Research Ship Aurora Australis Underway Meteorological Data, Quality Controlled

Data.gov (United States)

National Oceanic and Atmospheric Administration, Department of Commerce — Research Ship Aurora Australis Underway Meteorological Data (delayed ~10 days for quality control) are from the Shipboard Automated Meteorological and Oceanographic...

Interspecific interactions between Phragmites australis and Spartina alterniflora along a tidal gradient in the Dongtan wetland, Eastern China.

Directory of Open Access Journals (Sweden)

Yue Yuan

Full Text Available The invasive species Spartina alterniora Loisel was introduced to the eastern coast of China in the 1970s and 1980s for the purposes of land reclamation and the prevention of soil erosion. The resulting interspecific competition had an important influence on the distribution of native vegetation, which makes studying the patterns and mechanisms of the interactions between Spartina alterniora Loisel and the native species Phragmites australis (Cav. Trin ex Steud in this region very important. There have been some researches on the interspecific interactions between P. australis and S. alterniora in the Dongtan wetland of Chongming, east China, most of which has focused on the comparison of their physiological characteristics. In this paper, we conducted a neighbor removal experiment along a tidal gradient to evaluate the relative competitive abilities of the two species by calculating their relative neighbor effect (RNE index. We also looked at the influence of environmental stress and disturbance on the competitive abilities of the two species by comparing interaction strength (I among different tidal zones both for P. australis and S. alterniora. Finally, we measured physiological characteristics of the two species to assess the physiological mechanisms behind their different competitive abilities. Both negative and positive interactions were found between P. australis and S. alterniora along the environmental gradient. When the direction of the competitive intensity index for P. australis and S. alterniora was consistent, the competitive or facilitative effect of S. alterniora on P. australis was stronger than that of P. australis on S. alterniora. The interspecific interactions of P. australis and S. alterniora varied with environmental conditions, as well as with the method used, to measure interspecific interactions.

Exposure dose response relationships of the freshwater bivalve Hyridella australis to cadmium spiked sediments

International Nuclear Information System (INIS)

Marasinghe Wadige, Chamani P.M.; Maher, William A.; Taylor, Anne M.; Krikowa, Frank

2014-01-01

Highlights: • The exposure–dose–response approach was used to assess cadmium exposure and toxicity. • Accumulated cadmium in H. australis reflected the sediment cadmium exposure. • Spill over of cadmium into the biologically active pool was observed. • Increased cadmium resulted in measurable biological effects. • H. australis has the potential to be a cadmium biomonitor in freshwater environments. - Abstract: To understand how benthic biota may respond to the additive or antagonistic effects of metal mixtures in the environment it is first necessary to examine their responses to the individual metals. In this context, laboratory controlled single metal-spiked sediment toxicity tests are useful to assess this. The exposure–dose–response relationships of Hyridella australis to cadmium-spiked sediments were, therefore, investigated in laboratory microcosms. H. australis was exposed to individual cadmium spiked sediments (<0.05 (control), 4 ± 0.3 (low) and 15 ± 1 (high) μg/g dry mass) for 28 days. Dose was measured as cadmium accumulation in whole soft body and individual tissues at weekly intervals over the exposure period. Dose was further examined as sub-cellular localisation of cadmium in hepatopancreas tissues. The biological responses in terms of enzymatic and cellular biomarkers were measured in hepatopancreas tissues at day 28. H. australis accumulated cadmium from spiked sediments with an 8-fold (low exposure organisms) and 16-fold (high exposure organisms) increase at day 28 compared to control organisms. The accumulated tissue cadmium concentrations reflected the sediment cadmium exposure at day 28. Cadmium accumulation in high exposure organisms was inversely related to the tissue calcium concentrations. Gills of H. australis showed significantly higher cadmium accumulation than the other tissues. Accumulated cadmium in biologically active and biologically detoxified metal pools was not significantly different in cadmium exposed

Identification, Development, and Release of Insect Biocontrol Agents for the Management of Phragmites australis

Science.gov (United States)

2014-07-01

currently testing the pathogenicity of different isolates on P. australis germination and results are extremely diverse. Isolates and P. australis...pathogenicity. While these Pythium species have large effects on seed germination , it is doubtful that they can contribute to reductions in P...potential agents for in-depth study; (2) outline and report initial testing procedures and results of host-specificity studies of identified agents; (3

Histomorphology of the digestive tract of Chonopeltis australis ...

African Journals Online (AJOL)

The morphology and histology of the digestive tract of the branchiuran crustacean, Chonopeltis australis Box shall, 1976 are described from serial sections. The foregut is differentiated into a preoral cavity, containing the mandibles and tongue, an ascending oesophagus, with an H-shaped lumen invested with longitudinal, ...

Short-term Responses of Posidonia australis to Changes in Light Quality

Directory of Open Access Journals (Sweden)

Simone Strydom

2018-01-01

Full Text Available Seagrass meadows are highly productive ecosystems that provide ecosystem services to the coastal zone but are declining globally, particularly due to anthropogenic activities that reduce the quantity of light reaching seagrasses, such as dredging, river discharge and eutrophication. Light quality (the spectral composition of the light is also altered by these anthropogenic stressors as the differential attenuation of wavelengths of light is caused by materials within the water column. This study addressed the effect of altered light quality on different life-history stages of the seagrass Posidonia australis, a persistent, habitat-forming species in Australia. Aquarium-based experiments were conducted to determine how adult shoots and seedlings respond to blue (peak λ = 451 nm; green (peak λ = 522 nm; yellow (peak λ = 596 nm and red (peak λ = 673 nm wavelengths with a control of full-spectrum light (λ = 400 – 700 nm, at 200 μmol photons m-2 s-1. Posidonia australis adults did not respond to changes in light quality relative to full-spectrum light, demonstrating a capacity to obtain enough photons from a range of wavelengths across the visible spectrum to maintain short-term growth at high irradiances. Posidonia australis seedlings (<4 months old grown in blue light showed a significant increase in xanthophyll concentrations when compared to plants grown in full-spectrum, demonstrating a pigment acclimation response to blue light. These results differed significantly from negative responses to changes in light quality recently described for Halophila ovalis, a colonizing seagrass species. Persistent seagrasses such as P. australis, appear to be better at tolerating short-term changes in light quality compared to colonizing species when sufficient PPFD is present.

Heavy metal contents and transfer capacities of Phragmites australis and Suaeda salsa in the Yellow River Delta, China

Science.gov (United States)

Zhang, Shuai; Bai, Junhong; Wang, Wei; Huang, Laibing; Zhang, Guangliang; Wang, Dawei

2018-04-01

Plant samples including roots, stems and leaves of Phragmites australis and Suaeda salsa were collected in the short-term flooding and tidal flooding wetlands of the Yellow River Delta of China. Six heavy metals (e.g., As, Cd, Cr, Cu, Pb, and Zn) were measured in roots, stems and leaves of each plant species using inductively coupled plasma atomic absorption spectrometry (ICP-AAS) to investigate the levels, and transfer capabilities of heavy metals in these two plant species. Our results showed that in the tidal flooding wetlands, the contents of As, Cr and Cd in roots of Phragmites australis and Suaeda salsa were higher than those in their stems and leaves. Suaeda salsa showed higher contents of Pb and Zn in leaves than those in roots and stems, whereas lower levels of Pb and Zn were observed in Phragmites australis. In the short-term flooding wetlands, heavy metal contents exhibited a big difference between different tissues of Phragmites australis and Suaeda salsa, and both plant species showed higher levels of Pb and Zn in leaves. Suaeda salsa roots enriched more As and Cd, whereas higher enrichment levels were observed in Phragmites australis leaves, which indicated different transfer capacities of these two wetland plants. The transfer factors for stems and leaves of Phragmites australis in the tidal flooding wetlands significantly differed from those in the short-term flooding wetlands, however, no significant differences in transfer factors for stems and leaves of Suaeda salsa were observed between these two types of wetlands.

Root-secreted allelochemical in the noxious weed Phragmites australis deploys a reactive oxygen species response and microtubule assembly disruption to execute rhizotoxicity.

Science.gov (United States)

Rudrappa, Thimmaraju; Bonsall, Justin; Gallagher, John L; Seliskar, Denise M; Bais, Harsh P

2007-10-01

Phragmites australis is considered the most invasive plant in marsh and wetland communities in the eastern United States. Although allelopathy has been considered as a possible displacing mechanism in P. australis, there has been minimal success in characterizing the responsible allelochemical. We tested the occurrence of root-derived allelopathy in the invasiveness of P. australis. To this end, root exudates of two P. australis genotypes, BB (native) and P38 (an exotic) were tested for phytotoxicity on different plant species. The treatment of the susceptible plants with P. australis root exudates resulted in acute rhizotoxicity. It is interesting to note that the root exudates of P38 were more effective in causing root death in susceptible plants compared to the native BB exudates. The active ingredient in the P. australis exudates was identified as 3,4,5-trihydroxybenzoic acid (gallic acid). We tested the phytotoxic efficacy of gallic acid on various plant systems, including the model plant Arabidopsis thaliana. Most tested plants succumbed to the gallic acid treatment with the exception of P. australis itself. Mechanistically, gallic acid treatment generated elevated levels of reactive oxygen species (ROS) in the treated plant roots. Furthermore, the triggered ROS mediated the disruption of the root architecture of the susceptible plants by damaging the microtubule assembly. The study also highlights the persistence of the exuded gallic acid in P. australis's rhizosphere and its inhibitory effects against A. thaliana in the soil. In addition, gallic acid demonstrated an inhibitory effect on Spartina alterniflora, one of the salt marsh species it successfully invades.

Anatomy of nasal complex in the southern right whale, Eubalaena australis (Cetacea, Mysticeti).

Science.gov (United States)

Buono, Mónica R; Fernández, Marta S; Fordyce, R Ewan; Reidenberg, Joy S

2015-01-01

The nasal region of the skull has undergone dramatic changes during the course of cetacean evolution. In particular, mysticetes (baleen whales) conserve the nasal mammalian pattern associated with the secondary function of olfaction, and lack the sound-producing specializations present in odontocetes (toothed whales, dolphins and porpoises). To improve our understanding of the morphology of the nasal region of mysticetes, we investigate the nasal anatomy, osteology and myology of the southern right whale, Eubalaena australis, and make comparisons with other mysticetes. In E. australis external deflection surfaces around the blowholes appear to divert water off the head, and differ in appearance from those observed in balaenopterids, eschrichtiids and cetotherids. In E. australis the blowholes are placed above hypertrophied nasal soft tissues formed by fat and nasal muscles, a pattern also observed in balaenopterids (rorqual mysticetes) and a cetotherid (pygmy right whale, Caperea marginata). Blowhole movements are due to the action of five nasofacial muscles: dilator naris superficialis, dilator naris profundus, depressor alae nasi, constrictor naris, and retractor alae nasi. The dilator naris profundus found in E. australis has not been previously reported in balaenopterids. The other nasofacial muscles have a similar arrangement in balaenopterids, with minor differences. A novel structure, not reported previously in any mysticete, is the presence of a vascular tissue (rete mirabile) covering the lower nasal passage. This vascular tissue could play a role in warming inspired air, or may engorge to accommodate loss of respiratory space volume due to gas compression from increased pressure during diving. © 2014 Anatomical Society.

Understanding Super-Earths with MINERVA-Australis at USQ's Mount Kent Observatory

Science.gov (United States)

Wittenmyer, Robert; Horner, Jonathan; Kane, Stephen; Plavchan, Peter; Ciardi, David; Eastman, Jason; Johnson, John Asher; Wright, Jason; McCrady, Nate; MINERVA Collaboration

2018-01-01

Super Earths, planets between 5-10 Earth masses, are the most common types of planets known, yet are completely absent from our Solar system. As a result, their detailed properties, compositions, and formation mechanisms are poorly understood. NASA's Transiting Exoplanet Survey Satellite (TESS) will identify hundreds of Super-Earths orbiting bright stars, for the first time allowing in-depth characterisation of these planets. At the University of Southern Queensland, we are host to the MINERVA-Australis project, dedicated wholly to the follow-up characterisation and mass measurement of TESS planets. We give an update on the status of MINERVA-Australis and our expected performance. We also present results from the fully operational Northern MINERVA array, with the primary mission of discovering rocky planets orbiting 80 nearby bright stars.

The effects of litter on growth and plasticity of Phragmites australis clones originating from infertile, fertile or eutrophicated habitats

NARCIS (Netherlands)

Clevering, O.A.

1999-01-01

In many European countries a strong decline of Phragmites australis (Cav.) Trin. Ex Steudel (common reed) has been observed. In some instances this decline has been related to the accumulation of litter. A greenhouse experiment was conducted with P. australis cuttings from different stable and

Seasonal changes in metal accumulation and distribution in the organs of Phragmites australis (common reed from Lake Skadar, Montenegro

Directory of Open Access Journals (Sweden)

Kastratović Vlatko

2013-01-01

Full Text Available Due to its ability to accumulate metals, availability throughout the year and its large biomass, Phragmites australis (common reed is suitable for biomonitoring studies for the evaluation of load level of water ecosystem with trace metals. The heavy metals concentration in P.australis tissue can be several ten to several thousand times higher than those in the surrounding water. In this study we examined the content of heavy metals (Cd, Co, Cr, Cu, Mn, Ni, Pb, Zn, Sr and V in sediment, water and different organs of Phragmites australis collected from Lake Skadar, Montenegro, during different seasons of the year 2011. The highest concentrations of Sr were found in the leaves, while the other studied metals showed their highest concentrations in the roots. Thus, P. australis is considered a root bioaccumulation species. For most metals the concentration in roots and stems increases over time until the end of the growing season, and then decreases, while the concentration in leaves increases even after the growing season of the plant. If P. australis is used for phytoremediation purposes, then it should be harvested after the growing season because then the concentration of metals in the aboveground parts is maximal.

The Composition and The Content of The Main Pigments on Dodders Plant Cuscuta australis R.Br. and Cassytha filiformis L.

Directory of Open Access Journals (Sweden)

Heriyanto

2006-11-01

Full Text Available Research on dodders plant Cuscuta australis R.Br. and Cassytha filiformis L was done to analyze their pigment composition and content. The pigment composition was analyzed by the use of thin layer chromatography (TLC method based on spot color and retardation factor. The water content was measured according to Sudarmadji et. al. The chlorophylls and carotenoid contents were calculated by Porra et. al. and Gross equation, respectively. Result showed that Cuscuta australis R.Br. (green yellowish and orange and Cassytha filiformis L. (green and brown reddish had similar pigment composition consist of carotene, pheophytin a, chlorophyll a, chlorophyll b and xanthophyll. The average of the chlorophyll content from the highest to the lowest one was Cassytha filiformis L. green followed by Cuscuta australis R.Br. green yellowish and orange, while the total chlorophyll of Cassytha filiformis L. brown reddish was relatively similar with other dodders plant. The average of the carotenoid content from the highest to the lowest was Cuscuta australis R.Br. orange followed by Cuscuta australis R.Br. green yellowish. The pigment content of Cassytha filiformis L. was relatively similar to Cassytha filiformis L. brown reddish.

Isolation of fucoxanthin and fatty acids analysis of Padina australis ...

African Journals Online (AJOL)

Fucoxanthin has been successfully isolated from species of Malaysian brown seaweed, namely Padina australis. The purity of the fucoxanthin is >98% as indicated by high performance liquid chromatography analysis. This seaweed also contains a considerable amount of unsaturated fatty acids. Thirteen fatty acids were ...

Monitoring Phragmites australis increases from 1937 to 1976 in the Siyai Lagoon (Natal, South Africa by means of air photo interpretation

Directory of Open Access Journals (Sweden)

P. J. Weisser

1981-11-01

Full Text Available The colonization o f the Siyai Lagoon on the north coast of Natal by Phragmites australis was studied by means of  air photo interpretation. It was possible to locate and estimate P. australis areas for 1957 (0,74 ha, 1965 (1,65 ha, 1969 (1,93 ha and 1976 (2,94 ha. Phragmites australis first inhabited the shores of the middle section o f the lagoon followed by rapid expansion in the lower section. The upper section was colonized only at its lower end by expansion from the middle section. It is suggested that P. australis was unsuccessful in this section because of competition by the  Hibiscus tiliaceus—Barringtonia racemosa  Lagoon Fringe Forest. This same community is shading out  P. australis in some places. The notable increase in the rate of advance of land and littoral vegetation into the Siyai Lagoon was caused by sugar farming activities leading to erosion and sedimentation in the lagoon. A vegetation age gradient was observed from the upper section to the mouth region. The colonization of most of the Siyai Lagoon except the immediate mouth zone by  P. australis Reedswamp and  Hibiscus tiliaceus—Barringtonia racemosa Lagoon Fringe Forest, can be expected before the turn of the century. Dredging and mechanical control of vegetation will become necessary if major open water spaces are to be maintained.

Southern right whales Eubalaena australis visit the coasts of ...

African Journals Online (AJOL)

spamer

Counts and photographs of right whales Eubalaena australis taken on aerial surveys of the southern coast of. South Africa between ... of 0.08–2.89 km.h-1. Theodolite tracking of undisturbed groups of right whales from Cape Columbine produced ...... right whales on the coast of Argentina (Outer Coast) between 1971 and ...

[Effects of Cuscuta australis parasitism on the growth, reproduction and defense of Solidago canadensis].

Science.gov (United States)

Yang, Bei-fen; Du, Le-shan; Li, Jun-min

2015-11-01

In order to find out how parasitic Cuscuta australis influences the growth and reproduction of Solidago canadensis, the effects of the parasitism of C. australis on the morphological, growth and reproductive traits of S. canadensis were examined and the relationships between the biomass and the contents of the secondary metabolites were analyzed. The results showed that the parasitism significantly reduced the plant height, basal diameter, root length, root diameter, root biomass, stem biomass, leaf biomass, total biomass, number of inflorescences branches, axis length of inflorescence, and number of inflorescence. In particular, plant height, number of inflorescence and the stem biomass of parasitized S. canadensis were only 1/2, 1/5 and 1/8 of non-parasitized plants, respectively. There was no significant difference of plant height, root length, stem biomass and total biomass between plants parasitized with high and low intensities. But the basal diameter, root volume, leaf biomass, root biomass, the number of inflorescences branches, axis length of inflorescence and number of inflorescence of S. canadensis parasitized with high intensity were significantly lower than those of plants parasitized with low intensity. The parasitism of C. australis significantly increased the tannins content in the root and the flavonoids content in the stem of S. canadensis. The biomass of S. canadensis was significantly negatively correlated with the tannin content in the root and the flavonoids content in the stem. These results indicated that the parasitism of C. australis could inhibit the growth of S. canadensis by changing the resources allocation patterns as well as reducing the resources obtained by S. canadensis.

Pembentukan mother plant Bacopa australis secara In-vitro dan aklimatisasi dalam aquascape air tawar

Directory of Open Access Journals (Sweden)

Media Fitri Isma Nugraha

2017-12-01

Full Text Available Tanaman air adalah bagian penting dari ekosistem air tawar. Salah satu spesies yang terkenal adalah Bacopa australis. Hobiis aquascape saat ini memiliki ketertarikan tinggi terhadap tanaman air dengan kualitas yang bagus dari setiap spesiesnya. Metode perbanyakan tanaman air tanpa tanah, lahan pertanian dan air perlu dilakukan untuk memenuhi keinginan tersebut. Tujuan dari penelitian ini adalah untuk mendapatkan formula media kultur jaringan dan zat pengatur tumbuh yang tepat untuk multiplikasi dalam perakitan mother plant (tanaman induk Bacopa australis, serta mendapatkan media terbaik untuk aklimatisasi. Media yang digunakan adalah media Murashige dan Skoog (MS A padat dengan perbedaan konsentrasi zat pengatur tumbuh. Perlakuan uji dalam kombinasi zat pengatur tumbuh (a 0,50 mg/L BAP + 0,50 mg/L kinetin; (b 0,50 mg/L BAP; dan (c 0,50 mg/L 2,4-D. Aklimatisasi tanaman induk dilakukan pada berbagai media antara lain 1 pasir silika + pupuk aqua soil amazonia, 2. pasir malang + pupuk aqua soil amazonia, 3 pasir silika + pupuk cair; 4 pasir malang + pupuk. Hasil yang diperoleh, yaitu formula media kultur terbaik untuk multiplikasi tunas tanaman B. australis secara in-vitro adalah media MS (A yang diperkaya dengan 0,5 mg/L BAP + 0,5 mg/L kinetin, sedangkan aklimatisasi terbaik pada media pasir malang + pupuk aqua soil amazonia. Water plant is an important part of freshwater ecosystems. One of the famous species is Bacopa australis. Today, many aquascape hobbyists have a high interest in aquatic plant species that have good aesthetic appearances. To answer this challenge, a new method in-vitro propagation of aquatic plants, planted without soil, agricultural land and water was conducted. The aim of this research was to find the best growth regulator hormon formula and aclimatisation medium, in creating the mother plant Bacopa australis. The medium used was MS (Murashige and Skoog, 1974 with different growth regulator hormon, i.e: (a 0.50 mg L-1 BAP

Differentiation of Cuscuta chinensis and Cuscuta australis by HPLC-DAD-MS analysis and HPLC-UV quantitation.

Science.gov (United States)

He, Xianghui; Yang, Wenzhi; Ye, Min; Wang, Qing; Guo, Dean

2011-11-01

Cuscuta chinensis and Cuscuta australis, the two botanical sources of the Chinese herbal medicine Tu-Si-Zi, were distinguished from each other based on qualitative and quantitative chemical analysis. By HPLC‑DAD‑MS, a total of 36 compounds were characterized from these two Cuscuta species, including 14 flavonoids, 17 quinic acid derivatives, and 5 lignans. In addition, HPLC‑UV was applied to determine seven major compounds (6 flavonoids plus chlorogenic acid) in 27 batches of Tu-Si-Zi. The results revealed that the amounts of the three classes of compounds varied significantly between the species. C. australis contained more flavonoids but less quinic acid derivatives and lignans than C. chinensis. Particularly, the amounts of kaempferol and astragalin in C. australis were remarkably higher than in C. chinensis. This finding could be valuable for the quality control of Tu-Si-Zi. © Georg Thieme Verlag KG Stuttgart · New York.

Accumulation of Metals and Boron in Phragmites australis Planted in Constructed Wetlands Polishing Real Electroplating Wastewater.

Science.gov (United States)

Sochacki, Adam; Guy, Bernard; Faure, Olivier; Surmacz-Górska, Joanna

2015-01-01

The concentration of metals (Al, Cu, Fe, Mn, Ni, Zn) and B were determined in the above- and belowground biomass of Phragmites australis collected from the microcosm constructed wetland system used for the polishing of real electroplating wastewater. Translocation factor and bioconcentration factor were determined. Pearson correlation test was used to determine correlation between metal concentration in substrate and above- and belowground parts of Phragmites australis. The obtained results suggested that Phragmites australis did not play a major role as an accumulator of metals. It was observed also that the substrate could have exerted an effect on the translocation of Ni, Cu, Zn and Mn. The analysed concentrations of metals and B in biomass were in the range or even below the concentrations reported in the literature with the exception of Ni. The aboveground biomass was found suitable as a composting input in terms of metals concentrations.

Role of Phragmites australis (common reed) for heavy metals phytoremediation of estuarine sediments.

Science.gov (United States)

Cicero-Fernández, Diego; Peña-Fernández, Manuel; Expósito-Camargo, Jose A; Antizar-Ladislao, Blanca

2016-01-01

The ability of Phragmites australis to take up heavy metals (Co, Ni, Mo, Cd, Pb, Cr, Cu, Fe, Mn, Zn, and Hg) and other trace elements (As, Se, Ba), from estuarine sediments was investigated using a pilot plant experimental approach. Bioaccumulation (BCF) and translocation factors (TF) were calculated in vegetative and senescence periods for two populations of P. australis, from contaminated (MIC) and non-contaminated (GAL) estuarine sediments, respectively, both growing in estuarine contaminated sediment (RIA) from ría del Carmen y Boo, Santander Bay, Spain. The highest BCF values were obtained for Ni (0.43), Ba (0.43) Mo (0.36), Cr (0.35), and Cd (0.31) for plants collected from site GAL following the senescence period. The highest BCF values recorded for plants collected from MIC following the senescence period were for Mo (0.22) and Cu (0.22). Following senescence, plants collected from GAL and MIC presented TF>1 for Ni, Mo, Se, and Zn, and in addition plants collected from MIC presented TF>1 for Ba, Cr, and Mn. A substantial increase of Micedo's rhizosphere, six times higher than Galizano's rhizosphere, suggested adaptation to contaminated sediment. The evaluated communities of P. australis demonstrated their suitability for phytoremediation of heavy metals contaminated estuarine sediments.

Genital morphology of the male South American fur seal (Arctocephalus australis and biological implications

Directory of Open Access Journals (Sweden)

Alex Sander D. Machado

2012-12-01

Full Text Available Male capacity for spreading genes to a great number of descendents and to determine population dynamics depend directly on the genital organs. Morphological studies in pinnipeds are scarce and the functional meaning of some characteristics has never been discussed. We hypothesized that Arctocephalus australis (A. australis shows morphophysiological adaptations in order to guarantee the perpetuation of the species in the unique annual mating season. Seven males, dead from natural causes, had their genital organs collected and fixed for morphological description. Some features differ from other described mammalian males and are closely related to the biology and reproductive cycle of this species, as the scrotal epidermis, absence of glandular portion in the ductus deferens and spermatogenic epithelium suggest a recrudescent testis period. The corona glandis exhibits a singular arrangement: its erectile border looks like a formation of petals and its association with the os penis gives a "lily-flower" form to this region. We propose the name margo petaliformis to this particular erectile border of the corona glandis because of its similarity to a flower corola. The male genital organs of A. australis show morphological features compatible with adaptation to environment requirements and reproductive efficiency.

Genética poblacional de cobayas de Colombia, Cavia spp. (Rodentia: Caviidae con marcadores moleculares RAPD

Directory of Open Access Journals (Sweden)

Héctor Aníbal Campos

2008-09-01

Full Text Available En el presente estudio, mostramos los primeros resultados moleculares de formas colombianas de Cavia. Claramente, la población silvestre de C. anolaimae fue genéticamente diferenciada de la forma doméstica, C. porcellus, tal como ha sido demostrado por otros autores utilizando resultados morfométricos, osteológicos y cariotípicos. Ambas especies mostraron un considerable nivel de diversidad genética, aunque el segundo taxon mostró niveles mayores de esta diversidad. Los niveles de heterogeneidad genética también fueron mayores entre las poblaciones de C. porcellus (F ST = 0.254 que entre las poblaciones de C. anolaimae (F ST = 0.118. Esos niveles significativos de heterogeneidad genética, y los consiguientes bajos niveles de flujo génico, fueron discutidos comparativamente con los resultados por otros autores analizando otros marcadores moleculares (citocromo-b mitocondrial. Los resultados aquí mostrados son coherentes con un complejo proceso de domesticación en Cavia porcellus.Population genetics of Colombian Guinea Pigs, Cavia spp. (Rodentia: Caviidae with RAPD molecular markers. The genus Cavia occurs in South America, mainly in grasslands.. We collected blood samples from 97 individuals in six field populations and analyzed them with RAPD molecular markers. One wild type (C. anolaimae was differentiated from the domestic form (C. porcellus, in agreement with other authors who used morphological, osteological and karyotipic results. Genetic diversity was considerable in both species, but higher in C. porcellus. The levels of genetic heterogeneity were also higher among the populations of C. porcellus (F ST = 0.254 than among the populations of C. anolaimae (F ST = 0.118. These significant levels of genetic heterogeneity, and the low levels of gene flow, were consistent with a complex domestication process for Cavia porcellus. Rev. Biol. Trop. 56 (3: 1481-1501. Epub 2008 September 30.

Contamination of Soil with Pb and Sb at a Lead-Acid Battery Dumpsite and Their Potential Early Uptake by Phragmites australis

Directory of Open Access Journals (Sweden)

Abraham Jera

2017-01-01

Full Text Available Recycling of spent Lead-Acid Batteries (LABs and disposal of process slag potentially contaminate soil with Pb and Sb. Total and available concentrations of Pb and Sb in three soil treatments and parts of Phragmites australis were determined by atomic absorption spectrophotometry. Soil with nonrecycled slag (NR had higher total metal concentrations than that with recycled slag (RS. Low available fractions of Pb and Sb were found in the soil treatments before planting P. australis. After 16 weeks of growth of P. australis, the available fractions of Pb had no statistical difference from initial values (p>0.05 while available Sb fractions were significantly lower when compared with their initial values (p<0.05. Metal transfer factors showed that P. australis poorly accumulate Pb and Sb in roots and very poorly translocate them to leaves after growing for 8 and 16 weeks. It may be a poor phytoextractor of Pb and Sb in metal-contaminated soil at least for the 16 weeks of its initial growth. However, the plant established itself on the metalliferous site where all vegetation had been destroyed. This could be useful for potential ecological restoration. The long-term phytoextraction potential of P. australis in such environments as LABs may need further investigation.

Temporal variations of potential fecundity of southern blue whiting (Micromesistius australis australis) in the Southeast Pacific

Science.gov (United States)

Flores, Andrés; Wiff, Rodrigo; Díaz, Eduardo; Carvajal, Bernardita

2017-08-01

Fecundity is a key aspect of fish species reproductive biology because it relates directly to total egg production. Yet, despite such importance, fecundity estimates are lacking or scarce for several fish species. The gravimetric method is the most-used one to estimate fecundity by essentially scaling up the oocyte density to the ovary weight. It is a relatively simple and precise technique, but also time consuming because it requires counting all oocytes in an ovary subsample. The auto-diametric method, on the other hand, is relatively new for estimating fecundity, representing a rapid alternative, because it requires only an estimation of mean oocyte density from mean oocyte diameter. Using the extensive database available from commercial fishery and design surveys for southern blue whiting Micromesistius australis australis in the Southeast Pacific, we compared estimates of fecundity using both gravimetric and auto-diametric methods. Temporal variations in potential fecundity from the auto-diametric method were evaluated using generalised linear models considering predictors from maternal characteristics such as female size, condition factor, oocyte size, and gonadosomatic index. A global and time-invariant auto-diametric equation was evaluated using a simulation procedure based on non-parametric bootstrap. Results indicated there were not significant differences regarding fecundity estimates between the gravimetric and auto-diametric method (p > 0.05). Simulation showed the application of a global equation is unbiased and sufficiently precise to estimate time-invariant fecundity of this species. Temporal variations on fecundity were explained by maternal characteristic, revealing signals of fecundity down-regulation. We discuss how oocyte size and nutritional condition (measured as condition factor) are one of the important factors determining fecundity. We highlighted also the relevance of choosing the appropriate sampling period to conduct maturity studies

The Effect of Artificial Mowing on the Competition of Phragmites australis and Spartina alterniflora in the Yangtze Estuary

Directory of Open Access Journals (Sweden)

Yue Yuan

2017-01-01

Full Text Available Spartina alterniflora Loisel. is one of the most invasive species in the world. However, little is known about the role of artificial mowing in its invasiveness and competiveness. In this work, we studied the effect of mowing on its interspecific interactions with native species Phragmites australis (Cav. Trin ex Steud of the Yangtze Estuary, China. We calculated their relative neighbor effect (RNE index, effect of relative crowding (Dr index, and interaction strength (I index. The results showed that the RNE of Phragmites australis and Spartina alterniflora was 0.354 and 0.619, respectively, and they have competitive interactions. The mowing treatments can significantly influence the RNE of Phragmites australis and Spartina alterniflora on each other. Concretely, the RNE of Spartina alterniflora in the removal treatments was significantly higher than the value in the controls. But the RNE of Phragmites australis in the removal treatments was significantly lower than the value in the controls. Meanwhile, Dr of the two species on the targets was higher in the removal treatments than that in the controls, and the opposite was for I. We concluded that artificial mowing could promote the invasion of Spartina alterniflora by increasing its competitive performance compared with native species.

Incorporation of 2H-labelled cadaverines into the quinolizidine alkaloids in Baptisia australis

International Nuclear Information System (INIS)

Robins, D.J.; Sheldrake, G.N.

1988-01-01

The incorporation of 2 H-labelled cadaverines into the quinolizidine alkaloids, sparteine and N-methylcytisine, in Baptisia australis has been studied in order to gain more information about the formation of these alkaloids. (author)

Reproductive behavior in the squid Sepioteuthis australis from South Australia: interactions on the spawning grounds.

Science.gov (United States)

Jantzen, Troy M; Havenhand, Jon N

2003-06-01

Squid behavior is synonymous with distinctive body patterns, postures, and movements that constitute a complex visual communication system. These communications are particularly obvious during reproduction. They are important for sexual selection and have been identified as a potential means of species differentiation. Here we present a detailed account of copulation, mating, and egg deposition behaviors from in situ observations of the squid Sepioteuthis australis from South Australia. We identified four mating types from 85 separate mating attempts: "Male-upturned mating" (64% of mating attempts); "Sneaker mating" (33%); "Male-parallel" (2%); and "Head-to-head" (1%). Intervals between successive egg deposition behaviors were clearly bimodal, with modes at 2.5 s and 70.0 s. Ninety-three percent of egg capsules contained 3 or 4 eggs (mean = 3.54), and each egg cluster contained between 218 and 1922 egg capsules (mean = 893.9). The reproductive behavior of S. australis from South Australia was different from that described for other cephalopod species. More importantly, comparison between these results and those for other populations of S. australis suggests that behavior may differ from one population to another.

Isolation and amino acid sequence of a short-chain neurotoxin from an Australian elapid snake, Pseudechis australis.

OpenAIRE

Takasaki, C; Tamiya, N

1985-01-01

A short-chain neurotoxin Pseudechis australis a (toxin Pa a) was isolated from the venom of an Australian elapid snake Pseudechis australis (king brown snake) by sequential chromatography on CM-cellulose, Sephadex G-50 and CM-cellulose columns. Toxin Pa a has an LD50 (intravenous) value of 76 micrograms/kg body wt. in mice and consists of 62 amino acid residues. The amino acid sequence of Pa a shows considerable homology with those of short-chain neurotoxins of elapid snakes, especially of tr...

Warm gas towards young stellar objects in Corona Australis

DEFF Research Database (Denmark)

Lindberg, Johan; Jørgensen, Jes Kristian; D. Green, Joel

2014-01-01

The effects of external irradiation on the chemistry and physics in the protostellar envelope around low-mass young stellar objects are poorly understood. The Corona Australis star-forming region contains the R CrA dark cloud, comprising several low-mass protostellar cores irradiated by an interm......The effects of external irradiation on the chemistry and physics in the protostellar envelope around low-mass young stellar objects are poorly understood. The Corona Australis star-forming region contains the R CrA dark cloud, comprising several low-mass protostellar cores irradiated...... by an intermediate-mass young star. We study the effects on the warm gas and dust in a group of low-mass young stellar objects from the irradiation by the young luminous Herbig Be star R CrA. Herschel/PACS far-infrared datacubes of two low-mass star-forming regions in the R CrA dark cloud are presented...... Be star R CrA. Our results show that a nearby luminous star does not increase the molecular excitation temperatures in the warm gas around a young stellar object (YSO). However, the emission from photodissociation products of H2O, such as OH and O, is enhanced in the warm gas associated...

Seasonal changes of metal accumulation and distribution in common club rush (Schoenoplectus lacustris) and common reed (Phragmites australis).

Science.gov (United States)

Duman, Fatih; Cicek, Mehmet; Sezen, Goksal

2007-08-01

In this study, two aquatic macrophytes Phragmites australis and Schoenoplectus lacustris and corresponding sediment samples were collected every three months from Lake Sapanca (Turkey) and analysed for their heavy-metal contents (Pb, Cr, Cu, Mn, Ni, Zn and Cd). Accumulation factor ratios of plant parts were calculated for all metals, and the two species were compared in terms of accumulation properties. The highest concentrations were measured in the root systems while relatively low concentrations were found in the rhizome and above-ground parts of the plants. The accumulation ratios of root for P. australis were usually higher than the ratios for S. lacustris. While the accumulation ratios of root were higher in winter than in the other seasons for P. australis, for S. lacustris the highest accumulation ratios were found in the autumn. Both plant species were found to be root accumulators of Pb, Cu, Mn, Ni, Zn and Cd.

Water and Energy Balance in Response to the Removal of Invasive Phragmites Australis in a Riparian Wetland

Science.gov (United States)

Mykleby, P.; Lenters, J. D.; Cutrell, G. J.; Herrman, K.; Istanbulluoglu, E.; Scott, D.

2011-12-01

Vegetation plays an important role in the surface energy and water balance of wetlands. Transpiration from phreatophytes, in particular, withdraws water directly from groundwater, often impacting streamflow rates in adjacent tributaries. In the Republican River basin of the Central Plains (USA), streamflow has declined significantly in the past 30-40 years. Invasive vegetation species (such as Phragmites australis) have been removed from portions of the riparian corridor in an effort to halt or reverse the downward trend in streamflow. In this study, we investigated the energy and water balance of a P. australis-dominated riparian wetland in south-central Nebraska to assess the potential effectiveness of such an approach. Evapotranspiration (ET) rates were measured during two growing seasons - one being 2009, when the P. australis was at full growth, and the other during 2010, after the vegetation had been sprayed with herbicide (and remained only as dead, standing biomass). Energy balance measurements at the field site included net radiation, heat storage rates in the canopy, soil, and standing water, and sensible heat flux, which was measured using a large-aperture scintillometer (LAS). Latent heat flux (i.e., ET) was calculated as a residual of the energy balance, and comparisons were made between the two growing seasons. As a result of the spraying of the P. australis vegetation, season-mean ET rates dropped from 4.4 mm day-1 in 2009 to 3.0 mm day-1 in 2010. This decrease in ET was associated with a large increase in sensible heat flux, which more than doubled between the two years (from 33 W m-2 in 2009 to 76 W m-2 in 2010). Meteorological conditions at the site were slightly different from one year to the next, but the differences were not large enough to account for the dramatic changes in latent and sensible heat flux that were observed. We conclude, therefore, that the majority of the ~30% decrease in ET (and ~130% increase in sensible heat flux) was the

Phragmites australis + Typha latifolia Community Enhanced the Enrichment of Nitrogen and Phosphorus in the Soil of Qin Lake Wetland

Directory of Open Access Journals (Sweden)

Zhiwei Ge

2017-01-01

Full Text Available Aquatic plants play an essential role and are effective in mitigating lake eutrophication by forming complex plant-soil system and retaining total nitrogen (TN and phosphorus (TP in soils to ultimately reduce their quantities in aquatic systems. Two main vegetation types (Phragmites australis community and P. australis + Typha latifolia community of Qin Lake wetland were sampled in this study for the analysis of TN and TP contents and reserves in the wetland soils. The results showed that (1 the consumption effect of Qin Lake wetland on soluble N was much more significant than on soluble P. (2 The efficiency of TN enrichment in wetland soil was enhanced by vegetation covering of P. australis and T. latifolia. (3 Wetland soil P was consumed by P. australis community and this pattern was relieved with the introduction of T. latifolia. (4 According to the grey relativity analysis, the most intensive interaction between plants and soil occurred in summer. In addition, the exchange of N in soil-vegetation system primarily occurred in the 0–15 cm soil layer. Our results indicated that vegetation covering was essential to the enrichment of TN and TP, referring to the biology-related fixation in the wetland soil.

Assessment of the antiproliferative and antigenotoxic activity and phytochemical screening of aqueous extracts of Sambucus australis Cham. & Schltdl. (ADOXACEAE).

Science.gov (United States)

Tedesco, Marília; Kuhn, Andrielle W; Frescura, Viviane Dal-Souto; Boligon, Aline A; Athayde, Margareth L; Tedesco, Solange B; Silva, Antonio C F DA

2017-01-01

The purpose of this study was to evaluate the antiproliferative and antigenotoxic activity of Sambucus australis Cham. & Schltdl. aqueous extracts on the cell cycle of Allium cepa L. as well as determine the phenolic compounds in such extracts. S. australis inflorescences and leaves of two accessions were used for aqueous extract preparation at concentrations: 0.003 g/ml and 0.012 g/ml. A. cepa bulbs were rooted in distilled water and, subsequently, placed in treatments for 24 hours. Rootlets were collected and fixed in modified Carnoy's solution for 24 hours and kept. The squash technique was performed for slide preparation. Root tips were smashed and stained with 2% acetic orcein, and a total of 4000 cells per treatment were analyzed. The phenolic compounds were determined using high-performance liquid chromatography and data was analyzed using the Scott-Knott test. The results show that S. australis aqueous extracts have antiproliferative potential. Besides, the extracts prepared from S. australis leaves of both accessions at a concentration of 0.012 g/ml have shown antigenotoxic activity. The phytochemical analysis allowed us to determine the presence of flavonoids and phenolic acids, of which kaempferol and chrologenic acid were the most predominant compounds in the extracts from the inflorescences and leaves, respectively.

Genital morphology of the male South American fur seal (Arctocephalus australis and biological implications Morfologia dos órgãos genitais do macho do Lobo marinho (Arctocephalus australis e implicações biológicas

Directory of Open Access Journals (Sweden)

Alex Sander D. Machado

2012-12-01

Full Text Available Male capacity for spreading genes to a great number of descendents and to determine population dynamics depend directly on the genital organs. Morphological studies in pinnipeds are scarce and the functional meaning of some characteristics has never been discussed. We hypothesized that Arctocephalus australis (A. australis shows morphophysiological adaptations in order to guarantee the perpetuation of the species in the unique annual mating season. Seven males, dead from natural causes, had their genital organs collected and fixed for morphological description. Some features differ from other described mammalian males and are closely related to the biology and reproductive cycle of this species, as the scrotal epidermis, absence of glandular portion in the ductus deferens and spermatogenic epithelium suggest a recrudescent testis period. The corona glandis exhibits a singular arrangement: its erectile border looks like a formation of petals and its association with the os penis gives a "lily-flower" form to this region. We propose the name margo petaliformis to this particular erectile border of the corona glandis because of its similarity to a flower corola. The male genital organs of A. australis show morphological features compatible with adaptation to environment requirements and reproductive efficiency.A capacidade do macho de espalhar seus genes a um grande número de descendentes e determinar a dinâmica populacional depende diretamente dos seus órgãos genitais. Estudos morfológicos em pinípedes são escassos e o significado funcional de algumas de suas características ecológicas ainda foi pouco discutido. Nossa hipótese é que Arctocephalus australis (A. australis apresenta adaptações morfofisiológicas em seus órgãos genitais capazes de interagir com o meio e garantir a perpetuação da espécie que apresenta apenas uma época de acasalamento que ocorre uma vez a cada ano. Sete A. australis machos, mortos recentes por causas

Skull morphometrics of adult male Antartic fur seal, Arctocephalus gazella, and South American fur seal A. australis Morfometría craneana comparada de ejemplares machos adultos de lobo fino antártico, Arctocephalus gazella y lobo fino sudamericano, A. australis

Directory of Open Access Journals (Sweden)

Gustavo A. Daneri

2005-09-01

Full Text Available The skull morphometrics of adult male Antarctic fur seal, Arctocephalus gazella (Peters, 1875 and South American fur seal, A. australis (Zimmermann, 1783 were investigated using a collection of 45 and 38 skulls, respectively. Eighteen measurements were taken for each specimen. Comparative univariate and multivariate statistical analyses included standard statistics, one-way analysis of variance, principal component analysis and discriminant analysis. Individual variation was relatively high for some variables, as expressed by the coefficient of variation. Skulls of A. gazella were larger than those of A. australis for all but two variables: squamosal jugal suture and rostral length. Both species differed significantly as shown by both univariate and multivariate analyses. The discriminant function correctly classified all specimens. The standardized canonical coefficients showed that the variables which most contribute to the differentiation between species were, in decreasing order, the rostral length, palatal length, palatal width at postcanine 5 and braincase width. The present study corroborates that A. gazella and A. australis are phenotipically distinct species.Se estudió la morfometría craneana de especímenes machos adultos de lobo fino Antártico, Arctocephalus gazella (Peters, 1875 y lobo fino sudamericano, A. australis (Zimmermann, 1783, consultando una colección de 45 y 38 cráneos respectivamente. Para cada ejemplar se tomó un total de 18 medidas. El análisis comparativo univariado y multivariado incluyó estadística standard, análisis de varianza, análisis de componentes principales y análisis discriminante. La variación individual, según lo expresado por el coeficiente de variación, fue relativamente alta para algunas variables. Los cráneos de A. gazella fueron proporcionalmente más grandes que aquellos de A. australis para todas las variables estudiadas, excepto dos: longitud de la sutura escamoso-yugal y longitud

Primary structure of the oligosaccharide moiety of hemocyanin from the scorpion Androctonus australis

NARCIS (Netherlands)

Vliegenthart, J.F.G.; Debeire, P.; Montreuil, J.; Goyffon, M.; Kuik, J.A. van; Halbeek, H. van

1986-01-01

Hemocyanin, the copper-containing glycoprotein that serves as an oxygen carrier in the hemolymph of some arthropods and molluscs, was obtained from the blood of the scorpion Androctonus australis. Sugar analysis of the glycoprotein revealed that its carbohydrate moiety is of the N-glycosylic type.

Decomposition processes in soil of a healthy and a declining Phragmites australis stand

Czech Academy of Sciences Publication Activity Database

Šantrůčková, Hana; Picek, Tomáš; Šimek, Miloslav; Bauer, Václav; Kopecký, Jiří; Pechar, Libor; Lukavská, Jaroslava; Čížková, Hana

2001-01-01

Roč. 69, - (2001), s. 217-234 ISSN 0304-3770 R&D Projects: GA ČR GA206/96/0589 Institutional research plan: CEZ:AV0Z6066911 Keywords : decomposition * eutrophication * Phragmites australis Subject RIV: EH - Ecology, Behaviour Impact factor: 1.361, year: 2001

Aphid (Myzus persicae) feeding on the parasitic plant dodder (Cuscuta australis) activates defense responses in both the parasite and soybean host.

Science.gov (United States)

Zhuang, Huifu; Li, Juan; Song, Juan; Hettenhausen, Christian; Schuman, Meredith C; Sun, Guiling; Zhang, Cuiping; Li, Jing; Song, Dunlun; Wu, Jianqiang

2018-06-01

Dodders (Cuscuta spp.) are shoot holoparasites, whose haustoria penetrate host tissues to enable fusion between the parasite and host vascular systems, allowing Cuscuta to extract water, nutrients and other molecules from hosts. Aphids are piercing-sucking herbivores that use specialized stylets to feed on phloem sap. Aphids are known to feed on Cuscuta, but how Cuscuta and its host plant respond to aphids attacking the parasite was unknown. Phytohormone quantification, transcriptomic analysis and bioassays were performed to determine the responses of Cuscuta australis and its soybean (Glycine max) hosts to the feeding of green peach aphid (GPA; Myzus persicae) on C. australis. Decreased salicylic acid levels and 172 differentially expressed genes (DEGs) were found in GPA-attacked C. australis, and the soybean hosts exhibited increased jasmonic acid contents and 1015 DEGs, including > 100 transcription factor genes. Importantly, GPA feeding on C. australis increased the resistance of the soybean host to subsequent feeding by the leafworm Spodoptera litura and soybean aphid Aphis glycines, resulting in 21% decreased leafworm mass and 41% reduced aphid survival rate. These data strongly suggest that GPA feeding on Cuscuta induces a systemic signal, which is translocated to hosts and activates defense against herbivores. © 2018 The Authors. New Phytologist © 2018 New Phytologist Trust.

Chonopeltis australis (Crustacea) male reproductive system morphology; sperm transfer and review of reproduction in Branchiura.

Science.gov (United States)

Neethling, Lourelle Alicia Martins; Avenant-Oldewage, Annemariè

2015-02-01

The morphology of the male reproductive system as well as sperm transfer in Branchiura has been described for Dolops ranarum and Argulus japonicus. In this study, the reproductive system and accessory structures are described for male Chonopeltis australis using histology, light microscopy, and scanning electron microscopy. For the first time, we describe sperm transfer by means of a spermatophore in this genus. The internal and external morphology and mechanism of sperm transfer is compared with other Branchiura, where it has been described. The morphology of the reproductive system of C. australis is similar to that of D. ranarum while the accessory structures and the spermatophore produced are similar to that of A. japonicus. A revision of the definition of Branchiura with respect to reproduction is provided. © 2014 Wiley Periodicals, Inc.

Effects of sediment burial disturbance on macro and microelement dynamics in decomposing litter of Phragmites australis in the coastal marsh of the Yellow River estuary, China.

Science.gov (United States)

Sun, Zhigao; Mou, Xiaojie

2016-03-01

From April 2008 to November 2009, a field decomposition experiment was conducted to investigate the effects of sediment burial on macro (C, N) and microelement (Pb, Cr, Cu, Zn, Ni, and Mn) variations in decomposing litter of Phragmites australis in the coastal marsh of the Yellow River estuary. Three one-off sediment burial treatments [no sediment burial (0 mm year(-1), S0), current sediment burial (100 mm year(-1), S10), and strong sediment burial (200 mm year(-1), S20)] were laid in different decomposition sites. Results showed that sediment burials showed significant influence on the decomposition rate of P. australis, in the order of S10 (0.001990 day(-1)) ≈ S20 (0.001710 day(-1)) > S0 (0.000768 day(-1)) (p macro and microelement in decomposing litters of the three burial depths exhibited different temporal variations except for Cu, Zn, and Ni. No significant differences in C, N, Pb, Cr, Zn, and Mn concentrations were observed among the three burial treatments except for Cu and Ni (p > 0.05). With increasing burial depth, N, Cr, Cu, Ni, and Mn concentrations generally increased, while C, Pb, and Zn concentrations varied insignificantly. Sediment burial was favorable for C and N release from P. australis, and, with increasing burial depth, the C release from litter significantly increased, and the N in litter shifted from accumulation to release. With a few exceptions, Pb, Cr, Zn, and Mn stocks in P. australis in the three treatments evidenced the export of metals from litter to environment, and, with increasing burial depth, the export amounts increased greatly. Stocks of Cu and Ni in P. australis in the S10 and S20 treatments were generally positive, evidencing incorporation of the two metals in most sampling times. Except for Ni, the variations of C, N, Pb, Cr, Cu, Zn, and Mn stocks in P. australis in the S10 and S20 treatments were approximated, indicating that the strong burial episodes (S20) occurred in P. australis marsh in the future

Allelopathy and resource competition: the effects of Phragmites australis invasion in plant communities.

Science.gov (United States)

Uddin, Md Nazim; Robinson, Randall William

2017-12-01

Phragmites australis, a ubiquitous wetland plant, has been considered one of the most invasive species in the world. Allelopathy appears to be one of the invasion mechanisms, however, the effects could be masked by resource competition among target plants. The difficulty of distinguishing allelopathy from resource competition among plants has hindered investigations of the role of phytotoxic allelochemicals in plant communities. This has been addressed via experiments conducted in both the greenhouse and laboratory by growing associated plants, Melaleuca ericifolia, Rumex conglomeratus, and model plant, Lactuca sativa at varying densities with the allelopathic plant, P. australis, its litter and leachate of P. australis litter. This study investigated the potential interacting influences of allelopathy and resource competition on plant growth-density relationships. In greenhouse, the root exudates mediated effects showed the strongest growth inhibition of M. ericifolia at high density whereas litter mediated results revealed increased growth at medium density treatments compared to low and high density. Again, laboratory experiments related to seed germination and seedling growth of L. sativa and R. conglomeratus exhibited phytotoxicity decreased showing positive growth as plant density increased and vice versa. Overall, the differential effects were observed among experiments but maximum individual plant biomass and some other positive effects on plant traits such as root and shoot length, chlorophyll content occurred at an intermediate density. This was attributed to the sharing of the available phytotoxin among plants at high densities which is compatible to density-dependent phytotoxicity model. The results demonstrated that plant-plant interference is the combined effect of allelopathy and resource competition with many other factors but this experimental design, target-neighbor mixed-culture in combination of plant grown at varying densities with varying

Effect of gamma irradiation on toxicity and immunogenicity of Androctonus australis hector venom

International Nuclear Information System (INIS)

Abib, L.; Laraba-Djebari, F.

2003-01-01

An investigation was made of the radiosensitivity of the toxic and immunological properties of Androctonus australis hector venom. This venom was irradiated with two doses of gamma rays (1 and 2 kGy) from a 60 Co source. The results showed that venom toxicity was abolished for the two radiation doses (1 and 2 kGy) with, respectively, 10 and 25 times its initial LD50 value. However, irradiated venoms were immunogenic, and the antibodies elicited by them were able to recognize the native venom by enzyme-linked immunosorbent assay. Antisera raised against these toxoids (1 and 2 kGy) had a higher neutralizing capacity and immunoreactivity against all components of native venom than did the antiserum produced against the native venom. The antiserum of rabbits immunized with 2-kGy-irradiated venom was more efficient than 1-kGy-irradiated toxoid antiserum. Indeed, in vivo protection assays showed that the mice immunized with 2-kGy-irradiated venom resisted lethal doses (i.p.) of A. australis hector venom. (author)

Discovery of a new subclass of alpha-conotoxins in the venom of Conus australis

Digital Repository Service at National Institute of Oceanography (India)

Lebbe, E; Peigneur, S.; Maiti, M.; Mille, B.G.; Prabhadevi; Ravichandran, S.; Lescrinier, E; Waelkens, E; DeSouza, L.; Herdewijn, P.; Tytgat, J.

-conotoxin family. We purified the venom of a yet unexplored cone snail species, i.e. Conus australis, and we isolated a 16-amino acid peptide named alpha-conotoxin AusIA. The peptide has the typical alpha-conotoxin CC-X_m-C-X_n-C framework...

Phytoextraction of chloride from a cement kiln dust (CKD) contaminated landfill with Phragmites australis.

Science.gov (United States)

McSorley, Kaitlin; Rutter, Allison; Cumming, Robert; Zeeb, Barbara A

2016-05-01

Cement kiln dust (CKD) is a globally produced by-product from cement manufacturing that is stockpiled or landfilled. Elevated concentrations of chloride pose toxic threats to plants and aquatic communities, as the anion is highly mobile in water and can leach into surrounding water sources. Re-vegetation and in situ phytoextraction of chloride from a CKD landfill in Bath, ON, Canada, was investigated with the resident invasive species Phragmites australis (haplotype M). Existing stands of P. australis were transplanted from the perimeter of the site into the highest areas of contamination (5.9×10(3)μg/g). Accumulation in the shoots of P. australis was quantified over one growing season by collecting samples from the site on a bi-weekly basis and analyzing for chloride. Concentrations decreased significantly from early May (24±2.2×10(3)μg/g) until mid-June (15±2.5×10(3)μg/g), and then remained stable from June to August. Shoot chloride accumulation was not significantly affected by water level fluctuations at the site, however elevated potassium concentrations in the soil may have contributed to uptake. Based on shoot chloride accumulation and total biomass, it was determined that phytoextraction from the CKD landfill can remove 65±4kg/km(2) of chloride per season. Based on this extraction rate, removal of chloride present in the highly contaminated top 10cm of soil can be achieved in 3-9years. This is the first study to apply phytotechnologies at a CKD landfill, and to successfully demonstrate in situ phytoextraction of chloride. Copyright © 2015 Elsevier Ltd. All rights reserved.

Bioavailability of cadmium adsorbed on various oxides minerals to wetland plant species Phragmites australis

International Nuclear Information System (INIS)

Wang He; Jia Yongfeng; Wang Shaofeng; Zhu Huijie; Wu Xing

2009-01-01

The bioavailability of heavy metals strongly depends on their speciation in the environment. The effect of different chemical speciations of cadmium ions (i.e. adsorbed on different oxide minerals) on its bioavailability to wetland plant Phragmites australis was studied. Goethite, magnetite, gibbsite, alumina, and manganese oxide were chosen as representatives of metal (hydr)oxides commonly present in sediment. The cultivar system with Hoagland solution as nutrition supply, and single metal oxide with adsorbed Cd as contaminant was applied to study Cd accumulation by P. australis. The bioaccumulation degree in root after the 45-day treatment followed the order: Al(OH) 3 > Al 2 O 3 > Fe 3 O 4 > MnO 2 > FeOOH. The concentration of Cd in stem and leaf followed a similar order although it was considerably lower than that in root. Low-molecular-weight organic acids (LMWOAs), acetic acid, malic acid and citric acid were used to evaluate the desorbability of Cd from different oxides, which can be indicative of Cd-oxide bonding strength and Cd bioavailability. Desorption of Cd by acetic acid and malic acid followed the order: Al(OH) 3 > Fe 3 O 4 > Al 2 O 3 > FeOOH > MnO 2 , while by citric acid: Al(OH) 3 ≥ Al 2 O 3 > Fe 3 O 4 > FeOOH > MnO 2 . This was consistent with the Cd accumulation degree in the plant. Cd adsorbed on Al(OH) 3 was the most easily desorbable species and most bioavailable to P. australis among the oxide minerals, whereas MnO 2 adsorbed Cd was least desorbable by LMWOAs hence constituted the least bioavailable Cd species adsorbed on the oxide minerals.

Effects of arbuscular mycorrhizal fungi and soil nutrient addition on the growth of Phragmites australis under different drying-rewetting cycles.

Science.gov (United States)

Liang, Jin-Feng; An, Jing; Gao, Jun-Qin; Zhang, Xiao-Ya; Yu, Fei-Hai

2018-01-01

The frequency of soil drying-rewetting cycles is predicted to increase under future global climate change, and arbuscular mycorrhizal fungi (AMF) are symbiotic with most plants. However, it remains unknown how AMF affect plant growth under different frequencies of soil drying-rewetting cycles. We subjected a clonal wetland plant Phragmites australis to three frequencies of drying-rewetting cycles (1, 2, or 4 cycles), two nutrient treatments (with or without), and two AMF treatments (with or without) for 64 days. AMF promoted the growth of P. australis, especially in the 2 cycles of the drying-rewetting treatment. AMF had a significant positive effect on leaf mass and number of ramets in the 2 cycles of the drying-rewetting treatment with nutrient addition. In the 2 cycles of drying-rewetting treatment without nutrient addition, AMF increased leaf area and decreased belowground to aboveground biomass ratio. These results indicate that AMF may assist P. australis in coping with medium frequency of drying-rewetting cycles, and provide theoretical guidance for predicting how wetland plants respond to future global climate change.

Non-linear growth in tree ferns, Dicksonia antarctica and Cyathea australis

OpenAIRE

Blair, David P.; Blanchard, Wade; Banks, Sam C.; Lindenmayer, David B.

2017-01-01

Tree ferns are an important structural component of forests in many countries. However, because their regeneration is often unrelated to major disturbances, their age is often difficult to determine. In addition, rates of growth may not be uniform, which further complicates attempts to determine their age. In this study, we measured 5 years of growth of Cyathea australis and Dicksonia antarctica after a large wildfire in 2009 in south-eastern Australia. We found growth rates of these two spec...

Removal of Cu, Zn, Pb, and Cr from Yangtze Estuary Using the Phragmites australis Artificial Floating Wetlands

Directory of Open Access Journals (Sweden)

Xiaofeng Huang

2017-01-01

Full Text Available Contamination of heavy metals would threaten the water and soil resources; phytoremediation can be potentially used to remediate metal contaminated sites. We constructed the Phragmites australis artificial floating wetlands outside the Qingcaosha Reservoir in the Yangtze Estuary. Water characteristic variables were measured in situ by using YSI Professional Pro Meter. Four heavy metals (copper, zinc, lead, and chromium in both water and plant tissues were determined. Four heavy metals in estuary water were as follows: 0.03 mg/Kg, 0.016 mg/Kg, 0.0015 mg/Kg, and 0.004 mg/Kg. These heavy metals were largely retained in the belowground tissues of P. australis. The bioaccumulation (BAF and translation factor (TF value of four heavy metals were affected by the salinity, temperature, and dissolved oxygen. The highest BAF of each metal calculated was as follows: Cr (0.091 in winter > Cu (0.054 in autumn > Pb (0.016 in summer > Zn (0.011 in summer. Highest root-rhizome TF values were recorded for four metals: 6.450 for Cu in autumn, 2.895 for Zn in summer, 7.031 for Pb in autumn, and 2.012 for Cr in autumn. This indicates that the P. australis AFW has potential to be used to protect the water of Qingcaosha Reservoir from heavy metal contamination.

Effect of Plantago australis leaves on different gastric ulcer models

Directory of Open Access Journals (Sweden)

M.E. Bürger

Full Text Available The anti-ulcerogenic effect of the crude ethanolic extract (CEE of Plantago australis leaves was tested against ethanol-, indomethacin-, and cold restrain-induced stress ulcers. The CEE (500 and 1000 mg/kg reduced the lesion index (LI and the ulcer index in ethanol-induced ulcers, and the dose of 1000 mg/kg increased the amount of mucous. The highest dose of the CEE reduced the LI of cold restraint-induced stress ulcers when compared to the control group. The indomethacin-induced ulcers were not affected by this extract.

[Effects of water table manipulation on leaf photosynthesis, morphology and growth of Phragmites australis and Imperata cylindrica in the reclaimed tidal wetland at Dongtan of Chongming Island, China].

Science.gov (United States)

Zhong, Qi-Cheng; Wang, Jiang-Tao; Zhou, Jian-Hong; Ou, Qiang; Wang, Kai-Yun

2014-02-01

During the growing season of 2011, the leaf photosynthesis, morphological and growth traits of Phragmites australis and Imperata cylindrica were investigated along a gradient of water table (low, medium and high) in the reclaimed tidal wetland at the Dongtan of Chongming Island in the Yangtze Estuary of China. A series of soil factors, i. e., soil temperature, moisture, salinity and inorganic nitrogen content, were also measured. During the peak growing season, leaf photosynthetic capacity of P. australis in the wetland with high water table was significantly lower than those in the wetland with low and medium water tables, and no difference was observed in leaf photosynthetic capacity of I. cylindrica at the three water tables. During the entire growing season, at the shoot level, the morphological and growth traits of P. australis got the optimum in the wetland with medium water table, but most of the morphological and growth traits of I. cylindrica had no significant differences at the three water tables. At the population level, the shoot density, leaf area index and aboveground biomass per unit area were the highest in the wetland with high water table for P. australis, but all of the three traits were the highest in the wetland with low water table for I. cylindrica. At the early growing season, the rhizome biomass of P. australis in the 0-20 cm soil layer had no difference at the three water tables, and the rhizome biomass of I. cylindrica in the 0-20 cm soil layer in the wetland with high water table was significantly lower than those in the wetland with low and medium water table. As a native hygrophyte before the reclamation, the variations of performances of P. australis at the three water tables were probably attributed to the differences in the soil factors as well as the intensity of competition from I. cylindrica. To appropriately manipulate water table in the reclaimed tidal wetland may restrict the growth and propagation of the mesophyte I

Bioavailability of cadmium adsorbed on various oxides minerals to wetland plant species Phragmites australis

Energy Technology Data Exchange (ETDEWEB)

Wang He, E-mail: he.wangworld@yahoo.com.cn [Key Laboratory of Terrestrial Ecological Process, Institute of Applied Ecology, Chinese Academy of Sciences, No. 72 Wenhua Road, Shenyang 110016 (China); Graduate School, Chinese Academy of Sciences, Beijing 100049 (China); Jia Yongfeng, E-mail: yongfeng.jia@iae.ac.cn [Key Laboratory of Terrestrial Ecological Process, Institute of Applied Ecology, Chinese Academy of Sciences, No. 72 Wenhua Road, Shenyang 110016 (China); Wang Shaofeng [Key Laboratory of Terrestrial Ecological Process, Institute of Applied Ecology, Chinese Academy of Sciences, No. 72 Wenhua Road, Shenyang 110016 (China); Zhu Huijie; Wu Xing [Key Laboratory of Terrestrial Ecological Process, Institute of Applied Ecology, Chinese Academy of Sciences, No. 72 Wenhua Road, Shenyang 110016 (China); Graduate School, Chinese Academy of Sciences, Beijing 100049 (China)

2009-08-15

The bioavailability of heavy metals strongly depends on their speciation in the environment. The effect of different chemical speciations of cadmium ions (i.e. adsorbed on different oxide minerals) on its bioavailability to wetland plant Phragmites australis was studied. Goethite, magnetite, gibbsite, alumina, and manganese oxide were chosen as representatives of metal (hydr)oxides commonly present in sediment. The cultivar system with Hoagland solution as nutrition supply, and single metal oxide with adsorbed Cd as contaminant was applied to study Cd accumulation by P. australis. The bioaccumulation degree in root after the 45-day treatment followed the order: Al(OH){sub 3} > Al{sub 2}O{sub 3} > Fe{sub 3}O{sub 4} > MnO{sub 2} > FeOOH. The concentration of Cd in stem and leaf followed a similar order although it was considerably lower than that in root. Low-molecular-weight organic acids (LMWOAs), acetic acid, malic acid and citric acid were used to evaluate the desorbability of Cd from different oxides, which can be indicative of Cd-oxide bonding strength and Cd bioavailability. Desorption of Cd by acetic acid and malic acid followed the order: Al(OH){sub 3} > Fe{sub 3}O{sub 4} > Al{sub 2}O{sub 3} > FeOOH > MnO{sub 2}, while by citric acid: Al(OH){sub 3} {>=} Al{sub 2}O{sub 3} > Fe{sub 3}O{sub 4} > FeOOH > MnO{sub 2}. This was consistent with the Cd accumulation degree in the plant. Cd adsorbed on Al(OH){sub 3} was the most easily desorbable species and most bioavailable to P. australis among the oxide minerals, whereas MnO{sub 2} adsorbed Cd was least desorbable by LMWOAs hence constituted the least bioavailable Cd species adsorbed on the oxide minerals.

Phytotoxic potential of celtis australis L. (family ulmaceae) against four crop species

International Nuclear Information System (INIS)

Ahmad, I.; Hussain, F.

2014-01-01

Bioassays were conducted to test the phytotoxic potential of Celtis australis against Trifolium alexandrinum, Brassica campestris, Triticum aestivum and Lactuca sativa under laboratory condition. Aqueous extracts from twigs and leaves were obtained by soaking 5 and 10g plant material in 100 ml distilled water for 24 and 48hr durations. Aqueous extracts significantly delayed/retarded the germination and reduced the plumule and radicle growth of all the four test species. Generally, extracts soaked for 48h especially 10 gm/100ml were inhibitory than 24h extracts of 5 or 10gm material. Extracts from twigs were inhibitory to germination of wheat while same extracts inhibited the plumule growth of B. campestris. Radicle growth of T. alexandrinum was inhibited more by twig extracts. Hot water extracts from twigs were less inhibitory than leaf extracts. Litter and mulch also significantly delayed the seed germination and retarded the overall growth of seedlings of all test species. The number and length of seminal roots of T. aestivum was suppressed by all aqueous extracts, added litter and mulch. The inhibitory response depended upon the test species, concentration, soaking duration and physiological parameters. The results suggested that Celtis australis has strong phytotoxic potential. (author)

Genetic and epigenetic diversity and structure of Phragmites australis from local habitats of the Songnen Prairie using amplified fragment length polymorphism markers.

Science.gov (United States)

Qiu, T; Jiang, L L; Yang, Y F

2016-08-19

The genetic and epigenetic diversity and structure of naturally occurring Phragmites australis populations occupying two different habitats on a small spatial scale in the Songnen Prairie in northeastern China were investigated by assessing amplified fragment length polymorphisms (AFLPs) and methylation-sensitive amplified polymorphisms (MSAPs) through fluorescent capillary detection. The two groups of P. australis were located in a seasonal waterlogged low-lying and alkalized meadow with a pH of 8-8.5 and in an alkaline patch without accumulated rainwater and with a pH greater than 10. These groups showed high levels of genetic diversity at the habitat level based on the percentage of polymorphic bands (90.32, 82.56%), Nei's gene diversity index (0.262, 0.248), and the Shannon diversity index (0.407, 0.383). Although little is known about the between-habitat genetic differentiation of P. australis on a small spatial scale, our results implied significant genetic differentiation between habitats. Extensive epigenetic diversity within habitats, along with clear differentiation, was found. Specifically, the former habitat (Habitat 1, designated H1) harbored higher levels of genetic and epigenetic diversity than the latter (Habitat 2, designated H2), and population-level diversity was also high. This study represents one of few attempts to predict habitat-based genetic differentiation of reeds on a small scale. These assessments of genetic and epigenetic variation are integral aspects of molecular ecological studies on P. australis. Possible causes for within- and between-habitat genetic and epigenetic variations are discussed.

Use of gamma irradiation as a quarantine control method for Frankliniella australis (Morgan) (Thysanoptera: Thripidae)

International Nuclear Information System (INIS)

Araya, J.E.; Curkovic, T.; Cayo, A.

2007-01-01

The black flower thrips, Frankliniella australis (Morgan), a Chilean species, causes quarantine rejections of fresh fruits for export. Today, fumigation with CH3Br is efficient to avoid these rejections, but is questioned because it affects the ozone layer, irradiation of foods being an alternative. The effect of gamma irradiation was studied in the laboratory on F. australis adults, at dosages of 250, 500, 750, and 1000 Gy, followed by storage at 0-5 deg C to simulate shipping conditions. Mortality immediately after irradiation was low (1.5 to 22.3% at 250 and 1000 Gy, respectively), but increased an hour later (15.8, 33.4, 44.5, and 51.7% with 250, 500, 750, and 1000 Gy, respectively). In this evaluation, mortality with the greatest dosage was significantly larger than with 500 and 250 Gy, while results with 750 and 500 Gy were not different between them but different with the smallest dosage. At 24 hours, mortality with all dosages surpassed 91%, although only that at 1000 Gy was significantly greater than at 250 Gy. At day 4th (96 hours) there was at least 98.8% mortality for the irradiation treatments, with significant differences with the control, which then presented only 12.8% mortality. Using logit regression with results up to day 4, a probit 9 (LD99.9968) for adults was estimated at 188 Gy. This dosage is slightly less to those indicated in the literature for control of other thrips, which may be explained because of the combined use of cold storage, although more studies are necessary of this technology under commercial conditions to verify its applicability for quarantine control of F. australis. (author) [es

DNA hybridization evidence for the Australasian affinity of the American marsupial Dromiciops australis.

OpenAIRE

Kirsch, J A; Dickerman, A W; Reig, O A; Springer, M S

1991-01-01

DNA hybridization was used to compare representatives of the major groups of marsupials and a eutherian outgroup. Because of the large genetic distances separating marsupial families, trees were calculated from normalized percentages of hybridization; thermal-melting statistics, however, gave identical topologies for the well-supported clades. The most notable results were the association of the only extant microbiotheriid, Dromiciops australis, an American marsupial, with the Australasian Di...

Isolation, cloning, and characterization of a partial novel aro A gene in common reed (Phragmites australis).

Science.gov (United States)

Taravat, Elham; Zebarjadi, Alireza; Kahrizi, Danial; Yari, Kheirollah

2015-05-01

Among the essential amino acids, phenylalanine, tryptophan, and tyrosine are aromatic amino acids which are synthesized by the shikimate pathway in plants and bacteria. Herbicide glyphosate can inhibit the biosynthesis of these amino acids. So, identification of the gene tolerant to glyphosate is very important. It has been shown that the common reed or Phragmites australis Cav. (Poaceae) is relatively tolerant to glyphosate. The aim of the current research is identification, cloning, sequencing, and registering of partial aro A gene of the common reed P. australis. The partial aro A gene of common reed (P. australis) was cloned in Escherichia coli and the amino acid sequence was identified/determined for the first time. This is the first report for isolation, cloning, and sequencing of a part of aro A gene from the common reed. A 670 bp fragment including two introns (86 bp and 289 bp) was obtained. The open reading frame (ORF) region in part of gene was encoded for 98 amino acids. Alignment showed high similarity among this region with Zea mays (L.) (Poaceae) (94.6%), Eleusine indica L. Gaertn (Poaceae) (94.2%), and Zoysia japonica Steud. (Poaceae) (94.2%). The alignment of amino acid sequence of the investigated part of the gene showed a homology with aro A from several other plants. This conserved region forms the enzyme active site. The alignment results of nucleotide and amino acid residues with related sequences showed that there are some differences among them. The relative glyphosate tolerance in the common reed may be related to these differences.

Allelopathy and resource competition: the effects of Phragmites australis invasion in plant communities

OpenAIRE

Uddin, Md Nazim; Robinson, Randall William

2017-01-01

Background Phragmites australis, a ubiquitous wetland plant, has been considered one of the most invasive species in the world. Allelopathy appears to be one of the invasion mechanisms, however, the effects could be masked by resource competition among target plants. The difficulty of distinguishing allelopathy from resource competition among plants has hindered investigations of the role of phytotoxic allelochemicals in plant communities. This has been addressed via experiments conducted in ...

A sub-fossil kauri (Agathis australis) tree-ring chronology

International Nuclear Information System (INIS)

Bridge, M.C.; Ogden, J.

1986-01-01

A 491-year floating tree-ring chronology was constructed using sub-fossil bog kauris, Agathis australis, from a site near Huntly, North Island, New Zealand. The chronology has been approximately dated to within the period 3,500 B.P. to 3,000 B.P. by radiocarbon dating. This is the first sub-fossil New Zealand chronology, and shows the potential for the formation of a long chronology from the present back over several millenia. The applications of this chronology and its possible extensions include radiocarbon calibration for the Southern Hemisphere, and climatic reconstructions based on ring-widths. It will also assist interpretation of the history of the Waikato Valley over the last few millenia

BAROMETRIC PRESSURE and Other Data from AURORA AUSTRALIS and Other Platforms from 19910106 to 19920306 (NODC Accession 9500152)

Data.gov (United States)

National Oceanic and Atmospheric Administration, Department of Commerce — The Conductivity, Temperature and Depth (CTD) and other data were collected from Ship AURORA AUSTRALIS. The data was collected over a period spanning from January 6,...

Conditions for selective degradation of lignin by the fungus Ganoderma australis

Energy Technology Data Exchange (ETDEWEB)

Rios, S.; Eyzaguirre, J. (Universidad Catolica de Chile, Santiago (Chile). Lab. de Bioquimica)

1992-08-01

The white-rot fungus Ganoderma australis selectively degrades lignin in the ecosystem 'palo podrido'. Using conditions that simulate those of 'palo podrido' in the laboratory, it was found that low nitrogen content and low O{sub 2} tension stimulate the production of manganese peroxidase and lignin degradation, and depress cellulose degradation and cellulase production. The inverse is found at high nitrogen concentration and high O{sub 2} tension. This agrees with previous results indicating that low O{sub 2} tension and low nitrogen stimulate selective lignin degradation by this fungus. (orig.).

Tabla de vida y parámetros poblacionales de Lacertinella australis (Insecta-Hemiptera-Fulgoromorpha

Directory of Open Access Journals (Sweden)

Maria F. ROSSI BATIZ

2016-01-01

Full Text Available Lacertinella australis ha sido capturada en 11 provincias de la Argentina y fue mencionada como una especie de interés fitosanitario por su potencial para vehiculizar fitopatógenos. Atendiendo al amplio rango de distribución, su potencial importancia fitosanitaria y el carácter invasivo de su principal planta hospedera, Cor - taderia spp., se evaluaron aspectos del ciclo de vida a través de una tabla de vida vertical bajo condiciones controladas en el laboratorio y se confeccionó una segunda tabla de vida sobre la base de un muestreo de una población natural. Se estimaron los atributos poblacionales: tasa reproductiva básica o tasa de reemplazo ( R 0 , tasa finita de crecimiento poblacional ( λ , capacidad de incremento poblacional ( r c , valor reproductivo ( V x , tiempo generacional de la cohorte ( T c y el promedio del tiempo de desarrollo por estadios. Se mencionan y comparan aspectos comportamentales y de la bionomía de L. australis compartidos con las dos especies de la tribu cuya biología se conoce: Saccharosydne procerus y Saccharosydne saccharivora.

Genetic variation within three populations of Phycella australis (Phil. Ravenna from Biobío Region, Chile, evaluated using ISSR markers

Directory of Open Access Journals (Sweden)

Cristian Flores

2013-03-01

Full Text Available Phycella australis (Phil. Ravenna is a Chilean plant with high ornamental potential; however, the intensive extraction as a cut flower might be detrimental for the conservational state by ignoring the state of genetic variation. The objective of this investigation was to assess genetic variability within and between three populations of P. australis in the Biobío Region using inter-simple sequence repeat (ISSR markers. The evaluated areas correspond to three locations in the province of Concepción, Biobío Region: Desembocadura (36°48' S, 73°10' W, Santa Juana (36°58' S, 72°58' W, and Lipinhue (37°00' S, 72°58' W. Six ISSR primers were used obtaining 51 fragments, from which 72.5% were polymorphic. From the three evaluated sites Santa Juana showed a higher percentage of polymorphic loci (76.47%. From this variability, 83% belong to within population variability and only 17% belong to variability between populations. The dendrogram generated using the unweighted pair group method with arithmetic mean (UPGMA method, grouped Lipinhue and Santa Juana sites together, which agrees with the geographic locations. This investigation proved that P. australis has high genetic variability despite the exploitation for economic purposes.

Quantification of environment-driven changes in epiphytic macroinvertebrate communities associated to Phragmites australis

OpenAIRE

Miguel CAÑEDO-ARGÜELLES; Maria RIERADEVALL

2009-01-01

The epiphytic macroinvertebrate communities associated with the Common Reed, Phragmites australis (Cav.) Trin. ex Steudel, were examined seasonally from summer 2004 to spring 2005 in eleven coastal lagoons of the Llobregat Delta (NE Spain) following the method proposed by Kornijów & Kairesalo (1994). The aims of the study were to: 1) characterise and quantify changes in epiphytic macroinvertebrate communities along environmental gradients; 2) assess the contribution of elements of the epi...

A sulphated flavone glycoside from Livistona australis and its antioxidant and cytotoxic activity.

Science.gov (United States)

Kassem, Mona E S; Shoela, Soha; Marzouk, Mona M; Sleem, Amany A

2012-01-01

A new flavone glycoside tricin 7-O-β-glucopyranoside-2″-sulphate sodium salt along with 14 known flavonoid compounds were isolated and identified from the aqueous methanol extract of Livistona australis leaves. Their structures were established on the basis of extensive NMR (¹H, ¹³C, HSQC and H-H COSY) and ESIMS data. Antioxidant and cytotoxicity properties of the methanol extract of the leaves as well as the new compound were investigated.

Morphology of the eye of the southern right whales (Eubalaena australis).

Science.gov (United States)

Buono, Mónica R; Fernández, Marta S; Herrera, Yanina

2012-02-01

Recently, there has been a growing interest in the anatomy and optics of the visual system of cetaceans. However, much of the new information has been focused on odontocetes, and relatively little is known about the visual anatomy of baleen whales. The aim of this study was describe the eye anatomy of the southern right whale (Eubalaena australis). Eye samples were collected from 26 calves, four adults with known body length, as well as two specimens of unknown body length that had stranded near their nursery ground at Península Valdés, Argentina, over 6 years. We provide anatomical descriptions of the eyeball and extraocular structures, as well as quantitative data in the form of eyeball, corneal, scleral, and lens measurements. To explore the sensitivity of the eye to light, the f-number was estimated in one specimen. We found that the eyes of the calves differed from those of the adults in having less periorbital fat surrounding the eyeball. We also observed variations in the abundance of periorbital fat among the adult specimens. The regression analysis revealed a correlation between body length and eyeball size. By contrast, the dimensions of the cornea were only weakly correlated with body length. The estimated f-number suggests that the optical sensitivity of the Eubalaena australis eye is relatively low. However, caution had to be taken in interpreting f-number as a proxy of eye sensitivity because it depends on the lens size, which can be affected by the fixation methods used. Copyright © 2011 Wiley Periodicals, Inc.

Bioactivity and chemical composition of the essential oil from the leaves of Guatteria australis A.St.-Hil.

Science.gov (United States)

Siqueira, Carlos Alberto Theodoro; Serain, Alessandra Freitas; Pascoal, Aislan Cristina Rheder Fagundes; Andreazza, Nathalia Luiza; de Lourenço, Caroline Caramano; Ruiz, Ana Lúcia T Góis; de Carvalho, João Ernesto; de Souza, Ana Cláudia Oliveira; Mesquita, Juliana Tonini; Tempone, Andre Gustavo; Salvador, Marcos José

2015-01-01

Essential oil from the leaves of Guatteria australis was obtained by hydrodistillation, analyzed by Gas Chromatography coupled to Mass Spectromery (GC-MS) and their antiproliferative, antileishmanial, antibacterial, antifungal and antioxidant activities were also evaluated. Twenty-three compounds were identified among which germacrene B (50.66%), germacrene D (22.22%) and (E)-caryophyllene (8.99%) were the main compounds. The highest antiproliferative activity was observed against NCI-ADR/RES (TGI = 31.08 μg/ml) and HT-29 (TGI = 32.81 μg/ml) cell lines. It also showed good antileishmanial activity against Leishmania infantum (IC50 = 30.71 μg/ml). On the other hand, the oil exhibited a small effect against Staphylococcus aureus ATCC 6538, S. aureus ATCC 14458 and Escherichia coli ATCC 10799 (MIC = 250 μg/ml), as well as small antioxidant activity (457 μmol TE/g) assessed through ORACFL assay. These results represent the first report regarding chemical composition and bioactivity of G. australis essential oil.

Phylogeography of Australia's king brown snake (Pseudechis australis) reveals Pliocene divergence and Pleistocene dispersal of a top predator

Science.gov (United States)

Kuch, Ulrich; Keogh, J. Scott; Weigel, John; Smith, Laurie A.; Mebs, Dietrich

2005-03-01

King brown snakes or mulga snakes (Pseudechis australis) are the largest and among the most dangerous and wide-ranging venomous snakes in Australia and New Guinea. They occur in diverse habitats, are important predators, and exhibit considerable morphological variation. We infer the relationships and historical biogeography of P. australis based on phylogenetic analysis of 1,249 base pairs from the mitochondrial cytochrome b, NADH dehydrogenase subunit 4 and three adjacent tRNA genes using Bayesian, maximum-likelihood, and maximum-parsimony methods. All methods reveal deep phylogenetic structure with four strongly supported clades comprising snakes from New Guinea (I), localities all over Australia (II), the Kimberleys of Western Australia (III), and north-central Australia (IV), suggesting a much more ancient radiation than previously believed. This conclusion is robust to different molecular clock estimations indicating divergence in Pliocene or Late Miocene, after landbridge dispersal to New Guinea had occurred. While members of clades I, III and IV are medium-sized, slender snakes, those of clade II attain large sizes and a robust build, rendering them top predators in their ecosystems. Genetic differentiation within clade II is low and haplotype distribution largely incongruent with geography or colour morphs, suggesting Pleistocene dispersal and recent ecomorph evolution. Significant haplotype diversity exists in clades III and IV, implying that clade IV comprises two species. Members of clade II are broadly sympatric with members of both northern Australian clades. Thus, our data support the recognition of at least five species from within P. australis (auct.) under various criteria. We discuss biogeographical, ecological and medical implications of our findings.

Comparative morphophysiological evaluation of the testis of adult Wistar rats fed low protein-energy diet and dosed with aqueous extracts of Cuscuta australis.

Science.gov (United States)

Ozegbe, P C; Omirinde, J O

2012-12-18

Cuscuta australis (C. australis) seed and stem are historically used by the local population as dietary supplement for the management of infertility. This study, therefore, evaluated the effect of orally administered aqueous extracts of C. australis seed and stem, 300 mg/kg body weight/day for seven days, on the testis of the adult Wistar rat fed either low or normal protein-energy diets. The control group received water. The relative weight of the testis was non-significantly increased (p>0.05) in the Low Protein-energy diet-Water-treated (LPWA), Low Protein-energy diet-Seed-treated (LPSE) and Normal Protein-energy diet-Seed-treated (NPSE) groups relative to the Normal Protein-energy diet-Water-treated (NPWA). The weight of the testis was also non-significantly increased (p˃0.05) in the Low Protein-energy diet-Stem-treated (LPST), but decreased in the Normal Protein-energy diet-Stem-treated (NPST), relative to LPWA and NPWA. Heights of germinal epithelium were significantly decreased (p<0.05) in the LPWA, LPSE and LPST relative to the NPWA, NPSE and NPST. Diet significantly influenced (p<0.001) the effect of stem extract on the height of germinal epithelium. The NPSE, LPSE, NPST, LPST and LPWA showed significantly decreased (p<0.001) plasma levels of luteinizing hormone (LH) and follicle stimulating hormone (FSH) relative to NPWA. The LPWA, LPSE and NPST also showed significantly decreased (p<0.001) levels of testosterone relative to NPWA and LPST. Diet significantly influenced (p<0.001) the effect of seed on the level of LH. Seed-diet interactions significantly affected the levels of FSH (p<0.001) and LH (p<0.05), but not testosterone. Diet significantly influenced (p<0.001) the effects of stem extract on the levels of FSH, LH and testosterone. Stem-diet interactions significantly affected (p<0.001) the levels of FSH, LH and testosterone. Our data suggest that the aqueous extract of C. australis stem is more potent than the seed extract and that dietary protein

The effects of short term exposure to Bass Strait crude oil and Corexit 8667 on benthic community metabolism in Posidonia australis Hook. f. dominated microcosms

Energy Technology Data Exchange (ETDEWEB)

Hatcher, A.I.; Larkum, A.W.D.

1982-03-01

Microcosms consisting of a sublittoral seagrass meadow from Botany Bay, N.S.W. were maintained in aquaria in a controlled environment room from March to August 1979. Oxygen production and consumption in the microcosms and leaf turnover of the seagrass, Posidonia australis Hook.f. were measured before, during and after a 7-day treatment in June with Bass Strait crude oil and the dispersant Corexit 8667. Four microcosms received oil and two of these received dispersant. The leaf turnover of P. australis was not significantly affected by the addition of oil and dispersant. Photosynthetic oxygen production decreased and respiration increased in the microcosms during treatment. In August, 40 days after treatment, oxygen production rates and P/R ratios in the oil-treated microcosms were higher than rates measured before treatment. The oil-and-dispersant-treated microcosms did not show this trend. The results of this study indicate that a more severe stress is placed on the P. australis dominated benthic community by oil and dispersant than by oil alone.

Parasite body volume and infracommunity patterns in the southern pomfret Brama australis (Pisces: Bramidae Volumen corporal del parásito y patrones infracomunitarios en la reineta Brama australis (Pisces: Bramidae

Directory of Open Access Journals (Sweden)

MARIO GEORGE-NASCIMENTO

2002-12-01

Full Text Available The patterns of infracommunity descriptors (diversity, dominance, abundance are compared when calculated with the number and body volume of the parasites in a sample of 26 southern pomfrets Brama australis collected in the area off Talcahuano, Chile. No numerical infracommunity descriptor was correlated with its corresponding volumetric descriptor. This single result casts doubts about the general validity of the infracommunity patterns described in the literature so far, because they are almost exclusively based on the number of parasite individuals per individual host, restricting communication with ecologists that use density or other measures of ecological abundanceLos patrones de los descriptores infracomunitarios (diversidad, dominancia, abundancia son comparados cuando son calculados en base a los números o al volumen corporal de los parásitos en una muestra de 26 reinetas Brama australis recolectadas en el área de Talcahuano, Chile. Ningún descriptor infracomunitario calculado con el número de parásitos estuvo correlacionado con los basados en el volumen corporal de los parásitos. Este resultado siembra dudas acerca de la validez general que pueden tener los patrones infracomunitarios registrados en la literatura ya que están casi exclusivamente calculados con el número de parásitos por individuo hospedador, lo que dificulta aún más la comunicación con los ecólogos, que usan la densidad u otras medidas de abundancia ecológica

Accumulation of nutrients and heavy metals in Phragmites australis (Cav.) Trin. ex Steudel and Bolboschoenus maritimus (L.) Palla in a constructed wetland of the Venice lagoon watershed

International Nuclear Information System (INIS)

Bragato, Claudia; Brix, Hans; Malagoli, Mario

2006-01-01

A recently constructed wetland, located in the Venice lagoon watershed, was monitored to investigate growth dynamics, nutrient and heavy metal shoot accumulation of the two dominating macrophytes: Phragmites australis and Bolboschoenus maritimus. Investigations were conducted over a vegetative season at three locations with different distance to the inlet point to assess effects on vegetation. The distance from the inlet did not affect either shoot biomass or nutrients (N, P, K and Na) and heavy metals (Cr, Ni, Cu and Zn) shoot content. With the exception of Na, nutrient and heavy metal concentrations were higher in shoots of P. australis than in B. maritimus. Heavy metal concentration in the incoming water and in the soil was not correlated to the plant content of either species. Shoot heavy metal concentrations were similar to those reported in the current literature, but accumulation generally increased towards the end of the growing season. - Heavy metal shoot concentration in Phragmites australis and Bolboschoenus maritimus increased significantly at the end of the growing season

Temperature, energy acquisition and energy use in the Chilean silverside Basilichthys australis Eigenmann (Atherinopsidae Temperatura, adquisición de energía y uso de energía en el pejerrey chileno Basilichthys australis Eigenmann (Atherinopsidae

Directory of Open Access Journals (Sweden)

LEOPOLDO FUENTES

2005-06-01

Full Text Available We evaluated the influence of water temperature (Tw on the energy acquisition and use in the chilean silverside Basilichthys australis (Eigenmann 1927, an endemic species inhabiting freshwater ecosystems in Chile. We tested the effect of Tw (11.5, 14.0, 18.0, 22.0 and 26.0 °C on food intake, digestibility, food transit time and metabolic rate. As expected, this study demonstrated that many physiological variables under study were significantly affected by Tw, as well as the net energy balance of this species. Nevertheless, the net energy balance was not strictly related to the range of Tws evaluated. At Tws lower than 14 °C the energy budget was depressed, because food intake was lower than at Tws between 14 and 26 °C, where food intake was higher and independent of Tw. Consequently, at these temperatures the energy balance was positive and also independent of Tw. Physiologically, B. australis appears to be a tolerant species with respect to the wide range of water temperature in habitats at different depths. Thus, its distributions may extend through the entire profile of lakes and rivers, even in systems characterised by spatial and temporal thermal variabilityEn este trabajo evaluamos la influencia de la temperatura del agua (Ta en la adquisición de energía y su uso por parte del pejerrey chileno Basilichthys australis (Eigenmann 1927, una especie endémica que habita los ecosistemas dulceacuícolas de Chile. Investigamos el efecto de Ta (11,5, 14,0, 18,0, 22,0 y 26,0 °C en la ingesta de alimento, digestibilidad, tiempo de transito del alimento y tasa metabólica. De acuerdo a lo esperado, este estudio demostró que varias de las variables fisiológicas bajo estudio fueron significativamente afectadas por Ta, así como el balance energético de esta especie. Sin embargo, el balance neto de energía no estuvo estrictamente relacionado al rango de Tas evaluadas. En Tas inferiores a 14 °C el presupuesto de energía fue deprimido, debido a

Uptake of Carbamazepine by rhizomes and endophytic bacteria of Phragmites australis

Directory of Open Access Journals (Sweden)

Andres eSauvetre

2015-02-01

Full Text Available Carbamazepine is an antiepileptic and mood-stabilizing drug which is used widely in Europe and North America. In the environment, it is found as a persistent and recalcitrant conta¬mi-nant, being one of the most prominent hazardous pharmaceuticals and personal care products (PPCPs in effluents of wastewater treatment plants (WWTPs. Phragmites australis is one of the species with both, the highest potential of detoxification and phytoremediation. It has been used successfully in the treatment of industrial and municipal wastewater. Recently, the identification of endophytic micro¬organisms from different plant species growing in contaminated sites has provided a list of candidates which could be used as bio-inoculants for bioremediation of difficult compounds. In this study, Phragmites australis plants were exposed to 5 mg/L of carbamazepine. After 9 days the plants had removed 90% of the initial concentration. Endophytic bacteria were isolated from these plants and further characterized. Phylogenetic analysis based on 16S rDNA sequencing revealed that the majority of these isolates belong to three groups: Proteobacteria, Actinobacteria and Bacteroidetes. Carbamazepine uptake and plant growth promoting (PGP traits were analyzed among the isolates. Ninety percent of the isolates produce indole acetic acid (IAA and all of them possess at least one of the PGP traits tested. One isolate identified as Chryseobacterium taeanense combines good carbamazepine uptake and all of the PGP traits. Rhizobium daejeonense can remove carbamazepine and produces 23 µg/mL of IAA. Diaphorobacter nitroreducens and Achromobacter mucicolens are suitable for carbamazepine removal while both, Pseudomonas veronii and Pseudomonas lini show high siderophore production and phosphate solubilization. Alone or in combination, these isolates might be applied as inoculates in constructed wetlands in order to enhance the phyto-remediation of carbamazepine during wastewater

Non-linear growth in tree ferns, Dicksonia antarctica and Cyathea australis.

Science.gov (United States)

Blair, David P; Blanchard, Wade; Banks, Sam C; Lindenmayer, David B

2017-01-01

Tree ferns are an important structural component of forests in many countries. However, because their regeneration is often unrelated to major disturbances, their age is often difficult to determine. In addition, rates of growth may not be uniform, which further complicates attempts to determine their age. In this study, we measured 5 years of growth of Cyathea australis and Dicksonia antarctica after a large wildfire in 2009 in south-eastern Australia. We found growth rates of these two species were unaffected by aspect and elevation but slope had a minor effect with D. antarctica growing 0.3mm faster for each additional degree of slope. Geographic location influenced growth in both species by up to 12 - 14mm/yr. The most consistent factor influencing growth rate, however, was initial height at the time of the 2009 fire; a finding consistent in both species and all geographic locations. For both tree fern species, individuals that were taller at the commencement of the study had greater overall growth for the duration of the study. This effect did not decrease even among the tallest tree ferns in our study (up to 6 metres tall). Overall, Cyathea australis averaged 73 (± 22)mm/year of growth (± 1SD), with the rate increasing 5mm/yr per metre of additional height. Dicksonia antarctica averaged 33 (± 13)mm/year, increasing by 6mm/yr/m. Growth rates dependent on initial height were unexpected and we discuss possible reasons for this finding. Variable growth rates also suggest that common age estimation methods of dividing height by average growth rate are likely to underestimate the age of short tree ferns, while overestimating the age of tall tree ferns, particularly if they have been subject to a fire.

Retinal amino acid neurochemistry of the southern hemisphere lamprey, Geotria australis.

Directory of Open Access Journals (Sweden)

Lisa Nivison-Smith

Full Text Available Lampreys are one of the two surviving groups of the agnathan (jawless stages in vertebrate evolution and are thus ideal candidates for elucidating the evolution of visual systems. This study investigated the retinal amino acid neurochemistry of the southern hemisphere lamprey Geotria australis during the downstream migration of the young, recently-metamorphosed juveniles to the sea and during the upstream migration of the fully-grown and sexually-maturing adults to their spawning areas. Glutamate and taurine were distributed throughout the retina, whilst GABA and glycine were confined to neurons of the inner retina matching patterns seen in most other vertebrates. Glutamine and aspartate immunoreactivity was closely matched to Müller cell morphology. Between the migratory phases, few differences were observed in the distribution of major neurotransmitters i.e. glutamate, GABA and glycine, but changes in amino acids associated with retinal metabolism i.e. glutamine and aspartate, were evident. Taurine immunoreactivity was mostly conserved between migrant stages, consistent with its role in primary cell functions such as osmoregulation. Further investigation of glutamate signalling using the probe agmatine (AGB to map cation channel permeability revealed entry of AGB into photoreceptors and horizontal cells followed by accumulation in inner retinal neurons. Similarities in AGB profiles between upstream and downstream migrant of G. australis confirmed the conservation of glutamate neurotransmission. Finally, calcium binding proteins, calbindin and calretinin were localized to the inner retina whilst recoverin was localized to photoreceptors. Overall, conservation of major amino acid neurotransmitters and calcium-associated proteins in the lamprey retina confirms these elements as essential features of the vertebrate visual system. On the other hand, metabolic elements of the retina such as neurotransmitter precursor amino acids and Müller cells

Non-linear growth in tree ferns, Dicksonia antarctica and Cyathea australis.

Directory of Open Access Journals (Sweden)

David P Blair

Full Text Available Tree ferns are an important structural component of forests in many countries. However, because their regeneration is often unrelated to major disturbances, their age is often difficult to determine. In addition, rates of growth may not be uniform, which further complicates attempts to determine their age. In this study, we measured 5 years of growth of Cyathea australis and Dicksonia antarctica after a large wildfire in 2009 in south-eastern Australia. We found growth rates of these two species were unaffected by aspect and elevation but slope had a minor effect with D. antarctica growing 0.3mm faster for each additional degree of slope. Geographic location influenced growth in both species by up to 12 - 14mm/yr. The most consistent factor influencing growth rate, however, was initial height at the time of the 2009 fire; a finding consistent in both species and all geographic locations. For both tree fern species, individuals that were taller at the commencement of the study had greater overall growth for the duration of the study. This effect did not decrease even among the tallest tree ferns in our study (up to 6 metres tall. Overall, Cyathea australis averaged 73 (± 22mm/year of growth (± 1SD, with the rate increasing 5mm/yr per metre of additional height. Dicksonia antarctica averaged 33 (± 13mm/year, increasing by 6mm/yr/m. Growth rates dependent on initial height were unexpected and we discuss possible reasons for this finding. Variable growth rates also suggest that common age estimation methods of dividing height by average growth rate are likely to underestimate the age of short tree ferns, while overestimating the age of tall tree ferns, particularly if they have been subject to a fire.

Effects of Organic and Inorganic Nitrogen on the Growth and Production of Domoic Acid by Pseudo-nitzschia multiseries and P. australis (Bacillariophyceae) in Culture.

Science.gov (United States)

Martin-Jézéquel, Véronique; Calu, Guillaume; Candela, Leo; Amzil, Zouher; Jauffrais, Thierry; Séchet, Véronique; Weigel, Pierre

2015-11-26

Over the last century, human activities have altered the global nitrogen cycle, and anthropogenic inputs of both inorganic and organic nitrogen species have increased around the world, causing significant changes to the functioning of aquatic ecosystems. The increasing frequency of Pseudo-nitzschia spp. in estuarine and coastal waters reinforces the need to understand better the environmental control of its growth and domoic acid (DA) production. Here, we document Pseudo-nitzschia spp. growth and toxicity on a large set of inorganic and organic nitrogen (nitrate, ammonium, urea, glutamate, glutamine, arginine and taurine). Our study focused on two species isolated from European coastal waters: P. multiseries CCL70 and P. australis PNC1. The nitrogen sources induced broad differences between the two species with respect to growth rate, biomass and cellular DA, but no specific variation could be attributed to any of the inorganic or organic nitrogen substrates. Enrichment with ammonium resulted in an enhanced growth rate and cell yield, whereas glutamate did not support the growth of P. multiseries. Arginine, glutamine and taurine enabled good growth of P. australis, but without toxin production. The highest DA content was produced when P. multiseries grew with urea and P. australis grew with glutamate. For both species, growth rate was not correlated with DA content but more toxin was produced when the nitrogen source could not sustain a high biomass. A significant negative correlation was found between cell biomass and DA content in P. australis. This study shows that Pseudo-nitzschia can readily utilize organic nitrogen in the form of amino acids, and confirms that both inorganic and organic nitrogen affect growth and DA production. Our results contribute to our understanding of the ecophysiology of Pseudo-nitzschia spp. and may help to predict toxic events in the natural environment.

Invasion of Old World Phragmites australis in the New World: precipitation and temperature patterns combined with human influences redesign the invasive niche.

Science.gov (United States)

Guo, Wen-Yong; Lambertini, Carla; Li, Xiu-Zhen; Meyerson, Laura A; Brix, Hans

2013-11-01

After its introduction into North America, Euro-Asian Phragmites australis became an aggressive invasive wetland grass along the Atlantic coast of North America. Its distribution range has since expanded to the middle, south and southwest of North America, where invasive P. australis has replaced millions of hectares of native plants in inland and tidal wetlands. Another P. australis invasion from the Mediterranean region is simultaneously occurring in the Gulf region of the United States and some countries in South America. Here, we analysed the occurrence records of the two Old World invasive lineages of P. australis (Haplotype M and Med) in both their native and introduced ranges using environmental niche models (ENMs) to assess (i) whether a niche shift accompanied the invasions in the New World; (ii) the role of biologically relevant climatic variables and human influence in the process of invasion; and (iii) the current potential distribution of these two lineages. We detected local niche shifts along the East Coast of North America and the Gulf Coast of the United States for Haplotype M and around the Mississippi Delta and Florida of the United States for Med. The new niche of the introduced Haplotype M accounts for temperature fluctuations and increased precipitation. The introduced Med lineage has enlarged its original subtropical niche to the tropics-subtropics, invading regions with a high annual mean temperature (> ca. 10 °C) and high precipitation in the driest period. Human influence is an important factor for both niches. We suggest that an increase in precipitation in the 20th century, global warming and human-made habitats have shaped the invasive niches of the two lineages in the New World. However, as the invasions are ongoing and human and natural disturbances occur concomitantly, the future distribution ranges of the two lineages may diverge from the potential distribution ranges detected in this study. © 2013 John Wiley & Sons Ltd.

Debregeasia australis sp. nov. (Urticaceae), with a new synopsis of and a new key to the genus

DEFF Research Database (Denmark)

Wilmot-Dear, Christine Melanie; Friis, Ib

2012-01-01

A new species in the Old World genus Debregeasia (Urticaceae), D. australis Friis, Wilmot-Dear & C.J.Chen, based on material from forest habitats in eastern Queensland, Australia, is described, illustrated and mapped. A new synopsis of the genus and a new key to species recognised is provided as ...

Australis: AMS for ultra sensitive trace element and isotopic studies

Energy Technology Data Exchange (ETDEWEB)

Sie, S H; Suter, G F [Commonwealth Scientific and Industrial Research Organisation (CSIRO), North Ryde, NSW (Australia). Div. of Exploration Geoscience

1994-12-31

The accelerator mass spectrometer (AMS) at the CSIRO HIAF laboratory is being upgraded to enable in-situ measurements of ultratraces and isotopic-ratios in mineralogical applications. The upgraded system will include a microbeam Cs ion source which is designed to produce better than 50 micrometre diameter Cs beam to enable analyses of monomineralic grains. The Cs primary beam will be mass analysed in order to minimize contamination of the sample. The detection system will be upgraded to enable analyses of elements up to U, at 2 MV terminal voltage for charge states 4 and 5. The system will be known as AUSTRALIS: A.M.S. for Ultra Sensitive TRAce eLement and Isotopic Studies. An overview of the system and the anticipated applications in minerals exploration and mining research are presented. 4 refs., 1 fig.

Australis: AMS for ultra sensitive trace element and isotopic studies

International Nuclear Information System (INIS)

Sie, S.H.; Suter, G.F.

1993-01-01

The accelerator mass spectrometer (AMS) at the CSIRO HIAF laboratory is being upgraded to enable in-situ measurements of ultratraces and isotopic-ratios in mineralogical applications. The upgraded system will include a microbeam Cs ion source which is designed to produce better than 50 micrometre diameter Cs beam to enable analyses of monomineralic grains. The Cs primary beam will be mass analysed in order to minimize contamination of the sample. The detection system will be upgraded to enable analyses of elements up to U, at 2 MV terminal voltage for charge states 4 and 5. The system will be known as AUSTRALIS: A.M.S. for Ultra Sensitive TRAce eLement and Isotopic Studies. An overview of the system and the anticipated applications in minerals exploration and mining research are presented. 4 refs., 1 fig

Australis: AMS for ultra sensitive trace element and isotopic studies

Energy Technology Data Exchange (ETDEWEB)

Sie, S.H.; Suter, G.F. [Commonwealth Scientific and Industrial Research Organisation (CSIRO), North Ryde, NSW (Australia). Div. of Exploration Geoscience

1993-12-31

The accelerator mass spectrometer (AMS) at the CSIRO HIAF laboratory is being upgraded to enable in-situ measurements of ultratraces and isotopic-ratios in mineralogical applications. The upgraded system will include a microbeam Cs ion source which is designed to produce better than 50 micrometre diameter Cs beam to enable analyses of monomineralic grains. The Cs primary beam will be mass analysed in order to minimize contamination of the sample. The detection system will be upgraded to enable analyses of elements up to U, at 2 MV terminal voltage for charge states 4 and 5. The system will be known as AUSTRALIS: A.M.S. for Ultra Sensitive TRAce eLement and Isotopic Studies. An overview of the system and the anticipated applications in minerals exploration and mining research are presented. 4 refs., 1 fig.

Preliminary Study On Gonad Maturity Stages of the Sea Cucumber Paracaudina australis from Kenjeran Water, Surabaya, Indonesia

Science.gov (United States)

Widianingsih, Widianingsih; Zaenuri, Muhammad; Anggoro, Sutrisno; Pancasakti Kusumaningrum, Hermin; Hartati, Retno

2018-02-01

The holothurian Paracaudina australis is belong to family Caudinidae, ordo Molpadida and class Holothuroidea. This species is among the most common holothurian widely distributed in the tropical water. The purpose of this reseach is to do preliminary study on maturity stages of sea cucumber Paracaudina australis from Kenjeran Water, Surabaya, Indonesia. This research was conducted on April 2016. Samples were collected randomly on the Kenjeran Water, Surabaya. The result showed that there are five stages of gonad maturity. At the stage of maturity 1, the gonad was not clearly distinguished, there were unbranched small tubule. At the stage of maturity 2, there were small branched of tubules. At this stage, gonad can be differentiated between male and female. At the stage of maturity 3, tubule can been branched not only for male but also female. At the stage of maturity 4, the gonad was good mature, there were clearly branched tubule. At the stage of matury 5, there were generally had empty tubule except for a few relict unreleased spermatozoa. At female gonad, there were shrunken tubule and relict oocytes were presented in the lumen of the tubule.

Comparative evaluation of the sperm characteristics and morphology of adult Wistar rats fed either low or normal protein-energy diets and orally dosed with aqueous Cuscuta australis extracts.

Science.gov (United States)

Omirinde, J O; Ozegbe, P C; Oyeyemi, M O

2014-06-19

Cuscuta australis (C. australis) seed and stem are commonly used as dietary supplements in a maize-meal, "Ogi", by the local population for the management of male and female reproductive dysfunctions. This study, as a part of on-going efforts, therefore, evaluated and compared the effects of Low Protein-energy (LP) and Normal Protein-energy (NP) diets on the sperm morphology and characteristics of adult Wistar rats orally dosed aqueous extracts of C. australis seed (LPSE and NPSE) and stem (LPST and NPST), 300 mg of extract/kg body weight of rat/day, for seven days. The control groups (LPWA and NPWA) received vehicle, water. Live-dead ratio and percentage of sperms with curved tail were significantly decreased (p<0.01) in the NPST relative to the NPWA, LPWA, LPST, NPSE and LPSE. Total abnormal sperm counts, acephalic sperms and tailless head sperms were significantly decreased (p<0.001, p<0.05 and p<0.001, respectively) in the LPST and NPST relative to LPSE, NPSE, LPWA and NPWA. The LPSE, LPST and NPST showed significantly decreased (p<0.05) percentages of sperms with either bent mid-piece or curved mid-piece relative to the LPWA. Significantly decreased (p<0.05) percentage of sperms with curved mid-piece was also observed in the NPSE relative to LPWA. Protein-energy diet significantly influenced (at least p<0.05) the effect of each extract on sperm motility and percentage of sperms with curved tail. Stem extract significantly decreased (p<0.01) the percentages of acephalic sperms and tailless head sperms. Diet-stem extract interaction significantly influenced (p<0.05) live-dead ratio. Our data suggest that orally administered aqueous extracts of C. australis generally enhanced the sperm morphology and characteristics of the male Wistar rat and that the stem extract maintained sperm morphology better than the seed extract. It also showed that the stem extract decreased live-dead ratio and that the efficacy of orally administered aqueous C. australis stem extract

Evaluación de la Remoción de Nitrógeno, Fósforo y Sulfuros en Agua Residual Doméstica, Utilizando Phragmites australis en Bioreactores

OpenAIRE

Correa-Torres, Sandra N; Gamarra, Yolanda; Salazar, Andrés A; Pitta, Natalia M

2015-01-01

En el presente estudio se evaluó la remoción de nitrógeno, fósforo y sulfuros en un agua residual doméstica mediante fitorremediación utilizando Phragmites australis en bioreactores a escala de laboratorio. Se determinó el estudio las condiciones hidráulicas en reactores analizando las variables de relación geométrica largo:ancho (4:1 y 1:4) y usando un medio filtrante (grava/arena). Adicionalmente se evaluó el crecimiento de P. australis en los reactores y se analizó los porcentajes de remoc...

The effect of sampling methods on the apparent constituents of ink from the squid Sepioteuthis australis.

Science.gov (United States)

Madaras, F; Gerber, J P; Peddie, F; Kokkinn, M J

2010-11-01

Results of experiments conducted on ink recovered from the squid Sepioteuthis australis indicate that there is no epinephrine or protein naturally present in the ink as it would be ejected in vivo. Protein content was effectively zero when ink was syringed from the duct end of the ink sac of freshly killed animals. By contrast, there were proteins in samples collected from dead specimens where ink was collected by a stripping method. From these samples, a single large molecular weight protein was identified as having tyrosinase activity. Digestion of syringed ink did not yield signs of melanin-bound proteins. Analysis of supernatants after centrifugation of squid ink consistently revealed the presence of DOPA, dopamine, and taurine, whereas epinephrine and nor-epinephrine were recorded from what was believed to be contaminated ink. Histological investigations of the ink sac revealed a compartmentalised glandular structure distal to the duct end. Closer observation of the glandular tissue showed that compartments increased in size as they matured and moved further into the lumen. It was concluded that the presence of epinephrine and tyrosinase (or a related protein) in the ink of S. australis could be attributed to rupturing of basal glandular compartments or contamination from other sources during the extraction process.

Quince años de sucesión después de corta experimental en brezales de Erica australis L. en la provincia de León (España

Directory of Open Access Journals (Sweden)

Calvo, L.

2000-12-01

Full Text Available The response of the woody species to experimental cutting was studied for a period of fifteen years in a shrub community of NW Spain. This treatment represents the disturbance most frequently imposed by humans on these shrub communities throughout history. The dominant species, Erica australis, influences the regeneration patterns of the rest of the species which make up the community. There is a significant increase in the cover values of the woody species until the fourth year and of the herbaceous ones until the third year. Since then Erica australis attains the spatial occupancy and cover values it originally had, removing the herbaceous species and negatively influencing the growth of some woody ones like Halimium umbellatum and H. alyssoides. Both Erica australis and Genistella tridentata sprout after cutting. Arctostaphylos uva-ursi does not recover. Halimium alyssoides, H. umbellatum. Erica umbellata and Calluna vulgaris regenerate by germination. These shrubland communities have a high degree of resilience due to the strong sprouting potential of the component species.

[fr]
L'étude porte sur la régénération des espèces ligneuses après coupe, sur une durée de 15 ans, dans une lande dominée par Erica australis. Ce traitement experimental est l'un des plus fréquemment utilisés dans ce type de commimautés. L'espèce dominante Erica australis agit sur les types de régénération des autres espèces. On observe un accroisement significatif des taux de couverture pour les espèces ligneuses jusqu'au 4ème. année et jusqu'au Sème, année pour les herbacées. À partir de ce moment. Erica australis retrouve les valeurs d' origine, en limitant les taux des herbacées et en diminuant la croissance de quelques espèces ligneuses comme Halimium umbellatum et H. alyssoides. La régénération par rejet est le m

Marine water mites (Acari: Hydrachnidia: Pontarachnidae) from Taiwan, Korea and India, with the first description of the male of Pontarachna australis Smit, 2003

Digital Repository Service at National Institute of Oceanography (India)

Pesic, V.; Chatterjee, T.; Chan, B.K.K.; Ingole, B.S.

he hitherto unknown male of the marine water mite Pontarachna australis Smit, 2003 (Acari: Hydrachnidia: Pontarachnidae) is described and recorded from Taiwan for the first time. Another marine water mite, Litarachna denhami (Lohmann, 1909...

Radio emission from pre-main-sequence stars in Corona Australis

International Nuclear Information System (INIS)

Brown, A.

1987-01-01

The central region of the Corona Australis molecular cloud surrounding the stars R and TY CrA has been studied using the VLA at 6 cm. Eleven radio sources are detected including five associated with pre-main-sequence objects. The most striking is associated with the near-IR source IRS 7 and shows a complex structure comprising two strong pointlike sources positioned either side of the deeply embedded IR source and two extended lobes of radio emission. The IRS 7 radio source appears to be similar to that associated with Lynds 1551 IRS 5 but has a considerably larger angular size. The other detected sources include the massive pre-main-sequence star TY CrA, the near-IR sources IRS 1 and IRS 5, and the Herbig-Haro object HH 101. The stars R and T CrA were not detected. 35 references

Decomposition of Phragmites australis litter retarded by invasive Solidago canadensis in mixtures: an antagonistic non-additive effect

OpenAIRE

Zhang, Ling; Zhang, Yaojun; Zou, Jianwen; Siemann, Evan

2014-01-01

Solidago canadensis is an aggressive invader in China. Solidago invasion success is partially attributed to allelopathic compounds release and more benefits from AM fungi, which potentially makes the properties of Solidago litter different from co-occurring natives. These properties may comprehensively affect litter decomposition of co-occurring natives. We conducted a field experiment to examine litter mixing effects in a Phragmites australis dominated community invaded by Solidago in southe...

Uptake and Bioaccumulation of Pentachlorophenol by Emergent Wetland Plant Phragmites australis (Common Reed) in Cadmium Co-contaminated Soil.

Science.gov (United States)

Hechmi, Nejla; Ben Aissa, Nadhira; Abdenaceur, Hassen; Jedidi, Naceur

2015-01-01

Despite many studies on phytoremediation of soils contaminated with either heavy metals or organics, little information is available on the effectiveness of phytoremediation of co-occurring metal and organic pollutants especially by using wetland species. Phragmites australis is a common wetland plant and its potential for phytoremediation of cadmium pentachlorophenol (Cd-PCP) co-contaminated soil was investigated. A greenhouse study was executed to elucidate the effects of Cd (0, 10, and 20 mg kg(-1)) without or with PCP (0, 50, and 250 mg kg(-1)) on the growth of the wetland plant P. australis and its uptake, accumulation and removal of pollutant from soils. After 75 days, plant biomass was significantly influenced by interaction of Cd and PCP and the effect of Cd on plant growth being stronger than that of PCP. Coexistence of PCP at low level lessened Cd toxicity to plants, resulting in improved plant growth and increased Cd accumulation in plant tissues. The dissipation of PCP in soils was significantly influenced by interactions of Cd, PCP and plant presence or absence. As an evaluation of soil biological activities after remediation soil enzyme was measured.

Early successional stages of reed Phragmites australis vegetations and its importance for the Bearded Reedling Panurus biarmicus in Oostvaardersplassen, The Netherlands

NARCIS (Netherlands)

Beemster, Nico; Troost, Els; Platteeuw, Maarten

2010-01-01

A study on Bearded Reed ling Panurus biarmicus feeding habits in combination with a sample-wise breeding bird survey of the marshland zones of the Dutch wetland Oostvaardersplassen shows clear-cut spatial differences in densities and habitat use. The more mature stands of Reed Phragmites australis

The effect of kauri (Agathis australis) on grain size distribution and clay mineralogy of andesitic soils in the Waitakere Ranges, New Zealand

NARCIS (Netherlands)

Jongkind, A.G.; Buurman, P.

2006-01-01

Kauri (Agathis australis) is generally associated with intense podzolisation, but little research has been carried out to substantiate this. We studied soil profiles, grain size distribution patterns and clay mineralogy under kauri and broadleaf/tree fern vegetation in the Waitakere Ranges, North

The Spitzer survey of interstellar clouds in the Gould Belt. III. A multi-wavelength view of Corona Australis

DEFF Research Database (Denmark)

Peterson, Dawn E.; Caratti o Garatti, Alessio; Bourke, Tyler L.

2011-01-01

We present Spitzer Space Telescope IRAC and MIPS observations of a 0.85 deg2 field including the Corona Australis (CrA) star-forming region. At a distance of 130 pc, CrA is one of the closest regions known to be actively forming stars, particularly within its embedded association, the Coronet. Us...

Role of solid-phase microextraction in the identification of highly volatile pheromones of two Rhinoceros beetles Scapanes australis and Strategus aloeus (Coleoptera, Scarabaeidae, Dynastinae).

Science.gov (United States)

Rochat, D; Ramirez-Lucas, P; Malosse, C; Aldana, R; Kakul, T; Morin, J P

2000-07-14

Solid-phase microextraction (SPME) samplings from live insects or natural secretion allowed one to identify the aggregation pheromones of the pest beetles Scapanes australis and Strategus aloeus by efficient and rapid isolation of their highly volatile (72 < M(r) < 116) components. S. australis male pheromone was identified as a 84:12:4 (w/w) mixture of 2-butanol [67:33 (R)-(-):(S)-(+) ratio], 3-hydroxy-2-butanone and 2,3-butanediol [43:17:40 (R,R)-(-):(S,S)-(+):meso ratio], and S. aloeus pheromone as a 95.5:4.0:0.5 (w/w) mixture of 2-butanone, 3-pentanone and sec.-butyl acetate by GC-MS using conventional and chiral capillary columns. This is the first report of Scarabaeidae pheromones based on such small and common molecules.

Uptake of inorganic phosphorus by the aquatic plant Isoetes australis inhabiting oligotrophic vernal rock pools

DEFF Research Database (Denmark)

Christiansen, Nina Høj; Pulido, Cristina; Pedersen, Ole

2017-01-01

The submerged aquatic freshwater macrophyte Isoetes australis S. Williams grows in rock pools situated in south-western Australia, an environment where dissolved inorganic phosphorus (Pi) availability possibly limits growth. In contrast to the two coexisting aquatic species, Glossostigma drummundii...... experiment revealed high amounts of Pi translocation internally in the plant which seemed to go from roots and oldest leaves to younger leaves. As a result of the high root to shoot ratio, high surface area, root uptake kinetics, and sediment Pi availability, roots accounted for 87% of plant Pi uptake...

Short-term and long-term effects of tannins on nitrogen mineralisation and litter decomposition in kauri (Agathis australis (D. Don) Lindl.) forests

NARCIS (Netherlands)

Verkaik, E.; Jongkind, A.G.; Berendse, F.

2006-01-01

Kauri (Agathis australis (D. Don) Lindl.) occurs naturally in the warm temperate forest of northern New Zealand where it grows mixed with angiosperm tree species. Below mature kauri trees thick organic layers develop in which large amounts of nitrogen are accumulated. This nitrogen seems to be

The parasitic plant Cuscuta australis is highly insensitive to abscisic acid-induced suppression of hypocotyl elongation and seed germination.

Science.gov (United States)

Li, Juan; Hettenhausen, Christian; Sun, Guiling; Zhuang, Huifu; Li, Jian-Hong; Wu, Jianqiang

2015-01-01

Around 1% of angiosperms are parasitic plants. Their growth and development solely or partly depend on host plants from which they extract water, nutrients, and other molecules using a parasitic plant-specific organ, the haustorium. Strong depletion of nutrients can result in serious growth retardation and in some cases, death of the hosts. The genus Cuscuta (dodder) comprises about 200 holoparasitic species occurring on all continents. Their seedlings have no roots and cotyledons but are only string-like hypocotyls. When they contact suitable host plants, haustoria are formed and thereafter seedlings rapidly develop into vigorously growing branches without roots and leaves. This highly specialized lifestyle suggests that Cuscuta plants likely have unique physiology in development and stress responses. Using germination and seedling growth assays, we show that C. australis seeds and seedlings are highly insensitive to abscisic acid (ABA). Transcriptome analysis and protein sequence alignment with Arabidopsis, tomato, and rice homologs revealed that C. australis most likely consists of only four functional ABA receptors. Given that Cuscuta plants are no longer severely challenged by drought stress, we hypothesize that the ABA-mediated drought resistance pathway in Cuscuta spp. might have had degenerated over time during evolution.

The parasitic plant Cuscuta australis is highly insensitive to abscisic acid-induced suppression of hypocotyl elongation and seed germination.

Directory of Open Access Journals (Sweden)

Juan Li

Full Text Available Around 1% of angiosperms are parasitic plants. Their growth and development solely or partly depend on host plants from which they extract water, nutrients, and other molecules using a parasitic plant-specific organ, the haustorium. Strong depletion of nutrients can result in serious growth retardation and in some cases, death of the hosts. The genus Cuscuta (dodder comprises about 200 holoparasitic species occurring on all continents. Their seedlings have no roots and cotyledons but are only string-like hypocotyls. When they contact suitable host plants, haustoria are formed and thereafter seedlings rapidly develop into vigorously growing branches without roots and leaves. This highly specialized lifestyle suggests that Cuscuta plants likely have unique physiology in development and stress responses. Using germination and seedling growth assays, we show that C. australis seeds and seedlings are highly insensitive to abscisic acid (ABA. Transcriptome analysis and protein sequence alignment with Arabidopsis, tomato, and rice homologs revealed that C. australis most likely consists of only four functional ABA receptors. Given that Cuscuta plants are no longer severely challenged by drought stress, we hypothesize that the ABA-mediated drought resistance pathway in Cuscuta spp. might have had degenerated over time during evolution.

Egg discrimination in the Australian reed warbler (Acrocephalus australis) : rejection response toward model and conspecific eggs depending on timing and mode of artificial parasitism

NARCIS (Netherlands)

Welbergen, J; Komdeur, J; Kats, R; Berg, M

2001-01-01

In a coevolutionary arms race between an interspecific brood parasite and its host species, bath are expected to evolve adaptations and counteradaptations. We studied egg discrimination in the Australian warbler (Acrocephalus australis). This species is currently not significantly parasitized by the

Decomposition of Phragmites australis rhizomes in artificial land-water transitional zones (ALWTZs) and management implications

Science.gov (United States)

Han, Zhen; Cui, Baoshan; Zhang, Yongtao

2015-09-01

Rhizomes are essential organs for growth and expansion of Phragmites australis. They function as an important source of organic matter and as a nutrient source, especially in the artificial land-water transitional zones (ALWTZs) of shallow lakes. In this study, decomposition experiments on 1- to 6-year-old P. australis rhizomes were conducted in the ALWTZ of Lake Baiyangdian to evaluate the contribution of the rhizomes to organic matter accumulation and nutrient release. Mass loss and changes in nutrient content were measured after 3, 7, 15, 30, 60, 90, 120, and 180 days. The decomposition process was modeled with a composite exponential model. The Pearson correlation analysis was used to analyze the relationships between mass loss and litter quality factors. A multiple stepwise regression model was utilized to determine the dominant factors that affect mass loss. Results showed that the decomposition rates in water were significantly higher than those in soil for 1- to 6-year-old rhizomes. However, the sequence of decomposition rates was identical in both water and soil. Significant relationships between mass loss and litter quality factors were observed at a later stage, and P-related factors proved to have a more significant impact than N-related factors on mass loss. According to multiple stepwise models, the C/P ratio was found to be the dominant factor affecting the mass loss in water, and the C/N and C/P ratios were the main factors affecting the mass loss in soil. The combined effects of harvesting, ditch broadening, and control of water depth should be considered for lake administrators.

CO2 and CH4 exchange by Phragmites australis under different climates

Science.gov (United States)

Serrano Ortiz, Penélope; Chojnickic, Bogdan H.; Sánchez-Cañete, Enrique P.; Kowalska, Natalia; López-Ballesteros, Ana; Fernández, Néstor; Urbaniak, Marek; Olejnik, Janusz; Kowalski, Andrew S.

2015-04-01

The key role of wetlands regarding global warming is the resulting balance between net CO2 assimilation, via photosynthesis, and CO2 and CH4 emissions, given the potential to release stored carbon, because of the high temperature sensitivity of heterotrophic soil respiration and anoxic conditions. However, it is still unknown whether wetlands will convert from long-term carbon sinks to sources as a result of climate change and other anthropogenic effects such as land use changes. Phragmites australis is one of the most common species found in wetlands and is considered the most globally widespread and productive plant species in this type of ecosystem. In this context, the main objective of this study is to analyse the GHG exchange (CO2 and CH4) of two wetlands with Phragmites australis as the dominant species under different climates using the eddy covariance (EC) technique. The first site, Padul, is located in southern Spain, with a sub-humid warm climate, characterised by a mean annual temperature of 16°C and annual precipitation of ca. 470 mm, with a very dry summer. The second site, Rzecin is located in Poland with a mean annual temperature of 8°C, and annual precipitation around 600mm with no dry season. The Padul EC station is equipped with two infrared gas analysers to measure CO2 and CH4 fluxes (LI-7200 and LI-7700 respectively) while the Rzecin EC station has the same CH4 sensor as Padul, but also a sensor measuring both GHG fluxes (DLT-100 Fast Methane Analyser, Los Gatos). In this study, we present: i) the results of a CH4 analyser inter-comparison campaign (LI-7700 vs. Los Gatos), ii) a comparative analysis of the functional behaviour of respiration and photosynthesis in both sites testing relationships between CO2 fluxes measured with the EC technique and meteorological variables such as temperature and direct or diffuse radiation and iii) the CH4 dynamicsat both sites by identifying, when possible, annual, seasonal and diurnal patterns.

Preparation and Adsorption Performances of Phragmites australis Activated Carbon with High Acidity

Directory of Open Access Journals (Sweden)

FU Cheng-kai

2017-03-01

Full Text Available For removal of heavy metals from wastewater and recycling the wetland plants, the present study investigated the viability of using silage of Phragmites australis (PA to prepare activated carbons (ACs with high acidity. BET surface area, porous texture and surface functional characteristics of ACs were analyzed by N2 adsorption/desorption, elemental analysis and Boehm titration method. ACs presented well-developed micro-porosity and favorable surface acidity. The sorption equilibrium data for Ni (Ⅱ and Cd (Ⅱ sorption onto ACs were analyzed by the Langmuir and Freundlich models. The Langmuir model was fitted well to the adsorption behavior. The properties of high surface acidity promoted the adsorption of heavy metals by the silage-treated ACs and the chemical sorption played the key role in the sorption process.

Bioinformatic prediction of G protein-coupled receptor encoding sequences from the transcriptome of the foreleg, including the Haller's organ, of the cattle tick, Rhipicephalus australis.

Directory of Open Access Journals (Sweden)

Sergio Munoz

Full Text Available The cattle tick of Australia, Rhipicephalus australis, is a vector for microbial parasites that cause serious bovine diseases. The Haller's organ, located in the tick's forelegs, is crucial for host detection and mating. To facilitate the development of new technologies for better control of this agricultural pest, we aimed to sequence and annotate the transcriptome of the R. australis forelegs and associated tissues, including the Haller's organ. As G protein-coupled receptors (GPCRs are an important family of eukaryotic proteins studied as pharmaceutical targets in humans, we prioritized the identification and classification of the GPCRs expressed in the foreleg tissues. The two forelegs from adult R. australis were excised, RNA extracted, and pyrosequenced with 454 technology. Reads were assembled into unigenes and annotated by sequence similarity. Python scripts were written to find open reading frames (ORFs from each unigene. These ORFs were analyzed by different GPCR prediction approaches based on sequence alignments, support vector machines, hidden Markov models, and principal component analysis. GPCRs consistently predicted by multiple methods were further studied by phylogenetic analysis and 3D homology modeling. From 4,782 assembled unigenes, 40,907 possible ORFs were predicted. Using Blastp, Pfam, GPCRpred, TMHMM, and PCA-GPCR, a basic set of 46 GPCR candidates were compiled and a phylogenetic tree was constructed. With further screening of tertiary structures predicted by RaptorX, 6 likely GPCRs emerged and the strongest candidate was classified by PCA-GPCR to be a GABAB receptor.

BOOK REVIEW: European Perceptions of Terra Australis

Science.gov (United States)

Sterken, Christiaan

2012-12-01

Terra Australis - the southern land - has been one of the most widespread concepts in European geography from the sixteenth to the eighteenth century. This book comprises a set of 14 interdisciplinary scholarly contributions that deal with personal perceptions of Terra Australis by cartographers and explorers, and with putting these perceptions in their historical and cultural environments. This book seems, at a first glance, to be very remote from astronomy - and even from the history of astronomy - however, as it also offers an excellent background to Captain James Cook's second voyage to observe the 1769 transit of Venus from Tahiti, it definitely is a work of truly interdisciplinary character. Cook's voyages, in fact, became a model in which key scientists of many nationalities and disciplines traveled together on ships. In these voyages, art, science, technology and political power were centralised and united. The chapters range across history, the visual arts, literature, popular culture, technology, politics and science. Issues of scientific reasoning are raised in the description of how people did think about the south before there even existed a perception of the unknown land - quite comparable to how ancient and early-modern astronomers had their thought about cosmology even before any observational data were available. Several early map systems - like the zonal and T-O maps (medieval world maps with the letter T inside an O representing the lands inside a circle of oceans) - are described, and the description of Roman geography shows the amazing fact that theory and practice were not unified, and existed independently of each other insofar that a real paradox between theory and observation had persisted for a very long time. The maps and charts also exemplify the long-lasting consequences of early modern copy-paste practice: navigators copied original sketch charts of coasts that were previously unknown to them, herewith committing many translation and

Die-back of Phragmites australis in European wetlands: an overview of the European Research Programme on Reed Die-Back and Progression (1993-1994)

NARCIS (Netherlands)

Van der Putten, W.H.

1997-01-01

Reed (Phragmites australis (Cav.) Trin. ex Steudel) is one of the dominant plant species in European land-water ecotones. During the past decades reed belts have died back, especially in central and eastern Europe. The aim of the European Research Programme on Reed Die-back and Progression (EUREED),

Root parasitic plant Orobanche aegyptiaca and shoot parasitic plant Cuscuta australis obtained Brassicaceae-specific strictosidine synthase-like genes by horizontal gene transfer.

Science.gov (United States)

Zhang, Dale; Qi, Jinfeng; Yue, Jipei; Huang, Jinling; Sun, Ting; Li, Suoping; Wen, Jian-Fan; Hettenhausen, Christian; Wu, Jinsong; Wang, Lei; Zhuang, Huifu; Wu, Jianqiang; Sun, Guiling

2014-01-13

Besides gene duplication and de novo gene generation, horizontal gene transfer (HGT) is another important way of acquiring new genes. HGT may endow the recipients with novel phenotypic traits that are important for species evolution and adaption to new ecological niches. Parasitic systems expectedly allow the occurrence of HGT at relatively high frequencies due to their long-term physical contact. In plants, a number of HGT events have been reported between the organelles of parasites and the hosts, but HGT between host and parasite nuclear genomes has rarely been found. A thorough transcriptome screening revealed that a strictosidine synthase-like (SSL) gene in the root parasitic plant Orobanche aegyptiaca and the shoot parasitic plant Cuscuta australis showed much higher sequence similarities with those in Brassicaceae than with those in their close relatives, suggesting independent gene horizontal transfer events from Brassicaceae to these parasites. These findings were strongly supported by phylogenetic analysis and their identical unique amino acid residues and deletions. Intriguingly, the nucleus-located SSL genes in Brassicaceae belonged to a new member of SSL gene family, which were originated from gene duplication. The presence of introns indicated that the transfer occurred directly by DNA integration in both parasites. Furthermore, positive selection was detected in the foreign SSL gene in O. aegyptiaca but not in C. australis. The expression of the foreign SSL genes in these two parasitic plants was detected in multiple development stages and tissues, and the foreign SSL gene was induced after wounding treatment in C. australis stems. These data imply that the foreign genes may still retain certain functions in the recipient species. Our study strongly supports that parasitic plants can gain novel nuclear genes from distantly related host species by HGT and the foreign genes may execute certain functions in the new hosts.

Osmotic and ionic effects of NaCl and Na₂SO₄ salinity on Phragmites australis

DEFF Research Database (Denmark)

Pagter, Majken; Bragato, Claudia; Malagoli, Mario

2009-01-01

Osmotic and ion-specific effects of NaCl and Na2SO4 on Phragmites australis (Cav.) Trin ex. Steud. were investigated in a laboratory experiment by examining effects of iso-osmotic solutions of NaCl and Na2SO4 on growth, osmolality of cell sap, proline content, elemental composition and gas exchange....... Plants were supplied with a control standard nutrient solution (Ψ = -0.09 MPa) or solutions of NaCl or Na2SO4 at water potentials of -0.50, -1.09 or -1.74 MPa. Salt treatments increased root concentrations of Na and S or Cl, whereas P. australis had efficient mechanisms for exclusion of Na and S...... and partly Cl ions from the leaves. Incomplete exclusion of Cl from the leaves may affect aboveground biomass production, which was significantly more reduced by NaCl than Na2SO4. Stomatal conductance was negatively influenced by decreasing water potentials caused by NaCl or Na2SO4, implying that a non...

Characterization and structural analysis of a potent anticoagulant phospholipase A2 from Pseudechis australis snake venom.

Science.gov (United States)

Du, Qianyun Sharon; Trabi, Manuela; Richards, Renée Stirling; Mirtschin, Peter; Madaras, Frank; Nouwens, Amanda; Zhao, Kong-Nan; de Jersey, John; Lavin, Martin F; Guddat, Luke W; Masci, Paul P

2016-03-01

Pseudechis australis is one of the most venomous and lethal snakes in Australia. Numerous phospholipase A2 (PLA2) isoforms constitute a major portion of its venom, some of which have previously been shown to exhibit not only enzymatic, but also haemolytic, neurotoxic and anticoagulant activities. Here, we have purified a potent anticoagulant PLA2 (identified as PA11) from P. australis venom to investigate its phospholipase, anticoagulant, haemolytic and cytotoxic activities and shown that addition of 11 nM PA11 resulted in a doubling of the clotting time of recalcified whole blood. We have also demonstrated that PA11 has high PLA2 enzymatic activity (10.9 × 10(4) Units/mg), but low haemolytic activity (0.6% of red blood cells hydrolysed in the presence of 1 nM PA11). PA11 at a concentration lower than 600 nM is not cytotoxic towards human cultured cells. Chemical modification experiments using p-bromophenacyl bromide have provided evidence that the catalytic histidine of PA11 is critical for the anticoagulant activity of this PLA2. PA11 that was subjected to trypsin digestion without previous reduction and alkylation of the disulfide bonds maintained enzymatic and anticoagulant activity, suggesting that proteolysis alone cannot abolish these properties. Consistent with these results, administration of PA11 by gavage in a rabbit stasis thrombosis model increased the clotting time of recalcified citrated whole blood by a factor of four. These data suggest that PA11 has potential to be developed as an anticoagulant in a clinical setting. Copyright © 2015. Published by Elsevier Ltd.

Metazoan parasites of Brama australis from southern Chile: a tool for stock discrimination?

Science.gov (United States)

Oliva, M E; Espinola, J F; Ñacari, L A

2016-03-01

The metazoan parasites of 403 specimens of the southern ray's bream Brama australis from three localities in southern Chile (Lebu 36° 70' S; 73° 40' W, Calbuco 41° 50' S; 73° 08' W and Punta Arenas 53° 10' S; 70° 50' W) were recorded. More than 23 400 parasite specimens belonging to 12 taxa were registered. Metazoan parasites were dominated by the copepod Hatschekia conifera, constituting 97% of the total number of parasites; the larval cestode Hepatoxylon trichiuri was the second most important parasite (2·1% of the total number of parasites). The remaining 10 species constituted parasites. Parasitological evidence, based on univariate and multivariate analysis, does not support the existence of discrete stocks in the studied zone. © 2016 The Fisheries Society of the British Isles.

Human consumption of a vagrant South American Fur Seal Arctocephalus australis (Carnivora: Otariidae in Brazil

Directory of Open Access Journals (Sweden)

S. Siciliano

2016-04-01

Full Text Available The South American Fur Seal Arctocephalus australis is one of the most widely distributed South American otariid species. In Brazil, during austral winter months specimens of A. australis are regularly found along the Rio Grande do Sul and Santa Catarina coasts. Occasionally, vagrants have been recorded along the southeastern coast but rarely moves north of Rio de Janeiro, at 23°S. On 01 May 2015, fishermen noticed in the surf zone an unidentified large animal in Ilhéus, Bahia, northeastern Brazil. Severely wounded, it was still alive when first spotted. Numerous shark bites were observed in the rostrum and flippers, the peduncle was severely lacerated and the intestines were protruding. The specimen was identified as an adult of South American Fur Seal based on the combination of the characteristic coloration of the pelage, head shape, body size, the relatively large eye size, and mainly due to the pronounced three cusped teeth in post canines. Fishermen decided to butcher the carcass and share the meat among their companions. The present record, however, is of special concern as human consumption South American Fur Seal seems to be unusual in Brazil. Pieces of meat were shared among fishermen. In addition, small pieces of blubber were used as bait in the local shark long-line fishery. Consumption of an injured and presumably weak marine mammal carcass points to an increasing risk of contact between potentially harmful viruses, bacteria and fungi and humans. This note represents an alert to public health specialists and wildlife authorities in Brazil. It calls the urgency of an outreach campaign advertising to the potential risks of ingesting bushmeat either from land or aquatic sources. 

Caracterización estructural de un bosque de Podocarpus parlatorei y Juglans australis en Salta, Argentina

Directory of Open Access Journals (Sweden)

M.A. Pinazo

2003-06-01

Full Text Available Se estudió la estructura de bosques montanos ubicados en áreas con distinto grado de modificación humana en el Noroeste de Argentina (22º24’ S, 1550 msnm. Se utilizaron parcelas circulares para caracterizar los rodales. Los rodales fueron clasificados en función del área basal por especie. Se reconocieron cinco estructuras diferenciadas por la proporción de Juglans australis, Podocarpus parlatorei y de las especies tolerantes a la sombra Blepharocalyx salicifolius, Myrcianthes sp y Allophylus edulis. Se presentan datos de densidad y área basal de individuos con diámetro a la altura del pecho (DAP> 10 cm y la densidad de individuos con DAPStands of Subtropical Montane Cloud Forest were studied in areas under different land use regimes near Los Toldos (NW Argentina. Circular plots were used to calculate density and basal area of trees with dbh > 10 cm; and density of trees with dbh < 10 cm. The stands were classified and grouped as a function of basal area. Five structures were recognized, with different proportions of Juglans australis, Podocarpus parlatorei and shade-tolerant species like Blepharocalyx salicifolius, Allophylus edulis and Myrcianthes sp. Less disturbed area stands had a higher basal area and greater dbh for all species, and shade-tolerant species in the canopy. In the most disturbed area, all canopy species were shade intolerant and regeneration was dominated by shade-tolerant species. The differences in composition, basal area, stem diameter class distribution and regeneration indicate that the structure types corresponded to different stages of the successional process, and the regeneration of the most disturbed areas suggest a tendency towards the composition of mature forest.

Transcriptome and Degradome of microRNAs and Their Targets in Response to Drought Stress in the Plants of a Diploid and Its Autotetraploid Paulownia australis.

Directory of Open Access Journals (Sweden)

Suyan Niu

Full Text Available MicroRNAs (miRNAs are small, non-coding RNAs that play vital roles in plant growth, development, and stress response. Increasing numbers of studies aimed at discovering miRNAs and analyzing their functions in plants are being reported. In this study, we investigated the effect of drought stress on the expression of miRNAs and their targets in plants of a diploid and derived autotetraploid Paulownia australis. Four small RNA (sRNA libraries and four degradome libraries were constructed from diploid and autotetraploid P. australis plants treated with either 75% or 25% relative soil water content. A total of 33 conserved and 104 novel miRNAs (processing precision value > 0.1 were identified, and 125 target genes were identified for 36 of the miRNAs by using the degradome sequencing. Among the identified miRNAs, 54 and 68 were differentially expressed in diploid and autotetraploid plants under drought stress (25% relative soil water content, respectively. The expressions of miRNAs and target genes were also validated by quantitative real-time PCR. The results showed that the relative expression trends of the randomly selected miRNAs were similar to the trends predicted by Illumina sequencing. And the correlations between miRNAs and their target genes were also analyzed. Furthermore, the functional analysis showed that most of these miRNAs and target genes were associated with plant development and environmental stress response. This study provided molecular evidence for the possible involvement of certain miRNAs in the drought response and/or tolerance in P. australis, and certain level of differential expression between diploid and autotetraploid plants.

DNA hybridization evidence for the Australasian affinity of the American marsupial Dromiciops australis.

Science.gov (United States)

Kirsch, J A; Dickerman, A W; Reig, O A; Springer, M S

1991-01-01

DNA hybridization was used to compare representatives of the major groups of marsupials and a eutherian outgroup. Because of the large genetic distances separating marsupial families, trees were calculated from normalized percentages of hybridization; thermal-melting statistics, however, gave identical topologies for the well-supported clades. The most notable results were the association of the only extant microbiotheriid, Dromiciops australis, an American marsupial, with the Australasian Diprotodontia, and of both together with the Dasyuridae. Estimates of the rate of divergence among marsupial genomes suggest that the Dromiciops-Diprotodontia split occurred approximately 50 million years ago, well after the establishment of the major clades of marsupials but before deep oceanic barriers prohibited dispersal among Australia, Antarctica, and South America. Because Dromiciops is nested within an Australasian group, it seems likely that dispersal from Australia accounts for its present distribution. Images PMID:1961710

Extracts from Cladiella australis, Clavularia viridis and Klyxum simplex (Soft Corals are Capable of Inhibiting the Growth of Human Oral Squamous Cell Carcinoma Cells

Directory of Open Access Journals (Sweden)

Guey-Horng Wang

2008-11-01

Full Text Available Many biomedical products have already been obtained from marine organisms. In order to search more therapeutic drugs against cancer, this study demonstrates the cytotoxicity effects of Cladiella australis, Clavularia viridis and Klyxum simplex extractson human oral squamous cell carcinoma (SCC4, SCC9 and SCC25 cells using cell adhesion and cell viability assay. The morphological alterations in SCCs cells after treatment with three extracts, such as typical nuclear condensation, nuclear fragmentation and apoptotic bodies of cells were demonstrated by Hoechst stain. Flow cytometry indicated that three extracts sensitized SCC25 cells in the G0/G1 and S-G2/M phases with a concomitant significantly increased sub-G1 fraction, indicating cell death by apoptosis. This apoptosis process was accompanied by activation of caspase-3 expression after SCC25 cells were treated with three extracts. Thereby, it is possible that extracts of C. australis, C. viridis and K. simplex cause apoptosis of SCCs and warrant further research investigating the possible anti-oral cancer compounds in these soft corals.

Proteomic analysis of blue light-induced twining response in Cuscuta australis.

Science.gov (United States)

Li, Dongxiao; Wang, Liangjiang; Yang, Xiaopo; Zhang, Guoguang; Chen, Liang

2010-01-01

The parasitic plant Cuscuta australis (dodder) invades a variety of species by entwining the stem and leaves of a host and developing haustoria. The twining response prior to haustoria formation is regarded as the first sign for dodders to parasitize host plants, and thus has been the focus of studies on the host-parasite interaction. However, the molecular mechanism is still poorly understood. In the present work, we have investigated the different effects of blue and white light on the twining response, and identified a set of proteins that were differentially expressed in dodder seedlings using a proteomic approach. Approximately 1,800 protein spots were detected on each 2-D gel, and 47 spots with increased or decreased protein levels were selected and analyzed with MALDI-TOF-MS. Peptide mass fingerprints (PMFs) obtained for these spots were used for protein identification through cross-species database searches. The results suggest that the blue light-induced twining response in dodder seedlings may be mediated by proteins involved in light signal transduction, cell wall degradation, cell structure, and metabolism.

Molecular phylogeny and taxonomic revision of the genus Wittrockiella (Pithophoraceae, Cladophorales), including the descriptions of W. australis sp. nov. and W. zosterae sp. nov.

Science.gov (United States)

Boedeker, Christian; O'Kelly, Charles J; West, John A; Hanyuda, Takeaki; Neale, Adele; Wakana, Isamu; Wilcox, Mike D; Karsten, Ulf; Zuccarello, Giuseppe C

2017-06-01

Wittrockiella is a small genus of filamentous green algae that occurs in habitats with reduced or fluctuating salinities. Many aspects of the basic biology of these algae are still unknown and the phylogenetic relationships within the genus have not been fully explored. We provide a phylogeny based on three ribosomal markers (ITS, LSU, and SSU rDNA) of the genus, including broad intraspecific sampling for W. lyallii and W. salina, recommendations for the use of existing names are made, and highlight aspects of their physiology and life cycle. Molecular data indicate that there are five species of Wittrockiella. Two new species, W. australis and W. zosterae, are described, both are endophytes. Although W. lyallii and W. salina can be identified morphologically, there are no diagnostic morphological characters to distinguish between W. amphibia, W. australis, and W. zosterae. A range of low molecular weight carbohydrates were analyzed but proved to not be taxonomically informative. The distribution range of W. salina is extended to the Northern Hemisphere as this species has been found in brackish lakes in Japan. Furthermore, it is shown that there are no grounds to recognize W. salina var. kraftii, which was described as an endemic variety from a freshwater habitat on Lord Howe Island, Australia. Culture experiments indicate that W. australis has a preference for growth in lower salinities over full seawater. For W. amphibia and W. zosterae, sexual reproduction is documented, and the split of these species is possibly attributable to polyploidization. © 2017 Phycological Society of America.

Pharmacokinetics and pharmacodynamics of the myotoxic venom of Pseudechis australis (mulga snake) in the anesthetised rat.

Science.gov (United States)

Hart, A J; Hodgson, W C; O'Leary, M; Isbister, G K

2014-07-01

Myotoxicity is a common clinical effect of snake envenoming and results from either local or systemic myotoxins in snake venoms. Although numerous myotoxins have been isolated from snake venoms, there has been limited study on the relationship between the time course of venom concentrations (pharmacokinetics) and the time course of muscle injury measured as a rise in creatine kinase (CK) (pharmacodynamics). The aim of this study was to develop an in vivo model of myotoxicity to investigate the time course of myotoxicity and the effect of antivenom. Anesthetised rats were administered Pseudechis australis (mulga snake) venom either through i.v., i.m. or s.d. route, including a range of doses (5-100 μg/kg). Serial blood samples were collected for measurement of venom using enzyme immunoassay and measurement of CK and creatinine. Antivenom was administered before, 1 and 6 h after venom administration to investigate its effect on muscle injury. Plots of venom and CK versus time were made and the area under the curve (AUC) was calculated. There was a significant dose-dependent increase in CK concentration after administration of P. australis venom, which was greatest for i.v. administration. Timed measurement of venom concentrations showed a rapid absorption through s.d. and i.m. routes and a delayed rise in CK concentrations following any route. Antivenom prevented myotoxicity shown by a decrease in the CK AUC, which was most effective if given earliest. There was a rise in creatinine following i.v. venom administration. The study shows the delayed relationship between venom absorption and the rise in CK, consistent with the delayed onset of myotoxicity in human envenoming. Antivenom prevented myotoxicity more effectively if given earlier.

Otolith shape analysis as a tool for stock identification of the southern blue whiting, Micromesistius australis

Directory of Open Access Journals (Sweden)

Javier Leguá

2013-07-01

Full Text Available The southern blue whiting, Micromesistius australis (Norman, 1937, is an important demersal resource associated with the slope and continental shelf of southern Chile, Argentina and the Malvinas/Falkland Islands. Recent studies have reported schools of adult fish from Atlantic waters migrating along the southern Chilean coast in mid-winter, moving northwards to spawn in August (47°-51°S, and then returning to Atlantic waters, presumably to feed. The migratory pattern suggests the presence of one or more stock units associated with the South American coast. In the present study, "otolith morphometry" is used to determine the stock structure of M. australis based on applications of basic size descriptors (SDs (area, perimeter and otolith size, shape indices (SIs (circularity, squareness, shape factor, roundness, ellipticity, and normalised elliptical Fourier descriptors (NEFDs. Samples were collected during the winter and spring of 2010, during the reproductive period, in the economic zone of southern Chile (36°-57°S, in the Pacific Ocean and around the Falkland Islands economic zone (50°-52°S in the Atlantic Ocean. Analyses were conducted to include the effects of size, sex and age. A stepwise canonical discriminant analysis showed that fish were successfully discriminated with SDs, SIs and NEFDs. In this analysis, 86.4% and 70.1% of the fish were correctly classified as belonging to the Atlantic and Pacific stocks, respectively. A multivariate analysis of variance showed that the mean values of the NEFDs, SDs, and SIs did not vary significantly between sexes within areas (P > 0.05, but varied significantly between the Pacific and Atlantic oceans (P < 0.05. These results highlighted that otolith shape analysis can be a useful tool to evaluate the potential level of mixing in feeding areas where both stocks, the Pacific and Atlantic units, are expected to co-occur.

Akkumulation von L-Malat und D-Lactat in Arabidopsis thaliana und Laccase/HBT-vermittelte Delignifizierung von Spartina alterniflora und Phragmites australis

OpenAIRE

Heil, Alexander

2016-01-01

The current work contains two projects "Accumulation of L-malate and D-lactate in Arabidopsis thaliana" (A) "Laccase/HBT mediated delignification of Spartina alterniflora and Phragmites australis" (B). In project A, L-malate and D-lactate accumulated in A. thaliana plants. The accumulation of L-malate is carried out by modification of the plant metabolism with the enzymes PEPC, MDH and the tonoplast dicarboxylate transporter (TDT). Gene pepci2 (Hydrilla verticillata), mdh5 (Zea mays) and tdt ...

Changes in soluble metal concentrations induced by variable water table levels as response to liming and Phragmites australis growth in metal-polluted wetland soils: Management effectiveness

NARCIS (Netherlands)

Gonzalez Alcaraz, M.N.; van Gestel, C.A.M.

2016-01-01

This study aimed to assess the effectiveness of liming and Phragmites australis growth for the management of metal-polluted wetland soils under fluctuating water table levels. Soil columns (20 cm in diameter and 60 cm high) were constructed with two soil types (pH ~ 6.4 and pH ~ 3.1) and four

Моrрhоlоgy of inflorescensce and bluming peculiarities of Baptisia australis (L. R.Br. (Fabaceae introduced in М.М. Grishko National Botanical Garden NAS of Ukraine

Directory of Open Access Journals (Sweden)

Vira G. Mikolajchuk

2014-04-01

Full Text Available The structure of inflorescence in Baptisia australis introduced in conditions of M.M. Grishko National Botanical Garden in Kyiv has been studied. The dynamics of blooming and inflorescence development were analyzed.

Submillimeter Spectroscopy of the R Coronae Australis Molecular Cloud Region

Science.gov (United States)

Dunn, Marina Madeline; Walker, Christopher K.; Pat, Terrance; Sirsi, Siddhartha; Swift, Brandon J.; Peters, William L.

2018-01-01

The Interstellar Medium is comprised of large amounts of gas and dust which coalesce to form stars. Observing in the Terahertz regime of the electromagnetic spectrum, approximately 0.3 -300 microns, allows astronomers to study the ISM in unprecedented detail. Using the high spectral resolution imaging system of the SuperCam receiver, a 64-pixel array previously installed on the Submillimeter Telescope on Mt. Graham, AZ, we have begun a 500 square degree survey of the galactic plane. This instrument was designed to do a complete survey of the Milky Way from the ground, with the main focus being to observe two specific transitions of the carbon monoxide molecule, 12CO(3-2) and 13CO(3-2), at 345 GHz. In this work, we present results from these observations for the R Coronae Australis (R Cr A) complex, a region in the southern hemisphere of the sky, using spectroscopic data from a portion of the survey to gain better insight into the life cycle of the ISM. The majority of stars being formed here are similar to the stellar class of the Sun, making it an excellent area of observing interest. Using these results, we attempt to better ascertain the large-scale structure and kinematics inside of the molecular cloud.

A new dolphin species, the Burrunan Dolphin Tursiops australis sp. nov., endemic to southern Australian coastal waters.

Science.gov (United States)

Charlton-Robb, Kate; Gershwin, Lisa-ann; Thompson, Ross; Austin, Jeremy; Owen, Kylie; McKechnie, Stephen

2011-01-01

Small coastal dolphins endemic to south-eastern Australia have variously been assigned to described species Tursiops truncatus, T. aduncus or T. maugeanus; however the specific affinities of these animals is controversial and have recently been questioned. Historically 'the southern Australian Tursiops' was identified as unique and was formally named Tursiops maugeanus but was later synonymised with T. truncatus. Morphologically, these coastal dolphins share some characters with both aforementioned recognised Tursiops species, but they also possess unique characters not found in either. Recent mtDNA and microsatellite genetic evidence indicates deep evolutionary divergence between this dolphin and the two currently recognised Tursiops species. However, in accordance with the recommendations of the Workshop on Cetacean Systematics, and the Unified Species Concept the use of molecular evidence alone is inadequate for describing new species. Here we describe the macro-morphological, colouration and cranial characters of these animals, assess the available and new genetic data, and conclude that multiple lines of evidence clearly indicate a new species of dolphin. We demonstrate that the syntype material of T. maugeanus comprises two different species, one of which is the historical 'southern form of Tursiops' most similar to T. truncatus, and the other is representative of the new species and requires formal classification. These dolphins are here described as Tursiops australis sp. nov., with the common name of 'Burrunan Dolphin' following Australian aboriginal narrative. The recognition of T. australis sp. nov. is particularly significant given the endemism of this new species to a small geographic region of southern and south-eastern Australia, where only two small resident populations in close proximity to a major urban and agricultural centre are known, giving them a high conservation value and making them susceptible to numerous anthropogenic threats.

A new dolphin species, the Burrunan Dolphin Tursiops australis sp. nov., endemic to southern Australian coastal waters.

Directory of Open Access Journals (Sweden)

Kate Charlton-Robb

Full Text Available Small coastal dolphins endemic to south-eastern Australia have variously been assigned to described species Tursiops truncatus, T. aduncus or T. maugeanus; however the specific affinities of these animals is controversial and have recently been questioned. Historically 'the southern Australian Tursiops' was identified as unique and was formally named Tursiops maugeanus but was later synonymised with T. truncatus. Morphologically, these coastal dolphins share some characters with both aforementioned recognised Tursiops species, but they also possess unique characters not found in either. Recent mtDNA and microsatellite genetic evidence indicates deep evolutionary divergence between this dolphin and the two currently recognised Tursiops species. However, in accordance with the recommendations of the Workshop on Cetacean Systematics, and the Unified Species Concept the use of molecular evidence alone is inadequate for describing new species. Here we describe the macro-morphological, colouration and cranial characters of these animals, assess the available and new genetic data, and conclude that multiple lines of evidence clearly indicate a new species of dolphin. We demonstrate that the syntype material of T. maugeanus comprises two different species, one of which is the historical 'southern form of Tursiops' most similar to T. truncatus, and the other is representative of the new species and requires formal classification. These dolphins are here described as Tursiops australis sp. nov., with the common name of 'Burrunan Dolphin' following Australian aboriginal narrative. The recognition of T. australis sp. nov. is particularly significant given the endemism of this new species to a small geographic region of southern and south-eastern Australia, where only two small resident populations in close proximity to a major urban and agricultural centre are known, giving them a high conservation value and making them susceptible to numerous anthropogenic

Carbon dioxide, temperature, salinity, and other variables collected via surface underway survey from Volunteer Observing Ship AURORA AUSTRALIS in the Southern Oceans (> 60 degrees South) from 1992-10-19 to 2001-12-12 (NODC Accession 0081031)

Data.gov (United States)

National Oceanic and Atmospheric Administration, Department of Commerce — Surface and Atmospheric fCO2 measurements in the Southern Ocean during the VOS Project line onboard the oceanographic ship Aurora Australis.

A comparison of the impact of 'seagrass-friendly' boat mooring systems on Posidonia australis.

Science.gov (United States)

Demers, Marie-Claire A; Davis, Andrew R; Knott, Nathan A

2013-02-01

Permanent boat moorings have contributed to the decline of seagrasses worldwide, prompting the development of 'seagrass-friendly' moorings. We contrasted seagrass cover and density (predominantly Posidonia australis) in the vicinity of three mooring types and nearby reference areas lacking moorings in Jervis Bay, Australia. We examined two types of 'seagrass-friendly' mooring and a conventional 'swing' mooring. 'Swing' moorings produced significant seagrass scour, denuding patches of ~9 m radius. Seagrass-friendly 'cyclone' moorings produced extensive denuded patches (average radius of ~18 m). Seagrass-friendly 'screw' moorings, conversely, had similar seagrass cover to nearby reference areas. Our findings reinforce previous work highlighting the negative effects of 'swing' and 'cyclone' moorings. In contrast, the previously unstudied 'screw' moorings were highly effective. We conclude that regular maintenance of moorings and the monitoring of surrounding seagrass are required to ensure that 'seagrass-friendly' moorings are operating effectively. This is important, as following damage Posidonia will take many decades to recover. Copyright © 2012 Elsevier Ltd. All rights reserved.

Echolocation in sympatric Peale's dolphins (Lagenorhynchus australis) and Commerson's dolphins (Cephalorhynchus commersonii) producing narrow-bandhigh-frequency clicks

DEFF Research Database (Denmark)

Kyhn, Line Anker; Jensen, Frants Havmand; Beedholm, Kristian

2010-01-01

-element hydrophone array from wild Peale's (Lagenorhynchus australis) and Commerson's (Cephalorhynchus commersonii) dolphins off the Falkland Islands. The centroid frequency was different between Commerson's (133±2kHz) and Peale's (129±3kHz) dolphins. The r.m.s. bandwidth was 12±3kHz for both species. The source...... level was higher for Peale's dolphin (185±6dB re 1 uPa p.-p.) than for Commerson's(177±5 dB re 1 uPa p.-p.). The mean directivity indexes were 25dB for both species. The relatively low source levels in combination with the high directivity index may be an adaptation to reduce clutter when foraging...

Micromamiferos andinos holocenicos del sitio arqueologico Inca Cueva 5, Ju Juy, Argentina: tafonomia, zoogeografia y reconstruccion paleoambiental

Directory of Open Access Journals (Sweden)

Ortiz, P. E.

2002-08-01

Full Text Available A micromammal archaeological sequence (2120 f 120 to 780 f 100 years BP from Inca Cueva 5 site (23" 05' S - 65" 27' W; 3700 m.a.s.l., Jujuy Province, Argentina was studied. The following mammalian taxa were recorded: Order Didelphimorphia, Family Didelphidae, Thylamys cf. T. pallidior; Order Rodentia, Family Muridae, Akodon cf. A. albiventer, Andinomys edax, Auliscomys sublimis, Calomys lepidus, Neotomys ebriosus, Phyllotis sp.; Family Caviidae, Cavia cf. C. tschudii, Galea musteloides; Family Abrocomidae, Abrocoma cinerea; Family Chinchillidae, Lagidium viscacia; Family Octodontidae, Octodontomys gliroides. The taphonomy indicates that the sequence is an owl pellet accumulation inside the cave. The general landscape corresponds to the oriental border of the Puna steppe, with scattered shrub and low brush vegetation. Near the site there are small tree groups of Polylepis australis as well as small streams covered with grass and ciperaceous vegetation known as «vegas». Al1 the recorded taxa at Inca Cueva 5 exist today in Puna and Prepuna environments from Jujuy and Salta Provinces and southem Bolivia, excepting Cavia cf. C. tschudii. The modem records of this species in northem Argentina and southern Bolivia come from localities with high montane bunchgrass prairies and forests of the humid Yungas phytogeographical region. The presence of this species in the sequence suggests wetter climatic conditions on this region when the archaeological site was originated. Later drier conditions, caused probably by anthropic influence in the last 500 years, produced the retraction of Cavia tschudii to the moist eastern side of the Andes and its disappeareance of the Puna areas.El sitio arqueológico Inca Cueva 5 se encuentra en la provincia de Jujuy, Argentina, en el borde oriental de la región de la Puna (23" 05' S - 65" 27' W; 3700 m s n m y está fechado entre 2120 f 120 y 780 f 100 años radiocarbónicos AP. El estudio de una pequeña muestra de

Mapping the change of Phragmites australis live biomass in the lower Mississippi River Delta marshes

Science.gov (United States)

Ramsey, Elijah W.; Rangoonwala, Amina

2017-07-28

Multiyear remote sensing mapping of the normalized difference vegetation index (NDVI) was carried out as an indicator of live biomass composition of the Phragmites australis (hereafter Phragmites) marsh in the lower Mississippi River Delta (hereafter delta) from 2014 to 2017. Maps of NDVI change showed that the Phragmites condition was fairly stable between May 2014 and July 2015. From July 2015 to April 2016 NDVI change indicated Phragmites suffered a widespread decline in the live biomass proportion.  Between April and September 2016, most marsh remained unchanged from the earlier period or showed improvement; although there were pockets of continued decline scattered throughout the lower delta. From September 2016 to May 2017 a pronounced and widely exhibited decline in the condition of Phragmites marsh again occurred throughout the lower delta. This final NDVI change mapping supported field observations of Phragmites decline during the same period.

Temperature, salinity and other variables collected from discrete sample and profile observations using CTD, bottle and other instruments from the AURORA AUSTRALIS in the Indian Ocean from 1991-09-25 to 1991-10-27 (NODC Accession 0116370)

Data.gov (United States)

National Oceanic and Atmospheric Administration, Department of Commerce — NODC Accession 0116370 includes chemical, discrete sample, physical and profile data collected from AURORA AUSTRALIS in the Indian Ocean from 1991-09-25 to...

Spot-on Treatments of Diflubenzuron and Permethrin to Control a Guinea Pig Louse, Gliricola Porcelli (Phthiraptera: Gyropidae)

Science.gov (United States)

Guinea pigs (Cavia porcellus (L.)) (Rodentia: Caviidae) are pets and laboratory animals. They can be infested by a chewing louse, Gliricola porcelli (Schrank) (Phthiraptera: Gyropidae), which is fairly common in some animal rearing facilities, pet stores, and on wild guinea pigs. Infestation with G....

Organização e arquitetura microscópica do sistema tegumentar do Lobo-marinho-sul-americano (Arctocephalus australis, Zimmermann, 1783)

OpenAIRE

Ana Paula da Silva

2008-01-01

O lobo-marinho-sul-americano (Arctocephalus australis) membro da Ordem Carnivora, é comumente visto nos períodos de outono e inverno na costa brasileira do Rio Grande do Sul até o Rio de Janeiro, porém, sem colônias reprodutivas estabelecidas. A espécie pertence ao grupo dos pinípedes, carnívoros com membros em forma de nadadeiras que vivem em ambiente aquático e terrestre. Estudos sobre a morfologia da pele em pinípedes são raros e antigos, destes procederam muitos relatos divergentes, em vi...

Activity of male pheromone of Melanesian rhinoceros beetle Scapanes australis.

Science.gov (United States)

Rochat, Didier; Morin, Jean-Paul; Kakul, Titus; Beaudoin-Ollivier, Laurence; Prior, Robert; Renou, Michel; Malosse, Isabelle; Stathers, Tanya; Embupa, Sebastian; Laup, Samson

2002-03-01

Laboratory and field investigations were carried out to investigate the nature and role of the male pheromone emitted by the Dynast beetle Scapanes australis and to develop a mass trapping technique against this major coconut pest in Papua New Guinea. We report the biological data obtained from natural and synthetic pheromone, previously described as an 84:12:4 (w/w) mixture of 2-butanol (1), 3-hydoxy-2-butanone (2), and 2,3-butanediol (3). EAG recordings from natural and synthetic pheromone and a pitfall olfactometer were poorly informative. In contrast, extensive field trapping trials with various synthetic pheromone mixtures and doses showed that 1 and 2 (formulated in polyethylene sachets in 90:5 v/v ratio) were necessary and sufficient for optimum long-range attraction. Beetles were captured in traps baited with racemic 1 plus 2, with or without a stereoisomer mixture of 3 (2.5- to 2500-mg/day doses). Plant pieces, either sugarcane or coconut, enhanced captures by the synthetic pheromone, which was active alone. Traps with the pheromone caught both sexes in a 3:2 female-male ratio. A pheromone-based mass trapping led to the capture of 2173 beetles in 14 traps surrounding 40 ha of a cocoa-coconut plantation. The captures followed a log-linear decrease during the 125-week trapping program. The role of the male pheromone and its potential for crop protection are discussed.

Single cell gel electrophoresis as a tool to assess genetic damage in Heleobia cf. australis (Mollusca: Gastropoda as sentinel for industrial and domestic pollution in Montevideo bay (Uruguay

Directory of Open Access Journals (Sweden)

Silvia Villar

2015-09-01

Full Text Available AbstractThe knowledge of the extent of DNA damage in aquatic organisms in polluted areas is an important issue because contamination may alter their health at sublethal levels. Although molluscs have been widely used to monitor water pollution, there are no records of in vivo genotoxicity studies. Heleobia cf. australis, is distributed in almost all Uruguayan coastal ecosystems, including highly polluted sites. The comet assay is a damage genetic biomarker based on the migration of negatively charged DNA fragments produced by mutagenic agents in individual cells. Live individuals were collected in the Montevideo Bay (impacted area and Laguna Garzón (control to analyze the presence of mutagenic agents in the former site through comet assay. Cells from organisms of the impacted area showed significantly higher levels of genetic damage than those obtained in the control population, measured by percentage of DNA in the tail. Although preliminary, this approach supports the idea that H. cf. australis could be used as a sentinel to evaluate the presence of mutagenic agents in estuarine environments, alerting to the impact of contamination in its early stages.

Can nutrient enrichment influence the invasion of Phragmites australis?

Science.gov (United States)

Uddin, Md Nazim; Robinson, Randall William

2018-02-01

Plant invasion and nutrient enrichment because of anthropogenic landscape modifications seriously threaten native plant community diversity in aquatic and wetland ecosystems. It is poorly understood, however, whether these two disturbances interact with the functional identity of recipient native plants to drive community change. We performed combined studies in the fields and greenhouse to examine whether nutrient enrichment may trigger the invasion of Phragmites australis in wetlands through competitive advantage over native Melaleuca ericifolia. Chemical characterizations of rhizosphere water were distinguished in two different nutrient enriched wetlands associated with and without Phragmites over the seasons. Significant changes in rhizosphere water were observed in invaded area compared to uninvaded area at both sites. High nitrogen (NO 3 - ), phosphorous (PO 4 3- ), dissolved organic carbon, phenolics contents, with low pH were found in invaded areas compared to uninvaded areas. Total biomass of Phragmites was positively regressed with rhizosphere water nitrogen (NO 3 - ) and phosphorous (PO 4 3- ) content. Nutrient addition significantly enhanced the growth and competitive ability of Phragmites over Melaleuca. In contrast, Melaleuca was significantly less competitive than Phragmites. There was a significantly positive correlation between the growth of Phragmites grown alone and its competitive ability. The findings in greenhouse studies coupled with characteristics of Phragmites and its' rhizosphere chemistry in the nutrient enriched fields suggest that nutrient enrichment may enhance Phragmites invasion through correspondingly increasing growth and maintaining inherent competitive advantages of Phragmites. Nutrient management could limit the vigorous growth of Phragmites in wetlands and thereby reduce invasion through competitive advantages over natives, which might have important management implications for wetland managers. Copyright © 2017. Published by

Nutritional, antioxidative, and antimicrobial analysis of the Mediterranean hackberry (Celtis australis L.).

Science.gov (United States)

Ota, Ajda; Višnjevec, Ana Miklavčič; Vidrih, Rajko; Prgomet, Željko; Nečemer, Marijan; Hribar, Janez; Cimerman, Nina Gunde; Možina, Sonja Smole; Bučar-Miklavčič, Milena; Ulrih, Nataša Poklar

2017-01-01

Celtis australis is a deciduous tree commonly known as Mediterranean hackberry or the European nettle tree. The fruit of hackberry are seldom used for nutritional purposes. The nutritional and physicochemical properties of ripe hackberry fruit from Istria (Marasi village near Vrsar, Croatia) were determined, including water, total fiber, protein, vitamin, mineral, and phenolic contents. This analysis demonstrates that the hackberry fruit is a valuable source of dietary fiber, protein, and vitamins, and of pigments such as lutein, β -carotene, zeaxanthin, and tocopherols. The seasonal differences associated with the different growth stages for the element composition, total phenolic content, and phenolic profile were also determined for hackberry mesocarp and leaves. Water and ethanol extracts were prepared from mesocarp and leaves harvested at different growth stages and their phenolic profiles and antioxidant and antimicrobial activities were investigated. This study demonstrates that water and ethanol extracts of hackberry fruit and leaves collected at different growth stages contain epicatechin, gallic acid, vanillic acid, 3,4-dihydroxybenzaldehyde, delphinidin-3,5-di-O-glucoside, cyanidin-3,5-di-O-glucoside, and pelargonidin-3,5-di-O-glucoside. They also show some antimicrobial and antifungal activities. Further studies are needed to identify and define the active ingredients of these hackberry leaf ethanol extracts.

The removal of heavy metals by iron mine drainage sludge and Phragmites australis

Science.gov (United States)

Hoang Ha, Nguyen Thi; Anh, Bui Thi Kim

2017-06-01

This study was conducted to assess the removal of heavy metals from solutions by the combination of modified iron mine drainage sludge (sorbent column) and surface and subsurface flow constructed wetlands using the common reed (Phragmites australis) during 30 days of experiment. The results of this study demonstrated that the average removal rates of Zn, Pb, Mn, and As by sorbent column were 59.0, 55.1, 38.7, and 42.4%, respectively. The decreasing trend of removal rates of metals by sorbent column was obtained during the experiment. The average removal rates of Zn, Pb, Mn, and As by sorbent column-surface constructed wetland were 78.9, 73.5, 91.2, and 80.5%, respectively; those by sorbent column-subsurface flow constructed wetland were 81.7, 81.1, 94.1, and 83.1% which reflected that subsurface flow constructed wetland showed higher removal rate than the surface system. Concentrations of heavy metals in the outlet water were lower than the Vietnamese standard limits regulated for industrial wastewater. The results indicate the feasibility of integration of iron mine drainage sludge and constructed wetlands for wastewater treatment.

Temperature, salinity and other variables collected from discrete sample and profile observations using CTD, bottle and other instruments from AURORA AUSTRALIS in the Indian Ocean and Southern Oceans from 1995-07-17 to 1995-09-02 (NCEI Accession 0144339)

Data.gov (United States)

National Oceanic and Atmospheric Administration, Department of Commerce — NCEI Accession 0144339 includes discrete sample and profile data collected from AURORA AUSTRALIS in the Indian Ocean and Southern Oceans (> 60 degrees South) from...

Crassulacean acid metabolism enhances underwater photosynthesis and diminishes photorespiration in the aquatic plant Isoetes australis

DEFF Research Database (Denmark)

Pedersen, Ole; Rich, S.M.; Pulido Pérez, Cristina

2011-01-01

Underwater photosynthesis by aquatic plants is often limited by low availability of CO2, and photorespiration can be high. Some aquatic plants utilize crassulacean acid metabolism (CAM) photosynthesis. The benefits of CAM for increased underwater photosynthesis and suppression of photorespiration...... photorespiration was evident at a range of O2 concentrations, including values below air equilibrium. At a high O2 concentration of 2.2-fold the atmospheric equilibrium concentration, net photosynthesis was reduced substantially and, although it remained positive in leaves containing high malate concentrations...... were evaluated for Isoetes australis, a submerged plant that inhabits shallow temporary rock pools. • Leaves high or low in malate were evaluated for underwater net photosynthesis and apparent photorespiration at a range of CO2 and O2 concentrations. • CAM activity was indicated by 9.7-fold higher leaf...

Temperature, salinity and other variables collected from discrete sample and profile observations using CTD, PAR Sensor and other instruments from AURORA AUSTRALIS in the Indian Ocean and Southern Oceans from 2012-01-05 to 2012-02-12 (NCEI Accession 0143949)

Data.gov (United States)

National Oceanic and Atmospheric Administration, Department of Commerce — NCEI Accession 0143949 includes discrete sample and profile data collected from AURORA AUSTRALIS in the Indian Ocean and Southern Oceans (> 60 degrees South) from...

In situ O₂ dynamics in submerged Isoetes australis:

DEFF Research Database (Denmark)

Pedersen, Ole; Pulido Pérez, Cristina; Rich, S.M.

2011-01-01

, and the potential importance of the achlorophyllous leaf bases to underwater net photosynthesis (PN) and radial O2 loss to sediments is highlighted. O2 microelectrodes were used in situ to monitor pO2 in leaves, shallow sediments, and water in four vernal pools. The role of the achlorophyllous leaf bases in gas...... exchange was evaluated in laboratory studies of underwater PN, loss of tissue water, radial O2 loss, and light microscopy. Tissue and sediment pO2 showed large diurnal amplitudes and internal O2 was more similar to sediment pO2 than water pO2. In early afternoon, sediment pO2 was often higher than tissue p......A unique type of vernal pool are those formed on granite outcrops, as the substrate prevents percolation so that water accumulates in depressions when precipitation exceeds evaporation. The O2 dynamics of small, shallow vernal pools with dense populations of Isoetes australis were studied in situ...

Temperature, salinity and other variables collected from underway - surface observations using PAR Sensor and other instruments from the AURORA AUSTRALIS, NOAA Ship DISCOVERER and others in the Bering Sea, Caribbean Sea and others from 1994-01-28 to 2004-07-02 (NODC Accession 0109923)

Data.gov (United States)

National Oceanic and Atmospheric Administration, Department of Commerce — NODC Accession 0109923 includes biological, chemical, meteorological, physical and underway - surface data collected from AURORA AUSTRALIS, NOAA Ship DISCOVERER,...

Temperature, salinity and other variables collected from discrete sample and profile observations using CTD, bottle and other instruments from AURORA AUSTRALIS in the Indian Ocean, South Pacific Ocean and Southern Oceans from 2011-01-04 to 2011-02-06 (NCEI Accession 0143947)

Data.gov (United States)

National Oceanic and Atmospheric Administration, Department of Commerce — NCEI Accession 0143947 includes discrete sample and profile data collected from AURORA AUSTRALIS in the Indian Ocean, South Pacific Ocean and Southern Oceans (>...

Temperature, salinity and other variables collected from discrete sample and profile observations using CTD, PAR Sensor and other instruments from AURORA AUSTRALIS in the Indian Ocean, South Pacific Ocean and Southern Oceans from 2007-12-16 to 2008-01-27 (NCEI Accession 0143932)

Data.gov (United States)

National Oceanic and Atmospheric Administration, Department of Commerce — NCEI Accession 0143932 includes discrete sample and profile data collected from AURORA AUSTRALIS in the Indian Ocean, South Pacific Ocean and Southern Oceans (>...

Dissolved inorganic carbon, alkalinity, temperature, salinity and other variables collected from discrete sample and profile observations using Alkalinity titrator, CTD and other instruments from the AURORA AUSTRALIS in the Indian Ocean from 2008-03-22 to 2008-04-17 (NODC Accession 0109900)

Data.gov (United States)

National Oceanic and Atmospheric Administration, Department of Commerce — NODC Accession 0109900 includes biological, chemical, discrete sample, physical and profile data collected from AURORA AUSTRALIS in the Indian Ocean from 2008-03-22...

Dissolved inorganic carbon, alkalinity, temperature, salinity and other variables collected from discrete sample and profile observations using Alkalinity titrator, CTD and other instruments from the AURORA AUSTRALIS in the Indian Ocean from 2001-10-29 to 2001-12-13 (NODC Accession 0108158)

Data.gov (United States)

National Oceanic and Atmospheric Administration, Department of Commerce — NODC Accession 0108158 includes chemical, discrete sample, physical and profile data collected from AURORA AUSTRALIS in the Indian Ocean from 2001-10-29 to...

Dissolved inorganic carbon, temperature, salinity and other variables collected from discrete sample and profile observations using CTD, bottle and other instruments from AURORA AUSTRALIS in the Indian Ocean, South Pacific Ocean and others from 1993-04-04 to 1993-05-09 (NODC Accession 0115004)

Data.gov (United States)

National Oceanic and Atmospheric Administration, Department of Commerce — NCEI Accession 0115004 includes chemical, discrete sample, physical and profile data collected from AURORA AUSTRALIS in the Indian Ocean, South Pacific Ocean,...

Dissolved inorganic carbon, alkalinity, temperature, salinity and other variables collected from discrete sample and profile observations using Alkalinity titrator, CTD and other instruments from AURORA AUSTRALIS in the Indian Ocean and Southern Oceans from 2006-01-02 to 2006-03-12 (NODC Accession 0109922)

Data.gov (United States)

National Oceanic and Atmospheric Administration, Department of Commerce — NCEI Accession 0109922 includes chemical, discrete sample, optical, physical and profile data collected from AURORA AUSTRALIS in the Indian Ocean and Southern Oceans...

Dissolved inorganic carbon, alkalinity, temperature, salinity and other variables collected from discrete sample and profile observations using CTD, bottle and other instruments from the AURORA AUSTRALIS in the Great Australian Bight and Indian Ocean from 1998-02-28 to 1998-04-01 (NODC Accession 0115154)

Data.gov (United States)

National Oceanic and Atmospheric Administration, Department of Commerce — NODC Accession 0115154 includes chemical, discrete sample, physical and profile data collected from AURORA AUSTRALIS in the Great Australian Bight and Indian Ocean...

Decomposition of Phragmites australis litter retarded by invasive Solidago canadensis in mixtures: an antagonistic non-additive effect

Science.gov (United States)

Zhang, Ling; Zhang, Yaojun; Zou, Jianwen; Siemann, Evan

2014-06-01

Solidago canadensis is an aggressive invader in China. Solidago invasion success is partially attributed to allelopathic compounds release and more benefits from AM fungi, which potentially makes the properties of Solidago litter different from co-occurring natives. These properties may comprehensively affect litter decomposition of co-occurring natives. We conducted a field experiment to examine litter mixing effects in a Phragmites australis dominated community invaded by Solidago in southeast China. Solidago had more rapid mass and N loss rate than Phragmites when they decomposed separately. Litter mixing decreased N loss rate in Phragmites litter and increased that of Solidago. Large decreases in Phragmites mass loss and smaller increases in Solidago mass loss caused negative non-additive effect. Solidago litter extracts reduced soil C decomposition and N processes, suggested an inhibitory effect of Solidago secondary compounds. These results are consistent with the idea that nutrient transfer and secondary compounds both affected litter mixtures decomposition.

Dissolved inorganic carbon, alkalinity, temperature, salinity and other variables collected from discrete sample and profile observations using CTD, bottle and other instruments from the AURORA AUSTRALIS in the Indian Ocean and South Pacific Ocean from 1994-12-13 to 1995-02-01 (NODC Accession 0115020)

Data.gov (United States)

National Oceanic and Atmospheric Administration, Department of Commerce — NODC Accession 0115020 includes chemical, discrete sample, physical and profile data collected from AURORA AUSTRALIS in the Indian Ocean and South Pacific Ocean from...

Dissolved inorganic carbon, alkalinity, temperature, salinity and other variables collected from discrete sample and profile observations using Alkalinity titrator, CTD and other instruments from AURORA AUSTRALIS in the Indian Ocean and Southern Oceans from 2004-12-23 to 2005-02-17 (NODC Accession 0108076)

Data.gov (United States)

National Oceanic and Atmospheric Administration, Department of Commerce — NCEI Accession 0108076 includes discrete sample and profile data collected from AURORA AUSTRALIS in the Indian Ocean and Southern Oceans (> 60 degrees South) from...

An exploration of common reed (Phragmites australis bioenergy potential in North America

Directory of Open Access Journals (Sweden)

R. Vaičekonytė

2014-10-01

Full Text Available In North America, reed (Phragmites australis is typically considered to be a weed although it provides important ecosystem services. Small, sparse, patchy or mixed reedbeds are more suitable as habitat for many species than extensive dense reedbeds, whose habitat functions can be enhanced by the selective removal of biomass. We propose that above-ground reed biomass could be harvested for bioenergy, at the same time improving habitat for biodiversity by thinning or fragmenting the more extensive reedbeds. Biofuel pellets manufactured from reeds harvested at Montréal (Canada had moisture content 6.4 %, energy content 16.9 kJ g-1 (dry mass, ash content 3.44 %, and chloride content 1962 ppm. Thus, reed as a material for fuel pellet manufacture is similar to switchgrass (Panicum virgatum, which is commonly cultivated for that purpose and requires higher inputs than harvested wild reed. We discuss these findings in the context of environmental considerations and conclude that the bioenergy potential of reed could most expediently be realised in North America by combining material harvested from the widespread spontaneously occurring reedbeds with organic waste from other sources to create mixed biofuels. However, reeds with high levels of chlorine, sulphur or metals should not be burned to avoid air pollution or equipment damage unless these problems are mitigated by means of appropriate season of harvest, equipment, combustion regime, or use of a mixed feedstock.

Veiling and Accretion Around the Young Binary Stars S and VV Corona Australis

Science.gov (United States)

Sullivan, Kendall; Prato, Lisa; Avilez, Ian

2018-01-01

S CrA and VV CrA are two young binary star systems with separations of 170 AU and 250 AU, respectively, in the southern star-forming region Corona Australis. The spectral types of the four stars in these two systems are similar, approximately K7 to M1, hence the stellar masses are also similar. The study of young stars just emerging from their natal cloud cores at the very limits of observability allows us to probe the extreme environments in which planet formation begins to occur. Stars in this early evolutionary stage can have circumstellar or circumbinary disks, and sometimes remnants of the envelopes which surrounded them during the protostellar stage. Envelopes accrete onto disks and disks in turn accrete onto the central stars, triggering elevated continuum emission, line emission, outflows, and stellar winds. This violent stage marks the onset of the epoch of planet formation. Using high-resolution near-infrared, H-band spectroscopy from the Keck II telescope using the NIRSPEC instrument over 4-6 epochs, we are probing the chaotic environment surrounding the four stars in these systems. We determine the spectral types for VV CrA A and B for the first time, and examine the variable veiling and emission occurring around each of these stars. This research was supported in part by NSF grants AST-1461200 and AST-1313399.

Registros de enredamentos de baleias-franca, Eubalaena australis (CETACEA, MISTICETI, na temporada reprodutiva de 2010, em Santa Catarina, Brasil

Directory of Open Access Journals (Sweden)

Mônica Pontalti

2011-03-01

Full Text Available http://dx.doi.org/10.5007/2175-7925.2011v24n2p109 Baleias-francas (Eubalaena australis sofrem diferentes pressões antrópicas como poluição, tráfego de embarcações e emalhe em redes de pesca. Casos de enredamentos em baleias-francas são crescentes no litoral sul de Santa Catarina, podendo levar a encalhes e morte. Durante a temporada reprodutiva de 2010, foram registrados seis casos de emalhes em indivíduos juvenis e adultos. É necessária a criação de medidas de regulamentação da pesca durante a temporada reprodutiva de baleias-francas em Santa Catarina, considerando as peculiaridades da pesca na região com o objetivo de minimizar as injúrias causadas às baleias e evitar prejuízos às comunidades pesqueiras locais.

Paper production from wild dogwood (Cornus australis L. and the effect of bark on paper properties

Directory of Open Access Journals (Sweden)

Ayhan Gençer

2017-11-01

Full Text Available Generally bark has a negative effect pulp and paper properties. In this study, paper pulp and hand sheets were produced from Wild dogwood (Cornus australis L. using Kraft method. The cooking have been different conditions, chip / solution ratio 1/5, cooking temperature 170±2 °C by taking constant. Kraft method with the Na2S/NaOH, 18/20, 18/15, 18/10, 18/5 performed. Samples were used with and without bark in order to identify the negative impacts of the bark on pulp and paper production. In addition, it has been investigated whether the time of reaching the maximum temperature of K2 cooking is reduced from 120 minutes to 90 minutes, and the time and energy saving can be made. For all of the mechanical properties that were measured and pulp yield, the bark had a negative effect. But, this effect had not significant on mechanical properties at 95% significant level. On the other hand the bark had a negative effect on brightness and positive effects on opacity. These effects had significant at 95% significant level.

Partial pressure (or fugacity) of carbon dioxide, dissolved inorganic carbon, alkalinity, temperature, salinity and other variables collected from discrete sample and profile observations using CTD, PAR Sensor and other instruments from AURORA AUSTRALIS in the Indian Ocean and Southern Oceans from 2016-01-11 to 2016-03-15 (NCEI Accession 0163181)

Data.gov (United States)

National Oceanic and Atmospheric Administration, Department of Commerce — NCEI Accession 0163181 includes chemical, discrete sample, optical, physical and profile data collected from AURORA AUSTRALIS in the Indian Ocean and Southern Oceans...

Covalent structure of the insect toxin of the North African scorpion Androctonus australis Hector

International Nuclear Information System (INIS)

Darbon, H.; Kopeyan, C.; Rietschoten, J. van; Rochat, H.; Zlotkin, E.

1982-01-01

The complete covalent structure of the insect toxin purified from the venom of the North-African scorpion Androctonus australis Hector was described. Its amino acid sequence was established by phenylisothiocyanate degradation of several protein derivatives and proteolytic fragments in a liquid protein sequencer using either a ''protein'' or a ''peptide'' program. The position of the four disulfide bridges were deduced by analysis of proteolytic peptides before and after performic oxidation, and by partial labeling of the half cystine residues with [ 14 C]-iodoacetic acid and determining the specific radioactivities of the S-[ 14 C]-carboxymethylated phenylthiohydantoin cysteines. The sequences of the insect and mammal toxins from scorpions can be aligned with homology with the positions of seven half-cystine residues as registers. The mammal and insect toxins have three disulfide bridges at homologous positions. The fourth bridge is different in that Cys 12 in mammal toxin II is replaced by Cys 38 in the insect toxin. It is likely that the position of the disulfide bridges is the same for all scorpion neurotoxins active on mammals. We believe that the shift of one half-cystine residue in the insect toxin may induce a conformational change in the structure of the protein, which, in turn, may partially account for the total specificity of this toxin for insect nervous system. (author)

Effects of high salinity from desalination brine on growth, photosynthesis, water relations and osmolyte concentrations of seagrass Posidonia australis.

Science.gov (United States)

Cambridge, M L; Zavala-Perez, A; Cawthray, G R; Mondon, J; Kendrick, G A

2017-02-15

Highly saline brines from desalination plants expose seagrass communities to salt stress. We examined effects of raised salinity (46 and 54psu) compared with seawater controls (37psu) over 6weeks on the seagrass, Posidonia australis, growing in tanks with the aim of separating effects of salinity from other potentially deleterious components of brine and determining appropriate bioindicators. Plants survived exposures of 2-4weeks at 54psu, the maximum salinity of brine released from a nearby desalination plant. Salinity significantly reduced maximum quantum yield of PSII (chlorophyll a fluorescence emissions). Leaf water potential (Ψ w ) and osmotic potential (Ψ π ) were more negative at increased salinity, while turgor pressure (Ψ p ) was unaffected. Leaf concentrations of K + and Ca 2+ decreased, whereas concentrations of sugars (mainly sucrose) and amino acids increased. We recommend leaf osmolarity, ion, sugar and amino acid concentrations as bioindicators for salinity effects, associated with brine released in desalination plant outfalls. Copyright © 2016 Elsevier Ltd. All rights reserved.

Partial pressure (or fugacity) of carbon dioxide, salinity and other variables collected from underway - surface observations using Barometric pressure sensor, Carbon dioxide (CO2) gas analyzer and other instruments from the AURORA AUSTRALIS in the Great Australian Bight, Indian Ocean and others from 1992-10-19 to 2001-12-12 (NODC Accession 0115153)

Data.gov (United States)

National Oceanic and Atmospheric Administration, Department of Commerce — NODC Accession 0115153 includes chemical, meteorological, physical and underway - surface data collected from AURORA AUSTRALIS in the Great Australian Bight, Indian...

Red fox ( Vulpes vulpes L.) favour seed dispersal, germination and seedling survival of Mediterranean Hackberry ( Celtis australis L.)

Science.gov (United States)

Juan, Traba; Sagrario, Arrieta; Jesús, Herranz; Cristina, Clamagirand M.

2006-07-01

Seeds of the Mediterranean Hackberry Celtis australis are often encountered in fox faeces. In order to evaluate the effect of gut transit on the size of seeds selected, the rates and speed of germination and on the survival of the seedlings, Mediterranean Hackberry seeds from fox faeces were germinated in a greenhouse. The results were compared with those of seeds taken from ripe, uneaten fruits. Fox-dispersed seeds were smaller and lighter than the control ones and had higher (74% vs. 57%) and more rapid germination (74.5 days vs. 99.2 days). Seedlings from fox-dispersed seeds showed significantly greater survival by the end of the study period (74.1% vs. 43.6%) than the control ones. Survival in seedlings from fox-dispersed seeds was related to germination date, late seedlings showing poorer survival. This relationship was not observed away in the control seedlings. Seed mass did not affect seedling survival. Seedling arising from fox-dispersed seeds grew faster than control ones. These results suggest that fox can play a relevant role as seed disperser of Mediterranean Hackberry.

Marine Bacteria from Danish Coastal Waters Show Antifouling Activity against the Marine Fouling Bacterium Pseudoalteromonas sp. Strain S91 and Zoospores of the Green Alga Ulva australis Independent of Bacteriocidal Activity

DEFF Research Database (Denmark)

Bernbom, Nete; Ng, Yoke Yin; Kjelleberg, Staffan

2011-01-01

, representing the major taxonomic groups, different seasons, and isolation strategies, were tested for antiadhesive effect against the marine biofilm-forming bacterium Pseudoalteromonas sp. strain S91 and zoospores of the green alga Ulva australis. The antiadhesive effects were assessed by quantifying...... the number of strain S91 or Ulva spores attaching to a preformed biofilm of each of the 22 strains. The strongest antifouling activity was found in Pseudoalteromonas strains. Biofilms of Pseudoalteromonas piscicida, Pseudoalteromonas tunicata, and Pseudoalteromonas ulvae prevented Pseudoalteromonas S91 from...

Invasion of Old World Phragmites australis in the New World: precipitation and temperature patterns combined with human influences redesign the invasive niche

DEFF Research Database (Denmark)

Guo, Wen-Yong; Lambertini, Carla; Li, Xiu-Zhen

2013-01-01

niches. We suggest that an increase in precipitation in the 20(th) century, global warming and human-made habitats have shaped the invasive niches of the two lineages in the New World. However, as the invasions are on-going and human and natural disturbances occur concomitantly, the future distribution....... australis (Haplotype M and Med) in both their native and introduced ranges using environmental niche models (ENMs) to assess (i) whether a niche shift accompanied the invasions in the New World; (ii) the role of biologically relevant climatic variables and human influence in the process of invasion...... for temperature fluctuations and increased precipitation. The introduced Med lineage has enlarged its original subtropical niche to the tropics-subtropics, invading regions with a high annual mean temperature (> c. 10 °C) and high precipitation in the driest period. Human influence is an important factor for both...

Organic geochemistry of resins from modern Agathis australis and Eocene resins from New Zealand: Diagenetic and taxonomic implications

Science.gov (United States)

Lyons, P.C.; Mastalerz, Maria; Orem, W.H.

2009-01-01

A maturation series of resins and fossil resins from New Zealand, ranging in age from Modern to Eocene and ranging from uncoalified to high volatile C bituminous coal, were analyzed by elemental, pyrolysis-gas chromatography (Py-GC), Fourier Transform infrared (FTir), and solid-state 13C nuclear magnetic resonance (13C NMR) techniques. For comparison, four resin samples from the Latrobe Valley, Australia, were analyzed. All of the resins and fossil resins of this study show very high H/C atomic ratios, and are characterized by dominant peaks in the 10-60??ppm range of solid-state 13C NMR spectra and prominent bands in the aliphatic stretching region (2800-3000??cm- 1) of FTir spectra, all indicating a highly aliphatic molecular structure. The 13C NMR and FTir data indicate a diterpenoid structure for these resins. There is an abrupt loss of oxygen that occurs at the Lignite A/Subbituminous C stage, which is attributed to a dramatic loss of carboxyl (COOH) from the diterpenoid molecule. This is a new finding in the diagenesis of resins. This important loss in oxygenated functional groups is attributed to a maturation change. Also, there is a progressive loss of exomethylene (CH2) groups with increasing degree of maturation, as shown by both 13C NMR and FTir data. This change has been noted by previous investigators. Exomethylene is absent in the fossil resins from the Eocene high volatile C bituminous coals. This progressive loss is characteristic of Class I resinites. FTir data indicate that the oxygenated functional groups are strong in all the resin samples except the fossil resin from high volatile C bituminous coal. This important change in oxygenated functional groups is attributed to maturation changes. The 13C NMR and FTir data indicate there are minor changes in the Agathis australis resin from the living tree and soil, which suggests that alteration of A. australis resins begins shortly after deposition in the soil for as little as 1000??years. The Morwell

Organic geochemistry of resins from modern Agathis australis and Eocene resins from New Zealand: Diagenetic and taxonomic implications

Energy Technology Data Exchange (ETDEWEB)

Lyons, Paul C. [Lyons and Associates Consultants, 206 Amber Road, Middleboro, MA 02346 (United States); Mastalerz, Maria [Indiana Geological Survey, Indiana University, 611 North Walnut Grove, Bloomington, IN 47405 (United States); Orem, William H. [U.S. Geological Survey, MS 956 National Center, Reston, VA 20192 (United States)

2009-10-01

A maturation series of resins and fossil resins from New Zealand, ranging in age from Modern to Eocene and ranging from uncoalified to high volatile C bituminous coal, were analyzed by elemental, pyrolysis-gas chromatography (Py-GC), Fourier Transform infrared (FTir), and solid-state {sup 13}C nuclear magnetic resonance ({sup 13}C NMR) techniques. For comparison, four resin samples from the Latrobe Valley, Australia, were analyzed. All of the resins and fossil resins of this study show very high H/C atomic ratios, and are characterized by dominant peaks in the 10-60 ppm range of solid-state {sup 13}C NMR spectra and prominent bands in the aliphatic stretching region (2800-3000 cm{sup -} {sup 1}) of FTir spectra, all indicating a highly aliphatic molecular structure. The {sup 13}C NMR and FTir data indicate a diterpenoid structure for these resins. There is an abrupt loss of oxygen that occurs at the Lignite A/Subbituminous C stage, which is attributed to a dramatic loss of carboxyl (COOH) from the diterpenoid molecule. This is a new finding in the diagenesis of resins. This important loss in oxygenated functional groups is attributed to a maturation change. Also, there is a progressive loss of exomethylene (CH{sub 2}) groups with increasing degree of maturation, as shown by both {sup 13}C NMR and FTir data. This change has been noted by previous investigators. Exomethylene is absent in the fossil resins from the Eocene high volatile C bituminous coals. This progressive loss is characteristic of Class I resinites. FTir data indicate that the oxygenated functional groups are strong in all the resin samples except the fossil resin from high volatile C bituminous coal. This important change in oxygenated functional groups is attributed to maturation changes. The {sup 13}C NMR and FTir data indicate there are minor changes in the Agathis australis resin from the living tree and soil, which suggests that alteration of A. australis resins begins shortly after deposition

Effects of nutrients on interaction between the invasive bidens pilosa the parasitic cusuta australis

International Nuclear Information System (INIS)

Yang, B.; Li, J.; Yan, M.

2015-01-01

Parasitic plants have been identified as potential biological agents to control invasive plants. Understanding the interaction between invasive plants and their novel natural enemies is important for understanding mechanisms underlying plant invasion success and thus taking measures to control invasion. We conducted a factorial experiment to test the interactive effects of nutrient addition (low vs. high) and parasitism (with vs. without Cuscuta australis) on the growth of the invasive Bidens pilosa. Parasitism significantly decreased leaf, stem and root biomass of the host invasive plant, and nutrient addition increased leaf and stem biomass of the host. A synergistic effect of parasitism and nutrient addition was found on stem and leaf biomass of the hosts. Nutrient addition significantly increased vegetative biomass of the parasitic plant and caused a more deleterious effect on the invasive host. Reproductive biomass of the parasitic plant was significantly positively related with net photosynthetic rate, light-utilisation efficiency and apparent carboxylation efficiency. Vegetative biomass and total biomass of the parasitic plants were significantly positively related with specific leaf area and the relative chlorophyll content of the host plant. The deleterious effect of the parasite on the growth of the host plant was significantly positively correlated with vegetative biomass of the parasitic plant. Nutrient addition increased the negative effect of the parasitic plant on the invasive host, indicating that the parasitic plant is potentially a biological control agent for the invasive plant even in the context of changing global resources. (author)

Clinical Manifestations and Outcomes of Rickettsia australis Infection: A 15-Year Retrospective Study of Hospitalized Patients

Directory of Open Access Journals (Sweden)

Adam Stewart

2017-06-01

Full Text Available Queensland tick typhus (QTT; Rickettsia australis is an important cause of community-acquired acute febrile illness in eastern Australia. Cases of QTT were identified retrospectively from 2000 to 2015 at five sites in Northern Brisbane through a pathology database. Those included had a fourfold rise in spotted fever group (SFG-specific serology, a single SFG-specific serology ≥ 256 or SFG-specific serology ≥ 128 with a clinically consistent illness. Cases were excluded on the basis of clinical unlikelihood of QTT infection. Thirty-six cases were included. Fever was found in 34/36 (94% patients. Rash occurred in 83% of patients with maculopapular being the dominant morphology (70%. Thrombocytopenia, lymphopenia, and raised transaminases were common and occurred in 58%, 69%, and 89% of patients, respectively. Thirty-one of 36 (86% patients received antibiotic therapy (usually doxycycline and the time to correct antibiotic (from admission ranged from 3 to 120 h (mean 45.5 h. Four of 36 (11% required intensive care unit (ICU admission for severe sepsis and end-organ support. There were no deaths. QTT has a wide range of clinical and laboratory features. Early and appropriate antimicrobial therapy is important and may prevent severe disease. Further prospective studies are required to identify factors associated with severe infection and sepsis.

Disease protection and allelopathic interactions of seed-transmitted endophytic pseudomonads of invasive reed grass (Phragmites australis)

Science.gov (United States)

White, James F.; Kingsley, Katheryn I; Kowalski, Kurt P.; Irizarry, Ivelisse; Micci, April; Soares, Marcos Antonio; Bergen, Marshall S.

2018-01-01

Background and aimsNon-native Phragmites australis (haplotype M) is an invasive grass that decreases biodiversity and produces dense stands. We hypothesized that seeds of Phragmites carry microbes that improve seedling growth, defend against pathogens and maximize capacity of seedlings to compete with other plants.MethodsWe isolated bacteria from seeds of Phragmites, then evaluated representatives for their capacities to become intracellular in root cells, and their effects on: 1.) germination rates and seedling growth, 2.) susceptibility to damping-off disease, and 3.) mortality and growth of competitor plant seedlings (dandelion (Taraxacum officionale F. H. Wigg) and curly dock (Rumex crispus L.)).ResultsTen strains (of 23 total) were identified and characterized; seven were identified as Pseudomonas spp. Strains Sandy LB4 (Pseudomonas fluorescens) and West 9 (Pseudomonas sp.) entered root meristems and became intracellular. These bacteria improved seed germination in Phragmites and increased seedling root branching in Poa annua. They increased plant growth and protected plants from damping off disease. Sandy LB4 increased mortality and reduced growth rates in seedlings of dandelion and curly dock.ConclusionsPhragmites plants associate with endophytes to increase growth and disease resistance, and release bacteria into the soil to create an environment that is favorable to their seedlings and less favorable to competitor plants.

Nitrous oxide emissions from Phragmites australis-dominated zones in a shallow lake

International Nuclear Information System (INIS)

Yang Zhifeng; Zhao Ying; Xia Xinghui

2012-01-01

Nitrous oxide (N 2 O) emissions from Phragmites australis (reed) – dominated zones in Baiyangdian Lake, the largest shallow lake of Northern China, were investigated under different hydrological conditions with mesocosm experiments during the growing season of reeds. The daily and monthly N 2 O emissions were positively correlated with air temperature and the variation of aboveground biomass of reeds (p 2 O emissions from reeds were about 45.8–52.8% of that from the sediments. In terms of the effect of hydrological conditions, N 2 O emissions from the aquatic-terrestrial ecotone were 9.4–26.1% higher than the submerged zone, inferring that the variation of water level would increase N 2 O emissions. The annual N 2 O emission from Baiyangdian Lake was estimated to be about 114.2 t. This study suggested that N 2 O emissions from shallow lakes might be accelerated by the climate change as it has increased air temperature and changed precipitation, causing the variation of water level. - Highlights: ► The daily N 2 O emissions were significant positively correlated with air temperature. ► The monthly N 2 O emissions positively correlated with reed aboveground biomass variations. ► The N 2 O emissions from reeds contributed to 45.8–52.8% of that from the sediment. ► N 2 O emissions from the aquatic-terrestrial ecotone were 9.4–26.1% higher than the submerged zone. ► N 2 O emissions from shallow lakes might be accelerated by the climate change. - The increase of air temperature and water level variation would increase N 2 O emissions, suggesting N 2 O emissions from shallow lakes might be accelerated by climate change.

Diversity of fungal endophytes in non-native Phragmites australis in the Great Lakes

Science.gov (United States)

Clay, Keith; Shearin, Zachery; Bourke, Kimberly; Bickford, Wesley A.; Kowalski, Kurt P.

2016-01-01

Plant–microbial interactions may play a key role in plant invasions. One common microbial interaction takes place between plants and fungal endophytes when fungi asymptomatically colonize host plant tissues. The objectives of this study were to isolate and sequence fungal endophytes colonizing non-native Phragmites australis in the Great Lakes region to evaluate variation in endophyte community composition among three host tissue types and three geographical regions. We collected entire ramets from multiple clones and populations, surface sterilized plant tissues, and plated replicate tissue samples from leaves, stems, and rhizomes on corn meal agar plates to culture and isolate fungal endophytes. Isolates were then subjected to Sanger sequencing of the ITS region of the nuclear ribosomal DNA. Sequences were compared to fungal databases to define operational taxonomic units (OTUs) that were analyzed statistically for community composition. In total, we obtained 173 endophyte isolates corresponding to 55 OTUs, 39 of which were isolated only a single time. The most common OTU corresponded most closely to Sarocladium strictum and comprised 25 % of all fungal isolates. More OTUs were found in stem tissues, but endophyte diversity was greatest in rhizome tissues. PERMANOVA analyses indicated significant differences in endophyte communities among tissue types, geographical regions, and the interaction between those factors, but no differences among individual ramets were detected. The functional role of the isolated endophytes is not yet known, but one genus isolated here (Stagonospora) has been reported to enhance Phragmites growth. Understanding the diversity and functions of Phragmites endophytes may provide targets for control measures based on disrupting host plant/endophyte interactions.

Resistance strategies of Phragmites australis (common reed to Pb pollution in flood and drought conditions

Directory of Open Access Journals (Sweden)

Na Zhang

2018-01-01

Full Text Available Resistance strategies of clonal organs, and parent and offspring shoots of Phragmites australis (common reed to heavy metal pollution in soils are not well known. To clarify the tolerance or resistance strategies in reeds, we conducted a pot experiment with five levels of Pb concentration (0∼4,500 mg kg−1 in flood and drought conditions. Lead toxicity had no inhibitory effect on the number of offspring shoots in flood environment; however, biomass accumulation, and photosynthetic and clonal growth parameters were inhibited in both water environment. At each treatment of Pb concentration, offspring shoots had greater biomass and higher photosynthesis indicators than parent shoots. The lowest Pb allocation was found in rhizomes. More of the Pb transported to above-ground parts tended to accumulate in parent shoots rather than in offspring shoots. Biomass and photosynthesis of offspring shoots, rhizome length, and the number of buds, rhizomes and offspring shoots in the flooded treatment were significantly greater than those in the drought treatment. Our results indicated that the tolerance strategies used by reeds, including higher biomass accumulation and photosynthesis in offspring shoots, low allocation of Pb in rhizomes and offspring shoots, and stable clonal growth, maintained the stability of population propagation and productivity, improving the resistance of reeds to Pb pollution in flood environment. However, the resistance or tolerance was significantly reduced by the synergistic effect of Pb and drought, which significantly inhibited biomass accumulation, photosynthesis, and clonal growth of reeds.

Cellular and ultrastructural characterization of the grey-morph phenotype in southern right whales (Eubalaena australis).

Science.gov (United States)

Eroh, Guy D; Clayton, Fred C; Florell, Scott R; Cassidy, Pamela B; Chirife, Andrea; Marón, Carina F; Valenzuela, Luciano O; Campbell, Michael S; Seger, Jon; Rowntree, Victoria J; Leachman, Sancy A

2017-01-01

Southern right whales (SRWs, Eubalena australis) are polymorphic for an X-linked pigmentation pattern known as grey morphism. Most SRWs have completely black skin with white patches on their bellies and occasionally on their backs; these patches remain white as the whale ages. Grey morphs (previously referred to as partial albinos) appear mostly white at birth, with a splattering of rounded black marks; but as the whales age, the white skin gradually changes to a brownish grey color. The cellular and developmental bases of grey morphism are not understood. Here we describe cellular and ultrastructural features of grey-morph skin in relation to that of normal, wild-type skin. Melanocytes were identified histologically and counted, and melanosomes were measured using transmission electron microscopy. Grey-morph skin had fewer melanocytes when compared to wild-type skin, suggesting reduced melanocyte survival, migration, or proliferation in these whales. Grey-morph melanocytes had smaller melanosomes relative to wild-type skin, normal transport of melanosomes to surrounding keratinocytes, and normal localization of melanin granules above the keratinocyte nuclei. These findings indicate that SRW grey-morph pigmentation patterns are caused by reduced numbers of melanocytes in the skin, as well as by reduced amounts of melanin production and/or reduced sizes of mature melanosomes. Grey morphism is distinct from piebaldism and albinism found in other species, which are genetic pigmentation conditions resulting from the local absence of melanocytes, or the inability to synthesize melanin, respectively.

Coastal upwelling linked to toxic Pseudo-nitzschia australis blooms in Los Angeles coastal waters, 2005-2007

KAUST Repository

Schnetzer, Astrid; Jones, Burton; Schaffner, Rebecca A.; Cetinić, Ivona; Fitzpatrick, Elizabeth; Miller, Peter E.; Seubert, Erica L.; Caron, David A.

2013-01-01

Harmful algal blooms dominated by the diatom Pseudo-nitzschia spp. have become a perennial but variable event within surface waters near the greater Los Angeles area. Toxic blooms during spring seasons from 2005 to 2007 varied strongly in their overall toxicity and duration. Differences in bloom dynamics were linked to differences in storm-induced river discharge following episodic rain events and coastal upwelling, both major coastal processes that led to the injection of nutrients into coastal surface waters. Heavy river runoff during early 2005, a record-rainfall year, favored a phytoplankton community mainly comprised of algal taxa other than Pseudo-nitzschia. The spring bloom during 2005 was associated with low domoic acid surface concentrations and minor contributions of (mainly) P. delicatissima to the diatom assemblage. In contrast, highly toxic P. australis-dominated blooms during spring seasons of 2006 and 2007 were linked to strong upwelling events. River discharge quotas in 2006 and 2007, in contrast to 2005, fell well below annual averages for the region. Surface toxin levels were linked to colder, more saline (i.e. upwelled) water over the 3-year study, but no such consistent relationship between domoic acid levels and other physiochemical parameters, such as macronutrient concentrations or nutrient ratios, was observed. © The Author 2013. Published by Oxford University Press. All rights reserved.

Coastal upwelling linked to toxic Pseudo-nitzschia australis blooms in Los Angeles coastal waters, 2005-2007

KAUST Repository

Schnetzer, Astrid

2013-06-10

Harmful algal blooms dominated by the diatom Pseudo-nitzschia spp. have become a perennial but variable event within surface waters near the greater Los Angeles area. Toxic blooms during spring seasons from 2005 to 2007 varied strongly in their overall toxicity and duration. Differences in bloom dynamics were linked to differences in storm-induced river discharge following episodic rain events and coastal upwelling, both major coastal processes that led to the injection of nutrients into coastal surface waters. Heavy river runoff during early 2005, a record-rainfall year, favored a phytoplankton community mainly comprised of algal taxa other than Pseudo-nitzschia. The spring bloom during 2005 was associated with low domoic acid surface concentrations and minor contributions of (mainly) P. delicatissima to the diatom assemblage. In contrast, highly toxic P. australis-dominated blooms during spring seasons of 2006 and 2007 were linked to strong upwelling events. River discharge quotas in 2006 and 2007, in contrast to 2005, fell well below annual averages for the region. Surface toxin levels were linked to colder, more saline (i.e. upwelled) water over the 3-year study, but no such consistent relationship between domoic acid levels and other physiochemical parameters, such as macronutrient concentrations or nutrient ratios, was observed. © The Author 2013. Published by Oxford University Press. All rights reserved.

Micromamiferos andinos holocenicos del sitio arqueologico Inca Cueva 5, Ju Juy, Argentina: tafonomia, zoogeografia y reconstruccion paleoambiental

OpenAIRE

Ortiz, P. E.; Teta, P.

2002-01-01

A micromammal archaeological sequence (2120 f 120 to 780 f 100 years BP) from Inca Cueva 5 site (23" 05' S - 65" 27' W; 3700 m.a.s.l., Jujuy Province, Argentina) was studied. The following mammalian taxa were recorded: Order Didelphimorphia, Family Didelphidae, Thylamys cf. T. pallidior; Order Rodentia, Family Muridae, Akodon cf. A. albiventer, Andinomys edax, Auliscomys sublimis, Calomys lepidus, Neotomys ebriosus, Phyllotis sp.; Family Caviidae, Cavia cf. C. tschudii, Galea musteloides; Fam...

Influencia de la estación y de las especies Phragmites australis y Schoenoplectus californicus en la eliminación de materia orgánica y nutrientes contenidos en aguas servidas durante la operación de puesta en marcha de humedales construidos de flujo horizontal subsuperficial

Directory of Open Access Journals (Sweden)

Karen Rojas

2013-01-01

Full Text Available Las plantas de tratamiento de aguas servidas basadas en humedales construidos de flujo horizontal subsuperficial (HSS, logran su etapa de madurez después de dos años de operación. La eficiencia de operación de los sistemas depende de la estacionalidad, tipo de plantas y periodo de madurez del sistema. El objetivo de este trabajo es evaluar la influencia de la estación y de las especies Phragmites australis y Schoenoplectus californicus, en la eficiencia de depuración en materia orgánica y nutrientes de unidades de HSS, durante la etapa operativa de puesta en marcha. Con esta finalidad, se implementaron cuatro unidades de HSS bajo condiciones climáticas mediterráneas australes. Dos unidades fueron plantadas con Phragmites australis y las otras dos, con Schoenoplectus californicus. En este trabajo se presentan los resultados de la etapa de puesta en marcha, que cubre los primeros 193 días de operación. Se evaluó la influencia de la especie de planta y la estación (invierno y primavera, en la eficiencia de depuración de materia orgánica (Demanda Biológica de Oxígeno, DBO5, y Demanda Química de Oxígeno, DQO y nutrientes (nitrógeno (N-NH4+, N-NO3- y NT y fósforo (P-PO4-3 y PT. Las unidades de HSS plantadas con Phragmites australis mostraron mejor adaptación temprana que las unidades de HSS plantadas con Schoenoplectus californicus. Sin embargo, las eficiencias de eliminación fueron similares en todas las unidades. Estacionalmente, se pudo evidenciar una diferencia de eliminación para DQO (invierno: 18 a 30%, primavera: 45 a 55% y NT (invierno: 25 a 65%, primavera: 25 a 35%.

A comparative study on the uptake and translocation of organochlorines by Phragmites australis

Energy Technology Data Exchange (ETDEWEB)

San Miguel, Angélique; Ravanel, Patrick [Laboratoire d’Ecologie Alpine, UMR CNRS n°5553, Université Joseph Fourier, BP 53, 38041 Grenoble Cedex 09 (France); Raveton, Muriel, E-mail: muriel.raveton@ujf-grenoble.fr [Laboratoire d’Ecologie Alpine, UMR CNRS n°5553, Université Joseph Fourier, BP 53, 38041 Grenoble Cedex 09 (France)

2013-01-15

Highlights: ► This study compares uptake/translocation of organochlorine congeners in macrophytes. ► First, root OC uptake was strongly linked with the partitioning/diffusion process. ► With time exposure, bioconcentration increased with OC solubility and volatility. ► Translocation was linked to the combination of water flow and vapor flux transfers. ► The most volatile OCs might be phytovolatilized from foliar surfaces. -- Abstract: Organochlorines (OCs) are persistent chemicals found in various environmental compartments. The differences in the uptake of {sup 14}C-labeled 1,4-dichlorobenzene (DCB), 1,2,4-trichlorobenzene (TCB) and γ-hexachlorocyclohexane (γHCH) by Phragmites australis were investigated under hydroponic conditions. The first step in sorption appears to be correlated with the hydrophobic nature of the compounds, since log-linear correlations were obtained between root concentration factor and partition coefficient (LogK{sub ow}). After 7 days of exposure, plant uptake of DCB, TCB, γHCH was significant with bioconcentration factors reaching 14, 19 and 15, respectively. Afterwards, uptake and translocation were seen to be more complex, with a loss of the simple relationship between uptake and LogK{sub ow}. Linear correlations between the bioconcentration/translocation factors and the physico-chemical properties of OCs were shown, demonstrating that translocation from roots to shoots increases with solubility and volatility of the OCs. This suggests that OC-translocation inside plants might result from the combination of two processes, xylem sap flow and vapor fluxes. {sup 14}C-phytovolatilization was measured and was correlated with the volatility of the compounds; the more volatile OCs being most the likely to be phytovolatilized from foliar surfaces (p = 0.0008). Thus, OC-uptake/translocation appears to proceed at a rate that depends mostly on the OCs hydrophobicity, solubility and volatility.

Quantification of environment-driven changes in epiphytic macroinvertebrate communities associated to Phragmites australis

Directory of Open Access Journals (Sweden)

Miguel CAÑEDO-ARGÜELLES

2009-08-01

Full Text Available The epiphytic macroinvertebrate communities associated with the Common Reed, Phragmites australis (Cav. Trin. ex Steudel, were examined seasonally from summer 2004 to spring 2005 in eleven coastal lagoons of the Llobregat Delta (NE Spain following the method proposed by Kornijów & Kairesalo (1994. The aims of the study were to: 1 characterise and quantify changes in epiphytic macroinvertebrate communities along environmental gradients; 2 assess the contribution of elements of the epiphytic compartment to structuring the community; 3 define the optima and tolerances of selected epiphytic macroinvertebrate taxa for the most relevant ecological factors responsible for assemblage composition; and 4 identify possible epiphytic species assemblages that would allow a lagoon’s typology to be established, as well as their representative indicator species. Communities showed statistically significant seasonal variation, with two faunal peaks: one in summer, with high chironomid densities, and the other in winter, with high naidid densities. These peaks showed a clear response to the influence of environmental factors. Salinity explained the highest percentage of total variance (36%, while trophic variables (nutrients, phytoplanktonic chlorophyll-a, and total organic carbon and epiphyton biomass (19.2 and 4% of total variance explained, respectively were secondary. Three different epiphytic macroinvertebrate species assemblages could be defined. These assemblages were directly linked to conductivity conditions, which determined the rate of survival of certain taxa, and to the existence of a direct connection with the sea, which permitted the establishment of "brackish-water" species. In spite of the existence of these species assemblages, the species composition and biomass of epiphytic macroinvertebrates and epiphyton differed substantially between lagoons; both elements were subject to changes in the environment, which finally determined the site

Effects of high salinity from desalination brine on growth, photosynthesis, water relations and osmolyte concentrations of seagrass Posidonia australis

International Nuclear Information System (INIS)

Cambridge, M L; Zavala-Perez, A; Cawthray, G R; Mondon, J; Kendrick, G A

2017-01-01

Highly saline brines from desalination plants expose seagrass communities to salt stress. We examined effects of raised salinity (46 and 54 psu) compared with seawater controls (37 psu) over 6 weeks on the seagrass, Posidonia australis, growing in tanks with the aim of separating effects of salinity from other potentially deleterious components of brine and determining appropriate bioindicators. Plants survived exposures of 2–4 weeks at 54 psu, the maximum salinity of brine released from a nearby desalination plant. Salinity significantly reduced maximum quantum yield of PSII (chlorophyll a fluorescence emissions). Leaf water potential (Ψ w ) and osmotic potential (Ψ π ) were more negative at increased salinity, while turgor pressure (Ψ p ) was unaffected. Leaf concentrations of K + and Ca 2+ decreased, whereas concentrations of sugars (mainly sucrose) and amino acids increased. We recommend leaf osmolarity, ion, sugar and amino acid concentrations as bioindicators for salinity effects, associated with brine released in desalination plant outfalls. - Highlights: • We separated salt effects of desalination brine from other deleterious components. • Sublethal salinity stress depended on both salinity increase and exposure time. • Very effective osmoregulation led to tolerance of short intervals of high salinity.

Development of an Efficient Protein Extraction Method Compatible with LC-MS/MS for Proteome Mapping in Two Australian Seagrasses Zostera muelleri and Posidonia australis

Directory of Open Access Journals (Sweden)

Zhijian Jiang

2017-08-01

Full Text Available The availability of the first complete genome sequence of the marine flowering plant Zostera marina (commonly known as seagrass in early 2016, is expected to significantly raise the impact of seagrass proteomics. Seagrasses are marine ecosystem engineers that are currently declining worldwide at an alarming rate due to both natural and anthropogenic disturbances. Seagrasses (especially species of the genus Zostera are compromised for proteomic studies primarily due to the lack of efficient protein extraction methods because of their recalcitrant cell wall which is rich in complex polysaccharides and a high abundance of secondary metabolites in their cells. In the present study, three protein extraction methods that are commonly used in plant proteomics i.e., phenol (P; trichloroacetic acid/acetone/SDS/phenol (TASP; and borax/polyvinyl-polypyrrolidone/phenol (BPP extraction, were evaluated quantitatively and qualitatively based on two dimensional isoelectric focusing (2D-IEF maps and LC-MS/MS analysis using the two most abundant Australian seagrass species, namely Zostera muelleri and Posidonia australis. All three tested methods produced high quality protein extracts with excellent 2D-IEF maps in P. australis. However, the BPP method produces better results in Z. muelleri compared to TASP and P. Therefore, we further modified the BPP method (M-BPP by homogenizing the tissue in a modified protein extraction buffer containing both ionic and non-ionic detergents (0.5% SDS; 1.5% Triton X-100, 2% PVPP and protease inhibitors. Further, the extracted proteins were solubilized in 0.5% of zwitterionic detergent (C7BzO instead of 4% CHAPS. This slight modification to the BPP method resulted in a higher protein yield, and good quality 2-DE maps with a higher number of protein spots in both the tested seagrasses. Further, the M-BPP method was successfully utilized in western-blot analysis of phosphoenolpyruvate carboxylase (PEPC—a key enzyme for carbon

Evaluation of the effect of an extract of sabugueiro (Sambucus australis) on the labeling of blood constituents with technetium-99m

International Nuclear Information System (INIS)

Ribeiro, Camila Godinho; Rebello, Bernardo Machado; Neves, Rosane de Figueiredo; Santos-Filho, Sebastiao David; Fonseca, Adenilson de Souza da; Medeiros, Aldo da Cunha; Bernardo-Filho, Mario; Catanho, Maria Teresa Jansem de Almeida

2007-01-01

Sambucus australis (sabugueiro) has been used to treat inflammatory and rheumatologic disorders. Blood constituents labeled with technetium-99m (99mTc) have been used in nuclear medicine to obtain diagnostic images. The aim of this work was to evaluate the effect of a sabugueiro extract on the labeling of blood cells with 99mTc. Blood samples from Wistar rats were incubated with sabugueiro extract and the radiolabeling assay of blood constituents was carried out. After centrifugation, samples of plasma and blood cells were separated. Aliquots of plasma and blood cells were precipitated with trichloroacetic acid and centrifuged to isolate soluble and insoluble fractions. The radioactivity in each fraction was counted and the percentage of activity (%ATI) was determined. Incubation with sabugueiro extract altered significantly (p<0.05) the %ATI incorporated to the blood constituents. These results could be explained due the presence of chemical substances in the sabugueiro extract that present redox and/or chelating action altering the labeling of the blood constituents with 99mTc. (author)

In vitro apoptotic effects of methanol extracts of Dianthus chinensis and Acalypha australis L. targeting specificity protein 1 in human oral cancer cells.

Science.gov (United States)

Shin, Ji-Ae; Kim, Jae-Jin; Choi, Eun-Sun; Shim, Jung-Hyun; Ryu, Mi Heon; Kwon, Ki Han; Park, Hee-Min; Seo, Jin-Young; Lee, Soo-Yeon; Lim, Do-Won; Cho, Nam-Pyo; Cho, Sung-Dae

2013-07-01

The aims of this study were to evaluate the apoptotic activities and molecular mechanisms of methanol extracts of Dianthus chinensis (MEDC) and Acalypha australis L. (MEAL) in human oral cancer cells. The apoptotic effects and related molecular mechanisms of MEDC and MEAL on oral cancer cells were evaluated using MTS assay, DAPI staining, immunostaining, Western blotting, and reverse transcriptase-polymerase chain reaction. Sp1 was overexpressed in oral tumor tissues compared with normal oral mucosa. Downregulation of Sp1 inhibited the growth of SCC-15 and YD-15 oral cancer cells. MEDC and MEAL inhibited cell growth and induced apoptosis in both cell lines by decreasing the expression of Sp1. In addition, treatment of cells with MEDC and MEAL decreased Mcl-1 expression, which is a downstream target of Sp1. Our results indicate that MEDC and MEAL are bioactive natural products that can potentially induce apoptosis of tumor cells that overexpress the Sp1 protein. Copyright © 2012 Wiley Periodicals, Inc.

Time monitoring of radio jets and magnetospheres in the nearby young stellar cluster R Coronae Australis

International Nuclear Information System (INIS)

Liu, Hauyu Baobab; Takami, Michihiro; Yan, Chi-Hung; Karr, Jennifer; Chou, Mei-Yin; Ho, Paul T.-P.; Galván-Madrid, Roberto; Costigan, Gráinne; Manara, Carlo Felice; Forbrich, Jan; Rodríguez, Luis F.; Zhang, Qizhou

2014-01-01

We report Karl G. Jansky Very Large Array 8-10 GHz (λ = 3.0-3.7 cm) monitoring observations toward the young stellar object (YSO) cluster R Coronae Australis (R CrA), taken from 2012 March 15 to 2012 September 12. These observations were planned to measure the radio flux variabilities in timescales from 0.5 hr to several days, to tens of days, and up to ∼200 days. We found that among the YSOs detectable in individual epochs, in general, the most reddened objects in the Spitzer observations show the highest mean 3.5 cm Stokes I emission, and the lowest fractional variabilities on <200 day timescales. The brightest radio flux emitters in our observations are the two reddest sources IRS7W and IRS7E. In addition, by comparing our observations with observations taken from 1996 to 1998 and 2005, we found that the radio fluxes of these two sources have increased by a factor of ∼1.5. The mean 3.5 cm fluxes of the three Class I/II sources, IRSI, IRS2, and IRS6, appear to be correlated with their accretion rates derived by a previous near-infrared line survey. The weakly accreting Class I/II YSOs, or those in later evolutionary stages, present radio flux variability on <0.5 hr timescales. Some YSOs were detected only during occasional flaring events. The source R CrA went below our detection limit during a few fading events.

Biogas properties and enzymatic analysis during anaerobic fermentation of Phragmites australis straw and cow dung: influence of nickel chloride supplement.

Science.gov (United States)

Tian, Yonglan; Zhang, Huayong; Chai, Yang; Wang, Lijun; Mi, Xueyue; Zhang, Luyi; Ware, Maxwell Adam

2017-02-01

The importance of nickel (added as NiCl 2 ) on mesophilic anaerobic fermentation of Phragmites australis straw and cow dung was demonstrated by investigating the biogas properties, pH values, organic matter degradation [chemical oxygen demand (COD)] and enzyme activities (cellulase, protease and dehydrogenase) during the fermentation process. The results showed that Ni 2+ addition increased the cumulative biogas yields by >18 % by improving the efficiency of first peak stage and bringing forward the second peak stage. The pH values were not significantly influenced by Ni 2+ addition (p > 0.05). Biogas yields were associated with variations in COD concentrations rather than momentary concentrations. At the start-up stage of fermentation (4th day), the biogas yields increased gradually together with the increase of dehydrogenase activities at elevated Ni 2+ concentrations when cellulase and protease activities were similar in all test groups. It is suggested that Ni 2+ addition was mainly dependent on the methanogenic stage. After the start-up stage, the impact of Ni 2+ addition on biogas production was mainly dependent on its effect on cellulase activities, rather than protease or dehydrogenase activities.

« Murayana va à Garma cette année ! » : cérémonies publiques et rituels contemporains du nord-est de la Terre d’Arnhem (Australie)

OpenAIRE

De Largy Healy, Jessica

2011-01-01

Partant de l’idée que les cérémonies yolngu du nord-est de la Terre d'Arnhem (Australie) relèvent de négociations dynamiques entre des individus, des clans et des ancêtres, cet article examine comment une série d'échanges rituels furent articulés dans le cadre d’un festival culturel ouvert aux touristes. Je montre comment un projet de patrimonialisation numérique insuffla un élan de créativité rituelle dans plusieurs localités de la région et aboutit à une véritable campagne de représentation...

Growth of Phragmites australis (Cav.) Trin ex. Steudel in mine water treatment wetlands: effects of metal and nutrient uptake

International Nuclear Information System (INIS)

Batty, Lesley C.; Younger, Paul L.

2004-01-01

The abandoned mine of Shilbottle Colliery, Northumberland, UK is an example of acidic spoil heap discharge that contains elevated levels of many metals. Aerobic wetlands planted with the common reed, Phragmites australis, were constructed at the site to treat surface runoff from the spoil heap. The presence of a perched water table within the spoil heap resulted in the lower wetlands receiving acidic metal contaminated water from within the spoil heap while the upper wetland receives alkaline, uncontaminated surface runoff from the revegetated spoil. This unique situation enabled the comparison of metal uptake and growth of plants used in treatment schemes in two cognate wetlands. Results indicated a significant difference in plant growth between the two wetlands in terms of shoot height and seed production. Analyses of metal and nutrient concentrations within plant tissues provided the basis for three hypotheses to explain these differences: (i) the toxic effects of high levels of metals in shoot tissues (ii) the inhibition of Ca (an essential nutrient) uptake by the presence of metals and H + ions, and (iii) low concentrations of bioavailable nitrogen sources resulting in nitrogen deficiency. This has important implications for the engineering of constructed wetlands in terms of the potential success of plant establishment and vegetation development

Toxicokinetic and toxicodynamic analyses of Androctonus australis hector venom in rats: Optimization of antivenom therapy

International Nuclear Information System (INIS)

Hammoudi-Triki, D.; Lefort, J.; Rougeot, C.; Robbe-Vincent, A.; Bon, C.; Laraba-Djebari, F.; Choumet, V.

2007-01-01

This paper reports the simultaneous determination of toxicokinetic and toxicodynamic properties of Androctonus australis hector venom, in the absence and presence of antivenom (F(ab') 2 and Fab), in envenomed rats. After subcutaneous injection of the venom, toxins showed a complete absorption phase from the site of injection associated with a distribution into a large extravascular compartment. The injection of Fab and F(ab') 2 induced the neutralization of venom antigens in the blood compartment, as well as the redistribution of venom components from the extravascular compartment to the blood compartment. Interestingly, F(ab') 2 and Fab showed distinct efficiencies depending on their route of injection. F(ab') 2 induced a faster venom neutralization and redistribution than Fab when injected intravenously. Fab was more effective than F(ab') 2 by the intramuscular route. The hemodynamic effects of Aah venom were further investigated. Changes in mean arterial pressure and heart rate were observed in parallel with an upper airway obstruction. Fab was more effective than F(ab') 2 for preventing early symptoms of envenomation, whatever their route of administration. Intraperitoneal injection of F(ab') 2 and Fab was similar for the prevention of the delayed symptoms, even after a late administration. Fab was more effective than F(ab') 2 in the inhibition of airway resistance, independent of the route and time of administration. These results show that the treatment for scorpion stings might be improved by the intravascular injection of a mixture of Fab and F(ab') 2 . If antivenom cannot be administered intravenously, Fab might be an alternative as they are more effective than F(ab') 2 when injected intramuscularly

Comparison of Mercury Contamination in Live and Dead Dolphins from a Newly Described Species, Tursiops australis

Science.gov (United States)

Monk, Alissa; Charlton-Robb, Kate; Buddhadasa, Saman; Thompson, Ross M.

2014-01-01

Globally it is estimated that up to 37% of all marine mammals are at a risk of extinction, due in particular to human impacts, including coastal pollution. Dolphins are known to be at risk from anthropogenic contaminants due to their longevity and high trophic position. While it is known that beach-cast animals are often high in contaminants, it has not been possible to determine whether levels may also be high in live animals from the same populations. In this paper we quantitatively assess mercury contamination in the two main populations of a newly described dolphin species from south eastern Australia, Tursiops australis. This species appear to be limited to coastal waters in close proximity to a major urban centre, and as such is likely to be vulnerable to anthropogenic pollution. For the first time, we were able to compare blubber mercury concentrations from biopsy samples of live individuals and necropsies of beach-cast animals and show that beach-cast animals were highly contaminated with mercury, at almost three times the levels found in live animals. Levels in live animals were also high, and are attributable to chronic low dose exposure to mercury from the dolphin's diet. Measurable levels of mercury were found in a number of important prey fish species. This illustrates the potential for low dose toxins in the environment to pass through marine food webs and potentially contribute to marine mammal deaths. This study demonstrates the potential use of blubber from biopsy samples to make inferences about the health of dolphins exposed to mercury. PMID:25137255

Comparison of mercury contamination in live and dead dolphins from a newly described species, Tursiops australis.

Science.gov (United States)

Monk, Alissa; Charlton-Robb, Kate; Buddhadasa, Saman; Thompson, Ross M

2014-01-01

Globally it is estimated that up to 37% of all marine mammals are at a risk of extinction, due in particular to human impacts, including coastal pollution. Dolphins are known to be at risk from anthropogenic contaminants due to their longevity and high trophic position. While it is known that beach-cast animals are often high in contaminants, it has not been possible to determine whether levels may also be high in live animals from the same populations. In this paper we quantitatively assess mercury contamination in the two main populations of a newly described dolphin species from south eastern Australia, Tursiops australis. This species appear to be limited to coastal waters in close proximity to a major urban centre, and as such is likely to be vulnerable to anthropogenic pollution. For the first time, we were able to compare blubber mercury concentrations from biopsy samples of live individuals and necropsies of beach-cast animals and show that beach-cast animals were highly contaminated with mercury, at almost three times the levels found in live animals. Levels in live animals were also high, and are attributable to chronic low dose exposure to mercury from the dolphin's diet. Measurable levels of mercury were found in a number of important prey fish species. This illustrates the potential for low dose toxins in the environment to pass through marine food webs and potentially contribute to marine mammal deaths. This study demonstrates the potential use of blubber from biopsy samples to make inferences about the health of dolphins exposed to mercury.

Comparison of mercury contamination in live and dead dolphins from a newly described species, Tursiops australis.

Directory of Open Access Journals (Sweden)

Alissa Monk

Full Text Available Globally it is estimated that up to 37% of all marine mammals are at a risk of extinction, due in particular to human impacts, including coastal pollution. Dolphins are known to be at risk from anthropogenic contaminants due to their longevity and high trophic position. While it is known that beach-cast animals are often high in contaminants, it has not been possible to determine whether levels may also be high in live animals from the same populations. In this paper we quantitatively assess mercury contamination in the two main populations of a newly described dolphin species from south eastern Australia, Tursiops australis. This species appear to be limited to coastal waters in close proximity to a major urban centre, and as such is likely to be vulnerable to anthropogenic pollution. For the first time, we were able to compare blubber mercury concentrations from biopsy samples of live individuals and necropsies of beach-cast animals and show that beach-cast animals were highly contaminated with mercury, at almost three times the levels found in live animals. Levels in live animals were also high, and are attributable to chronic low dose exposure to mercury from the dolphin's diet. Measurable levels of mercury were found in a number of important prey fish species. This illustrates the potential for low dose toxins in the environment to pass through marine food webs and potentially contribute to marine mammal deaths. This study demonstrates the potential use of blubber from biopsy samples to make inferences about the health of dolphins exposed to mercury.

Surveying managers to inform a regionally relevant invasive Phragmites australis control research program.

Science.gov (United States)

Rohal, C B; Kettenring, K M; Sims, K; Hazelton, E L G; Ma, Z

2018-01-15

Managers of invasive species consider the peer-reviewed literature only moderately helpful for guiding their management programs. Though this "knowing-doing gap" has been well-described, there have been few efforts to guide scientists in how to develop useful and usable science. Here we demonstrate how a comprehensive survey of managers (representing 42 wetland management units across the Great Salt Lake watershed) can highlight management practices and challenges (here for the widespread invasive plant, Phragmites australis, a recent and aggressive invader in this region) to ultimately inform a research program. The diversity of surveyed organizations had wide-ranging amounts of Phragmites which led to different goals and approaches including more aggressive control targets and a wider array of control tools for smaller, private organizations compared to larger government-run properties. We found that nearly all managers (97%) used herbicide as their primary Phragmites control tool, while burning (65%), livestock grazing (49%), and mowing (43%) were also frequently used. Managers expressed uncertainties regarding the timing of herbicide application and type of herbicide for effective control. Trade-offs between different Phragmites treatments were driven by budgetary concerns, as well as environmental conditions like water levels and social constraints like permitting issues. Managers had specific ideas about the plant communities they desired following Phragmites control, yet revegetation of native species was rarely attempted. The results of this survey informed the development of large-scale, multi-year Phragmites control and native plant revegetation experiments to address management uncertainties regarding herbicide type and timing. The survey also facilitated initial scientist-manager communication, which led to collaborations and knowledge co-production between managers and researchers. An important outcome of the survey was that experimental results were

Against the odds: complete outcrossing in a monoecious clonal seagrass Posidonia australis (Posidoniaceae).

Science.gov (United States)

Sinclair, Elizabeth A; Gecan, Ilena; Krauss, Siegfried L; Kendrick, Gary A

2014-06-01

Seagrasses are marine, flowering plants with a hydrophilous pollination strategy. In these plants, successful mating requires dispersal of filamentous pollen grains through the water column to receptive stigmas. Approximately 40 % of seagrass species are monoecious, and therefore little pollen movement is required if inbreeding is tolerated. Outcrossing in these species is further impacted by clonality, which is variable, but can be extensive in large, dense meadows. Despite this, little is known about the interaction between clonal structure, genetic diversity and mating systems in hydrophilous taxa. Polymorphic microsatellite DNA markers were used to characterize genetic diversity, clonal structure, mating system and realized pollen dispersal in two meadows of the temperate, monoecious seagrass, Posidonia australis, in Cockburn Sound, Western Australia. Within the two sampled meadows, genetic diversity was moderate among the maternal shoots (R = 0·45 and 0·64) and extremely high in the embryos (R = 0·93-0·97). Both meadows exhibited a highly clumping (or phalanx) structure among clones, with spatial autocorrelation analysis showing significant genetic structure among shoots and embryos up to 10-15 m. Outcrossing rates were not significantly different from one. Pollen dispersal distances inferred from paternity assignment averaged 30·8 and 26·8 m, which was larger than the mean clone size (12·8 and 13·8 m). These results suggest highly effective movement of pollen in the water column. Despite strong clonal structure and moderate genetic diversity within meadows, hydrophilous pollination is an effective vector for completely outcrossed offspring. The different localized water conditions at each site (highly exposed conditions vs. weak directional flow) appear to have little influence on the success and pattern of successful pollination in the two meadows. © The Author 2014. Published by Oxford University Press on behalf of the Annals of Botany Company. All

Mapping invasive Phragmites australis in the coastal Great Lakes with ALOS PALSAR satellite imagery for decision support

Science.gov (United States)

Bourgeau-Chavez, Laura L.; Kowalski, Kurt P.; Carlson Mazur, Martha L.; Scarbrough, Kirk A.; Powell, Richard B.; Brooks, Colin N.; Huberty, Brian; Jenkins, Liza K.; Banda, Elizabeth C.; Galbraith, David M.; Laubach, Zachary M.; Riordan, Kevin

2013-01-01

The invasive variety of Phragmites australis (common reed) forms dense stands that can cause negative impacts on coastal Great Lakes wetlands including habitat degradation and reduced biological diversity. Early treatment is key to controlling Phragmites, therefore a map of the current distribution is needed. ALOS PALSAR imagery was used to produce the first basin-wide distribution map showing the extent of large, dense invasive Phragmites-dominated habitats in wetlands and other coastal ecosystems along the U.S. shore of the Great Lakes. PALSAR is a satellite imaging radar sensor that is sensitive to differences in plant biomass and inundation patterns, allowing for the detection and delineation of these tall (up to 5 m), high density, high biomass invasive Phragmites stands. Classification was based on multi-season ALOS PALSAR L-band (23 cm wavelength) HH and HV polarization data. Seasonal (spring, summer, and fall) datasets were used to improve discrimination of Phragmites by taking advantage of phenological changes in vegetation and inundation patterns over the seasons. Extensive field collections of training and randomly selected validation data were conducted in 2010–2011 to aid in mapping and for accuracy assessments. Overall basin-wide map accuracy was 87%, with 86% producer's accuracy and 43% user's accuracy for invasive Phragmites. The invasive Phragmites maps are being used to identify major environmental drivers of this invader's distribution, to assess areas vulnerable to new invasion, and to provide information to regional stakeholders through a decision support tool.

Spatial genetic structure in natural populations of Phragmites australis in a mosaic of saline habitats in the Yellow River Delta, China.

Directory of Open Access Journals (Sweden)

Lexuan Gao

Full Text Available Determination of spatial genetic structure (SGS in natural populations is important for both theoretical aspects of evolutionary genetics and their application in species conservation and ecological restoration. In this study, we examined genetic diversity within and among the natural populations of a cosmopolitan grass Phragmites australis (common reed in the Yellow River Delta (YRD, China, where a mosaic of habitat patches varying in soil salinity was detected. We demonstrated that, despite their close geographic proximity, the common reed populations in the YRD significantly diverged at six microsatellite loci, exhibiting a strong association of genetic variation with habitat heterogeneity. Genetic distances among populations were best explained as a function of environmental difference, rather than geographical distance. Although the level of genetic divergence among populations was relatively low (F'(ST =0.073, weak but significant genetic differentiation, as well as the concordance between ecological and genetic landscapes, suggests spatial structuring of genotypes in relation to patchy habitats. These findings not only provided insights into the population dynamics of common reed in changing environments, but also demonstrated the feasibility of using habitat patches in a mosaic landscape as test systems to identify appropriate genetic sources for ecological restoration.

Kelp and dolphin gulls cause perineal wounds in South American fur seal pups (Arctocephalus australis) at Guafo Island, Chilean Patagonia.

Science.gov (United States)

Seguel, Mauricio; Muñoz, Francisco; Montalva, Felipe; Perez-Venegas, Diego; Pavés, Héctor; Gottdenker, Nicole

2017-07-01

During five reproductive seasons, we documented the presence, extent and origin of perineal wounds in South American fur seal pups ( Arctocephalus australis ) on Guafo Island, Northern Chilean Patagonia. The seasonal prevalence of perineal wounds ranged from 5 to 9%, and new cases were more common at the end of the breeding season (February), when pups were on average two months old and were actively expelling hookworms ( Uncinaria sp). Histologically, wounds corresponded to marked ulcerative lymphoplasmacytic and histiocytic dermatitis with granulation tissue and mixed bacterial colonies. In 2015 and 2017, kelp gulls ( Larus dominicanus ) and dolphin gulls ( Leucophaeus scoresbii ) were observed picking and wounding the perineal area of marked pups. This behaviour occurred more frequently after the pups' defecation, when sea gulls engaged in consumption of pups' faeces. The affected pups usually had moderate to marked hookworm infections along with bloody diarrhoea and anaemia. Pups with severe wounds (23% of affected animals) had swollen perineal areas and signs of secondary systemic bacterial infection. We propose that seagulls on Guafo Island have learned to consume remains of blood and parasites in the faeces of pups affected by hookworm infection, causing perineal wounds during this process. We conclude that this perineal wounding is an unintentional, occasional negative effect of an otherwise commensal gull-fur seal relationship.

Stable isotopes indicate population structuring in the southwest Atlantic population of right whales (Eubalaena australis.

Directory of Open Access Journals (Sweden)

Morgana Vighi

Full Text Available From the early 17th century to the 1970s southern right whales, Eubalaena australis, were subject to intense exploitation along the Atlantic coast of South America. Catches along this coast recorded by whalers originally formed a continuum from Brazil to Tierra del Fuego. Nevertheless, the recovery of the population has apparently occurred fragmentarily, and with two main areas of concentration, one off southern Brazil (Santa Catarina and another off central Argentina (Peninsula Valdés. This pattern suggests some level of heterogeneity amongst the population, which is apparently contradicted by records that traced individuals moving throughout the whole geographical extension covered by the species in the Southwest Atlantic. To test the hypothesis of the potential occurrence of discrete subpopulations exploiting specific habitats, we investigated N, C and O isotopic values in 125 bone samples obtained from whaling factories operating in the early 1970s in southern Brazil (n=72 and from contemporary and more recent strandings occurring in central Argentina (n=53. Results indicated significant differences between the two sampling areas, being δ13C and δ18O values significantly higher in samples from southern Brazil than in those from central Argentina. This variation was consistent with isotopic baselines from the two areas, indicating the occurrence of some level of structure in the Southwest Atlantic right whale population and equally that whales more likely feed in areas commonly thought to exclusively serve as nursing grounds. Results aim at reconsidering of the units currently used in the management of the southern right whale in the Southwest Atlantic Ocean. In the context of the current die-off affecting the species in Peninsula Valdés, these results also highlight the necessity to better understand movements of individuals and precisely identify their feeding areas.

An investigation of the possibility of mercury phytoremediation from Bandar ImamChlor-alkali plants' wastewater using Phragmites australis

International Nuclear Information System (INIS)

Tayebi, L.; Hamidian, A.H.; Danehkar, A.; Poorbagher, H.

2016-01-01

The Petrochemical industry is the most important and most widely active industries in the country. Due to the variety and complexity of industrial products, it also produces a wild range of pollutants. Mercury waste disposal from Chlor-alkali units is one of the fundamental problems of this industry. Various studies have shown that Phytoremediation system for removal of mercury from aqueous solutions is very efficient and, in some cases up to 95% of mercury has been removed from the solution. The purpose of this study was to evaluate the ability of common reed (Phragmites australis) in the removal of mercury from the Chlor-alkali effluent in Bandar Imam Petrochemical. Plant samples Harvested from Shadegan wetland were cultured hydroponically in plastic aquariums. Effluent samples which were taken from Chlor-alkali plants were added to the culture medium. An aquarium containing wastewater, water and nutrients was considered as control. Mercury concentrations in water and plant at 1, 3, 5 and 7 days were measured by Varian Spectra 220 Atomic Absorption Spectroscopy. The results showed that Time has a direct effect on mercury up taking by common reed. The common Reed absorption average was 2657.25 ppm within 7 days, that shows a high capacity of mercury absorption from Chlor-alkali plant effluents. Also In the study period, 96.25% of mercury were removed from common reed aquarium effulgent water.

Multiple antibiotic resistance patterns of rhizospheric bacteria isolated from Phragmites australis growing in constructed wetland for distillery effluent treatment.

Science.gov (United States)

Chaturvedi, Sonal; Chandra, Ram; Rai, Vibhuti

2008-01-01

Susceptibility patterns of 12 different antibiotics were investigated against rhizospheric bacteria isolated from Phragmites australis from three different zones i.e. upper (0-5 cm), middle (5-10 cm), lower (10-15 cm) in constructed wetland system with and without distillery effluent. The major pollutants of distillery effluent were phenols, sulphide, heavy metals, and higher levels of biological oxygen demand (BOD), chemical oxygen demand (COD) etc. The antibiotic resistance properties of bacteria were correlated with the heavy metal tolerance (one of distillery pollutant). Twenty-two species from contaminated and seventeen species from non-contaminated site were tested by agar disc-diffusion method. The results revealed that more than 63% of total isolates were resistance towards one or more antibiotics tested from all the three different zones of contaminated sites. The multiple-drug resistance property was shown by total 8 isolates from effluent contaminated region out of which 3 isolates were from upper zone, 3 isolates from middle zone and 2 isolates were from lower zone. Results indicated that isolates from contaminated rhizosphere were found more resistant to antibiotics than isolates from non-contaminated rhizosphere. Further this study produces evidence suggesting that tolerance to antibiotics was acquired by isolates for the adaptation and detoxification of all the pollutants present in the effluent at contaminated site. This consequently facilitated the phytoremediation of effluent, which emerges the tolerance and increases resistance to antibiotics.

Endoparasite fauna of five Gadiformes fish species from the coast of Chile: host ecology versus phylogeny.

Science.gov (United States)

Chávez, R A; González, M T; Oliva, M E; Valdivia, I M

2012-03-01

The aims of the present study were to compare, using multivariate analyses, the degree of similarity of the endoparasite fauna of five fish species belonging to the order Gadiformes: Merluccius gayi, Merluccius australis, Macruronus magellanicus (Gadoidei) and Micromesistius australis and Nezumia pulchella (Macrouroidei), from the southern and central Chilean coast, and to evaluate whether the composition of the endoparasite fauna was determined by phylogenetic or ecological relationships. We employed our database of Merluccius australis, M. magellanicus and Micromesistius australis, which was complemented with published information for M. magellanicus, Merluccius australis, Micromesistius australis, M. gayi and N. pulchella. A higher number of endoparasite species was recorded for Merluccius australis, Micromesistius australis and M. magellanicus, namely Anisakis sp. and Hepatoxylon trichiuri, which is the most prevalent parasite among these hosts. Aporocotyle wilhelmi and Hysterothylacium sp. were detected only in M. gayi, whereas Lepidapedon sp. was found exclusively in N. pulchella. These results suggest that fish ecology rather than host phylogeny was the most important factor for the determination of similarity in parasite composition. This result could be explained by the similar trophic patterns of hosts and by the predominance of generalist larval species among these fish parasite communities.

Reproduction at the extremes: pseudovivipary, hybridization and genetic mosaicism in Posidonia australis (Posidoniaceae).

Science.gov (United States)

Sinclair, Elizabeth A; Statton, John; Hovey, Renae; Anthony, Janet M; Dixon, Kingsley W; Kendrick, Gary A

2016-02-01

Organisms occupying the edges of natural geographical ranges usually survive at the extreme limits of their innate physiological tolerances. Extreme and prolonged fluctuations in environmental conditions, often associated with climate change and exacerbated at species' geographical range edges, are known to trigger alternative responses in reproduction. This study reports the first observations of adventitious inflorescence-derived plantlet formation in the marine angiosperm Posidonia australis, growing at the northern range edge (upper thermal and salinity tolerance) in Shark Bay, Western Australia. These novel plantlets are described and a combination of microsatellite DNA markers and flow cytometry is used to determine their origin. Polymorphic microsatellite DNA markers were used to generate multilocus genotypes to determine the origin of the adventitious inflorescence-derived plantlets. Ploidy and genome size were estimated using flow cytometry. All adventitious plantlets were genetically identical to the maternal plant and were therefore the product of a novel pseudoviviparous reproductive event. It was found that 87 % of the multilocus genotypes contained three alleles in at least one locus. Ploidy was identical in all sampled plants. The genome size (2 C value) for samples from Shark Bay and from a separate site much further south was not significantly different, implying they are the same ploidy level and ruling out a complete genome duplication (polyploidy). Survival at range edges often sees the development of novel responses in the struggle for survival and reproduction. This study documents a physiological response at the trailing edge, whereby reproductive strategy can adapt to fluctuating conditions and suggests that the lower-than-usual water temperature triggered unfertilized inflorescences to 'switch' to growing plantlets that were adventitious clones of their maternal parent. This may have important long-term implications as both genetic and

Surface pH changes suggest a role for H+/OH- channels in salinity response of Chara australis.

Science.gov (United States)

Absolonova, Marketa; Beilby, Mary J; Sommer, Aniela; Hoepflinger, Marion C; Foissner, Ilse

2018-05-01

To understand salt stress, the full impact of salinity on plant cell physiology has to be resolved. Electrical measurements suggest that salinity inhibits the proton pump and opens putative H + /OH - channels all over the cell surface of salt sensitive Chara australis (Beilby and Al Khazaaly 2009; Al Khazaaly and Beilby 2012). The channels open transiently at first, causing a characteristic noise in membrane potential difference (PD), and after longer exposure remain open with a typical current-voltage (I/V) profile, both abolished by the addition of 1 mM ZnCl 2 , the main known blocker of animal H + channels. The cells were imaged with confocal microscopy, using fluorescein isothiocyanate (FITC) coupled to dextran 70 to illuminate the pH changes outside the cell wall in artificial fresh water (AFW) and in saline medium. In the early saline exposure, we observed alkaline patches (bright fluorescent spots) appearing transiently in random spatial distribution. After longer exposure, some of the spots became fixed in space. Saline also abolished or diminished the pH banding pattern observed in the untreated control cells. ZnCl 2 suppressed the alkaline spot formation in saline and the pH banding pattern in AFW. The osmotic component of the saline stress did not produce transient bright spots or affect banding. The displacement of H + from the cell wall charges, the H + /OH - channel conductance/density, and self-organization are discussed. No homologies to animal H + channels were found. Salinity activation of the H + /OH - channels might contribute to saline response in roots of land plants and leaves of aquatic angiosperms.

Composting Phragmites australis Cav. plant material and compost effects on soil and tomato (Lycopersicon esculentum Mill.) growth.

Science.gov (United States)

Toumpeli, Anna; Pavlatou-Ve, Athina K; Kostopoulou, Sofia K; Mamolos, Andreas P; Siomos, Anastasios S; Kalburtji, Kiriaki L

2013-10-15

Composting organic residues is a friendly to the environment alternative to producing fertilizer. This research was carried out to study the process of composting Phragmites australis Cav. plant material alone or with animal manure on a pilot-scale, to evaluate firstly the quality of the composts produced and secondly, using a pot experiment, the effects of their application on soil physicochemical characteristics and tomato plants development. For the compost production a randomized complete block design was used with five treatments (five compost types) and four replications. For the pot experiment, a completely randomized design was used with 17 treatments (plain soil, soil with synthetic fertilizer and the application of five compost types, at three rates each) and five replications. Compost N increased with composting time, while C/N ratio decreased significantly and by the end it ranged from 43.3 for CM to 22.6 for CY. Compost pH became almost neutral, ranging from 6.73 for CY to 7.21 for CM3Y3AM4 by the end. Compost combinations CY7AM3 and CM7AM3 had a more positive influence on the soil physicochemical characteristics than the others. Soil N, P, Ca and Mg concentrations and the reduction of clay dispersion were the highest when CM7AM3 compost was added. The macro-aggregate stability was the highest for CY7AM3, which also sustained plant growth. The latter compost combination improved most of the soil physicochemical characteristics and plant growth especially, when the application rate was 4% (w/w), which equals to 156 Mg ha(-1). Copyright © 2013 Elsevier Ltd. All rights reserved.

CHEMICAL AND PHYSICAL CONDITIONS IN MOLECULAR CLOUD CORE DC 000.4-19.5 (SL42) IN CORONA AUSTRALIS

Energy Technology Data Exchange (ETDEWEB)

Hardegree-Ullman, E.; Whittet, D. C. B. [New York Center for Astrobiology and Department of Physics, Applied Physics, and Astronomy, Rensselaer Polytechnic Institute, 110 Eighth Street, Troy, NY 12180 (United States); Harju, J. [Finnish Centre for Astronomy with ESO (FINCA), University of Turku, Vaeisaelaentie 20, FI-21500, Piikkioe (Finland); Juvela, M.; Sipilae, O. [Department of Physics, P.O. Box 64, FI-00014, University of Helsinki (Finland); Hotzel, S., E-mail: hardee@rpi.edu [Observatory, FI-00014, University of Helsinki (Finland)

2013-01-20

Chemical reactions in starless molecular clouds are heavily dependent on interactions between gas phase material and solid phase dust and ices. We have observed the abundance and distribution of molecular gases in the cold, starless core DC 000.4-19.5 (SL42) in Corona Australis using data from the Swedish ESO Submillimeter Telescope. We present column density maps determined from measurements of C{sup 18}O (J = 2-1, 1-0) and N{sub 2}H{sup +} (J = 1-0) emission features. Herschel data of the same region allow a direct comparison to the dust component of the cloud core and provide evidence for gas phase depletion of CO at the highest extinctions. The dust color temperature in the core calculated from Herschel maps ranges from roughly 10.7 to 14.0 K. This range agrees with the previous determinations from Infrared Space Observatory and Planck observations. The column density profile of the core can be fitted with a Plummer-like density distribution approaching n(r) {approx} r {sup -2} at large distances. The core structure deviates clearly from a critical Bonnor-Ebert sphere. Instead, the core appears to be gravitationally bound and to lack thermal and turbulent support against the pressure of the surrounding low-density material: it may therefore be in the process of slow contraction. We test two chemical models and find that a steady-state depletion model agrees with the observed C{sup 18}O column density profile and the observed N(C{sup 18}O) versus A{sub V} relationship.

Isolation of a Seawater Tolerant Leptospira spp. from a Southern Right Whale (Eubalaena australis).

Science.gov (United States)

Grune Loffler, Sylvia; Rago, Virginia; Martínez, Mara; Uhart, Marcela; Florin-Christensen, Monica; Romero, Graciela; Brihuega, Bibiana

2015-01-01

Leptospirosis is the most widespread zoonotic disease in the world. It is caused by pathogenic spirochetes of the genus Leptospira spp. and is maintained in nature through chronic renal infection of carrier animals. Rodents and other small mammals are the main reservoirs. Information on leptospirosis in marine mammals is scarce; however, cases of leptospirosis have been documented in pinniped populations from the Pacific coast of North America from southern California to British Columbia. We report the isolation of a Leptospira spp. strain, here named Manara, from a kidney sample obtained from a Southern Right Whale (Eubalaena australis) calf, which stranded dead in Playa Manara, Península Valdés, Argentina. This strain showed motility and morphology typical of the genus Leptospira spp. under dark-field microscopy; and grew in Ellinghausen-McCullough-Johnson-Harris (EMJH) medium and Fletcher medium after 90 days of incubation at 28°C. Considering the source of this bacterium, we tested its ability to grow in Fletcher medium diluted with seawater at different percentages (1%, 3%, 5%, 7% and 10% v/v). Bacterial growth was detected 48 h after inoculation of Fletcher medium supplemented with 5% sea water, demonstrating the halophilic nature of the strain Manara. Phylogenetic analysis of 16S rRNA gene sequences placed this novel strain within the radiation of the pathogenic species of the genus Leptospira spp., with sequence similarities within the range 97-100%, and closely related to L. interrogans. Two different PCR protocols targeting genus-specific pathogenic genes (G1-G2, B64I-B64II and LigB) gave positive results, which indicates that the strain Manara is likely pathogenic. Further studies are needed to confirm this possibility as well as determine its serogroup. These results could modify our understanding of the epidemiology of this zoonosis. Until now, the resistance and ability to grow in seawater for long periods of time had been proven for the strain

Isolation of a Seawater Tolerant Leptospira spp. from a Southern Right Whale (Eubalaena australis.

Directory of Open Access Journals (Sweden)

Sylvia Grune Loffler

Full Text Available Leptospirosis is the most widespread zoonotic disease in the world. It is caused by pathogenic spirochetes of the genus Leptospira spp. and is maintained in nature through chronic renal infection of carrier animals. Rodents and other small mammals are the main reservoirs. Information on leptospirosis in marine mammals is scarce; however, cases of leptospirosis have been documented in pinniped populations from the Pacific coast of North America from southern California to British Columbia. We report the isolation of a Leptospira spp. strain, here named Manara, from a kidney sample obtained from a Southern Right Whale (Eubalaena australis calf, which stranded dead in Playa Manara, Península Valdés, Argentina. This strain showed motility and morphology typical of the genus Leptospira spp. under dark-field microscopy; and grew in Ellinghausen-McCullough-Johnson-Harris (EMJH medium and Fletcher medium after 90 days of incubation at 28°C. Considering the source of this bacterium, we tested its ability to grow in Fletcher medium diluted with seawater at different percentages (1%, 3%, 5%, 7% and 10% v/v. Bacterial growth was detected 48 h after inoculation of Fletcher medium supplemented with 5% sea water, demonstrating the halophilic nature of the strain Manara. Phylogenetic analysis of 16S rRNA gene sequences placed this novel strain within the radiation of the pathogenic species of the genus Leptospira spp., with sequence similarities within the range 97-100%, and closely related to L. interrogans. Two different PCR protocols targeting genus-specific pathogenic genes (G1-G2, B64I-B64II and LigB gave positive results, which indicates that the strain Manara is likely pathogenic. Further studies are needed to confirm this possibility as well as determine its serogroup. These results could modify our understanding of the epidemiology of this zoonosis. Until now, the resistance and ability to grow in seawater for long periods of time had been proven

Adaptive response of arbuscular mycorrhizal symbiosis to accumulation of elements and translocation in Phragmites australis affected by cadmium stress.

Science.gov (United States)

Huang, Xiaochen; Ho, Shih-Hsin; Zhu, Shishu; Ma, Fang; Wu, Jieting; Yang, Jixian; Wang, Li

2017-07-15

Arbuscular mycorrhizal (AM) fungi have been reported to play a central role in improving plant tolerance to cadmium (Cd)-contaminated sites. This is achieved by enhancing both the growth of host plants and the nutritive elements in plants. This study assessed potential regulatory effects of AM symbiosis with regard to nutrient uptake and transport, and revealed different response strategies to various Cd concentrations. Phragmites australis was inoculated with Rhizophagus irregularis in the greenhouse cultivation system, where it was treated with 0-20 mg L -1 of Cd for 21days to investigate growth parameters, as well as Cd and nutritive element distribution in response to AM fungus inoculation. Mycorrhizal plants showed a higher tolerance, particularly under high Cd-level stress in the substrate. Moreover, our results determined the roots as dominant Cd reservoirs in plants. The AM fungus improved Cd accumulation and saturated concentration in the roots, thus inhibiting Cd uptake to shoots. The observed distributions of nutritive elements and the interactions among these indicated the highest microelement contribution to roots, Ca contributed maximally in leaves, and K and P contributed similarly under Cd stress. In addition, AM fungus inoculation effectively impacted Mn and P uptake and accumulation while coping with Cd toxicity. This study also demonstrated translocation factor from metal concentration (TF) could be a good parameter to evaluate different transportation strategies induced by various Cd stresses in contrast to the bioconcentration factor (BCF) and translocation factor from metal accumulation (TF'). Copyright © 2017 Elsevier Ltd. All rights reserved.

Effects of species, sex, length, and locality on the mercury content of school shark Galeorhinus australis (Macleay) and gummy shark Mustelus antarcticus Guenther from south-eastern Australian waters

Energy Technology Data Exchange (ETDEWEB)

Walker, T.I.

1976-12-01

The mercury levels detected in the muscle tissues of sharks ranged from 0.01 to 2.7 ppM wet weight for school shark Galeorhinus australis (Macleay) and from 0.07 to 3.0 ppM for gummy shark Mustelus antarcticus Guenther. Estimates of the mean mercury levels for the 1971 Victorian landed commercial shark catch were found to be 0.90 ppM for the school shark and 0.37 ppM for the gummy shark. The analyses for total mercury determinations were carried out by five independent laboratories. Preliminary analyses carried out by one indicated that most of the mercury in school sharks and about two-thirds of the mercury in gummy sharks was present as methylmercury. The mercury concentrations varied exponentially with shark length. School sharks had statistically significant higher mercury levels than gummy sharks of the same length and for both the medium-sized and large individuals of each species males had significantly higher levels than females. Levels in male gummy sharks were found to be affected by locality.

Anomalous colour in Neotropical mammals: a review with new records for Didelphis sp. (Didelphidae, Didelphimorphia and Arctocephalus australis (Otariidae, Carnivora

Directory of Open Access Journals (Sweden)

MSL. Abreu

Full Text Available Anomalous colourations occur in many tropical vertebrates. However, they are considered rare in wild populations, with very few records for the majority of animal taxa. We report two new cases of anomalous colouration in mammals. Additionally, we compiled all published cases about anomalous pigmentation registered in Neotropical mammals, throughout a comprehensive review of peer reviewed articles between 1950 and 2010. Every record was classified as albinism, leucism, piebaldism or eventually as undetermined pigmentation. As results, we report the new record of a leucistic specimen of opossum (Didelphis sp. in southern Brazil, as well as a specimen of South American fur seal (Arctocephalus australis with piebaldism in Uruguay. We also found 31 scientific articles resulting in 23 records of albinism, 12 of leucism, 71 of piebaldism and 92 records classified as undetermined pigmentation. Anomalous colouration is apparently rare in small terrestrial mammals, but it is much more common in cetaceans and michrochiropterans. Out of these 198 records, 149 occurred in cetaceans and 30 in bats. The results related to cetaceans suggest that males and females with anomolous pigmentation are reproductively successful and as a consequence their frequencies are becoming higher in natural populations. In bats, this result can be related to the fact these animals orient themselves primarily through echolocation, and their refuges provide protection against light and predation. It is possible that anomalous colouration occurs more frequently in other Neotropical mammal orders, which were not formally reported. Therefore, we encourage researchers to publish these events in order to better understand this phenomenon that has a significant influence on animal survival.

Factors affecting post-control reinvasion by seed of an invasive species, Phragmites australis, in the central Platte River, Nebraska.

Science.gov (United States)

Galatowitsch, Susan M.; Larson, Diane L.; Larson, Jennifer L.

2016-01-01

Invasive plants, such as Phragmites australis, can profoundly affect channel environments of large rivers by stabilizing sediments and altering water flows. Invasive plant removal is considered necessary where restoration of dynamic channels is needed to provide critical habitat for species of conservation concern. However, these programs are widely reported to be inefficient. Post-control reinvasion is frequent, suggesting increased attention is needed to prevent seed regeneration. To develop more effective responses to this invader in the Central Platte River (Nebraska, USA), we investigated several aspects of Phragmites seed ecology potentially linked to post-control reinvasion, in comparison to other common species: extent of viable seed production, importance of water transport, and regeneration responses to hydrology. We observed that although Phragmites seed does not mature until very late in the ice-free season, populations produce significant amounts of viable seed (>50 % of filled seed). Most seed transported via water in the Platte River are invasive perennial species, although Phragmites abundances are much lower than species such as Lythrum salicaria, Cyperus esculentus and Phalaris arundinacea. Seed regeneration of Phragmites varies greatly depending on hydrology, especially timing of water level changes. Flood events coinciding with the beginning of seedling emergence reduced establishment by as much as 59 % compared to flood events that occurred a few weeks later. Results of these investigations suggest that prevention of seed set (i.e., by removal of flowering culms) should be a priority in vegetation stands not being treated annually. After seeds are in the seedbank, preventing reinvasion using prescribed flooding has a low chance of success given that Phragmites can regenerate in a wide variety of hydrologic microsites.

Circadian changes in endogenous concentrations of indole-3-acetic acid, melatonin, serotonin, abscisic acid and jasmonic acid in Characeae (Chara australis Brown).

Science.gov (United States)

Beilby, Mary J; Turi, Christina E; Baker, Teesha C; Tymm, Fiona Jm; Murch, Susan J

2015-01-01

Giant-celled Characeae (Chara australis Brown), grown for 4 months on 12/12 hr day/night cycle and summer/autumn temperatures, exhibited distinct concentration maxima in auxin (indole-3-acetic acid; IAA), melatonin and serotonin about 4 hr after subjective daybreak. These concentration peaks persisted after 3 day pretreatment in continuous darkness: confirming a circadian rhythm, rather than a response to "light on." The plants pretreated for 3 d in continuous light exhibited several large IAA concentration maxima throughout the 24 hr. The melatonin and serotonin concentrations decreased and were less synchronized with IAA. Chara plants grown on 9/15 hr day/night cycle for 4 months and winter/spring temperatures contained much smaller concentrations of IAA, melatonin and serotonin. The IAA concentration maxima were observed in subjective dark phase. Serotonin concentration peaks were weakly correlated with those of IAA. Melatonin concentration was low and mostly independent of circadian cycle. The "dark" IAA concentration peaks persisted in plants treated for 3 d in the dark. The plants pretreated for 3 d in the light again developed more IAA concentration peaks. In this case the concentration maxima in melatonin and serotonin became more synchronous with those in IAA. The abscisic acid (ABA) and jasmonic acid (JA) concentrations were also measured in plants on winter regime. The ABA concentration did not exhibit circadian pattern, while JA concentration peaks were out of phase with those of IAA. The data are discussed in terms of crosstalk between metabolic pathways.

Warm gas towards young stellar objects in Corona Australis. Herschel/PACS observations from the DIGIT key programme

Science.gov (United States)

Lindberg, Johan E.; Jørgensen, Jes K.; Green, Joel D.; Herczeg, Gregory J.; Dionatos, Odysseas; Evans, Neal J.; Karska, Agata; Wampfler, Susanne F.

2014-05-01

Context. The effects of external irradiation on the chemistry and physics in the protostellar envelope around low-mass young stellar objects are poorly understood. The Corona Australis star-forming region contains the R CrA dark cloud, comprising several low-mass protostellar cores irradiated by an intermediate-mass young star. Aims: We study the effects of the irradiation coming from the young luminous Herbig Be star R CrA on the warm gas and dust in a group of low-mass young stellar objects. Methods: Herschel/PACS far-infrared datacubes of two low-mass star-forming regions in the R CrA dark cloud are presented. The distributions of CO, OH, H2O, [C ii], [O i], and continuum emission are investigated. We have developed a deconvolution algorithm which we use to deconvolve the maps, separating the point-source emission from the extended emission. We also construct rotational diagrams of the molecular species. Results: By deconvolution of the Herschel data, we find large-scale (several thousand AU) dust continuum and spectral line emission not associated with the point sources. Similar rotational temperatures are found for the warm CO (282 ± 4 K), hot CO (890 ± 84 K), OH (79 ± 4 K), and H2O (197 ± 7 K) emission in the point sources and the extended emission. The rotational temperatures are also similar to those found in other more isolated cores. The extended dust continuum emission is found in two ridges similar in extent and temperature to molecular millimetre emission, indicative of external heating from the Herbig Be star R CrA. Conclusions: Our results show that nearby luminous stars do not increase the molecular excitation temperatures of the warm gas around young stellar objects (YSOs). However, the emission from photodissociation products of H2O, such as OH and O, is enhanced in the warm gas associated with these protostars and their surroundings compared to similar objects not subjected to external irradiation. Table 9 and appendices are available in

Globalisation and the Australian Aborigines: gain or strain? La Mondialisation : une chance pour les Aborigènes d’Australie ?

Directory of Open Access Journals (Sweden)

Ludivine Royer

2009-10-01

Full Text Available La mondialisation est un phénomène très complexe, qui implique à la fois l’émergence de l’économie de marché, l’accélération du commerce international, l’ouverture des frontières, la libre circulation des personnes et des biens, le développement extraordinaire des transports et de la technologie de l’information, la montée en puissance des télécommunications et des médias à l’échelle planétaire, l’expansion des cultures occidentales et le déclin des États-nations au profit d’institutions internationales en plein essor. Un nouvel ordre mondial est né, et comme la plupart des autres pays, l’Australie a connu de profonds changements depuis la fin des années 1980. Cet article se propose de montrer l’impact direct et indirect de la mondialisation économique, culturelle, technologique et politique sur le peuple aborigène. Bien entendu, il ne s’agit pas de présenter de manière exhaustive les conséquences multiples et complexes de la mondialisation sur les droits, cultures, et sociétés aborigènes, leur développement économique et leur statut politique. Il s’attelle en revanche à mettre en évidence les logiques politiques et socio-culturelles que la mondialisation a favorisées dans les affaires aborigènes, de l’assimilation à l’auto-détermination.

Reducing uncertainty and bias in acoustic biomass estimations of southern blue whiting (Micromesistius australis in the southeastern Pacific: transducer motion effects upon acoustic attenuation Reduciendo el sesgo e incertidumbre de las estimaciones hidroacústicas de biomasa de merluza de tres aletas (Micromesistius australis en el Pacífico suroriental: efectos del movimiento del transductor sobre la atenuación acústica

Directory of Open Access Journals (Sweden)

Alvaro Saavedra

2012-09-01

Full Text Available We evaluated the loss of sensitivity due to the motion experienced by a hull-mounted transducer and its effects upon the estimated biomass of southern blue whiting (Micromesistius australis in an acoustic survey conducted in the southeastern Pacific, off the Chilean coast, during the austral winter of 2009. Vessel motion data (pitch and roll were registered in situ using a digital clinometer and used to correct the nautical area scattering coefficients (NASC in elementary sampling units of 926 m distance by 10 m depth. These NASC correction factors (NASCcp were calculated using Dunford's algorithm for circular transducers. We found high variability in NASCcp, which averaged 12%, and ranged between 0 and 50%. NASCcp variability was explained significantly by the mean depth of the integrated stratum (33%, the weather condition, as measured by Beaufort's scale (5%, and the vessel course relative to wind direction (2%. The empirical model we used to explain NASC Cp variability may be suitable for correcting bias due to transducer motion in other, past and future, fisheries acoustic surveys targeting mid-water species under rough weather conditions.Se evaluó la pérdida de sensibilidad producida por el movimiento de un transductor montado en el casco y sus efectos sobre la abundancia y biomasa estimada de merluza de tres aletas (Micromesistius australis en un estudio acústico realizado en el Pacífico suroriental, frente a la costa de Chile, durante el invierno austral de 2009. Los datos de movimiento del barco (cabeceo y balanceo fueron registrados in situ utilizando un clinómetro digital y luego utilizados para estimar la pérdida teórica de sensibilidad del transductor y, finalmente, traducir esta pérdida en factores de corrección del coeficiente de dispersión por área náutica (NASC calculados para intervalos básicos de muestreo de 926 m de distancia por 10 m de profundidad. Los factores de corrección del NASC (NASC Cp fueron calculados

THE SPITZER SURVEY OF INTERSTELLAR CLOUDS IN THE GOULD BELT. III. A MULTI-WAVELENGTH VIEW OF CORONA AUSTRALIS

International Nuclear Information System (INIS)

Peterson, Dawn E.; Bourke, Tyler L.; Forbrich, Jan; Patten, Brian M.; Caratti o Garatti, Alessio; Gutermuth, Robert A.; Joergensen, Jes K.; Allen, Lori E.; Dunham, Michael M.; Harvey, Paul M.; Evans, Neal J.; MerIn, Bruno; Chapman, Nicholas L.; Cieza, Lucas A.; Huard, Tracy L.; Knez, Claudia; Prager, Brian

2011-01-01

We present Spitzer Space Telescope IRAC and MIPS observations of a 0.85 deg 2 field including the Corona Australis (CrA) star-forming region. At a distance of 130 pc, CrA is one of the closest regions known to be actively forming stars, particularly within its embedded association, the Coronet. Using the Spitzer data, we identify 51 young stellar objects (YSOs) in CrA which include sources in the well-studied Coronet cluster as well as sources distributed throughout the molecular cloud. Twelve of the YSOs discussed are new candidates, one of which is located in the Coronet. Known YSOs retrieved from the literature are also added to the list, and a total of 116 candidate YSOs in CrA are compiled. Based on these YSO candidates, the star formation rate is computed to be 12 M sun Myr -1 , similar to that of the Lupus clouds. A clustering analysis was also performed, finding that the main cluster core, consisting of 68 members, is elongated (having an aspect ratio of 2.36), with a circular radius of 0.59 pc and mean surface density of 150 pc -2 . In addition, we analyze outflows and jets in CrA by means of new CO and H 2 data. We present 1.3 mm interferometric continuum observations made with the Submillimeter Array (SMA) covering R CrA, IRS 5, IRS 7, and IRAS 18595-3712 (IRAS 32). We also present multi-epoch H 2 maps and detect jets and outflows, study their proper motions, and identify exciting sources. The Spitzer and ISAAC/VLT observations of IRAS 32 show a bipolar precessing jet, which drives a CO(2-1) outflow detected in the SMA observations. There is also clear evidence for a parsec-scale precessing outflow, which is east-west oriented and originates in the SMA 2 region and likely driven by SMA 2 or IRS 7A.

Uptake of radionuclides by a common reed (Phragmites australis (Cav.) Trin. ex Steud.) grown in the vicinity of the former uranium mine at Zirovski vrh

Energy Technology Data Exchange (ETDEWEB)

Cerne, Marko, E-mail: marko.cerne@ijs.s [Jozef Stefan Institute, Jamova cesta 39, SI-1000 Ljubljana (Slovenia); Smodis, Borut, E-mail: borut.smodis@ijs.s [Jozef Stefan Institute, Jamova cesta 39, SI-1000 Ljubljana (Slovenia); Strok, Marko, E-mail: marko.strok@ijs.s [Jozef Stefan Institute, Jamova cesta 39, SI-1000 Ljubljana (Slovenia)

2011-04-15

From uranium mining areas, in particular, the radionuclides are usually discharged to the environment during the mining and milling process. At the former uranium mine Zirovski vrh, Slovenia, mine waste and mill tailings were deposited at the Jazbec site and the Borst site, respectively. Plants grown in soils contaminated with the seepage waters from tailings may represent radiological concern if radionuclides from the uranium decay chain are transferred into the food chain. Uranium is usually accumulated in the roots and translocated to the shoots in limited amounts. Uranium plant accumulators are usually plants from Brassicaceae and Poaceae families. A common reed (Phragmites australis (Cav.) Trin. ex Steud.), a tall perennial grass, growing in a wetland habitats, accumulates metals in the above-ground parts. It may be used for phytoremediation of uranium-contaminated soils, because of high biomass production and high metal-accumulation potential. Preliminary results of radionuclide contents measured in such plants, growing on the deposit tailings are presented. A common reed, that was grown on the Borst tailings pile accumulated 8.6 {+-} 8 mBq/g dry weight (d.w.) and 2.4 {+-} 2 mBq/g dry weight (d.w.) of {sup 238}U in leaves and stems, respectively. In the paper, activity concentrations of other nuclides, i.e. {sup 226}Ra, {sup 210}Pb and {sup 40}K are also shown and discussed.

[Study of the reineta protein modifications (Brama australis), put under freezing and storage to -18 degrees C and -30 degrees C].

Science.gov (United States)

Abugoch, Lilian; Quitral, Vilma; Larraín, M Angélica; Vinagre, Julia; Kriukov, Andrei; Chávez, Gloria

2006-12-01

The objective of the present work was to study functional and thermal properties of reineta (Brama australis) frozen meat, analysed by water retention capacity (WRC), gel forming capacity (GFC), texture, emulsifying capacity and differential scanning calorimetry (DSC). For this study, reineta fillets were obtained and extracted by the same conditions, and cutted, packaged, frozen and stored at -18 degrees C and -30 degrees C for 7 months. The results obtained, showed that there were no signifficant differences in the responses to thermal treatment for all the specimens. For samples frozen at -18 degrees C and -30 degrees C, the protein contents were 23.5 + 0.0 and 25.4 + 1.0%, respectively. The WRC values were 0.45 + 0.1 and 1.59 +/- 0.0 g water/g protein, respectively. The gel forming capacity was only present in the fresh samples, whereas the frozen stored ones only form protein aggregates. The emulsifying capacity was between 960 and 1400 g oil / g protein, and the storage time increased this value. The miosin denaturation temperature (Td) and denaturation enthalpy (?H), obtained by DSC, fluctuated between 39.2 +/- 0.5 to 44.8 +/- 0.8 degrees C and 1.12 +/- 0.3 to 0.52 +/- 0.2 J/g, respectively. The actina values were between 71.0 +/- 0.6 to 75.3 +/- 0.5 degrees C and between 0.5 +/- 0.1 to 0.7 +/- 0.1 J/g. Cooperativity decreased as the storage time increased. This is showing a certain degree of protein displacement. The values found by thermal analyses showed a direct relationship with the functional properties, both decreasing with storage time.

Formação do plexo braquial e sistematização dos territórios nervosos em membros torácicos de lobos-marinhos Arctocephalus australis

Directory of Open Access Journals (Sweden)

Daniel Alexandre Stüpp de Souza

2010-04-01

Full Text Available For the study concerning the brachial plexus (BP and the nervous territories of the thoracic limb of South American Fur Seal (Arctocephalus australis, two animals had been used. Their skin was removed and the musculature of the thoracic limb and pectoral region was identified. After that compresses of glacial acetic acid solution of 3% had been applied in the musculature, in order to facilitate the carried through dissection. In analyzed specimens it was observed the emergency of BP from the sixth cervical nerve until the first thoracic nerve. From these four roots trunks of nerves of the same number are formed, whose ventral branches will constitute its arrangement and territorial distribution. From these four trunks emerge the 12 component nerves of the BP, some of them come from only one segment (supra scapular, cranial pectoral, lateral thoracic, thoraco-dorsal and long thoracic, while others come from more than a segment (sub scapular, muscle-cutaneous, axillary, median, caudal pectoral, ulnar and radial. In this direction,this observed constancy in the innervation of the musculature, joints and bones of the thoracic limb, led us to infer that a definite pattern in the delimitation of the nervous territories clearly exists.

Fungal Planet description sheets: 469–557

NARCIS (Netherlands)

Crous, P.W.; Wingfield, M.J.; Burgess, T.I.; Hardy, G.E.St.J.; Crane, C.; Barrett, S.; Cano-Lira, J.F.; Roux, Le J.J.; Thangavel, R.; Guarro, J.; Siqueira, C.M. J.P.Z.; Souza-Motta, C.M.; Stephenson, S.L.; Sutton, D.A.; Tamakeaw, N.; Telleria, M.T.; Valenzuela-Lopez, N.; Viljoen, A.; Visagie, C.M.; Vizzini, A.; Stchigel, A.M.; Wartchow, B.D. F.; Wingfield, B.D.; Yurchenko, E.; Zamora, J.C.; Groenewald, J.Z.; Martín, M.P.; Alfredo, D.S.; Barber, P.A.; Barreto, R.W.; Baseia, I.G.; Cano-Canals, J.; Cheewangkoon, R.; Ferreira, R.J.; Gené, J.; Lechat, C.; Moreno, G.; Roets, F.; Shivas, R.G.; Sousa, J.O.; Tan, Y.P.; Wiederhold, N.P.; Abell, S.E.; Accioly, T.; Albizu, J.L.; Alves, J.L.; Antoniolli, Z.I.; Aplin, N.; Araújo, J.; Arzanlou, M.; Bezerra, J.D.P.; Bouchara, J.-P.; Carlavilla, J.R.; Castillo, A.; Castroagudín, V.L.; Ceresini, P.C.; Claridge, G.F.; Coelho, G.; Ceresini, P.C.; Claridge, G.F.; Coelho, G.; Coimbra, V.R.M.; Costa, L.A.; Cunha, da K.C.; Silva, da S.S.; Daniel, R.; Beer, de Z.W.; Dueñas, M.; Edwards, J.; Enwistle, P.; Fiuza, P.O.; Fournier, J.; García, D.; Gibertoni, T.B.; Giraud, S.; Guevara-Suarez, M.; Gusmão, L.F.P.; Haituk, S.; Heykoop, M.; Hirooka, Y.; T.A. Hofmann, J. Houbraken, D.P. Hughes, I. Kautmanová, O. Koppel, O. Koukol, T.A.; T.A. Hofmann, J. Houbraken, D.P. Hughes, I. Kautmanová, O. Koppel, O. Koukol, J.; Hughes, D.P.; Kautmanová, I.; Koppel, O.; Koukol, O.; Larsson, E.; Latha, K.P.D.; Lee, D.H.; Lisboa, Á. López-Villalba, D.O.; Lisboa, W.S.; López-Villalba, Á.; Maciel, J.L.N.; Manimohan, P.; Manjón, J.L.; Marincowitz, S.; Marney, T.S.; Meijer, M.; Miller, A.N.; Olariaga, I.; Paiva, L.M.; Piepenbring, M.; Poveda-Molero, J.C.; Raj, K.N.A.; Raja, H.A.; Rougeron, A.; Salcedo, I.; Samadi, R.; Santos, T.A.B.; Scarlett, K.; Seifert, K.A.; Shuttleworth, L.A.; Silva, G.A.; Silva, M.

2016-01-01

Novel species of fungi described in this study include those from various countries as follows: Australia: Apiognomonia lasiopetali on Lasiopetalum sp., Blastacervulus eucalyptorum on Eucalyptus adesmophloia, Bullanockia australis (incl. Bullanockia gen. nov.) on Kingia australis, Caliciopsis

Fungal Planet description sheets: 469-557

NARCIS (Netherlands)

Crous, P.W.; Wingfield, M.J.; Burgess, T.I.; Hardy, G.E.St.J.; Crane, C.; Barrett, S.; Cano-Lira, J.F.; Le Roux, J.J.; Thangavel, R.; Guarro, J.; Stchigel, A.M.; Martín, M.P.; Alfredo, D.S.; Barber, P.A.; Barreto, R.W.; Baseia, I.G.; Cano-Canals, J.; Cheewangkoon, R.; Ferreira, R.J.; Gené, J.; Lechat, C.; Moreno, G.; Roets, F.; Shivas, R.G.; Sousa, J.O.; Tan, Y.P.; Wiederhold, N.P.; Abell, S.E.; Accioly, T.; Albizu, J.L.; Alves, J.L.; Antoniolli, Z.I.; Aplin, N.; Araújo, J.; Arzanlou, M.; Bezerra, J.D.P.; Bouchara, J.-P.; Carlavilla, J.R.; Castillo, A.; Castroagudín, V.L.; Ceresini, P.C.; Claridge, G.F.; Coelho, G.; Coimbra, V.R.M.; Costa, L.A.; da Cunha, K.C.; da Silva, S.S.; Daniel, R.; de Beer, Z.W.; Dueñas, M.; Edwards, J.; Enwistle, P.; Fiuza, P.O.; Fournier, J.; García, D.; Gibertoni, T.B.; Giraud, S.; Guevara-Suarez, M.; Gusmão, L.F.P.; Haituk, S.; Heykoop, M.; Hirooka, Y.; Hofmann, T.A.; Houbraken, J.; Hughes, D.P.; Kautmanová, I.; Koppel, O.; Koukol, O.; Larsson, E.; Latha, K.P.D.; Lee, D.H.; Lisboa, D.O.; Lisboa, W.S.; López-Villalba, Á.; Maciel, J.L.N.; Manimohan, P.; Manjón, J.L.; Marincowitz, S.; Marney, T.S.; Meijer, M.; Miller, A.N.; Olariaga, I.; Paiva, L.M.; Piepenbring, M.; Poveda-Molero, J.C.; Raj, K.N.A.; Raja, H.A.; Rougeron, A.; Salcedo, I.; Samadi, R.; Santos, T.A.B.; Scarlett, K.; Seifert, K.A.; Shuttleworth, L.A.; da Silva, S.S.; Silva, M.; Siqueira, J.P.Z.; Souza-Motta, C.M.; Stephenson, S.L.; Sutton, D.A.; Tamakeaw, N.; Telleria, M.T.; Valenzuela-Lopez, N.; Viljoen, A.; Visagie, C.M.; Vizzini, A.; Wartchow, F.; Wingfield, B.D.; Yurchenko, E.; Zamora, J.C.; Groenewald, J.Z.

2016-01-01

Novel species of fungi described in this study include those from various countries as follows: Australia: Apiognomonia lasiopetali on Lasiopetalum sp., Blastacervulus eucalyptorum on Eucalyptus adesmophloia, Bullanockia australis (incl. Bullanockia gen. nov.) on Kingia australis, Caliciopsis

Comparative evaluation of the sperm characteristics and ...

African Journals Online (AJOL)

olayemitoyin

J. Physiol. Sci. 29(June 2014) 055 –061 www.njps.com.ng. Comparative evaluation of the ... Summary: Cuscuta australis (C. australis) seed and stem are commonly used as .... 0.05, Values with different superscripts are significantly different.

Hurricane Activity and the Large-Scale Pattern of Spread of an Invasive Plant Species

Science.gov (United States)

Bhattarai, Ganesh P.; Cronin, James T.

2014-01-01

Disturbances are a primary facilitator of the growth and spread of invasive species. However, the effects of large-scale disturbances, such as hurricanes and tropical storms, on the broad geographic patterns of invasive species growth and spread have not been investigated. We used historical aerial imagery to determine the growth rate of invasive Phragmites australis patches in wetlands along the Atlantic and Gulf Coasts of the United States. These were relatively undisturbed wetlands where P. australis had room for unrestricted growth. Over the past several decades, invasive P. australis stands expanded in size by 6–35% per year. Based on tropical storm and hurricane activity over that same time period, we found that the frequency of hurricane-force winds explained 81% of the variation in P. australis growth over this broad geographic range. The expansion of P. australis stands was strongly and positively correlated with hurricane frequency. In light of the many climatic models that predict an increase in the frequency and intensity of hurricanes over the next century, these results suggest a strong link between climate change and species invasion and a challenging future ahead for the management of invasive species. PMID:24878928

Determining the best phenological state for accurate mapping of Phragmites australis in wetlands using time series multispectral satellite data

Science.gov (United States)

Rupasinghe, P. A.; Markle, C. E.; Marcaccio, J. V.; Chow-Fraser, P.

2017-12-01

Phragmites australis (European common reed), is a relatively recent invader of wetlands and beaches in Ontario. It can establish large homogenous stands within wetlands and disperse widely throughout the landscape by wind and vehicular traffic. A first step in managing this invasive species includes accurate mapping and quantification of its distribution. This is challenging because Phragimtes is distributed in a large spatial extent, which makes the mapping more costly and time consuming. Here, we used freely available multispectral satellite images taken monthly (cloud free images as available) for the calendar year to determine the optimum phenological state of Phragmites that would allow it to be accurately identified using remote sensing data. We analyzed time series, Landsat-8 OLI and Sentinel-2 images for Big Creek Wildlife Area, ON using image classification (Support Vector Machines), Normalized Difference Vegetation Index (NDVI) and Normalized Difference Water Index (NDWI). We used field sampling data and high resolution image collected using Unmanned Aerial Vehicle (UAV; 8 cm spatial resolution) as training data and for the validation of the classified images. The accuracy for all land cover classes and for Phragmites alone were low at both the start and end of the calendar year, but reached overall accuracy >85% by mid to late summer. The highest classification accuracies for Landsat-8 OLI were associated with late July and early August imagery. We observed similar trends using the Sentinel-2 images, with higher overall accuracy for all land cover classes and for Phragmites alone from late July to late September. During this period, we found the greatest difference between Phragmites and Typha, commonly confused classes, with respect to near-infrared and shortwave infrared reflectance. Therefore, the unique spectral signature of Phragmites can be attributed to both the level of greenness and factors related to water content in the leaves during late

Anomalous colour in Neotropical mammals: a review with new records for Didelphis sp. (Didelphidae, Didelphimorphia and Arctocephalus australis (Otariidae, Carnivora Coloração anômala em mamíferos Neotropicais: uma revisão com novos registros para Didelphis sp. (Didelphidae, Didelphimorphia e Arctocephalus australis (Otariidae, Carnivora

Directory of Open Access Journals (Sweden)

MSL. Abreu

2013-02-01

Full Text Available Anomalous colourations occur in many tropical vertebrates. However, they are considered rare in wild populations, with very few records for the majority of animal taxa. We report two new cases of anomalous colouration in mammals. Additionally, we compiled all published cases about anomalous pigmentation registered in Neotropical mammals, throughout a comprehensive review of peer reviewed articles between 1950 and 2010. Every record was classified as albinism, leucism, piebaldism or eventually as undetermined pigmentation. As results, we report the new record of a leucistic specimen of opossum (Didelphis sp. in southern Brazil, as well as a specimen of South American fur seal (Arctocephalus australis with piebaldism in Uruguay. We also found 31 scientific articles resulting in 23 records of albinism, 12 of leucism, 71 of piebaldism and 92 records classified as undetermined pigmentation. Anomalous colouration is apparently rare in small terrestrial mammals, but it is much more common in cetaceans and michrochiropterans. Out of these 198 records, 149 occurred in cetaceans and 30 in bats. The results related to cetaceans suggest that males and females with anomolous pigmentation are reproductively successful and as a consequence their frequencies are becoming higher in natural populations. In bats, this result can be related to the fact these animals orient themselves primarily through echolocation, and their refuges provide protection against light and predation. It is possible that anomalous colouration occurs more frequently in other Neotropical mammal orders, which were not formally reported. Therefore, we encourage researchers to publish these events in order to better understand this phenomenon that has a significant influence on animal survival.Colorações anômalas ocorrem em muitos vertebrados tropicais. Entretanto, estas são consideradas raras em populações selvagens, havendo poucos registros para a maioria dos táxons. Reportam

Phragmites australis

DEFF Research Database (Denmark)

Bui, Truong Tho; Sorrell, Brian K.; Lambertini, Carla

2016-01-01

It has been suggested that in plant invasions, species may develop intrinsically higher gas exchange and growth rates, and greater nitrogen uptake and allocation to shoots, in their invasive range than in their native habitat under excess nutrients. In this study, native populations of two old...... world Phragmitesaustralis phylogeographic groups (EU and MED) were compared with their invasive populations in North America [NAint (M) and NAint (Delta)] under unlimited nutrient availability and identical environmental conditions in a common garden. We expected that both introduced groups would have......, the introduced groups invested more biomass in above-ground tissues than roots and rhizomes. Our results support the concept that invasive populations develop enhanced morphological, physiological and biomass traits in their new ranges that may assist their competiveness under nutrient-enriched conditions...

Intestinal helminth fauna of the South American sea lion Otaria flavescens and fur seal Arctocephalus australis from northern Patagonia, Argentina.

Science.gov (United States)

Hernández-Orts, J S; Montero, F E; Juan-García, A; García, N A; Crespo, E A; Raga, J A; Aznar, F J

2013-09-01

We report on the intestinal helminth fauna of 56 South American sea lions, Otaria flavescens, and 5 South American fur seals, Arctocephalus australis, from northern Patagonia, Argentina. A total of 97,325 helminth specimens were collected from sea lions. Gravid individuals were represented by 6 species of parasites: 1 digenean (Ascocotyle (Ascocotyle) patagoniensis), 1 cestode (Diphyllobothrium spp.), 3 nematodes (Uncinaria hamiltoni, Contracaecum ogmorhini s.s., Pseudoterranova cattani) and 1 acanthocephalan (Corynosoma australe). In addition, third-stage larvae of 2 nematodes (Contracaecum sp. and Anisakis sp. type I) and 3 juvenile acanthocephalans (Andracantha sp., Profilicollis chasmagnathi and Corynosoma cetaceum) were also collected. Andracantha sp., C. ogmorhini s.s. and P. chasmagnathi represent new host records. A total of 1516 helminth specimens were collected from fur seals. Gravid individuals were represented by three species of parasites, namely, Diphyllobothrium spp., C. ogmorhini s.s. and C. australe. In addition, larvae of Contracaecum sp. and P. cattani, juveniles of C. cetaceum and immature cestodes (Tetrabothriidae gen. sp.) were also collected. Corynosoma australe was the most prevalent and abundant parasite in both hosts, accounting for >90% of all specimens. Sea lions and furs seals from northern Patagonia harbour the intestinal helminth communities that could be predicted for otariids, i.e. the combination of species of the genera Corynosoma, Diphyllobothrium, Pseudoterranova, Contracaecum and, in pups, Uncinaria. Additionally, both species of otariid are apparently unsuitable hosts (i.e. non-hosts) for as many as five parasite taxa. The inclusion or exclusion of these species affects estimation of species richness at both component community (11 versus 6 species in sea lions; 7 versus 3 species in fur seals) and infracommunity (mean: 3.1 versus 2.6 in sea lions; 2.2 versus 1.7 species) levels. Information about the reproductive status of

Structures of Bordered Pits Potentially Contributing to Isolation of a Refilled Vessel from Negative Xylem Pressure in Stems of Morus australis Poir.: Testing of the Pit Membrane Osmosis and Pit Valve Hypotheses.

Science.gov (United States)

Ooeda, Hiroki; Terashima, Ichiro; Taneda, Haruhiko

2017-02-01

Two hypotheses have been proposed to explain the mechanism preventing the refilling vessel water from being drained to the neighboring functional vessels under negative pressure. The pit membrane osmosis hypothesis proposes that the xylem parenchyma cells release polysaccharides that are impermeable to the intervessel pit membranes into the refilling vessel; this osmotically counteracts the negative pressure, thereby allowing the vessel to refill. The pit valve hypothesis proposes that gas trapped within intervessel bordered pits isolates the refilling vessel water from the surrounding functional vessels. Here, using the single-vessel method, we assessed these hypotheses in shoots of mulberry (Morus australis Poir.). First, we confirmed the occurrence of xylem refilling under negative pressure in the potted mulberry saplings. To examine the pit membrane osmosis hypothesis, we estimated the semi-permeability of pit membranes for molecules of various sizes and found that the pit membranes were not semi-permeable to polyethylene glycol of molecular mass osmosis mechanism in mulberry would be unrealistically large. © The Author 2016. Published by Oxford University Press on behalf of Japanese Society of Plant Physiologists. All rights reserved. For permissions, please email: journals.permissions@oup.com.

Long-term responses of Burrunan dolphins (Tursiops australis to swim-with dolphin tourism in Port Phillip Bay, Victoria, Australia: A population at risk

Directory of Open Access Journals (Sweden)

Nicole E. Filby

2014-12-01

Full Text Available This study investigated Burrunan dolphin responses to dolphin-swim tour vessels across two time periods: 1998–2000 and 2011–2013. A total of 211 dolphin sightings were documented across 306 surveys. Sighting success rate and mean encounter time with dolphins decreased significantly by 12.8% and 8.2 min, respectively, between periods. Approaches that did not contravene regulations elicited highest approach responses by dolphins towards tour vessels, whereas dolphins’ responded to illegal approaches most frequently with avoidance. Small groups responded to tour vessels with avoidance significantly more than large groups. Initial dolphin behaviour had a strong effect on dolphin’s responses to tour vessels, with resting groups the most likely to exhibit avoidance. Calves were significantly more likely to be present during swims in 2011–2013. Dolphin’s responses to tour vessels changed across time, with effect responses (avoidance and approach increasing significantly as dolphins gained cumulative experience. These dolphins are forced to expend a greater level of time and energy avoiding or approaching boats, shifting from a non-effect response to an effect response. Consequences of this include possible decrease in biological fitness by detracting from core biological activities such as foraging and resting. Combined with a decrease in sighting success between periods, the results imply that this population of dolphins, which is endemic to Australia and listed as threatened under the Victorian Flora and Fauna Guarantee Act 1988, may not be well suited to the dolphin-swim industry. The management implications of these results warrant a shift from passive to active management in Port Phillip Bay. The importance of long-term research is highlighted, given behavioural responses detected herein would be undetected in short-term studies. Keywords: Burrunan dolphin (Tursiops australis, Avoidance, Behaviour, Compliance, Management

Competition from native hydrophytes reduces establishment and growth of invasive dense-flowered cordgrass (Spartina densiflora

Directory of Open Access Journals (Sweden)

Ahmed M. Abbas

2015-10-01

Full Text Available Experimental studies to determine the nature of ecological interactions between invasive and native species are necessary for conserving and restoring native species in impacted habitats. Theory predicts that species boundaries along environmental gradients are determined by physical factors in stressful environments and by competitive ability in benign environments, but little is known about the mechanisms by which hydrophytes exclude halophytes and the life history stage at which these mechanisms are able to operate. The ongoing invasion of the South American Spartina densiflora in European marshes is causing concern about potential impacts to native plants along the marsh salinity gradient, offering an opportunity to evaluate the mechanisms by which native hydrophytes may limit, or even prevent, the expansion of invasive halophytes. Our study compared S. densiflora seedling establishment with and without competition with Phragmites australis and Typha domingensis, two hydrophytes differing in clonal architecture. We hypothesized that seedlings of the stress tolerant S. densiflora would be out-competed by stands of P. australis and T. domingensis. Growth, survivorship, biomass patterns and foliar nutrient content were recorded in a common garden experiment to determine the effect of mature P. australis and T. domingensis on the growth and colonization of S. densiflora under fresh water conditions where invasion events are likely to occur. Mature P. australis stands prevented establishment of S. densiflora seedlings and T. domingensis reduced S. densiflora establishment by 38%. Seedlings grown with P. australis produced fewer than five short shoots and all plants died after ca. 2 yrs. Our results showed that direct competition, most likely for subterranean resources, was responsible for decreased growth rate and survivorship of S. densiflora. The presence of healthy stands of P. australis, and to some extent T. domingensis, along river channels

An electrophysiological study on the effects of Pa-1G (a phospholipase A(2)) from the venom of king brown snake, Pseudechis australis, on neuromuscular function.

Science.gov (United States)

Fatehi, M; Rowan, E G; Harvey, A L

2002-01-01

The effects of Pa-1G, a phospholipase A(2) (PLA(2)) from the venom of the Australian king brown snake (Pseudechis australis) were determined on the release of acetylcholine, muscle resting membrane potential and motor nerve terminal action potential at mouse neuromuscular junction. Intracellular recording from endplate regions of mouse triangularis sterni nerve-muscle preparations revealed that Pa-1G (800 nM) significantly reduced the amplitude of endplate potentials within 10 min exposure. The quantal content of endplate potentials was decreased to 58+/-6% of control after 30 min exposure to 800 nM Pa-1G. The toxin also caused a partial depolarisation of mouse muscle fibres within 60 min exposure. Extracellular recording of action potentials at motor nerve terminals showed that Pa-1G reduced the waveforms associated with both sodium and potassium conductances. To investigate whether this was a direct or indirect effect of the toxin on these ionic currents, whole cell patch clamp experiments were performed using human neuroblastoma (SK-N-SH) cells and B82 mouse fibroblasts stably transfected with rKv1.2. Patch clamp recording experiments confirmed that potassium currents sensitive to alpha-dendrotoxin recorded from B82 cells and sodium currents in SK-N-SH cells were not affected by the toxin. Since neither facilitation of acetylcholine release at mouse neuromuscular junction nor depression of potassium currents in B82 cells has been observed, the apparent blockade of potassium currents at mouse motor nerve endings induced by the toxin is unlikely to be due to a selective block of potassium channels.

Fungal Planet 557 ? 21 December 2016

OpenAIRE

Crous, P.W.; Wingfield, M.J.; Burgess, T.I.; Hardy, G.E.St.J.; Crane, C.; Barrett, S.; Cano-Lira, J.F.; Le Roux, J.J.; Thangavel, R.; Guarro, J.; Stchigel, A.M.; Mart?n, M.P.; Alfredo, D.S.; Barber, P.A.; Barreto, R.W.

2016-01-01

Novel species of fungi described in this study include those from various countries as follows: Australia: Apiognomonia lasiopetali on Lasiopetalum sp., Blastacervulus eucalyptorum on Eucalyptus adesmophloia, Bullanockia australis (incl. Bullanockia gen. nov.) on Kingia australis, Caliciopsis eucalypti on Eucalyptus marginata, Celerioriella petrophiles on Petrophile teretifolia, Coleophoma xanthosiae on Xanthosia rotundifolia, Coniothyrium hakeae on Hakea sp., Diatrypella banksiae on Banksia ...

Fungal Planet description sheets: 469–557

OpenAIRE

Crous, P.W.; Wingfield, M.J.; Burgess, T.I.; Hardy, G.E.St.J.; Crane, C.; Barrett, S.; Cano-Lira, J.F.; Roux, Le, J.J.; Thangavel, R.; Guarro, J.; Siqueira, C.M., J.P.Z.; Souza-Motta, C.M.; Stephenson, S.L.; Sutton, D.A.; Tamakeaw, N.

2016-01-01

Novel species of fungi described in this study include those from various countries as follows: Australia: Apiognomonia lasiopetali on Lasiopetalum sp., Blastacervulus eucalyptorum on Eucalyptus adesmophloia, Bullanockia australis (incl. Bullanockia gen. nov.) on Kingia australis, Caliciopsis eucalypti on Eucalyptus marginata, Celerioriella petrophiles on Petrophile teretifolia, Coleophoma xanthosiae on Xanthosia rotundifolia, Coniothyrium hakeae on Hakea sp., Diatrypella banksiae on Banksia ...

Fungal Planet description sheets: 469-557

OpenAIRE

Crous, P.W.; Wingfield, M.J.; Burgess, T.I.; Hardy, G.E.St.J.; Crane, C.; Barrett, S.; Cano-Lira, J.F.; Le Roux, J.J.; Thangavel, R.; Guarro, J.; Stchigel, A.M.; Martín, M.P.; Alfredo, D.S.; Barber, P.A.; Barreto, R.W.

2016-01-01

Novel species of fungi described in this study include those from various countries as follows: Australia: Apiognomonia lasiopetali on Lasiopetalum sp., Blastacervulus eucalyptorum on Eucalyptus adesmophloia, Bullanockia australis (incl. Bullanockia gen. nov.) on Kingia australis, Caliciopsis eucalypti on Eucalyptus marginata, Celerioriella petrophiles on Petrophile teretifolia, Coleophoma xanthosiae on Xanthosia rotundifolia, Coniothyrium hakeae on Hakea sp., Diatrypella banksiae on Banksia ...

Increased Wounding of Southern Right Whale (Eubalaena australis Calves by Kelp Gulls (Larus dominicanus at Península Valdés, Argentina.

Directory of Open Access Journals (Sweden)

Carina F Marón

Full Text Available At least 626 southern right whale (Eubalaena australis calves died at the Península Valdés calving ground, Argentina, between 2003 and 2014. Intense gull harassment may have contributed to these deaths. In the 1970s, Kelp Gulls (Larus dominicanus began feeding on skin and blubber pecked from the backs of living right whales at Valdés. The frequency of gull attacks has increased dramatically over the last three decades and mother-calf pairs are the primary targets. Pairs attacked by gulls spend less time nursing, resting and playing than pairs not under attack. In successive attacks, gulls open new lesions on the whales' backs or enlarge preexisting ones. Increased wounding could potentially lead to dehydration, impaired thermoregulation, and energy loss to wound healing. The presence, number and total area of gull-inflicted lesions were assessed using aerial survey photographs of living mother-calf pairs in 1974-2011 (n = 2680 and stranding photographs of dead calves (n = 192 in 2003-2011. The percentage of living mothers and calves with gull lesions increased from an average of 2% in the 1970s to 99% in the 2000s. In the 1980s and 1990s, mothers and calves had roughly equal numbers of lesions (one to five, but by the 2000s, calves had more lesions (nine or more covering a greater area of their backs compared to their mothers. Living mother-calf pairs and dead calves in Golfo Nuevo had more lesions than those in Golfo San José in the 2000s. The number and area of lesions increased with calf age during the calving season. Intensified Kelp Gull harassment at Península Valdés could be compromising calf health and thereby contributing to the high average rate of calf mortality observed in recent years, but it cannot explain the large year-to-year variance in calf deaths since 2000.

Hydrological Conditions Affect the Interspecific Interaction between Two Emergent Wetland Species

Directory of Open Access Journals (Sweden)

Jian Zhou

2018-01-01

Full Text Available Hydrological conditions determine the distribution of plant species in wetlands, where conditions such as water depth and hydrological fluctuations are expected to affect the interspecific interactions among emergent wetland species. To test such effects, we conducted a greenhouse experiment with three treatment categories, interspecific interaction (mixed culture or monoculture, water depth (10 or 30 cm depth, and hydrological fluctuation (static or fluctuating water level, and two common emergent wetland plant species, Scirpus planiculumis Fr. (Cyperaceae and Phragmites australis var. baiyangdiansis (Gramineae. An increase in the water depth significantly restrained the growth of both S. planiculumis and P. australis, while hydrological fluctuations did not obviously alter the growth of either species. In addition, both water depth and hydrological fluctuations significantly affected the interspecific interaction between these two wetland species. P. australis benefited from interspecific interaction under increasing water depth and hydrological fluctuations, and the RII values were clearly positive for plants grown at a water depth that fluctuated around 30 cm. The results may have some implications for understanding how S. planiculumis and P. australis, as well as wetland communities, respond to the natural variation or human modification of hydrological conditions.

Caracterização farmacobotânica das espécies de Sambucus (Caprifoliaceae utilizadas como medicinais no Brasil: Parte II. Sambucus australis Cham. & Schltdl.

Directory of Open Access Journals (Sweden)

Eliana Nunes

Full Text Available Sambucus australis Cham. & Schltdl. (sabugueiro-do-rio-grande, Caprifoliaceae é uma planta medicinal descrita apenas na primeira edição da Farmacopéia Brasileira. A espécie é nativa no Brasil, e suas flores são utilizadas na medicina popular, na forma de infusão ou decocção, como diuréticas, antipiréticas, antiinflamatórias, laxativo leve e no tratamento de doenças do aparelho respiratório. Visando elaborar uma monografia farmacopéica atualizada e comparativa com a de Sambucus nigra L., de origem européia, foram estabelecidos os caracteres botânicos macro e microscópicos, através da metodologia clássica utilizada em morfoanatomia vegetal. São características macroscópicas: flores morfologicamente monoclinas; corola de sete a dez milímetros de diâmetro; pétalas com cinco, raro quatro nervuras paralelas; estames curtos e longos; gineceu em regra com cinco lóculos. São características microscópicas: cutícula espessa e estriada; ausência de idioblastos de areia cristalina de oxalato de cálcio; estômatos anomocíticos; brácteas anfiestomáticas; sépalas hipoestomáticas; pétalas anfi-hipoestomáticas; células epidérmicas da face abaxial de sépalas e pétalas retilíneas a sinuosas; células epidérmicas do filete alongadas e de paredes retilíneas; tricomas tectores e glandulares de diferentes tipos; brácteas, sépalas e pétalas com mesofilo homogêneo; sistema vascular representado por feixes colaterais ou agrupamentos de elementos xilemáticos; presença de gotas lipídicas em todas as peças.

A novel association between Rhodnius neglectus and the Livistona australis palm tree in an urban center foreshadowing the risk of Chagas disease transmission by vectorial invasions in Monte Alto City, São Paulo, Brazil.

Science.gov (United States)

Carvalho, Danila B; Almeida, Carlos E; Rocha, Cláudia S; Gardim, Sueli; Mendonça, Vagner J; Ribeiro, Aline R; Alves, Zulimar C P V T; Ruellas, Kellem T; Vedoveli, Alan; da Rosa, João A

2014-02-01

After several public notifications of domiciliary invasions, palm trees were investigated in downtown Monte Alto City, São Paulo State, Brazil, in proximity to the city hall building, the main church, condominiums and marketing establishments. One hundred seventy four palm trees of 10 species were investigated, in which 72 specimens of Rhodnius neglectus, a potential Chagas disease vector, were captured via manual methods. All insects were collected from dead leaves, organic debris and bird nests in the only three Livistona australis palm trees in the central park square. This was the first record of R. neglectus colonizing this palm species. Although no Trypanosoma cruzi was found by abdominal compression followed by light microscopy, the poor nutritional status of the bugs hampered the examination of gut contents for parasite detection. Furthermore, the central crowns of the trees, which shelter bats (Chiroptera: Mammalia), could not be carefully searched for insects due to difficult access. This new finding highlights the sudden alteration in insect behavior, probably as a result of man's interference. This report aims to warn those involved in the health system about this new threat, justifying detailed research of the area to evaluate the magnitude of this emerging public health issue. Copyright © 2013 Elsevier B.V. All rights reserved.

Simulated herbivory and vegetation dynamics in coal slurry ponds reclaimed as wetlands

Energy Technology Data Exchange (ETDEWEB)

Mathis, M.J.; Middleton, B.A. [Southern Illinois University, Carbondale, IL (USA). Dept. of Plant Biology

1999-12-01

The biodiversity of coal slurry ponds can be inhibited at least in part, by dense stands of Phragmites australis. In this study, it is demonstrated that species richness can be increased in coal slurry ponds if the dominant species (P. Australis and Typha latifolia) are removed and that underwater herbivory simulated by cutting will kill emergents. The study was conducted in the greenhouse and the field in both flooded and drawndown conditions. In a reclaimed coal pond at Pyramid State Park, Illinois, neither P. australis nor T. Latifolia survived cutting underwater, but all of the uncut plants survived. Regrowth measured as total biomass of stems was less among flooded versus freely drained plants (0.3 and 2.6 g biomass, respectively). Cut versus uncut plants, combining freely drained and flooded, had less below-ground biomass (99.4 and 254.4 g, respectively). In an unreclaimed coal slurry pond with monospecific stands of P. Australis, plant species richness increased in cut plots as compared to uncut plots (29 vs 2 species, respectively) between March and September, 1995. This study demonstrated that species richness can be increased in coal ponds by mechanical cutting and this potentially by herbivory; however, the additional species were mostly exotics.

Marsh plant response to metals: Exudation of aliphatic low molecular weight organic acids (ALMWOAs)

Science.gov (United States)

Rocha, A. Cristina S.; Almeida, C. Marisa R.; Basto, M. Clara P.; Vasconcelos, M. Teresa S. D.

2016-03-01

Metal exposure is known to induce the production and secretion of substances, such as aliphatic low molecular weight organic acids (ALMWOAs), into the rhizosphere by plant roots. Knowledge on this matter is extensive for soil plants but still considerably scarce regarding marsh plants roots adapted to high salinity media. Phragmites australis and Halimione portulacoides, two marsh plants commonly distributed in European estuarine salt marshes, were used to assess the response of roots of both species, in terms of ALMWOAs exudation, to Cu, Ni and Cd exposure (isolated and in mixture since in natural environment, they are exposed to mixture of metals). As previous studies were carried out in unrealistic and synthetic media, here a more natural medium was selected. Therefore, in vitro experiments were carried out, with specimens of both marsh plants, and in freshwater contaminated with two different Cu, Ni and Cd concentrations (individual metal and in mixture). Both marsh plants were capable of liberating ALMWOAs into the surrounding medium. Oxalic, citric and maleic acids were found in P. australis root exudate solutions and oxalic and maleic acids in H. portulacoides root exudate solutions. ALMWOA liberation by both plants was plant species and metal-dependent. For instance, Cu affected the exudation of oxalic acid by H. portulacoides and of oxalic and citric acids by P. australis roots. In contrast, Ni and Cd did not stimulate any specific response. Regarding the combination of all metals, H. portulacoides showed a similar response to that observed for Cu individually. However, in the P. australis case, at high metal concentration mixture, a synergetic effect led to the increase of oxalic acid levels in root exudate solution and to a decrease of citric acid liberation. A correlation between ALMWOAs exudation and metal accumulation could not be established. P. australis and H. portulacoides are considered suitable metal phytoremediators of estuarine impacted areas

Preliminary Investigations on the Distribution of Leptospira Serovars in Domestic Animals in North-west Morocco.

Science.gov (United States)

Benkirane, A; Noury, S; Hartskeerl, R A; Goris, M G A; Ahmed, A; Nally, J E

2016-04-01

Leptospirosis is a neglected zoonosis of global importance with a complex epidemiology that affects humans, domestic and wild mammals. However, due to the diversity of clinical signs and difficulties of establishing a confirmatory laboratory diagnosis, the disease remains poorly investigated, particularly in the developing world. In Morocco, a descriptive study of the seroprevalence of Leptospira infection in animals has never been undertaken. To fill this gap, the current study was conducted on a subset of animals in north-west Morocco as a preliminary step towards understanding the epidemiological patterns of animal leptospirosis in the country. The study was conducted on 289 serum samples collected between January and April 2012 from dogs, cattle, sheep, goats and donkeys in the areas of Rabat-Temara, Sidi Kacem and Oulmes. All serum samples were tested by the MAT with 14 reference strains of the most prevalent pathogenic serovars of Leptospira and two serovars of non-pathogenic Leptospira. The overall seroprevalence of Leptospira in cattle, sheep, goats, dogs and donkeys was 15%, 18%, 20%, 21% and 20%, respectively. The most prevalent serogroups found in each species were Ballum, Sejroe, and Australis in cattle, Ballum, Australis and Sejroe in sheep, Australis and Ballum in goats, Javanica and Australis in donkey and Australis, Ballum and Canicola in dogs. Of all the serogroups tested in this study, Icterohaemorrhagiae, the only serogroup which has been previously reported in humans in Morocco, was rarely reactive. The majority of reactive sera were collected from low land areas. A large number of sera samples classified as seronegative when tested against pathogenic leptospires were positive when tested against non-pathogenic leptospires; this is suggestive of possible novel, as yet unclassified, Leptospira serovars in Morocco. Eleven of thirteen sheep urine samples were positive by real-time PCR confirming their role as Leptospira carriers in Morocco. © 2014

Zinc accumulation in plant species indigenous to a Portuguese polluted site: relation with soil contamination.

Science.gov (United States)

Marques, Ana P G C; Rangel, António O S S; Castro, Paula M L

2007-01-01

The levels of zinc accumulated by roots, stems, and leaves of two plant species, Rubus ulmifolius and Phragmites australis, indigenous to the banks of a stream in a Portuguese contaminated site were investigated in field conditions. R. ulmifolius, a plant for which studies on phytoremediation potential are scarce, dominated on the right side of the stream, while P. australis proliferated on the other bank. Heterogeneous Zn concentrations were found along the banks of the stream. Zn accumulation in both species occurred mainly in the roots, with poor translocation to the aboveground sections. R. ulmifolius presented Zn levels in the roots ranging from 142 to 563 mg kg(-1), in the stems from 35 to 110 mg kg(-1), and in the leaves from 45 to 91 mg kg(-1), vs. average soil total Zn concentrations varying from 526 to 957 mg kg(-1). P. australis showed Zn concentrations in the roots from 39 to 130 mg kg(-1), in the stems from 31 to 63 mg kg(-1), and in the leaves from 37 to 83 mg kg(-1), for the lower average soil total Zn levels of 138 to 452 mg kg(-1) found on the banks where they proliferated. Positive correlations were found between the soil total, available and extractable Zn fractions, and metal accumulation in the roots and leaves of R. ulmifolius and in the roots and stems of P. australis. The use of R. ulmifolius and P. australis for phytoextraction purposes does not appear as an effective method of metal removing, but these native metal tolerant plant species may be used to reduce the effects of soil contamination, avoiding further Zn transfer to other environmental compartments.

Homogenous stands of a wetland grass living in heavy metal polluted wetlands harbor diverse consortia of arbuscular mycorrhizal fungi.

Science.gov (United States)

Ban, Yihui; Jiang, Yinghe; Li, Meng; Zhang, Xiangling; Zhang, Shiyang; Wu, Yang; Xu, Zhouying

2017-08-01

Over the last three decades, the presence of arbuscular mycorrhizal (AM) fungi in wetland habitats had received increased attention, however, their distribution and functions have not been studied intensively. Using Illumina sequencing technology, we examined the AM fungal communities in roots of Phragmites australis living in 3 heavy metals (HMs) polluted wetlands located in Hubei Province, China. A total of 258 operational taxonomic units (OTUs) from 235,213 sequences affiliated with 6 Glomeromycota families (Glomeraceae, Paraglomeraceae, Claroideoglomeraceae, Ambisporaceae, Archaeosporaceae, and Diversisporaceae) were obtained, with Glomeraceae and Paraglomeraceae being the most and second-most dominant family, respectively. P. australis living in the HMs polluted wetlands harbored diverse AM fungi, including many non-recorded species in upland habitats, and the OTU number which we obtained in this study was higher than most of the records of upland habitats. Dry and waterlogged samples had common OTUs, however, AM fungal communities at different levels in dry and corresponding waterlogged P. australis roots were significant different. In addition, results from this study suggested that a preemption (geometric model) species abundance distributions (SAD), which might due to the distinctive features, e.g. heavy overdominance and difference in the most dominant taxon of each sample, was observed across AM fugal taxa in P. australis roots of the 3 HMs polluted wetlands. Copyright © 2017 Elsevier Ltd. All rights reserved.

Ubiquitous distribution of fluorescent protein in muscles of four species and two subspecies of eel (genus Anguilla).

Science.gov (United States)

Funahashi, Aki; Itakura, Takao; Hassanin Abeer, A I; Komatsu, Masaharu; Hayashi, Seiichi; Kaminishi, Yoshio

2017-03-01

In this study, the localization of fluorescent protein (FP) was characterized in the muscles of four species and two subspecies of eels Anguilla anguilla, A. australis, A. bicolor bicolor (b.), A. bicolor pacifica (p.) and A. mossambica in addition to the previously reported A. japonica. The open reading frame of each eel FP was 417 bp encoding 139 amino acid residues. The deduced amino acid sequences among the four species and two subspecies exhibited 91.4-100% identity, and belonged to the fatty-acid-binding protein (FABP) family. The gene structure of eel FPs in A. japonica, A. anguilla, A. australis, A. bicolor b., A. bicolor p. and A. mossambica have four exons and three introns, and were common to that of FABP family. The apo eel FPs expressed by Escherichia coli with recombinant eel FP genes were analysed for the fluorescent properties in the presence of bilirubin. The excitation and emission spectra of holo eel FPs had the maximum wavelengths of 490-496 and 527-530 nm, respectively. The holo eel FPs indicated that the fluorescent intensities were stronger in A. japonica and A. bicolor than in A. mossambica, A. australis and A. anguilla. The comparison of amino acid sequences revealed two common substitutions in A. mossambica, A. australis and A. anguilla with weak fluorescent intensity.

Fungal disease prevention in seedlings of rice (Oryza sativa) and other grasses by growth-promoting seed-associated endophytic bacteria from invasive Phragmites australis

Science.gov (United States)

Verma, Satish K.; Kingsley, Kathryn L.; Bergen, Marshall S.; Kowalski, Kurt P.; White, James F.

2018-01-01

Non-cultivated plants carry microbial endophytes that may be used to enhance development and disease resistance of crop species where growth-promoting and protective microbes may have been lost. During seedling establishment, seedlings may be infected by several fungal pathogens that are seed or soil borne. Several species of Fusarium, Pythium and other water moulds cause seed rots during germination. Fusariumblights of seedlings are also very common and significantly affect seedling development. In the present study we screened nine endophytic bacteria isolated from the seeds of invasive Phragmites australis by inoculating onto rice, Bermuda grass (Cynodon dactylon), or annual bluegrass (Poa annua) seeds to evaluate plant growth promotion and protection from disease caused by Fusarium oxysporum. We found that three bacteria belonging to genus Pseudomonas spp. (SLB4-P. fluorescens, SLB6-Pseudomonas sp. and SY1-Pseudomonassp.) promoted seedling development, including enhancement of root and shoot growth, and stimulation of root hair formation. These bacteria were also found to increase phosphate solubilization in in vitro experiments. Pseudomonas sp. (SY1) significantly protected grass seedlings from Fusarium infection. In co-culture experiments, strain SY1 strongly inhibited fungal pathogens with 85.71% growth inhibition of F. oxysporum, 86.33% growth inhibition of Curvularia sp. and 82.14% growth inhibition of Alternaria sp. Seedlings previously treated with bacteria were found much less infected by F. oxysporum in comparison to non-treated controls. On microscopic observation we found that bacteria appeared to degrade fungal mycelia actively. Metabolite products of strain SY1 in agar were also found to inhibit fungal growth on nutrient media. Pseudomonas sp. (SY1) was found to produce antifungal volatiles. Polymerase chain reaction (PCR) amplification using specific primers for pyrrolnitirin synthesis and HCN (hydrogen cyanide) production

Calliobothrium spp. (Eucestoda: Tetraphyllidea: Onchobothriidae) in Mustelus schmitti (Chondrichthyes: Carcharhiniformes) from Argentina and Uruguay.

Science.gov (United States)

Ivanov, Verónica A; Brooks, Daniel R

2002-12-01

Three species of Calliobothrium inhabit the spiral intestine of Mustelus schmitti in Argentina and Uruguay. Calliobothrium verticillatum australis is redescribed and its taxonomic status modified to species as C. australis. Calliobothrium barbarae n. sp. can be distinguished from all other species of Calliobothrium, which are small bodied, nonlaciniate, and without accessory piece between the bases of axial hook, by worm length, number of segments, cocoon morphology, and hooks shape. Calliobothrium lunae n. sp. is different from other Calliobothrium spp., which are small bodied, nonlaciniate. and have an accessory piece, by the number of segments and testes, hook shape, cocoon morphology, and the presence of ciliumlike projections on the distal surface of muscular pads. Calliobothrium australis is clearly distinguished from other large-bodied, laciniate species of the genus by worm length, number of testes, ovary shape, cocoon morphology, hook shape, and in being hyperapolytic. The oioxenous specificity involving Calliobothrium spp. and Mustelus spp. described by previous authors is confirmed in this study.

Effects of interspecific competition on the growth of macrophytes and nutrient removal in constructed wetlands: A comparative assessment of free water surface and horizontal subsurface flow systems.

Science.gov (United States)

Zheng, Yucong; Wang, Xiaochang; Dzakpasu, Mawuli; Zhao, Yaqian; Ngo, Huu Hao; Guo, Wenshan; Ge, Yuan; Xiong, Jiaqing

2016-05-01

The outcome of competition between adjoining interspecific colonies of Phragmites and Typha in two large field pilot-scale free water surface (FWS) and subsurface flow (SSF) CWs is evaluated. According to findings, the effect of interspecific competition was notable for Phragmites australis, whereby it showed the highest growth performance in both FWS and SSF wetland. In a mixed-culture, P. australis demonstrates superiority in terms of competitive interactions for space between plants. Furthermore, the interspecific competition among planted species seemed to cause different ecological responses of plant species in the two CWs. For example, while relatively high density and shoot height determined the high aboveground dry weight of P. australis in the FWS wetland, this association was not evident in the SSF. Additionally, while plants nutrients uptake accounts for a higher proportion of the nitrogen removal in FWS, that in the SSF accounts for a higher proportion of the phosphorous removal. Copyright © 2016 Elsevier Ltd. All rights reserved.

Role of plants in nitrogen and sulfur transformations in floating hydroponic root mats: A comparison of two helophytes.

Science.gov (United States)

Saad, Rania A B; Kuschk, Peter; Wiessner, Arndt; Kappelmeyer, Uwe; Müller, Jochen A; Köser, Heinz

2016-10-01

Knowledge about the roles helophytes play in constructed wetlands (CWs) is limited, especially regarding their provision of organic rhizodeposits. Here, transformations of inorganic nitrogen and sulfur were monitored in a CW variety, floating hydroponic root mat (FHRM), treating synthetic wastewater containing low concentration of organic carbon. Two helophytes, Phragmites australis and Juncus effusus, were compared in duplicates. Striking differences were found between the FHRM of the two helophytes. Whereas ammonium was removed in all FHRMs to below detection level, total nitrogen of 1.15 ± 0.4 g m(-2) d(-1) was removed completely only in P. australis systems. The mats with J. effusus displayed effective nitrification but incomplete denitrification as 77% of the removed ammonium-nitrogen accumulated as nitrate. Furthermore, the P. australis treatment units showed on average 3 times higher sulfate-S removal rates (1.1 ± 0.45 g m(-2) d(-1)) than the systems planted with J. effusus (0.37 ± 0.29 g m(-2) d(-1)). Since the influent organic carbon was below the stoichiometric requirement for the observed N and S transformation processes, helophytes' organic rhizodeposits apparently contributed to these transformations, while P. australis provided about 6 times higher bioavailable organic rhizodeposits than J. effusus. Copyright © 2016 Elsevier Ltd. All rights reserved.

Diurnal dynamics of oxygen and carbon dioxide concentrations in shoots and rhizomes of a perennial in a constructed wetland indicate down-regulation of below ground oxygen consumption

Czech Academy of Sciences Publication Activity Database

Fausser, A. C.; Dušek, Jiří; Čížková, Hana; Kazda, M.

2016-01-01

Roč. 8, JUL (2016), č. článku plw025. ISSN 2041-2851 R&D Projects: GA MŠk(CZ) ED1.1.00/02.0073; GA MŠk(CZ) LM2010007 Institutional support: RVO:86652079 Keywords : typha-latifolia l * internal gas-transport * phragmites-australis * convective throughflow * pressurized ventilation * angustifolia l * ex steud * roots * flow * respiration * Aeration * constructed wetland * in-situ field study * internal carbon dioxide * internal oxygen dynamics * Phragmites australis Subject RIV: EF - Botanics OBOR OECD: Plant sciences, botany Impact factor: 2.238, year: 2016

Combined genomic and structural analyses of a cultured magnetotactic bacterium reveals its niche adaptation to a dynamic environment

Directory of Open Access Journals (Sweden)

Ana Carolina Vieira Araujo

2016-10-01

Full Text Available Abstract Background Magnetotactic bacteria (MTB are a unique group of prokaryotes that have a potentially high impact on global geochemical cycling of significant primary elements because of their metabolic plasticity and the ability to biomineralize iron-rich magnetic particles called magnetosomes. Understanding the genetic composition of the few cultivated MTB along with the unique morphological features of this group of bacteria may provide an important framework for discerning their potential biogeochemical roles in natural environments. Results Genomic and ultrastructural analyses were combined to characterize the cultivated magnetotactic coccus Magnetofaba australis strain IT-1. Cells of this species synthesize a single chain of elongated, cuboctahedral magnetite (Fe3O4 magnetosomes that cause them to align along magnetic field lines while they swim being propelled by two bundles of flagella at velocities up to 300 μm s−1. High-speed microscopy imaging showed the cells move in a straight line rather than in the helical trajectory described for other magnetotactic cocci. Specific genes within the genome of Mf. australis strain IT-1 suggest the strain is capable of nitrogen fixation, sulfur reduction and oxidation, synthesis of intracellular polyphosphate granules and transporting iron with low and high affinity. Mf. australis strain IT-1 and Magnetococcus marinus strain MC-1 are closely related phylogenetically although similarity values between their homologous proteins are not very high. Conclusion Mf. australis strain IT-1 inhabits a constantly changing environment and its complete genome sequence reveals a great metabolic plasticity to deal with these changes. Aside from its chemoautotrophic and chemoheterotrophic metabolism, genomic data indicate the cells are capable of nitrogen fixation, possess high and low affinity iron transporters, and might be capable of reducing and oxidizing a number of sulfur compounds. The relatively

Use of biological indexes of the common reed (Phragmites australis) seed progeny in the environmental safety of radioactive contaminated water bodies

Energy Technology Data Exchange (ETDEWEB)

Yavnyuk, A. [National Aviation University, Kiev (Ukraine); Shevtsova, N.; Gudkov, D. [Institute of Hydrobiology of the National Academy of Sciences, Kiev (Ukraine)

2014-07-01

Environmental protection requires effective monitoring system of radionuclide contamination and radiobiological effects as well as development of their prevention and minimizing measures for humans and biota. There is a majority of conventional techniques for living organisms' habitat quality assessment. One of the most widespread, convenient and accessible ones, is the seed progeny analysis, for example of conifers, cereals and wild herbaceous plants. Availability of vitality, growth, mutability indexes and abnormalities of vascular plant germs for environment quality express assessment was discussed in numerous publications. However, this point is studied insufficiently concerning aquatic vascular plants, forming communities playing significant role in radionuclides distribution in contaminated water bodies. Common reed (Phragmites australis (Trin) Ex. Steud) is a widespread species mostly dominating in air-aquatic vascular plant communities of freshwater bodies; it is a first-order {sup 137}Cs and {sup 90}Sr accumulating species. To assess the common reed germs growth indexes availability, seeds were sampled in polygon water bodies of different radionuclide contamination levels and 0.7-22 mcGy h{sup -1} total absorbed dose range, within the Chernobyl Exclusion Zone. In water bodies with background level of radionuclide contamination, for comparison, total absorbed dose varied in range of 0.03-0.3 mcGy h{sup -1}. Series of seeds germination experiments was carried out in laboratory conditions. Complex of germs indexes was investigated, conditionally divided into three groups: (1) Vitality indexes. In course of experiment series, vitality was assessed via germinating energy, germinating ability indexes, germination period (first and last germ appearance) and survivability study; (2) Growth indexes. Root and leaf length, occurrence of plant groups with different vegetative organs length were determined for germs growth speed assessment; (3) Teratological

Marine Bacteria from Danish Coastal Waters Show Antifouling Activity against the Marine Fouling Bacterium Pseudoalteromonas sp. Strain S91 and Zoospores of the Green Alga Ulva australis Independent of Bacteriocidal Activity▿†

Science.gov (United States)

Bernbom, Nete; Ng, Yoke Yin; Kjelleberg, Staffan; Harder, Tilmann; Gram, Lone

2011-01-01

The aims of this study were to determine if marine bacteria from Danish coastal waters produce antifouling compounds and if antifouling bacteria could be ascribed to specific niches or seasons. We further assess if antibacterial effect is a good proxy for antifouling activity. We isolated 110 bacteria with anti-Vibrio activity from different sample types and locations during a 1-year sampling from Danish coastal waters. The strains were identified as Pseudoalteromonas, Phaeobacter, and Vibrionaceae based on phenotypic tests and partial 16S rRNA gene sequence similarity. The numbers of bioactive bacteria were significantly higher in warmer than in colder months. While some species were isolated at all sampling locations, others were niche specific. We repeatedly isolated Phaeobacter gallaeciensis at surfaces from one site and Pseudoalteromonas tunicata at two others. Twenty-two strains, representing the major taxonomic groups, different seasons, and isolation strategies, were tested for antiadhesive effect against the marine biofilm-forming bacterium Pseudoalteromonas sp. strain S91 and zoospores of the green alga Ulva australis. The antiadhesive effects were assessed by quantifying the number of strain S91 or Ulva spores attaching to a preformed biofilm of each of the 22 strains. The strongest antifouling activity was found in Pseudoalteromonas strains. Biofilms of Pseudoalteromonas piscicida, Pseudoalteromonas tunicata, and Pseudoalteromonas ulvae prevented Pseudoalteromonas S91 from attaching to steel surfaces. P. piscicida killed S91 bacteria in the suspension cultures, whereas P. tunicata and P. ulvae did not; however, they did prevent adhesion by nonbactericidal mechanism(s). Seven Pseudoalteromonas species, including P. piscicida and P. tunicata, reduced the number of settling Ulva zoospores to less than 10% of the number settling on control surfaces. The antifouling alpP gene was detected only in P. tunicata strains (with purple and yellow pigmentation), so

The effects of two phospholipase A2 inhibitors on the neuromuscular blocking activities of homologous phospholipases A2 from the venom of Pseudechis australis, the Australian king brown snake.

Science.gov (United States)

Fatehi, M; Rowan, E G; Harvey, A L

1995-12-01

Previous studies have shown that homologous phospholipases A2 (PLA2) (Pa-3, Pa-9C, Pa-10F and Pa-11) from the venom of the Australian king brown snake, Pseudechis australis, significantly reduce the resting membrane potentials and quantal contents of endplate potentials recorded from endplate regions of mouse triangularis sterni nerve-muscle preparations. It is not clear whether PLA2 activity is essential for their neuromuscular activities. Therefore, pharmacological studies were carried out to determine whether neuromuscular activity of the toxins changed after treatment with the phospholipase A2 inhibitors 7,7-dimethyl-eicosadienoic acid (DEDA) and manoalide. After incubation of the toxins with manoalide (120 nM), or DEDA (50 microM), no PLA2 activity against 1-stearoyl 2-[3H]arachidonoylglycerophosphocholine was detected. After incubation with manoalide and/or DEDA, the toxins did not depolarize muscle fibre membranes up to 60 min after administration. However, manoalide and DEDA had different influences on the inhibitory effect of these toxic enzymes on acetylcholine release from nerve terminals. Manoalide abolished the inhibitory effect of the toxins on evoked release of acetylcholine. In contrast, DEDA was not able to prevent the reduction of quantal content of endplate potentials induced by the toxins. This study provides evidence that the depolarizing action and the inhibitory effect on release of acetylcholine exerted by these toxic PLA2 from king brown snake are independent phenomena. The evidence for this conclusion was that inhibition of enzymatic activity with an arachidonic acid analogue (DEDA) abolished the depolarizing effect of the toxins but not the effects on the quantal release of acetylcholine from mouse motor nerve terminals. The data suggest that the depolarizing effect of these toxins is probably due to the enzymatic activity. Since manoalide interacts with lysine residues of PLA2 polypeptides, and, as shown here, manoalide prevented

Bioatividade de três espécies vegetais nativas da Floresta Atlântica brasileira frente ao microcrustáceo Artemia salina

Directory of Open Access Journals (Sweden)

W.M Pompilho

2014-09-01

Full Text Available Este trabalho teve por objetivo a investigação fitoquímica e propriedades antioxidantes de extratos das folhas de Trigynaea oblongifolia Schltdl (Annonaceae, Ottonia frutescens Trel (Piperaceae, e Bathysa australis (St Hill Hooz (Rubiaceae, bem como avaliar, in vitro, a letalidade frente ao microcrustáceo Artemia salina Leach. Os extratos foram preparados por maceração em metanol 10% (p/v por sete dias, à temperatura ambiente. A atividade antioxidante dos extratos foi determinada pela metodologia que utiliza o radical estável DPPH. A toxicidade dos extratos foi avaliada frente ao microcrustáceo A. salina. Os extratos de O. frutescens e B. australis apresentaram as seguintes classes de metabólitos secundários: Alcalóides, Antraquinonas, Cumarinas, Polifenóis (Taninos, Saponinas. Nos extratos de T. oblongifolia, além dos metabólitos citados anteriormente, foi detectada a presença de Flavonóides. A atividade antioxidante, observada em 30 minutos na concentração de 24 µg/mL de extrato, foi de: O. frutescens - 38,3%, T. oblongifolia - 32,3%, e B. australis - 32,1%. A Concentração Letal, CL50, dos extratos em A. salina foi de: O. frutescens - 149,75 ± 1,02 µg/mL, T. oblongifolia - 148,8 ± 1,74 µg/mL, e B. australis - 684 ± 9,04 µg/mL. Neste contexto, destacamos as espécies, nativas da Floresta Atlântica, O. frutescens e T. oblongifolia de grande potencial na bioprospecção de moléculas biologicamente ativas.

The lumbosacral plexus of the red-rumped agouti (Dasyprocta leporina Linnaeus, 1758 (Rodentia: Caviidae

Directory of Open Access Journals (Sweden)

Gleidson Benevides de Oliveira

2016-12-01

Full Text Available The red-rumped agouti is a small-sized wild rodent, belonging to the Dasyproctidae family, with great zootechnical potential, and it adapts well to captivity. In order to contribute to the species biology, this study describes the origin of the nerves forming the lumbosacral plexus. Twelve animals (six males and six females were used, from previous experiments. The animals were fixed in a 10% formaldehyde aqueous solution and eviscerated after 72 hours. Then, the major and minor psoas muscles were retracted, exposing the nerves forming the plexus. Cotton soaked with 20-volume hydrogen peroxide was placed on these nerves, remaining for 12 hours straight for bleaching and subsequent dissection. The topographical relations of the lumbosacral plexus were grouped into tables and arranged in terms of simple percentage. In 7 cases (58.34%, the lumbosacral plexus in the red-rumped agouti stemmed from the ventral roots of the last 4 lumbar nerves and the first 3 sacral nerves (Type I – L4-S3, in 4 animals (33.33% it stemmed from L5-S3 (Type II, and in 1 case (8.33% it stemmed from L5-S4 (Type III. The nerves participating of the lumbosacral plexus in the red-rumped agouti were: lateral femoral cutaneous, genitofemoral, femoral, obturator, sciatic, cranial gluteal, caudal gluteal, and pudendal nerve. The origin of the lumbosacral plexus and the spinal nerves making up this plexus in red-rumped agoutis were similar to that described in other rodents, such as rock cavy, lowland paca and spix's yellow-toothed cavy.

An acyltransferase gene that putatively functions in anthocyanin modification was horizontally transferred from Fabaceae into the genus Cuscuta

Directory of Open Access Journals (Sweden)

Ting Sun

2016-06-01

Full Text Available Horizontal gene transfer (HGT refers to the flow of genetic materials to non-offspring, and occasionally HGT in plants can improve the adaptation of organisms in new niches due to expanded metabolic capability. Anthocyanins are an important group of water-soluble red, purple, or blue secondary metabolites, whose diversity results from modification after the main skeleton biosynthesis. Cuscuta is a stem holoparasitic genus, whose members form direct connection with hosts to withdraw water, nutrients, and macromolecules. Such intimate association is thought to increase the frequency of HGT. By transcriptome screening for foreign genes in Cuscuta australis, we discovered that one gene encoding a putative anthocyanin acyltransferase gene of the BAHD family, which is likely to be involved in anthocyanin modification, was acquired by C. australis from Fabaceae through HGT. The anthocyanin acyltransferase-like (AT-like gene was confirmed to be present in the genome assembly of C. australis and the transcriptomes of Cuscuta pentagona. The higher transcriptional level in old stems is consistent with its putative function in secondary metabolism by stabilizing anthocyanin at neutral pH and thus HGT of this AT-like gene may have improved biotic and abiotic resistance of Cuscuta.

Role of extrinsic arbuscular mycorrhizal fungi in heavy metal-contaminated wetlands with various soil moisture levels.

Science.gov (United States)

Zheng, S; Wang, C; Shen, Z; Quan, Y; Liu, X

2015-01-01

This study presents an efficient heavy metal (HM) control method in HM-contaminated wetlands with varied soil moisture levels through the introduction of extrinsic arbuscular mycorrhizal fungi (AMF) into natural wetland soil containing indigenous AMF species. A pot culture experiment was designed to determine the effect of two soil water contents (5-8% and 25-30%), five extrinsic AMF inoculants (Glomus mosseae, G. clarum, G. claroideum, G. etunicatum, and G. intraradices), and HM contamination on root colonization, plant growth, and element uptake of common reed (Phragmites australis (Cav.) Trin. ex Steudel) plantlets in wetland soils. This study showed the prevalence of mycorrhizae in the roots of all P. australis plantlets, regardless of extrinsic AMF inoculations, varied soil moisture or HM levels. It seems that different extrinsic AMF inoculations effectively lowered HM concentrations in the aboveground tissues of P. australis at two soil moisture levels. However, metal species, metal concentrations, and soil moisture should also be very important factors influencing the elemental uptake performance of plants in wetland ecosystems. Besides, the soil moisture level significantly influenced plant growth (including height, and shoot and root dry weight (DW)), and extrinsic AMF inoculations differently affected shoot DW.

Changes of Species Richness in Heathland Communities over 15 Years following Disturbances

Directory of Open Access Journals (Sweden)

L. Calvo

2012-01-01

Full Text Available The aim of this study was to define the species richness patterns over a period of 15 years during the vegetation recovery process after disturbances (burning, cutting and ploughing in heathlands. Three communities were selected: two dominated by Erica australis and one dominated by Calluna vulgaris. The alpha and gamma diversity patterns were site specific and influenced by the ecological traits of dominant shrub species. The shrubland dominated by Erica australis, typical resprouters with a fast regeneration, showed the highest values of alpha and gamma diversity during the first 7 years of regeneration. The heathland dominated by Calluna vulgaris, an obligate seeder, had a contrasting pattern of alpha and gamma diversity, as the highest values appeared from year 7 until year 14. Thus, the speed of regeneration of the dominant shrub species could be the main factor affecting structural parameters in these communities. Species richness patterns did not vary in relation to the different types of perturbation. Cutting and burning would be the most suitable forestry management strategies to conserve Erica australis heathlands, but burning is more appropriate in Calluna vulgaris ones because cutting modified this community.

First report on the contribution of small-sized species to the copepod community structure of the southern Patagonian shelf (Argentina, 47-55°S

Directory of Open Access Journals (Sweden)

Julieta Carolina Antacli

2014-03-01

Full Text Available The copepod community structure, with special emphasis on small-sized species, was studied over the southern Patagonian shelf in late summer 2004, applying the first plankton sampling in the region with a fine-mesh (66 μm net. The key role of the copepods Drepanopus forcipatus and Calanus australis was confirmed, but also the high abundance and frequency of occurrence of the microcopepods Oithona helgolandica and Microsetella norvegica and of the medium-sized copepod Ctenocalanus vanus were revealed. Copepod community structure was nearly homogenous over the entire study area. Drepanopus forcipatus, O. helgolandica and M. norvegica were identified as the typical species of the region, although secondarily C. australis and Oithona atlantica also contributed significantly to community similarity across the area. The study of interspecific relationships of dominant copepods indicated that D. forcipatus and C. australis were associated positively with O. helgolandica, while C. vanus, and M. norvegica constituted a separate assemblage with Clausocalanus brevipes and O. atlantica. The importance of fine-mesh-size nets for collecting the smaller size fractions of mesozooplankton and for accurately portraying the mesozooplankton assemblage structure in the area is stressed by this study.

The genus Basilichthys (Teleostei: Atherinopsidae revisited along its Chilean distribution range (21° to 40° S using variation in morphologyand mtDNA El género Basilichthys (Teleostei: Atherinopsidae analizado a lo largo de su distribución en Chile (21° a 40° S, utilizando rasgos morfológicos y variabilidad del ADN mitocondrial

Directory of Open Access Journals (Sweden)

DAVID VÉLIZ

2012-03-01

Full Text Available There is still doubt as to the number of species of the freshwater Chilean ichthyofauna, 64 % of which have conservation problems. One of the groups is that of the silversides of the genus Basilichthys. Three morphological species of this genus have been described in Chile with disjoint distributions: Basilichthys semotilus, B. microlepidotus and B. australis; the latter two overlap in distribution only in the Aconcagua River and are not easily distinguishable by morphological and meristic characters. In order to evaluate the efficacy of identification of these species by molecular techniques, we analyzed the sequence of 9 % of the mitochondrial DNA (Control Region and COI of individuals from the Loa River (21°41' S to the Valdivia River (39°50' S, adding meristic features for B. microlepidotus and B. australis in order to study population variation to clarify the taxonomy of the native species of the genus. The phylogenetic analysis showed that the individuals of Basilichthys semotilus form an haplogroup separated from the other species of the genus; however, B. australis and B. microlepidotus form a monophyletic group that shares the most common haplotypes. An analysis of meristic information showed no statistically significant differences in the number of lateral line scales or number of rays in the fins between B. microlepidotus and B. australis. These results do not support the current classification for the latter two species; there appears to be one group in the extreme north of the country (Basilichthys semotilus and a second group in central Chile which should be called B. microlepidotus. This information will be useful to review the conservation status of the Chilean fauna.Si bien aún existen dudas sobre el número de especies descritas en el país, se reconoce que el 64 % de la ictiofauna dulceacuícola chilena se encuentra en alguna categoría de peligro de conservación. Uno de los grupos categorizados como vulnerable y en

Effects of Spartina alterniflora invasion on the communities of methanogens and sulfate-reducing bacteria in estuarine marsh sediments

Directory of Open Access Journals (Sweden)

Jemaneh eZeleke

2013-08-01

Full Text Available The effect of plant invasion on the microorganisms of soil sediments is very important for estuary ecology. The community structures of methanogens and sulfate-reducing bacteria (SRB as a function of Spartina alterniflora invasion in Phragmites australis-vegetated sediments of the Dongtan wetland in the Yangtze River estuary, China, were investigated using 454 pyrosequencing and quantitative real-time PCR (qPCR of the methyl coenzyme M reductase A (mcrA and dissimilatory sulfite-reductase (dsrB genes. Sediment samples were collected from two replicate locations, and each location included three sampling stands each covered by monocultures of P. australis, S. alterniflora and both plants (transition stands, respectively. qPCR analysis revealed higher copy numbers of mcrA genes in sediments from S. alterniflora stands than P. australis stands (5- and 7.5-fold more in the spring and summer, respectively, which is consistent with the higher methane flux rates measured in the S. alterniflora stands (up to 8.01 ± 5.61 mg m-2 h-1. Similar trends were observed for SRB, and they were up to two orders of magnitude higher than the methanogens. Diversity indices indicated a lower diversity of methanogens in the S. alterniflora stands than the P. australis stands. In contrast, insignificant variations were observed in the diversity of SRB with the invasion. Although Methanomicrobiales and Methanococcales, the hydrogenotrophic methanogens, dominated in the salt marsh, Methanomicrobiales displayed a slight increase with the invasion and growth of S. alterniflora, whereas the later responded differently. Methanosarcina, the metabolically diverse methanogens, did not vary with the invasion of, but Methanosaeta, the exclusive acetate utilizers, appeared to increase with S. alterniflora invasion. In SRB, sequences closely related to the families Desulfobacteraceae and Desulfobulbaceae dominated in the salt marsh, although they displayed minimal changes with the S

Vegetation types alter soil respiration and its temperature sensitivity at the field scale in an estuary wetland.

Directory of Open Access Journals (Sweden)

Guangxuan Han

Full Text Available Vegetation type plays an important role in regulating the temporal and spatial variation of soil respiration. Therefore, vegetation patchiness may cause high uncertainties in the estimates of soil respiration for scaling field measurements to ecosystem level. Few studies provide insights regarding the influence of vegetation types on soil respiration and its temperature sensitivity in an estuary wetland. In order to enhance the understanding of this issue, we focused on the growing season and investigated how the soil respiration and its temperature sensitivity are affected by the different vegetation (Phragmites australis, Suaeda salsa and bare soil in the Yellow River Estuary. During the growing season, there were significant linear relationships between soil respiration rates and shoot and root biomass, respectively. On the diurnal timescale, daytime soil respiration was more dependent on net photosynthesis. A positive correlation between soil respiration and net photosynthesis at the Phragmites australis site was found. There were exponential correlations between soil respiration and soil temperature, and the fitted Q10 values varied among different vegetation types (1.81, 2.15 and 3.43 for Phragmites australis, Suaeda salsa and bare soil sites, respectively. During the growing season, the mean soil respiration was consistently higher at the Phragmites australis site (1.11 µmol CO2 m(-2 s(-1, followed by the Suaeda salsa site (0.77 µmol CO2 m(-2 s(-1 and the bare soil site (0.41 µmol CO2 m(-2 s(-1. The mean monthly soil respiration was positively correlated with shoot and root biomass, total C, and total N among the three vegetation patches. Our results suggest that vegetation patchiness at a field scale might have a large impact on ecosystem-scale soil respiration. Therefore, it is necessary to consider the differences in vegetation types when using models to evaluate soil respiration in an estuary wetland.

Soroprevalência da infecção leptospiral em capivaras (Hydrochoerus hydrochaeris abatidas em um frigorífico do Rio Grande do Sul Seroprevalence of leptospiral infection in capybaras (Hydrochoerus hydrochaeris in a slaughterhouse of Rio Grande do Sul, Brazil

Directory of Open Access Journals (Sweden)

Éverton F. Silva

2009-02-01

Full Text Available Capivaras (Hydrochoerus hydrochaeris são roedores selvagens do continente americano com crescente importância comercial como fonte alternativa de carne para o consumo humano. Nessa espécie, os estudos sobre a soroprevalência da infecção leptospiral são escassos e restritos aos espécimes de vida livre. Relatamos aqui reações positivas para anticorpos aglutinantes anti-leptospiras em 27,3% (6/22 das capivaras abatidas em um frigorífico do Rio Grande do Sul. Os níveis mais altos de anticorpos sugerem infecção pelo sorogrupo Australis devido à reação para uma cepa de referência do sorovar Bratislava e para um isolado canino local do sorovar Australis, caracterizado como Leptospira noguchii. Esses resultados ressaltam que considerável parcela de capivaras criadas em cativeiro podem funcionar como reservatório de leptospiras patogênicas e chamam atenção para o risco ocupacional dos trabalhos que envolvem a criação e o abate dessa espécie animal.Capybaras (Hydrochoerus hydrochaeris are wild rodents from the American Continent with increasing importance as a commercial alternative source of meat for human consumption. Studies on seroprevalence for leptospiral infection are scarce and restricted to free living capybaras. We report detection of agglutinating antibodies against leptospires in 27% (6/22 of all animals in a slaughterhouse from Rio Grande do Sul. The highest antibody titers predicted Australis as the infecting serogroup due to reactions against a reference strain of serovar Bratislava and a canine local isolate of serovar Australis, characterized as Leptospira noguchii. The data presented in this report highlight that a considerable fraction of capybaras in captivity may behave as reservoir for pathogenic leptospires emphasizing the occupational risk of those who deal with animal farming and slaughter.

Biosorption of cesium by native and chemically modified biomass of marine algae: introduce the new biosorbents for biotechnology applications

International Nuclear Information System (INIS)

Jalali-Rad, R.; Ghafourian, H.; Asef, Y.; Dalir, S.T.; Sahafipour, M.H.; Gharanjik, B.M.

2004-01-01

Biosorption batch experiments were conducted to determine the cesium binding ability of native biomass and chemically modified biosorbents derived from marine algae, namely ferrocyanide algal sorbents type 1 and type 2 (FASs1 and FASs2). The applicability of the Langmuir and Freundlich isotherms for representation of the experimental data was investigated. The cesium sorption performances of the various types of sorbents were compared using the maximum capacities (q max values) obtained from fitting the Langmuir isotherm to the values calculated from the sorption experiments, which FASs type 1 and type 2 showed better sorption performances for cesium. FASs1 and FASs2 derived from formaldehyde and glutaraldehyde crosslinked Padina australis exhibited lower sorption capacities than those prepared from the non-crosslinked one. Most of the cesium ions were bound to FASs1, derived from Sargassum glaucescens and P. australis, in <2 min and equilibrium reached within the first 30 min of contact. Biosorption of cesium by FASs1 derived from P. australis and Cystoseria indica was constantly occurred at a wide range of pH, between 1 and 10, and the highest removal took place at pH 4. The presence of sodium and potassium at 0.5 and 1 mM did not inhibit cesium biosorption by algae biomass. The maximum cesium uptake was acquired using the large particles of FAS2 originated from S. glaucescens (2-4 mm). Desorption of cesium from the metal-laden FASs1 (from P. australis, S. glaucescens and Dictyota indica) was completely achieved applying 0.5 and 1 M NaOH and KOH, although the cesium sorption capacity of the biosorbents (from C. indica and S. glaucescens) decreased by 46-51% after 9 sorption-desorption cycles

Biosorption of cesium by native and chemically modified biomass of marine algae: introduce the new biosorbents for biotechnology applications

Energy Technology Data Exchange (ETDEWEB)

Jalali-Rad, R. [Department of Biotechnology, Nuclear Research Center, Atomic Energy Organization of Iran, Tehran (Iran, Islamic Republic of)]. E-mail: rjalali@aeoi.org.ir; Ghafourian, H. [Department of Biotechnology, Nuclear Research Center, Atomic Energy Organization of Iran, Tehran (Iran, Islamic Republic of); Asef, Y. [Department of Biotechnology, Nuclear Research Center, Atomic Energy Organization of Iran, Tehran (Iran, Islamic Republic of); Dalir, S.T. [Department of Biotechnology, Nuclear Research Center, Atomic Energy Organization of Iran, Tehran (Iran, Islamic Republic of); Sahafipour, M.H. [Department of Biotechnology, Nuclear Research Center, Atomic Energy Organization of Iran, Tehran (Iran, Islamic Republic of); Gharanjik, B.M. [Offshore Fisheries Research Center, Chabahar (Iran, Islamic Republic of)

2004-12-10

Biosorption batch experiments were conducted to determine the cesium binding ability of native biomass and chemically modified biosorbents derived from marine algae, namely ferrocyanide algal sorbents type 1 and type 2 (FASs1 and FASs2). The applicability of the Langmuir and Freundlich isotherms for representation of the experimental data was investigated. The cesium sorption performances of the various types of sorbents were compared using the maximum capacities (q{sub max} values) obtained from fitting the Langmuir isotherm to the values calculated from the sorption experiments, which FASs type 1 and type 2 showed better sorption performances for cesium. FASs1 and FASs2 derived from formaldehyde and glutaraldehyde crosslinked Padina australis exhibited lower sorption capacities than those prepared from the non-crosslinked one. Most of the cesium ions were bound to FASs1, derived from Sargassum glaucescens and P. australis, in <2 min and equilibrium reached within the first 30 min of contact. Biosorption of cesium by FASs1 derived from P. australis and Cystoseria indica was constantly occurred at a wide range of pH, between 1 and 10, and the highest removal took place at pH 4. The presence of sodium and potassium at 0.5 and 1 mM did not inhibit cesium biosorption by algae biomass. The maximum cesium uptake was acquired using the large particles of FAS2 originated from S. glaucescens (2-4 mm). Desorption of cesium from the metal-laden FASs1 (from P. australis, S. glaucescens and Dictyota indica) was completely achieved applying 0.5 and 1 M NaOH and KOH, although the cesium sorption capacity of the biosorbents (from C. indica and S. glaucescens) decreased by 46-51% after 9 sorption-desorption cycles.

Microsensor studies on Padina from a natural CO2 seep: implications of morphology on acclimation to low pH.

Science.gov (United States)

Hofmann, Laurie C; Fink, Artur; Bischof, Kai; de Beer, Dirk

2015-12-01

Low seawater pH can be harmful to many calcifying marine organisms, but the calcifying macroalgae Padina spp. flourish at natural submarine carbon dioxide seeps where seawater pH is low. We show that the microenvironment created by the rolled thallus margin of Padina australis facilitates supersaturation of CaCO3 and calcifi-cation via photosynthesis-induced elevated pH. Using microsensors to investigate oxygen and pH dynamics in the microenvironment of P. australis at a shallow CO2 seep, we found that, under saturating light, the pH inside the microenvironment (pHME ) was higher than the external seawater (pHSW ) at all pHSW levels investigated, and the difference (i.e., pHME - pHSW ) increased with decreasing pHSW (0.9 units at pHSW 7.0). Gross photosynthesis (Pg ) inside the microenvironment increased with decreasing pHSW , but algae from the control site reached a threshold at pH 6.5. Seep algae showed no pH threshold with respect to Pg within the pHSW range investigated. The external carbonic anhydrase (CA) inhibitor, acetazolamide, strongly inhibited Pg of P. australis at pHSW 8.2, but the effect was diminished under low pHSW (6.4-7.5), suggesting a greater dependence on membrane-bound CA for the dehydration of HCO3 (-) ions during dissolved inorganic carbon uptake at the higher pHSW . In comparison, a calcifying green alga, Halimeda cuneata f. digitata, was not inhibited by AZ, suggesting efficient bicarbonate transport. The ability of P. australis to elevate pHME at the site of calcification and its strong dependence on CA may explain why it can thrive at low pHSW . © 2015 Phycological Society of America.

Vegetation Types Alter Soil Respiration and Its Temperature Sensitivity at the Field Scale in an Estuary Wetland

Science.gov (United States)

Han, Guangxuan; Xing, Qinghui; Luo, Yiqi; Rafique, Rashad; Yu, Junbao; Mikle, Nate

2014-01-01

Vegetation type plays an important role in regulating the temporal and spatial variation of soil respiration. Therefore, vegetation patchiness may cause high uncertainties in the estimates of soil respiration for scaling field measurements to ecosystem level. Few studies provide insights regarding the influence of vegetation types on soil respiration and its temperature sensitivity in an estuary wetland. In order to enhance the understanding of this issue, we focused on the growing season and investigated how the soil respiration and its temperature sensitivity are affected by the different vegetation (Phragmites australis, Suaeda salsa and bare soil) in the Yellow River Estuary. During the growing season, there were significant linear relationships between soil respiration rates and shoot and root biomass, respectively. On the diurnal timescale, daytime soil respiration was more dependent on net photosynthesis. A positive correlation between soil respiration and net photosynthesis at the Phragmites australis site was found. There were exponential correlations between soil respiration and soil temperature, and the fitted Q 10 values varied among different vegetation types (1.81, 2.15 and 3.43 for Phragmites australis, Suaeda salsa and bare soil sites, respectively). During the growing season, the mean soil respiration was consistently higher at the Phragmites australis site (1.11 µmol CO2 m−2 s−1), followed by the Suaeda salsa site (0.77 µmol CO2 m−2 s−1) and the bare soil site (0.41 µmol CO2 m−2 s−1). The mean monthly soil respiration was positively correlated with shoot and root biomass, total C, and total N among the three vegetation patches. Our results suggest that vegetation patchiness at a field scale might have a large impact on ecosystem-scale soil respiration. Therefore, it is necessary to consider the differences in vegetation types when using models to evaluate soil respiration in an estuary wetland. PMID:24608636

Tidal flushing restores the physiological condition of fish residing in degraded salt marshes.

Directory of Open Access Journals (Sweden)

Kimberly L Dibble

Full Text Available Roads, bridges, and dikes constructed across salt marshes can restrict tidal flow, degrade habitat quality for nekton, and facilitate invasion by non-native plants including Phragmites australis. Introduced P. australis contributes to marsh accretion and eliminates marsh surface pools thereby adversely affecting fish by reducing access to intertidal habitats essential for feeding, reproduction, and refuge. Our study assessed the condition of resident fish populations (Fundulus heteroclitus at four tidally restricted and four tidally restored marshes in New England invaded by P. australis relative to adjacent reference salt marshes. We used physiological and morphological indicators of fish condition, including proximate body composition (% lipid, % lean dry, % water, recent daily growth rate, age class distributions, parasite prevalence, female gravidity status, length-weight regressions, and a common morphological indicator (Fulton's K to assess impacts to fish health. We detected a significant increase in the quantity of parasites infecting fish in tidally restricted marshes but not in those where tidal flow was restored to reduce P. australis cover. Using fish length as a covariate, we found that unparasitized, non-gravid F. heteroclitus in tidally restricted marshes had significantly reduced lipid reserves and increased lean dry (structural mass relative to fish residing in reference marshes. Fish in tidally restored marshes were equivalent across all metrics relative to those in reference marshes indicating that habitat quality was restored via increased tidal flushing. Reference marshes adjacent to tidally restored sites contained the highest abundance of young fish (ages 0-1 while tidally restricted marshes contained the lowest. Results indicate that F. heteroclitus residing in physically and hydrologically altered marshes are at a disadvantage relative to fish in reference marshes but the effects can be reversed through ecological

The Effect of Restoration on Soil Respiration in an Urban Tidal Wetland in the Meadowlands, New Jersey

Science.gov (United States)

Schafer, K. V.; Kurepa, S.; Duman, T.; Scott, M.; Pechmann, I.; Vanderklein, D. W.

2017-12-01

The effect of wetland restoration on soil respiration in tidal brackish marshes has not been comprehensively studied. In New Jersey, common mitigation efforts come in the form of the removal of an invasive haplotype of Phragmites australis and replanting of native species, resulting in significant habitat disturbance. This study investigated the differences in soil respiration within and between areas covered with P. australis, Spartina alterniflora, and Spartina patens. We performed static chamber measurements of soil respiration using an infrared gas analyzer to measure CO2 fluxes in a natural site and a mitigated site in the Meadowlands of New Jersey. Daytime measurements were performed in 10 random locations in areas populated with each of the vegetation types, to represent the spatial heterogeneity of the wetland area, during summer 2017. Due to the nature of the wetland, vegetation had to be removed to uncover the soil. Prior to measuring exposed soil respiration, we therefore measured CO2 flux including the vegetation within the chamber, which allowed us to additionally calculate the respiration including the vegetation. Furthermore, we assessed direct respiration of green leaves with leaf gas exchange measurements. Combining these different methodologies and scales allow us to estimate the function of different components that contribute to total respiration from the wetland, and how they change spatially and temporally. Initial results showed that soil respiration in P. australis patches was much higher than in both Spartina species, however average vegetation respiration per unit mass was similar across all three. Vegetation respiration and soil respiration are of the same order of magnitude in all three species as well. Also, when respiration with and without vegetation was combined, P. australis showed a considerably higher flux.

Interannual variations in the hatching pattern, larval growth and otolith size of a sand-dwelling fish from central Chile

Science.gov (United States)

Rodríguez-Valentino, Camilo; Landaeta, Mauricio F.; Castillo-Hidalgo, Gissella; Bustos, Claudia A.; Plaza, Guido; Ojeda, F. Patricio

2015-09-01

The interannual variation (2010-2013) of larval abundance, growth and hatching patterns of the Chilean sand stargazer Sindoscopus australis (Pisces: Dactyloscopidae) was investigated through otolith microstructure analysis from samples collected nearshore (otolith size (radius, perimeter and area), related to body length of larvae, significantly decreased from 2010 to 2012, but increases significantly in 2013. Although the mean values of microincrement widths of sagitta otoliths were similar between 2010 and 2011 (around 0.6-0.7 μm), the interindividual variability increases in 2011 and 2013, suggesting large environmental variability experienced by larvae during these years. Finally, the hatching pattern of S. australis changed significantly from semi-lunar to lunar cycle after 2012.

POTENSI RUMPUT LAUT DI PANTAI BAYAH, KABUPATEN LEBAK, BANTEN SEBAGAI ANTIBAKTERI Escherichia coli

Directory of Open Access Journals (Sweden)

Triastinurmiatiningsih Triastinurmiatiningsih

2008-07-01

Full Text Available Antibacterial potency of some seaweed against Escherichia coli has been known. The aim of this research is to know the species of seaweeds from Bayah beach Lebak Banten which may be used as antibacterial against Escherichia coli. Twenty one seaweed species samples from Bayah Beach Lebak Banten were exstracted by organic solvent of absolute methanol according to Espeche, Fraile, and Mayer (1984 and Darusman, Sayuti, Komar & Pamungkas (1992 methods. The antibacterial activities were examined by means of Kirby-Bauer or diffusion method. The results showed antibacterial activities occur from the extract of Boodlea composite, Chaetomorpha crassa, Ulva fasciata, Sargassum crustaefolium, Padina australis and Halimeda gracilis. Sofar, Padina australis extract had shown better inhibitory activities than others.

Remediation of mercury-polluted soils using artificial wetlands.

Science.gov (United States)

García-Mercadoa, Héctor Daniel; Fernándezb, Georgina; Garzón-Zúñigac, Marco Antonio; Durán-Domínguez-de-Bazúaa, María Del Carmen

2017-01-02

Mexico's mercury mining industry is important for economic development, but has unfortunately contaminated soils due to open-air disposal. This case was seen at two sites in the municipality of Pinal de Amoles, State of Queretaro, Mexico. This paper presents an evaluation of mercury dynamics and biogeochemistry in two soils (mining waste soil) using ex-situ wetlands over 36 weeks. In soils sampled in two former mines of Pinal de Amoles, initial mercury concentrations were 424 ± 29 and 433 ± 12 mg kg -1 in La Lorena and San Jose, former mines, respectively. Typha latifolia and Phragmites australis were used and 20 reactors were constructed (with and without plants). The reactors were weekly amended with a nutrient solution (NPK), for each plant, at a pH of 5.0. For remediation using soils from San Jose 70-78% of mercury was removed in T. latifolia reactors and 76-82% in P. australis reactors, and for remediation of soils from La Lorena, mercury content was reduced by 55-71% using T. latifolia and 58-66% in P. australis reactors. Mercury emissions into the atmosphere were estimated to be 2-4 mg m -2 h -1 for both soils.

Habitat-dependent changes in vigilance behaviour of Red-crowned Crane influenced by wildlife tourism.

Science.gov (United States)

Li, Donglai; Liu, Yu; Sun, Xinghai; Lloyd, Huw; Zhu, Shuyu; Zhang, Shuyan; Wan, Dongmei; Zhang, Zhengwang

2017-11-30

The Endangered Red-crowned Crane (Grus japonensis) is one of the most culturally iconic and sought-after species by wildlife tourists. Here we investigate how the presence of tourists influence the vigilance behaviour of cranes foraging in Suaeda salsa salt marshes and S. salsa/Phragmites australis mosaic habitat in the Yellow River Delta, China. We found that both the frequency and duration of crane vigilance significantly increased in the presence of wildlife tourists. Increased frequency in crane vigilance only occurred in the much taller S. salsa/P. australis mosaic vegetation whereas the duration of vigilance showed no significant difference between the two habitats. Crane vigilance declined with increasing distance from wildlife tourists in the two habitats, with a minimum distance of disturbance triggering a high degree of vigilance by cranes identified at 300 m. The presence of wildlife tourists may represent a form of disturbance to foraging cranes but is habitat dependent. Taller P. australis vegetation serves primarily as a visual obstruction for cranes, causing them to increase the frequency of vigilance behaviour. Our findings have important implications for the conservation of the migratory red-crowned crane population that winters in the Yellow River Delta and can help inform visitor management.

Development of the inverted visceral yolk sac in three species of caviids (Rodentia, Caviomorpha, Caviidae).

Science.gov (United States)

Miglino, M A; Franciolli, A L R; de Oliveira, M F; Ambrósio, C E; Bonatelli, M; Machado, M R F; Mess, A

2008-08-01

Guinea pig related rodents possess numerous derived placental characters. We attempt to identify diversity within the visceral yolk sac and its association with the chorioallantoic placenta in three species of caviids, two of them possessing a capsule formed by the decidua that covers the chorioallantoic placenta. The results verify that in early pregnancy all three species have an inverted yolk sac placenta. In advanced pregnancy the species differ: Galea spixii, as representative without a capsule, bear a yolk sac in apposition to the chorioallantoic placenta with signs of exchange activity until term. Galea is similar to other caviomorphs in this respect. In Dasyprocta leporina and Cuniculus paca, the representatives possessing a capsule, the yolk sac endoderm lacks signs of substance exchange. Evidently, the presence of a capsule prevents such an interaction. The variations established here must be considered if animal models for human placentation are required which have restricted access to the chorioallantoic placenta from the outside.

A new karyotype for the genus Cavia from a southern island of Brazil (Rodentia - Caviidae

Directory of Open Access Journals (Sweden)

A. Gava

1998-03-01

Full Text Available Intraspecific karyotype variation in mammal species is very common and often caused by centromeric fusion of acrocentric chromosomes. We describe here a new karyotype 2n = 62 (FN = 112 for the genus Cavia from the Moleques do Sul Islands, of the southern coast of Brazil. We analyzed two male and four female karyotypes that had twenty-four biarmed pairs and six pairs of acrocentric chromosomes. The sexual pair consisted of a metacentric X-chromosome and a large acrocentric Y. C-bands were found in the centromeric and pericentromeric regions of almost all chromosomes, except for some small biarmed and acrocentric ones. Nucleolus organizer regions appeared in two biarmed chromosomes, and G-banding patterns were also seen.RESUMO A variação cariotípica nas espécies de mamíferos é bastante comum e geralmente causada pela fusão de cromossomos acrocêntricos. Foi descrito neste trabalho um novo cariótipo, com 2n = 62 e FN = 112, para o gênero Cavia proveniente das ilhas Moleques do Sul, da costa sul do Brasil. Foram analisados os cariótipos de dois machos e quatro fêmeas que possuiam 24 pares de cromossomos com dois braços e seis pares de acrocêntricos. O par sexual era constituído por um cromossomo X metacêntrico grande e um Y acrocêntrico. As bandas C estavam localizadas nas regiões centroméricas e pericentroméricas da maioria dos cromossomos, com exceção de alguns acrocêntricos e os cromossomos de dois braços menores. As regiões organizadoras de nucléolo ocorreram em dois cromossomos com dois braços e o padrão de bandamento G foi também apresentado.

Genetic diversity and population structure of the Guinea pig (Cavia porcellus, Rodentia, Caviidae) in Colombia.

Science.gov (United States)

Burgos-Paz, William; Cerón-Muñoz, Mario; Solarte-Portilla, Carlos

2011-10-01

The aim was to establish the genetic diversity and population structure of three guinea pig lines, from seven production zones located in Nariño, southwest Colombia. A total of 384 individuals were genotyped with six microsatellite markers. The measurement of intrapopulation diversity revealed allelic richness ranging from 3.0 to 6.56, and observed heterozygosity (Ho) from 0.33 to 0.60, with a deficit in heterozygous individuals. Although statistically significant (p guinea-pig lines and populations, coincided with the historical and geographical distribution of the populations. Likewise, high genetic identity between improved and native lines was established. An analysis of group probabilistic assignment revealed that each line should not be considered as a genetically homogeneous group. The findings corroborate the absorption of native genetic material into the improved line introduced into Colombia from Peru. It is necessary to establish conservation programs for native-line individuals in Nariño, and control genealogical and production records in order to reduce the inbreeding values in the populations.

Genetic diversity and population structure of the Guinea pig (Cavia porcellus, Rodentia, caviidae in Colombia

Directory of Open Access Journals (Sweden)

William Burgos-Paz

2011-01-01

Full Text Available The aim was to establish the genetic diversity and population structure of three guinea pig lines, from seven production zones located in Nariño, southwest Colombia. A total of 384 individuals were genotyped with six microsatellite markers. The measurement of intrapopulation diversity revealed allelic richness ranging from 3.0 to 6.56, and observed heterozygosity (Ho from 0.33 to 0.60, with a deficit in heterozygous individuals. Although statistically significant (p < 0.05, genetic differentiation between population pairs was found to be low. Genetic distance, as well as clustering of guinea-pig lines and populations, coincided with the historical and geographical distribution of the populations. Likewise, high genetic identity between improved and native lines was established. An analysis of group probabilistic assignment revealed that each line should not be considered as a genetically homogeneous group. The findings corroborate the absorption of native genetic material into the improved line introduced into Colombia from Peru. It is necessary to establish conservation programs for native-line individuals in Nariño, and control genealogical and production records in order to reduce the inbreeding values in the populations.

Potential of Root Exudates from Wetland Plants and Their Potential Role for Denitrification and Allelopathic Interactions

DEFF Research Database (Denmark)

Zhai, Xu

Root exudates from wetland plants have both positive and negative interactions among microbe, plants and ecosystems. Wetland species releasing organic carbon into the rhizosphere for providing energy to denitrifying bacteria fuel denitrification for removal nitrogen in subsurface flow constructed...... wetlands. Furthermore, environmental factors such as temperature and light-regime affect the photosynthetic carbon fixation, which continuously influence the compositions and quantity of root exudates released into rhizosphere. Conversely, root exudates from invasive species might contain some phytotoxic...... chemicals to suppress the growth of native species. Phragmites australis is recognized as the most invasive species in wetland ecosystems in North America, and allelopathy has been reported to be involved in the invasion success of the introduced exotic P. australis. The composition of the root exudates may...

Asociación Thysanoptera (Insecta-Vicia faba (Fabaceae en la Prepuna y Puna de Jujuy, Argentina Thysanoptera (Insecta-Vicia faba (Fabaceae association in Prepuna and Puna in Jujuy, Argentina

Directory of Open Access Journals (Sweden)

María Inés Zamar

2012-03-01

Full Text Available Los distintos estados fenológicos de Vicia faba ofrecen recursos alimenticios y sustratos para el desarrollo de una importante diversidad de insectos. Los objetivos de este estudio fueron: identificar el complejo de tisanópteros antófilos, analizar las fluctuaciones de las poblaciones, conocer aspectos bioecológicos y determinar el rol que cumplen en esta asociación. El estudio se realizó durante el período floración-fructificación del cultivo de haba, en dos etapas y regiones fitogeográficas de Jujuy: Prepuna (2 479msnm, semanalmente desde octubre-diciembre de 1995-1996 y Puna (3 367msnm, quincenalmente desde diciembre 2007-marzo 2008. Cada muestra consistió de 25 flores tomadas al azar; sólo en Prepuna se realizó un muestreo complementario de tres golpes/planta (n=10 plantas. Se realizaron observaciones sobre sitios de oviposición, ingreso a la flor, lugares de pupación, comportamiento alimenticio y lesiones producidas. En Prepuna, el complejo de tisanópteros está formado por Frankliniella australis, F. occidentalis, F. gemina, F. schultzei y Thrips tabaci; en Puna la diversidad específica está restringida a F. australis y F. gemina. A pesar de que el período siembra-cosecha no coincide en ambas áreas, las fluctuaciones de las poblaciones presentan un mismo patrón: a medida que avanza la floración aumenta el número de tisanópteros, que coincide con la disponibilidad del recurso alimenticio. En ambas áreas, F. australis es la especie dominante y mantiene poblaciones sucesivas en el cultivo; deposita los huevos en los botones florales y las larvas eclosionan cuando se produce la apertura de las flores; la alimentación de larvas y adultos ocasiona manchas plateadas con puntuaciones negras. En la Prepuna, F. australis atraviesa los estados inmaduros móviles en las flores y los quiescentes en el suelo; en la Puna, todos los estados de desarrollo transcurren dentro de las flores. Thrips tabaci, F. gemina, F. shultzei y F

Plant–soil feedback in native vs. invasive populations of a range expanding plant

Czech Academy of Sciences Publication Activity Database

Dostálek, Tomáš; Münzbergová, Zuzana; Kladivová, A.; Macel, M.

2016-01-01

Roč. 399, 1-2 (2016), s. 209-220 ISSN 0032-079X Institutional support: RVO:67985939 Keywords : Rorippa australis * soil community * invasive species Subject RIV: EF - Botanics Impact factor: 3.052, year: 2016

Natural diet of three species of shrimp in a tropical coastal lagoon

Directory of Open Access Journals (Sweden)

Albertoni Edélti Faria

2003-01-01

Full Text Available The gut content of 495 specimens of Farfantepenaeus brasiliensis, 131 of F. paulensis (Penaeidae and 102 of Macrobrachium acanthurus (Palaemonidae were analyzed to establish the composition of their diets F. brasiliensis had as the most important feeding items in its diet larvae of Chironomidae, Polychaeta and Heleobia australis (Mollusca. For F. paulensis, the most important items were the same as for F. brasiliensis, but the order of importance of H. australis and Polychaeta was inverted. M. acanthurus had detritus as the most important item, followed by Chironomidae larvae, Odonata nymphs, and fragments of the macroalgae Chara. The results showed that the three species were omnivorous, with a varied diet including both components of macrofauna of benthos and associated to the macroalgae Chara and plant fragments and detritus.

An unusual giant pycnogonid (Pycnogonida-Colossendeidae) Decolopoda qasimi sp. nov. from Antarctic waters

Digital Repository Service at National Institute of Oceanography (India)

Jayasree, V.; Sreepada, R.A.; Parulekar, A.H.

Five specimens of benthic pycnogonids collected from the Southern Ocean are described. Of these, two are identified as Nymphon australis (Hodgson) and two as Ecleipsotherma spinosa (Hodgson). One specimen under the class Colossendeidae, is described...

Diet of some insectivorous passerines in semi-arid regions of South ...

African Journals Online (AJOL)

BrubruNilaus afer, Brown-crowned Tchagra Tchagra australis,Crimson-breasted Shrike Laniarius atrococcineus, BokmakierieTelophorus zeylonus, Pririt Batis Batis pririt (Malaconotidae), Common Fiscal Lanius collarisand Magpie Shrike Corvinella melanoleuca(Laniidae) had eaten mainly grasshoppers and beetles.

New records of water mites (Acari: Hydrachnidia, Halacaroidea) from Patagonia (Chile)

NARCIS (Netherlands)

Pešić, V.; Smit, H.; Datry, T.

2010-01-01

New records of water mite species (Acari: Hydrachnidia, Halacaroidea) from Patagonia (Southern Chile) are reported. Four species, Anisitsiellides australis Smit, 2002, Peregrinacarus falklandensis Bartsch, 2001, Lobohalacarus weberi (Romijn & Viets, 1924) and Soldanellonyx monardi Walter, 1919 are

78 FR 42653 - Taking of Marine Mammals Incidental to Commercial Fishing Operations; Atlantic Large Whale Take...

Science.gov (United States)

2013-07-16

... defines a strategic stock of marine mammals as a stock: (1) For which the level of direct human-caused... Whales, Eubalaena australis. Behaviour 88(1/2):42-60. BILLING CODE 3510-22-P [GRAPHIC] [TIFF OMITTED...

Livestock as a potential biological control agent for an invasive wetland plant

NARCIS (Netherlands)

Silliman, Brian R.; Mozdzer, Thomas; Angelini, Christine; Brundage, Jennifer E.; Esselink, Peter; Bakker, Jan P.; Gedan, Keryn B.; van de Koppel, Johan; Baldwin, Andrew H.

2014-01-01

Invasive species threaten biodiversity and incur costs exceeding billions of US$. Eradication efforts, however, are nearly always unsuccessful. Throughoutmuch of North America, land managers have used expensive, and ultimately ineffective, techniques to combat invasive Phragmites australis in

Silver nanoparticles uptake by salt marsh plants - Implications for phytoremediation processes and effects in microbial community dynamics.

Science.gov (United States)

Fernandes, Joana P; Mucha, Ana P; Francisco, Telmo; Gomes, Carlos Rocha; Almeida, C Marisa R

2017-06-15

This study investigated the uptake of silver nanoparticles (AgNPs) by a salt marsh plant, Phragmites australis, as well as AgNPs effects on rhizospheric microbial community, evaluating the implications for phytoremediation processes. Experiments were carried out with elutriate solution doped with Ag, either in ionic form or in NP form. Metal uptake was evaluated in plant tissues, elutriate solutions and sediments (by AAS) and microbial community was characterized in terms of bacterial community structure (evaluated by ARISA). Results showed Ag accumulation but only in plant belowground tissues and only in the absence of rhizosediment, the presence of sediment reducing Ag availability. But in plant roots Ag accumulation was higher when Ag was in NP form. Multivariate analysis of ARISA profiles showed significant effect of the absence/presence of Ag either in ionic or NP form on microbial community structure, although without significant differences among bacterial richness and diversity. Overall, P. australis can be useful for phytoremediation of medium contaminated with Ag, including with AgNPs. However, the presence of Ag in either forms affected the microbial community structure, which may cause disturbances in ecosystems function and compromise phytoremediation processes. Such considerations need to be address regarding environmental management strategies applied to the very important estuarine areas. The form in which the metal was added affected metal uptake by Phragmites australis and rhizosediment microbial community structure, which can affect phytoremediation. Copyright © 2017 Elsevier Ltd. All rights reserved.

Evaluation of seasonal changes in methane flux in a wetland ecosystem using the Closed Geosphere Experiment Facility

Science.gov (United States)

Suzuki, S.; Inubushi, K.; Yokozawa, M.; Hara, T.; Nishidate, K.; Tsuga, S.; Tako, Y.; Nakamura, Y.

2009-04-01

To estimate CH4 emission from a wetland ecosystem to the atmosphere, seasonal change in CH4 flux was measured continuously in the Closed Geosphere Experiment Facility (CGEF). Plant-mediated transport is one of the important pathways for CH4 emission from Phragmites australis-dominated vegetation because most CH4 emission occurs through P. australis plant. The CGEF is equipped with a Geosphere Module (GM) and a Geosphere Material Circulation (GMC) system. The size of the GM is 5.8 m Ã- 8.7 m in ground area with an average height of 11.9 m, including the soil depth of 3.1 m. A wetland ecosystem dominated by P. australis was introduced into the GM. The CGEF can control air temperature and CO2 concentration in the GM automatically. Hourly CH4 flux from the wetland ecosystem can be calculated easily by measuring continuously the changes in CH4 concentration in air, air temperature and pressure in the GM. The method showed that monthly CH4 flux varied from 0.39 to 1.11 g C m-2 month-1 from April to November and the CH4 emission for the plant growing season (eight months) was 5.64 g C m-2. The CGEF has an advantage in studying total CH4 emission from soil to the atmosphere through plant-mediated transport, diffusion and ebullition because of the large size of the GM.

Metagenomic Survey of Viral Diversity Obtained from Feces of Subantarctic and South American Fur Seals.

Directory of Open Access Journals (Sweden)

Mariana Kluge

Full Text Available The Brazilian South coast seasonally hosts numerous marine species, observed particularly during winter months. Some animals, including fur seals, are found dead or debilitated along the shore and may harbor potential pathogens within their microbiota. In the present study, a metagenomic approach was performed to evaluate the viral diversity in feces of fur seals found deceased along the coast of the state of Rio Grande do Sul. The fecal virome of two fur seal species was characterized: the South American fur seal (Arctocephalus australis and the Subantarctic fur seal (Arctocephalus tropicalis. Fecal samples from 10 specimens (A. australis, n = 5; A. tropicalis, n = 5 were collected and viral particles were purified, extracted and amplified with a random PCR. The products were sequenced through Ion Torrent and Illumina platforms and assembled reads were submitted to BLASTx searches. Both viromes were dominated by bacteriophages and included a number of potentially novel virus genomes. Sequences of picobirnaviruses, picornaviruses and a hepevirus-like were identified in A. australis. A rotavirus related to group C, a novel member of the Sakobuvirus and a sapovirus very similar to California sea lion sapovirus 1 were found in A. tropicalis. Additionally, sequences of members of the Anelloviridae and Parvoviridae families were detected in both fur seal species. This is the first metagenomic study to screen the fecal virome of fur seals, contributing to a better understanding of the complexity of the viral community present in the intestinal microbiota of these animals.

Delayed XBT data collected by Commonwealth Scientific Industrial Research Organization (CSIRO) for the Global Temperature-Salinity Profile Program (GTSPP), dates range from 01-05-1993 to 10-08-1993 (NODC Accession 0041369)

Data.gov (United States)

National Oceanic and Atmospheric Administration, Department of Commerce — XBT and CTD data were collected in the Indian Ocean aboard the Aurora Australis from 05 January 1993 to 08 October 1993. Data were submitted by the CommonWealth...

Livestock as a potential biological control agent for an invasive wetland plant

NARCIS (Netherlands)

Silliman, B.R.; Mozdzer, T.; Angelini, C.; Brundage, J.E.; Esselink, P.; Bakker, J.P.; Gedan, K.B.; van de Koppel, J.; Baldwin, A.H.

2014-01-01

Invasive species threaten biodiversity and incur costs exceeding billions of US$. Eradication efforts, however, are nearly always unsuccessful. Throughout much of North America, land managers have used expensive, and ultimately ineffective, techniques to combat invasive Phragmites australis in

THE STATUS OF HERPETOLOGY IN SOUTHERN AFRICA This ...

African Journals Online (AJOL)

David Onderstall is working on the eastern forms of Afroedura. Probably the ... unique types: L. australis from Ceres in the south-western Cape and L. rupicola from Lake .... 1972) has investigated the ecology and behaviour of anuran tadpoles.

The distribution and accumulation of chromium in the water, sediment and macrophytes of Skadar lake

Directory of Open Access Journals (Sweden)

Kastratović Vlatko

2016-01-01

Full Text Available The aquatic macrophytes Phragmites australis (Cav. Trin. ex Steud., Ceratophyllum demersum L., and Lemna minor L. were used as bioindicator plant species in order to define contamination level by Cr in Skadar lake (Montenegro. Plants, water and sediments were tested for the content of Cr at six locations around Lake Skadar during four periods in 2011. The content of Cr in the examined sediment was in the range of 35.6-127 mg/kg dry weight. The largest proportion of detected Cr (50.6% was associated with the oxidizable phase in the form of organic complexes. The concentration of Cr in the studied macrophytes declined in the following order: C. demersum > P. australis > L. minor. The highest average content of Cr was detected in the leaf of C. demersum (11.4 mg/kg in April.

Mississippi River, Baton Rouge to the Gulf, Louisiana, Project. Supplement II.

Science.gov (United States)

1984-04-01

Hlydrocotyl Persimmon Diospyros virginiana Picke relweed Pontederia cordata Rattlebox Daubentonia drummundii Rose au Phragmites australis Saltgrass Distichlis...menhaden, genus Brevoortia, with respect to salinity, in the upper drainage basin of Barataria Bay, Louisiana. M.S. Thesis. Louisiana State University

A new species of Iotarphia Cameron (Coleoptera, Staphylinidae, Aleocharinae from Tasmanian seacoasts, Australia

Directory of Open Access Journals (Sweden)

Seung-Gyu Lee

2016-11-01

Full Text Available Iotarphia rufobrunnea Lee & Ahn, sp. n. is described from Tasmania. The new species is compared with another species of the genus, I. australis Cameron. A description, habitus photograph and illustrations of the diagnostic characters are provided.

Nutrient Cycling and Retention Along a Littoral Gradient in a Dutch Shallow Lake in Relation to Water Level Regime

NARCIS (Netherlands)

Sollie, S.; Verhoeven, J.T.A.

Littoral zones are characterized by gradients in depth and vegetation biomass, influencing nutrient retention capacity. A field experiment was conducted in a Phragmites australis dominated littoral zone to investigate nutrient retention and its effect on surface water quality. Measurements were done

Biogenic silica in tidal freshwater marsh sediments and vegetation (Schelde estuary, Belgium)

NARCIS (Netherlands)

Struyf, E.; van Damme, S.; Gribsholt, B.; Middelburg, J.J.; Meire, P.

2005-01-01

To date, estuarine ecosystem research has mostly neglected silica cycling in freshwater intertidal marshes. However, tidal marshes can store large amounts of biogenic silica (BSi) in vegetation and sediment. BSi content of the typical freshwater marsh plants Phragmites australis, Impatiens

Comparison of metabolisable energy values of different foodstuffs determined in ostriches and poultry

DEFF Research Database (Denmark)

Cilliers, S C; Sales, J; Hayes, J P

1999-01-01

Apparent (AMEn) and true (TMEn) metabolisable energy values, corrected for nitrogen retention, of wheat bran, saltbush (Atriplex nummularia), common reed (Phragmites australis), lupins, soyabean oil cake meal (SBOCM), sunflower oil cake meal (SFOCM) and fishmeal were compared in 7 successive trials...

REMOTE DETENTION OF INVASIVE AND OPPORTUNISTIC PLANT SPECIES IN GREAT LAKES COASTAL WETLANDS

Science.gov (United States)

Invasive and opportunistic plant species have been associated with wetland disturbance. Increases in the abundance of plant species such as common reed (Phragmites australis) in coastal Great Lakes wetlands are hypothesized to occur with shifts toward drier hydrologic regimes, fr...

Alstroemeria presliana Herb. (Alstroemeriaceae in Chile from a Cytogenetic Perspective Alstroemeria presliana Herb. (Alstroemeriaceae en Chile Bajo una Perspectiva Citogenética

Directory of Open Access Journals (Sweden)

Carlos M Baeza

2008-12-01

Full Text Available Alstroemeria (Alstroemeriaceae is an endemic genus of South America with two major distribution centers in the continent: Chile and Brazil. In Chile the genus is distributed from the North, near Iquique (20º13’ S, 70º09’ W to the Chilean and Argentine Patagonia (53º10’ S, 70º54’ W. The central zone of Chile presents the highest number of species. A. presliana Herb. grows from Curicó (34º59’ S, 71º14’ W to Cautín (38º45’ S, 72º34’ W in Chile and Neuquén (36º50’ S, 71º05’ W, Argentina. A comparative karyotype study was made between a population of A. presliana subsp. presliana and a population of A. presliana subsp. australis Ehr. Bayer. Both populations presented asymmetric karyotypes, with 2n = 2x = 16 chromosomes, but with different chromosome formulae: A. presliana subsp. presliana has a haploid formula with 4m + 1sm-sat + 1st-sat + 2t, i.e., four pairs ofmetacentric chromosomes, one submetacentric pair with satellite, one subtelocentric pair with satellite, and two telocentrics pairs. A. presliana subsp. australis has a formula with 2m + 1m-sat + 1sm + 4t chromosomes, i.e., two pairs of metacentric chromosomes, one metacentric pair with satellite, one submetacentric pair, and four telocentrics chromosomes. These results indicated that the karyotype of the subspecies is very different, and it would be possible to recognize A. presliana subsp. australis as a new species.Alstroemeria (Alstroemeriaceae es un género endémico de Sudamérica y presenta dos grandes centros de distribución: Chile y Brasil. En Chile se distribuye desde el norte, cerca de Iquique (20º13’ S, 70º09’ O hasta la Patagonia (53º10’ S, 70º54’ O. La zona central del país presenta el mayor número de especies. A. presliana Herb. crece con una distribución que va desde Curicó (34º59’ S, 71º14’ O a Cautín (38º45’ S, 72º34’ O en Chile y en la Provincia de Neuquén (36º50’ S, 71º05’ O, Argentina. Se hizo un

Comparative morphophysiological evaluation of the testis of adult ...

African Journals Online (AJOL)

olayemitoyin

Wistar rats fed low protein-energy diet and dosed with aqueous extracts ... extracts of C. australis seed and stem, 300mg/kg body weight/day for seven days, on the testis of the adult Wistar rat ..... Modern Study of Traditional Chinese Medicine,.

ALL THAT "PHRAG": BRINGING ENGINEERING, WETLAND ECOLOGY, ENVIRONMENTAL SCIENCE, AND LANDSCAPE ECOLOGY TO BEAR ON THE QUESTION OF COMMON REED IN GREAT LAKES COASTAL WETLANDS

Science.gov (United States)

Coastal wetlands are among the most fragmented and disturbed ecosystems and the Great Lakes are no exception. One possible result is the observed increase in the presence and dominance of invasive and other opportunistic plant species, such as the common reed (Phragmites australi...

An annotated catalogue of Recent Pectinoidea (Mollusca, Pectinidae and Propeamussiidae) type material in the Museum of Natural History, Humboldt University, Berlin

NARCIS (Netherlands)

Dijkstra, H.H.; Köhler, F.

2008-01-01

This paper lists 22 pectinoid types (21 primary and one secondary) and three potential syntypes in the Museum of Natural History (ZMB) in Berlin. Eight lectotypes are designated herein for the stabilization of taxonomic names: Pecten aequatorialis, Pecten australis, Pecten clathratus, Camptonectes

AIRBORNE HYPERSPECTRAL IDENTIFICATION OF INVASIVE AND OPPORTUNISTIC WETLANDS PLANT SPECIES

Science.gov (United States)

Coastal wetlands are among the most fragmented and disturbed ecosystems and the Great Lakes are no exception. One possible result is the observed increase in the presence and dominance of invasive and other opportunistic plant species, such as the common reed (Phragmites australi...

Investigation into the kinetics of constructed wetland degradation ...

African Journals Online (AJOL)

-scale, horizontal subsurface-flow constructed wetland (6.0 m × 1.0 m × 0.5 m) in Leipzig, Germany. The bed contained glacial gravel (4–8 mm) planted with Phragmites australis. Construction was completed in October 2013 and experiments ...

Detection of Leptospira DNA in urine and presence of specific antibodies in outdoor cats in Germany.

Science.gov (United States)

Weis, Sonia; Rettinger, Anna; Bergmann, Michele; Llewellyn, Julia R; Pantchev, Nikola; Straubinger, Reinhard K; Hartmann, Katrin

2017-04-01

Objectives Clinical manifestation of infection with Leptospira species in cats is rare. Nevertheless, cats can develop specific antibodies against the spirochetes after infection. In Canada, Taiwan and the USA it was recently demonstrated that naturally infected cats can also shed DNA from pathogenic Leptospira species in their urine, but the zoonotic potential of infected cats is still unclear. The objective of this study was to demonstrate if outdoor cats in Germany shed DNA from pathogenic Leptospira species in their urine. As a second aim, antibody prevalence was determined. Methods Two hundred and fifteen outdoor cats were prospectively recruited. Urine samples were tested by real-time PCR targeting the lipL32 gene of pathogenic Leptospira species. Antibody titres against eight serovars (Australis, Autumnalis, Bratislava, Canicola, Copenhageni, Grippotyphosa, Pomona, Saxkoebing) belonging to seven serogroups (Australis, Autumnalis, Canicola, Grippotyphosa, Icterohaemorrhagiae, Pomona, Sejroe) were determined by microscopic agglutination test. Results Urine samples from 7/215 cats (3.3%; 95% confidence interval [CI] 0.9-5.7) were PCR-positive. Specific antibodies were detected in 35/195 cats (17.9%; 95% CI: 12.5-23.3) with titres ranging from 1:100 to 1:6400. Australis, Bratislava and Grippotyphosa were the most common serovars. Conclusions and relevance Outdoor cats in Germany can shed DNA from pathogenic Leptospira species. Therefore, outdoor cats should be considered as a possible source of infection for dogs or humans. Further studies are needed to determine the role of Leptospira species as a cause of disease in cats.

Keanekaragaman dan Kerapatan Rumput Laut Alami Perairan Pulau Serangan Denpasar Bali

Directory of Open Access Journals (Sweden)

Ni Desak Putu Dita Herlinawati

2017-08-01

Full Text Available Serangan Island was a costal area located in the Serangan village, South Denpasar district, near with Sanur and Nusa Dua tourism area. Serangan beach has a biodiversity such as natural macroalgae. This study was conducted in January 2017 at the seaweed cultivation area with the aims of research were to know the variety and density of macroalgae. The method used was a 1x1 m quadrat transect. Sampling was carried out during low tide. Macroalgae found in the area, consist of 12 species namely Ulva lactuca, Chaetomorpha linum. Chaetomorpha aera, Padina australis, Sargassum fluitans, Turbinaria ornate, Gelidium sp., Hypnea cornuta, Hypnea spicifera, Gracilaria salicornia, Acanthophora spicifera, Halimeda opuntia. Those species were belonging to 3 divisi namely Chlorophyta, Phaeophyta, Rhodophyta. The highest density of macroalgae was Padina australis while the lowest density was Chaetomorpha linum. Type of dominated macroalgae was from a group of Phaeophyta (brown algae with highest dominance from the species of Padina australis. Water quality namely acidity (pH was in the range of 7.54 to 7.75, salinity of 31.33-32.00 ppt, the water temperature was 26.50-27.30? C, which all was categorized as the optimal parameters for the growth of macroalgae. Assosiation of biota found were 9 species namely fish of larva, Cypraea lynx (Molusca, Emerita sp., Halodule sp., Synapta maculate, Enhalus acoroides, Cymodocea serrulata, Hermit crab, Ophiuroidea sp. The conditions coastal waters substrate was varied from white sand stone type to stony type by coral pieces.

Varietal Response of Chickpea (Cicer arietinum L.) Towards the Allelopathy of Different Weeds

International Nuclear Information System (INIS)

Rahamdad, K.; Ijaz, A.K.

2015-01-01

In a laboratory trial three chickpea varieties viz, Karak-I, Karak-III and Shenghar were tested against the phytotoxicity of five weed species: Parthenium hysterophorus L., Phragmites australis (Cav.) Trin., Datura alba L., Cyperus rotundus L. and Convolvulus arvensis L.in January 2013. The weed extracts were prepared at the rate of 120 g/L (w/v) after shade dry. The results indicated highly significant inhibitory effect of all the tested weed species on the chickpea varieties. The results also showed that the chickpea variety Karak-III was more susceptible to the phototoxicity of the tested weed extracts. Among the extract, C. arvensis proved much toxic in term of inhibition of germination by giving only 43.33% germination in comparison with control where 97.50% germination was recorded. On the other hand, the effect of P. australis extract was found a little stimulator by speeding the seed germination in all varieties and giving a low (2.21) mean germination time (MGT) value. From the current results it can be concluded that the infestation of C. arvensis can pollute the soil by accumulating toxic chemicals that leads to the germination failure and growth suppression in chickpea. Therefore, the prevention and removal of C. arvensis in the chickpea growing areas could be recommended. In addition, P. australis must be tested against chickpea weeds (chickpea varieties withstand against its phototoxicity), so that it can be popularized as bio herbicide in chickpea if it gave promising results in controlling chickpea weeds. (author)

Seasonal and spatial variations in heterotrophic nanoflagellate and bacteria abundances in sediments of a freshwater littoral zone

NARCIS (Netherlands)

Starink, Mathieu; Bär-Gilissen, M.J.; Cappenberg, T.E.

1996-01-01

We studied seasonal variation in heterotrophic nanoflagellates (HNAN) and bacterial, densities at different depths in the sediment of two freshwater littoral stations. Station 1 was in a reed bed of Phragmites australis; station 2 was outside the reed zone in open water. Benthic HNAN abundances

Antibacterial activity of Sargassum polycystum C. Agardh and ...

African Journals Online (AJOL)

In this study, the antibacterial activity of n-hexane, dichloromethane and methanolic extracts of brown seaweeds (Phaeophyceae), Sargassum polycystum C. Agardh and Padina australis Hauck, was examined using the disc diffusion and broth microdilution methods. The bioactivity of the seaweed extracts was expressed as ...

Nederland in 2050: wijnland of woestijnland?

NARCIS (Netherlands)

Wamelink, G.W.W.

2010-01-01

Bij de gevolgen van klimaatveranderingen denken we vooral aan het buitenland, zoals de verwoestijning in Spanje en Australië. De klimaatverandering zal de Nederlandse natuur echter ook niet onberoerd laten. Hebben we over honderd jaar nog dezelfde vegetatie? Is Nederland verworden tot wijnland of

Contrasting growth effects of prey capture in two aquatic carnivorous plant species

Czech Academy of Sciences Publication Activity Database

Adamec, Lubomír; Sirová, Dagmara; Vrba, J.

2010-01-01

Roč. 176, č. 2 (2010), s. 153-160 ISSN 1863-9135 Institutional research plan: CEZ:AV0Z60050516; CEZ:AV0Z60170517 Keywords : Aldrovanda vesiculosa * Utricularia australis * shoot mineral nutrient content Subject RIV: EF - Botanics Impact factor: 1.108, year: 2010

Factors influencing CO2 and CH4 emissions from coastal wetlands in the Liaohe Delta, Northeast China

DEFF Research Database (Denmark)

Olsson, L.; Ye, S.; Wei, M.

2015-01-01

temperature and vegetation on CH4 emissions and ecosystem respiration (Reco) from five coastal wetlands in the Liaohe Delta, northeast China: two Phragmites australis (common reed) wetlands, two Suaeda salsa (sea blite) marshes and a rice (Oryza sativa) paddy. Throughout the growing season, the Suaeda...

Effects of two common macrophytes on methane dynamics in freshwater sediments

NARCIS (Netherlands)

Van der Nat, F.J.; Middelburg, J.J.

1998-01-01

The methane cycle in constructed wetlands without plants and with Phragmites australis (reed) and Scirpus lacustris (bulrush) was investigated. Variations in CH4 production largely determined variations in CH4 emission among the systems: rather than variations in CH4 storage and oxidation. Twofold

Modelling landslide dynamics in forested landscapes

NARCIS (Netherlands)

Claessens, L.F.G.

2005-01-01

The research resulting in this thesis covers the geological, geomorphological and landscape ecology related themes of the project 'Podzolisation under Kauri (Agathis australis): for better or worse?' supported by theNetherlands Organisation

The impacts of ditch cuttings on weed pressure and crop yield in maize

NARCIS (Netherlands)

Huijser, M.P.; Meerburg, B.G.; Holshof, G.

2004-01-01

The Flevoland Polder in The Netherlands is characterised by large agricultural fields separated by ditches. The vegetation in the ditches is typically cut twice a year to ensure sufficient drainage. Removal of the cuttings, primarily reed (Phragmites australis), results in a substantial increase in

78 FR 23908 - Marine Mammals; File No. 14809

Science.gov (United States)

2013-04-23

... and Southern Oceans. Methods to be used include suction cup tagging, acoustic playbacks, passive... macrocephalus), and southern right (Eubalaena australis) whales, as well as 31 cetacean species that are not... Scientific Advisors. Documents may be reviewed in the following locations: Permits and Conservation Division...

Paraspidodera uncinata (Nematoda, Lauroiinae as parasite of Cavia magna and Cavia aperea (Rodentia, Caviidae in southern Brazil

Directory of Open Access Journals (Sweden)

Ana Gabriela da Silva Rocha

2015-05-01

Full Text Available Out of the 5 species of Guinea pig registered for Brazil, 4 (Cavia fulgida, C. porcellus, C. aperea, and C. magna have already been reported as hosts of Paraspidodera uncinata. The rodent species C. magna and C. aperea are small-sized mammals, with terrestrial habits, which occur from southern Brazil to eastern Uruguay. Guinea pig specimens donated for research were necropsied for the analysis of endoparasites, and the nematodes found were identified as P. uncinata. The microhabitats of this species were the small and large intestines in C. magna and the large intestine in C. aperea. The prevalence of P. uncinata in the hosts was 60% in C. magna (n = 5 and 14% in C. aperea (n = 7. The record of P. uncinata in different Guinea pig species allows inferring that the foraging mode is similar in the different locations where they occur in southern Brazil, because, perhaps, the infection of hosts has occurred through the ingestion of vegetables contaminated with P. uncinata eggs. This study contributes to knowledge on the helminth fauna of C. magna and C. aperea in southern Brazil.

The Hibiscus panduriformis complex (Malvaceae) in Australia

NARCIS (Netherlands)

Juswara, L.S.; Craven, L.A.

2005-01-01

The Hibiscus panduriformis Burm.f. species complex in Australia is revised. Six species are recognised, of which one is the widespread H. panduriformis; one, H. austrinus, is based upon H. panduriformis var. australis; and four represent new species, H. apodus, H. calcicola, H. fluvialis, and H.

Enige diatomeeënsoorten, nieuw voor de Nederlandse flora

NARCIS (Netherlands)

Dam, van Herman

1974-01-01

During an investigation of the epiphyton, growing on the culms of Phragmites australis, Typha latifolia, and Glyceria maxima, in the nature-reserve “Het Naardermeer”, ten species of diatoms were discovered which are new for the Dutch flora. These are enumerated together with some notes on their

Macrophyte community development and its implication for fisheries ...

African Journals Online (AJOL)

Agricultural activities, and poor management practices over the years have led to high siltation rates and consequent extensive growth of emergent aquatic macrophytes such as Typha australis, Nymphaea lotus, Echinochloa pyramidalis and Leersia hexandra, as well as marginal plants such as Mimosa pigra and Sesbania ...

78 FR 8435 - Importation of Fresh Citrus Fruit From Uruguay, Including Citrus Hybrids and Fortunella

Science.gov (United States)

2013-02-06

...] australis, causal agent of sweet orange scab); and a pathogen (Xanthomonas citri subsp. citri, causal agent... oranges (Citrus sinensis (L.) Osbeck), lemons (C. limon (L.) Burm. f.), four species of mandarins (C... of the reading room). The PRA, titled ``Importation of Fresh Citrus Fruit, including Sweet Orange...

Temporal variations in methane emissions from emergent aquatic macrophytes in two boreonemoral lakes.

Science.gov (United States)

Milberg, Per; Törnqvist, Lina; Westerberg, Lars M; Bastviken, David

2017-07-01

Methane (CH 4 ) emissions via emergent aquatic macrophytes can contribute substantially to the global CH 4 balance. We addressed temporal variability in CH 4 flux by using the static chamber approach to quantify fluxes from plots dominated by two species considered to differ in flux transport mechanisms ( Phragmites australis , Carex rostrata ). Temporal variability in daily mean emissions from early June to early October was substantial. The variable that best explained this variation was air temperature. Regular and consistent diel changes were absent and therefore less relevant to include when estimating or modelling CH 4 emissions. Methane emissions per m 2 from nearby plots were similar for Phragmites australis and Carex rostrata indicating that CH 4 production in the system influenced emissions more than the species identity. This study indicates that previously observed diel patterns and species-effects on emissions require further evaluation to support improved local and regional CH 4 flux assessments.

Zooarqueologia dos mamíferos aquáticos e semi-aquáticos da Ilha de Santa Catarina, sul do Brasil

Directory of Open Access Journals (Sweden)

Pedro Volkmer de Castilho

2001-09-01

Full Text Available This study analyzes the use of aquatic mammals by prehistoric societies of Santa Catarina Island, Southern Brazil. Samples from two archaeological sites were examined: Rio do Meio (RM and Porto do Rio Vermelho (SCPRV. Nine aquatic mammal species were found: a pinnipeds: Arctocephalus australis (Zimmerman, 1783 and A. tropicalis (Gray, 1872, and b cetaceans: Eubalaena australis (Desmoulins, 1822, Delphinus delphis Linnaeus, 1758, Stenella frontalis (Cuvier, 1829, Steno bredanensis (Lesson, 1828, Tursiops truncatus (Montagu, 1821, Pontoporia blainvillei (Gervais & d'Orbigny, 1844 and a non-identified rorqual from the genus Balaenoptera Lacépède, 1804. Three especies of semi-aquatic mammals were also recorded: Hydrochoerus hydrochaeris (Linnaeus, 1758, Tapirus terrestris (Linnaeus, 1758 and Lontra longicaudis (Olfers,1818. Both sites presented similar species diversity, although abundance was greater at the most recent site (RM. There were more samples from axial skeletons, but in genera the anatomical regions were homogeneously distributed among the identified taxa.

Plants' use of different nitrogen forms in response to crude oil contamination

International Nuclear Information System (INIS)

Nie Ming; Lu Meng; Yang Qiang; Zhang Xiaodong; Xiao Ming; Jiang Lifen; Yang Ji; Fang Changming; Chen Jiakuan; Li Bo

2011-01-01

In this study, we investigated Phragmites australis' use of different forms of nitrogen (N) and associated soil N transformations in response to petroleum contamination. 15 N tracer studies indicated that the total amount of inorganic and organic N assimilated by P. australis was low in petroleum-contaminated soil, while the rates of inorganic and organic N uptake on a per-unit-biomass basis were higher in petroleum-contaminated soil than those in un-contaminated soil. The percentage of organic N in total plant-assimilated N increased with petroleum concentration. In addition, high gross N immobilization and nitrification rates relative to gross N mineralization rate might reduce inorganic-N availability to the plants. Therefore, the enhanced rate of N uptake and increased importance of organic N in plant N assimilation might be of great significance to plants growing in petroleum-contaminated soils. Our results suggest that plants might regulate N capture under petroleum contamination. - Plant strategies of utilizing nitrogen in crude oil-contaminated soils.

Die Brustflosse des Grönlandswales (Balaena mysticetus L.)

NARCIS (Netherlands)

Kükenthal, W.

1922-01-01

Das Studium der Brustflosse des Grönlandswales hat zu Fragen von allgemeinerem Interesse geführt. Ihre kurze und breite Form sowie ihre anscheinende Fünffingerigkeit, die ausserdem nur noch beim südlichen Glattwal (Balaena australis) vorkommt, liess sie ursprünglicher erscheinen als die schlankere

Typha control efficiency of a weed-cutting boat in the Lac de Guiers in Senegal : A preliminary study on mowing speed and re-growth capacity

NARCIS (Netherlands)

Hellsten, S.; Dieme, C.; Mbengue, M.; Janauer, G.A.; Hollander, den N.G.; Pieterse, A.H.

1999-01-01

Prolific growth of Typha australis in the lower part of the Senegal River and the Lac de Guiers resulted from changed ecological conditions following the construction of two high dams in the Senegal River. Fluctuation of the water level has decreased markedly and the water has changed from brackish

Ecology, fish and fishery of Lake Liambezi, a recently refilled ...

African Journals Online (AJOL)

Lake Liambezi (300 km2) refilled in 2009 after a prolonged 22-year dry period. Its aquatic macrophyte populations, fish fauna and fishery shortly after refilling are described. The emergent aquatic macrophyte Phragmites australis formed dense stands covering large parts of the lake, while extensive beds of submerged ...

Noodlottige kindermishandeling: 'n literatuuroorsig en die profiel in ...

African Journals Online (AJOL)

Literatuuroorsig en bespreking. Literatuuroorsig. 'n Studie wat in The Children's Hospital in Camperdown, Australië, onderneem is,3 toon dat die meerderheid slagoffers van noodlottige kindermishandeling (9 van 17 gevalle) jonger as een jaar oud was, terwyl die res van die slagoffers almal jonger as drie jaar oud was.

Biopsying southern right whales : Their reactions and effects on reproduction

NARCIS (Netherlands)

Best, PB; Reeb, D; Rew, MB; Palsboll, PJ; Schaeff, C; Brandao, A

Collecting skin biopsies from large whales for genetic analysis is often subject to national permit, and in the case of cow-calf pairs, it may be prohibited. We present results of 906 biopsy attempts on southern fight whales (Eubalaena australis) in South African waters between 1995 and 1997,

Composition and possible function of social groupings of southern right whales in South African waters

NARCIS (Netherlands)

Best, PB; Schaeff, CM; Reeb, D; Palsboll, PJ

2003-01-01

We collected behavioural data and skin samples for molecular sex determination from 327 right whales (Eubalaena australis) in the coastal waters of South Africa between July and October, 1995 and 1996, as well as from 147 cows with calves-of-the-year between August and October 1996, September and

Development of autochthonous microbial consortia for enhanced phytoremediation of salt-marsh sediments contaminated with cadmium

International Nuclear Information System (INIS)

Teixeira, Catarina; Almeida, C. Marisa R.; Nunes da Silva, Marta; Bordalo, Adriano A.; Mucha, Ana P.

2014-01-01

Microbial assisted phytoremediation is a promising, though yet poorly explored, new remediation technique. The aim of this study was to develop autochthonous microbial consortia resistant to cadmium that could enhance phytoremediation of salt-marsh sediments contaminated with this metal. The microbial consortia were selectively enriched from rhizosediments colonized by Juncus maritimus and Phragmites australis. The obtained consortia presented similar microbial abundance but a fairly different community structure, showing that the microbial community was a function of the sediment from which the consortia were enriched. The effect of the bioaugmentation with the developed consortia on cadmium uptake, and the microbial community structure associated to the different sediments were assessed using a microcosm experiment. Our results showed that the addition of the cadmium resistant microbial consortia increased J. maritimus metal phytostabilization capacity. On the other hand, in P. australis, microbial consortia amendment promoted metal phytoextraction. The addition of the consortia did not alter the bacterial structure present in the sediments at the end of the experiments. This study provides new evidences that the development of autochthonous microbial consortia for enhanced phytoremediation of salt-marsh sediments contaminated with cadmium might be a simple, efficient, and environmental friendly remediation procedure. Capsule abstract: Development of autochthonous microbial consortia resistant to cadmium that enhanced phytoremediation by salt-marsh plants, without a long term effect on sediment bacterial diversity. - Highlights: • Cd resistant microbial consortia were developed and applied to salt-marsh sediments. • In Phragmites australis the consortia amendment promoted metal phytoextraction. • The consortia addition increased Juncus maritimus phytostabilization capacity. • No long term changes on the rhizosediment bacterial structure were observed

Treatment of sludge containing nitro-aromatic compounds in reed-bed mesocosms – Water, BOD, carbon and nutrient removal

International Nuclear Information System (INIS)

Gustavsson, L.; Engwall, M.

2012-01-01

Highlights: ► It is necessary to improve existing and develop new sludge management techniques. ► One method is dewatering and biodegradation of compounds in constructed wetlands. ► The result showed high reduction of all tested parameters after treatment. ► Plants improve degradation and Phragmites australis is tolerant to xenobiotics. ► The amount of sludge could be reduced by 50–70%. - Abstract: Since the mid-1970s, Sweden has been depositing 1 million ton d.w sludge/year, produced at waste water treatment plants. Due to recent legislation this practice is no longer a viable method of waste management. It is necessary to improve existing and develop new sludge management techniques and one promising alternative is the dewatering and treatment of sludge in constructed wetlands. The aim of this study was to follow reduction of organic carbon, BOD and nutrients in an industrial sludge containing nitro-aromatic compounds passing through constructed small-scale wetlands, and to investigate any toxic effect such as growth inhibition of the common reed Phragmites australis. The result showed high reduction of all tested parameters in all the outgoing water samples, which shows that constructed wetlands are suitable for carbon and nutrient removal. The results also showed that P. australis is tolerant to xenobiotics and did not appear to be affected by the toxic compounds in the sludge. The sludge residual on the top of the beds contained low levels of organic carbon and is considered non-organic and could therefore be landfilled. Using this type of secondary treatment method, the amount of sludge could be reduced by 50–70%, mainly by dewatering and biodegradation of organic compounds.

Exotic Spartina alterniflora invasion alters ecosystem-atmosphere exchange of CH4 and N2O and carbon sequestration in a coastal salt marsh in China.

Science.gov (United States)

Yuan, Junji; Ding, Weixin; Liu, Deyan; Kang, Hojeong; Freeman, Chris; Xiang, Jian; Lin, Yongxin

2015-04-01

Coastal salt marshes are sensitive to global climate change and may play an important role in mitigating global warming. To evaluate the impacts of Spartina alterniflora invasion on global warming potential (GWP) in Chinese coastal areas, we measured CH4 and N2O fluxes and soil organic carbon sequestration rates along a transect of coastal wetlands in Jiangsu province, China, including open water; bare tidal flat; and invasive S. alterniflora, native Suaeda salsa, and Phragmites australis marshes. Annual CH4 emissions were estimated as 2.81, 4.16, 4.88, 10.79, and 16.98 kg CH4 ha(-1) for open water, bare tidal flat, and P. australis, S. salsa, and S. alterniflora marshes, respectively, indicating that S. alterniflora invasion increased CH4 emissions by 57-505%. In contrast, negative N2O fluxes were found to be significantly and negatively correlated (P carbon sequestration rate of S. alterniflora marsh amounted to 3.16 Mg C ha(-1) yr(-1) in the top 100 cm soil profile, a value that was 2.63- to 8.78-fold higher than in native plant marshes. The estimated GWP was 1.78, -0.60, -4.09, and -1.14 Mg CO2 eq ha(-1) yr(-1) in open water, bare tidal flat, P. australis marsh and S. salsa marsh, respectively, but dropped to -11.30 Mg CO2 eq ha(-1) yr(-1) in S. alterniflora marsh. Our results indicate that although S. alterniflora invasion stimulates CH4 emissions, it can efficiently mitigate increases in atmospheric CO2 and N2O along the coast of China. © 2014 John Wiley & Sons Ltd.

Development of autochthonous microbial consortia for enhanced phytoremediation of salt-marsh sediments contaminated with cadmium

Energy Technology Data Exchange (ETDEWEB)

Teixeira, Catarina [Centro Interdisciplinar de Investigação Marinha e Ambiental (CIIMAR/CIMAR), Universidade do Porto, Rua dos Bragas, 289, 4050-123 Porto (Portugal); Laboratório de Hidrobiologia e Ecologia, Instituto de Ciências Biomédicas Abel Salazar (ICBAS), Universidade do Porto, Rua Jorge Viterbo Ferreira, 228, 4050-313 Porto (Portugal); Almeida, C. Marisa R.; Nunes da Silva, Marta [Centro Interdisciplinar de Investigação Marinha e Ambiental (CIIMAR/CIMAR), Universidade do Porto, Rua dos Bragas, 289, 4050-123 Porto (Portugal); Bordalo, Adriano A. [Centro Interdisciplinar de Investigação Marinha e Ambiental (CIIMAR/CIMAR), Universidade do Porto, Rua dos Bragas, 289, 4050-123 Porto (Portugal); Laboratório de Hidrobiologia e Ecologia, Instituto de Ciências Biomédicas Abel Salazar (ICBAS), Universidade do Porto, Rua Jorge Viterbo Ferreira, 228, 4050-313 Porto (Portugal); Mucha, Ana P., E-mail: amucha@ciimar.up.pt [Centro Interdisciplinar de Investigação Marinha e Ambiental (CIIMAR/CIMAR), Universidade do Porto, Rua dos Bragas, 289, 4050-123 Porto (Portugal)

2014-09-15

Microbial assisted phytoremediation is a promising, though yet poorly explored, new remediation technique. The aim of this study was to develop autochthonous microbial consortia resistant to cadmium that could enhance phytoremediation of salt-marsh sediments contaminated with this metal. The microbial consortia were selectively enriched from rhizosediments colonized by Juncus maritimus and Phragmites australis. The obtained consortia presented similar microbial abundance but a fairly different community structure, showing that the microbial community was a function of the sediment from which the consortia were enriched. The effect of the bioaugmentation with the developed consortia on cadmium uptake, and the microbial community structure associated to the different sediments were assessed using a microcosm experiment. Our results showed that the addition of the cadmium resistant microbial consortia increased J. maritimus metal phytostabilization capacity. On the other hand, in P. australis, microbial consortia amendment promoted metal phytoextraction. The addition of the consortia did not alter the bacterial structure present in the sediments at the end of the experiments. This study provides new evidences that the development of autochthonous microbial consortia for enhanced phytoremediation of salt-marsh sediments contaminated with cadmium might be a simple, efficient, and environmental friendly remediation procedure. Capsule abstract: Development of autochthonous microbial consortia resistant to cadmium that enhanced phytoremediation by salt-marsh plants, without a long term effect on sediment bacterial diversity. - Highlights: • Cd resistant microbial consortia were developed and applied to salt-marsh sediments. • In Phragmites australis the consortia amendment promoted metal phytoextraction. • The consortia addition increased Juncus maritimus phytostabilization capacity. • No long term changes on the rhizosediment bacterial structure were observed.

Pteropods in Southern Ocean ecosystems

Science.gov (United States)

Hunt, B. P. V.; Pakhomov, E. A.; Hosie, G. W.; Siegel, V.; Ward, P.; Bernard, K.

2008-09-01

To date, little research has been carried out on pelagic gastropod molluscs (pteropods) in Southern Ocean ecosystems. However, recent predictions are that, due to acidification resulting from a business as usual approach to CO 2 emissions (IS92a), Southern Ocean surface waters may begin to become uninhabitable for aragonite shelled thecosome pteropods by 2050. To gain insight into the potential impact that this would have on Southern Ocean ecosystems, we have here synthesized available data on pteropod distributions and densities, assessed current knowledge of pteropod ecology, and highlighted knowledge gaps and directions for future research on this zooplankton group. Six species of pteropod are typical of the Southern Ocean south of the Sub-Tropical Convergence, including the four Thecosomes Limacina helicina antarctica, Limacina retroversa australis, Clio pyramidata, and Clio piatkowskii, and two Gymnosomes Clione limacina antarctica and Spongiobranchaea australis. Limacina retroversa australis dominated pteropod densities north of the Polar Front (PF), averaging 60 ind m -3 (max = 800 ind m -3) and 11% of total zooplankton at the Prince Edward Islands. South of the PF L. helicina antarctica predominated, averaging 165 ind m -3 (max = 2681 ind m -3) and up to >35% of total zooplankton at South Georgia, and up to 1397 ind m -3 and 63% of total zooplankton in the Ross Sea. Combined pteropods contributed 40% of community grazing impact. Further research is required to quantify diet selectivity, the effect of phytoplankton composition on growth and reproductive success, and the role of carnivory in thecosomes. Life histories are a significant knowledge gap for Southern Ocean pteropods, a single study having been completed for L. retroversa australis, making population studies a priority for this group. Pteropods appear to be important in biogeochemical cycling, thecosome shells contributing >50% to carbonate flux in the deep ocean south of the PF. Pteropods may also

75 FR 62455 - Importation of Fresh Unshu Oranges From the Republic of Korea Into the Continental United States

Science.gov (United States)

2010-10-12

... of Elsinoe australis, the fungus that is the causal agent of sweet orange scab. (In addition to...-0022] RIN 0579-AD14 Importation of Fresh Unshu Oranges From the Republic of Korea Into the Continental... on the importation of Unshu oranges from the Republic of Korea that are no longer necessary...

Wat komt bovenaan de lijst bij Google?

NARCIS (Netherlands)

Litvak, Nelly

2006-01-01

In 1998 presenteerden de PhD-studenten Sergey Brin en Larry Page uit Stanford het artikel ‘The anatomy of a Large-Scale Hypertextual Web Search Engine’ op het zevende World-Wide-Web-congres in Brisbane, Australië. Zij beschreven de Web-zoekmachine Google, waarvan de blanco bladzijde tegenwoordig zo

A Regional Guidebook for Applying the Hydrogeomorphic Approach to Assessing the Functions of Tidal Fringe Wetlands Along the Mississippi and Alabama Gulf Coast

Science.gov (United States)

2007-04-01

philoxeroides Alligatorweed Alabama Class C noxious weed Imperata cylindrica Cogongrass Alabama Class A noxious weed; Mississippi noxious weed Ipomoea...Invasive Species Alternanthera philoxeroides Phragmites australis Cuscuta spp. Imperata cylindrica...weed Cuscuta spp. Dodder Alabama Class A noxious weed Imperata cylindrica Cogongrass Alabama Class A noxious weed; MS noxious weed Ipomoea

LED licht van de toekomst

NARCIS (Netherlands)

Zeiler, W.

2009-01-01

De gloeilamp is verleden tijd, na ongeveer 125 jaar na de ontdekking door Thomas Edison valt langzaam maar zeker binnen een decennium het doek. Australië heeft de klassieke gloeilamp al in de ban gedaan en vele landen volgen deze trend. De rol van de klassieke gloeilamp wordt overgenomen door LED.

7 CFR 319.28 - Notice of quarantine.

Science.gov (United States)

2010-01-01

... of the country of origin. Only Unshu orange trees may be grown in these areas, which must be kept...); Brazil; and Paraguay is prohibited. (2) To prevent the introduction into the United States of sweet orange scab (Elsinoe australis Bitanc. and Jenkins), the importation of fruits and peel of all species...

Cephalopod diet of the Cape fur seal, Arctocephalus pusillus ...

African Journals Online (AJOL)

Sepia australis proved to be numerically the most important cephalopod in the diet of seals from Possession Island and Van Reenen Bay, while Octopus magnificus dominated at these colonies in terms of wet mass. Contrary to previous findings it is suggested that seals from Van Reenen Bay and Possession Island forage ...

Cephalopoda: Sepiidae

African Journals Online (AJOL)

1992-06-09

Jun 9, 1992 ... mag benadeel aangesien die optimum-temperature en -diepte vir teling nie saamval nie. • Presented at the ... snapshot of the S. australis population against which changes in ... usually for 30 min, during daylight in stratified semi-random squares .... This mean mass was used to estimate a total number of.

THE ABILITY OF LEAVES AND RHIZOMES OF AQUATIC PLANTS TO ACCUMULATE MACRO- AND MICRONUTRIENTS

Directory of Open Access Journals (Sweden)

Agnieszka Edyta Parzych

2015-06-01

Full Text Available The samples of macrophytes and bottom sediments originated from the littoral zone of the Słupia River were collected in summer 2013. The aim of this study was to compare the properties of the accumulation of leaves and rhizomes of Glyceria maxima, Phragmites australis, Typha latifolia and Phalaris arundinacea for macro- and micronutrients. The largest quantities of macroelements were found in the leaves of the examined species, and microelements dominated the rhizomes of most examined macrophytes except for Mn in P.australis and T.latifolia. The obtained results show that N and K dominated in the leaves of P.arundinacea, P and Mg in the leaves of P.australis, and Ca in the leaves of G.maxima. The largest quantities of N, P and K were cumulated in the rhizomes of P.arundinacea, while Mg and Ca in the rhizome of T.latifolia. The leaves of aquatic plants accumulated from 1354.9 mmolc·kg-1 (T.latifolia to 1844.0 mmolc·kg-1 (P.arundinacea, and rhizomes from 985.8 mmolc·kg-1 (G.maxima to 1335.2 mmolc·kg-1 (P.arundinacea of all the analyzed components. In these species of macrophytes lower accumulated value of the sum of macro- and microelements were found in the rhizomes. The share of nitrogen was 42.4–59.8% of this amount, phosphorus 4.3–8.6%, potassium 22.8–35.1%, calcium from 2,6% to 12.4%, magnesium 3.0–7.5%, and heavy metals were from 0.6% (G.maxima to 1.2% (T.latifolia in leaves and from 2.2% (T.latifolia to 8.7% (G.maxima in rhizomes.

Investigation on concentration of elements in wetland sediments and aquatic plants

Directory of Open Access Journals (Sweden)

H. Janadeleh

2016-01-01

Full Text Available The major aim of the present study was to investigate element (Fe, Ni, Pb, V, Zn concentrations in sediment and different tissues of Phragmities australis and Typha latifolia in Hor al-Azim Wetland Southwest Iran. Sampling of sediments and aquatic plants was carried out during spring and summer 2014. Results showed that the mean  concentrations of elements in Phragmities australis  in root and stem-leaf were as follows: Iron:4448 mg/kg, Nickel: 28 mg/kg, Lead:8 mg/kg, Vanadium:10 mg/kg  and Zinc 15.5 mg/kg in root and: Fe:645 mg/kg, Ni:15 mg/kg, Pb:4 mg/kg, V:4 mg/kg and Zinc 16 mg/kg respectively. Also, the mean concentrations of Fe, Ni, Pb, V and Zn in roots of Typha latifolia were 8696 mg/kg, 34 mg/kg, 5 mg/kg, 19 mg/kg and 27 mg/kg respectively. The mean concentrations of Fe, Ni, V, Pb, Zn in stem-leaves of Typha latifolia were as follows: 321 mg/kg, 3 mg/kg, 7 mg/kg, 2 mg/kg and 14 mg/kg respectively. The mean concentrations of Fe, Ni, V, Pb and zinc were as: 40991 mg/kg, 65 mg/kg, 60 mg/kg, 31 mg/kg, 60 mg/kg respectively in surface sediment of study area. Concentration pattern of elements in sediment were as: Fe>Ni>Zn>V>Pb. The highest concentration of elements in the plant was seen in the roots. Also, Typha latifolia can uptake more concentration of elements than Phragmities australis. Based on the enrichment factor, Ni in summer had the highest EF values among the elements studied and it has a moderate enrichment.

Restoration of Tidal Flow to Impounded Salt Marsh Exerts Mixed Effect on Leaf Litter Decomposition

Science.gov (United States)

Henry, B. A.; Schade, J. D.; Foreman, K.

2015-12-01

Salt marsh impoundments (e.g. roads, levees) disconnect marshes from ocean tides, which impairs ecosystem services and often promotes invasive species. Numerous restoration projects now focus on removing impoundments. Leaf litter decomposition is a central process in salt marsh carbon and nutrient cycles, and this study investigated the extent to which marsh restoration alters litter decomposition rates. We considered three environmental factors that can potentially change during restoration: salinity, tidal regime, and dominant plant species. A one-month field experiment (Cape Cod, MA) measured decay of litter bags in impounded, restored, and natural marshes under ambient conditions. A two-week lab experiment measured litter decay in controlled incubations under experimental treatments for salinity (1ppt and 30 ppt), tidal regime (inundated and 12 hr wet-dry cycles), and plant species (native Spartina alterniflora and invasive Phragmites australis). S. alterniflora decomposed faster in situ than P. australis (14±1.0% mass loss versus 0.74±0.69%). Corroborating this difference in decomposition, S. alterniflora supported greater microbial respiration during lab incubation, measured as CO2 flux from leaf litter and biological oxygen demand of water containing leached organic matter (OM). However, nutrient analysis of plant tissue and leached OM show P. australis released more nitrogen than S. alterniflora. Low salinity treatments in both lab and field experiments decayed more rapidly than high salinity treatments, suggesting that salinity inhibited microbial activity. Manipulation of inundation regime did not affect decomposition. These findings suggest the reintroduction of tidal flow to an impounded salt marsh can have mixed effects; recolonization by the native cordgrass could supply labile OM to sediment and slow carbon sequestration, while an increase in salinity might inhibit decomposition and accelerate sequestration.

Combined influence of sedimentation and vegetation on the soil carbon stocks of a coastal wetland in the Changjiang estuary

Science.gov (United States)

Zhang, Tianyu; Chen, Huaipu; Cao, Haobing; Ge, Zhenming; Zhang, Liquan

2017-07-01

Coastal wetlands play an important role in the global carbon cycle. Large quantities of sediment deposited in the Changjiang (Yangtze) estuary by the Changjiang River promote the propagation of coastal wetlands, the expansion of saltmarsh vegetation, and carbon sequestration. In this study, using the Chongming Dongtan Wetland in the Changjiang estuary as the study area, the spatial and temporal distribution of soil organic carbon (SOC) stocks and the influences of sedimentation and vegetation on the SOC stocks of the coastal wetland were examined in 2013. There was sediment accretion in the northern and middle areas of the wetland and in the Phragmites australis marsh in the southern area, and sediment erosion in the Scirpus mariqueter marsh and the bare mudflat in the southern area. More SOC accumulated in sediments of the vegetated marsh than in the bare mudflat. The total organic carbon (TOC) stocks increased in the above-ground biomass from spring to autumn and decreased in winter; in the below-ground biomass, they gradually increased from spring to winter. The TOC stocks were higher in the below-ground biomass than in the above-ground biomass in the P. australis and Spartina alterniflora marshes, but were lower in the below-ground biomass in S. mariqueter marsh. Stocks of SOC showed temporal variation and increased gradually in all transects from spring to winter. The SOC stocks tended to decrease from the high marsh down to the bare mudflat along the three transects in the order: P. australis marsh > S. alterniflora marsh > S. mariqueter marsh > bare mudflat. The SOC stocks of the same vegetation type were higher in the northern and middle transects than in the southern transect. These results suggest that interactions between sedimentation and vegetation regulate the SOC stocks in the coastal wetland in the Changjiang estuary.

Heavy metal content in ash of energy crops growing in sewage-contaminated natural wetlands: Potential applications in agriculture and forestry?

International Nuclear Information System (INIS)

Bonanno, Giuseppe; Cirelli, Giuseppe Luigi; Toscano, Attilio; Giudice, Rosa Lo; Pavone, Pietro

2013-01-01

One of the greatest current challenges is to find cost-effective and eco-friendly solutions to the ever increasing needs of modern society. Some plant species are suitable for a multitude of biotechnological applications such as bioenergy production and phytoremediation. A sustainable practice is to use energy crops to clean up polluted lands or to treat wastewater in constructed wetlands without claiming further arable land for biofuel production. However, the disposal of combustion by-products may add significant costs to the whole process, especially when it deals with toxic waste. This study aimed to investigate the possibility of recycling ash from energy biomass as a fertilizer for agriculture and forestry. In particular, the concentrations of Cd, Cr, Cu, Mn, Pb and Zn were analyzed in the plant tissues and corresponding ash of the grasses Phragmites australis and Arundo donax, collected in an urban stream affected by domestic sewage. Results showed that the metal concentration in ash is 1.5–3 times as high as the values in plant tissues. However, metal enriched ash showed much lower element concentrations than the legal limits for ash reutilization in agriculture and forestry. This study found that biomass ash from constructed wetlands may be considered as a potential fertilizer rather than hazardous waste. Energy from biomass can be a really sustainable and clean option not only through the reduction of greenhouse gas emissions, but also through ash recycling for beneficial purposes, thus minimizing the negative impacts of disposal. - Highlights: • Metal content in ash reflects the element concentrations in Phragmites australis and Arundo donax. • Metal enriched ash of both species may be recycled as fertilizers in agriculture and forestry. • Constructed wetlands may produce a large amount of plant ash-based fertilizers from P. australis and A. donax

Comparative pathology and ecological implications of two myxosporean parasites in native Australian frogs and the invasive cane toad.

Directory of Open Access Journals (Sweden)

Ashlie Hartigan

Full Text Available Myxosporean parasites Cystodiscus axonis and C. australis are pathogens of native and exotic Australian frog species. The pathology and ecological outcomes of infection with these parasites were investigated in this study. Gliosis was correlated to Cystodiscus axonis plasmodia in the brains of (9/60 tadpoles and (3/9 adult endangered Green and golden bell frogs using ordinal regression. Severe host reactions to C. axonis (haemorrhage, necrosis, and vasulitis were observed in the brains of threatened Southern bell frogs (8/8, critically endangered Booroolong frogs (15/44 and Yellow spotted bell frogs (3/3. Severe brain lesions were associated with behavioural changes, neurological dysfunction, and spontaneous death. Both C. axonis and C. australis develop in the bile ducts of tadpoles, the plasmodia were significantly associated with biliary hyperplasia, inflammation and the loss of hepatocytes in (34/72 Green and golden bell frog tadpoles using ordinal regression. These lesions were so severe that in some cases 70% of the total liver was diseased. Normal liver function in tadpoles is necessary for metamorphosis, metabolism, and immune function. We postulate that this extensive liver damage would have significant host health impacts. Severe hepatic myxosporidiosis was more prevalent in tadpoles examined in autumn and winter (overwintered, suggestive of delayed metamorphosis in infected tadpoles, which would have serious flow-on effects in small populations. We compared the sensitivity of histopathology and species-specific PCR in the detection of C. australis and C. axonis. PCR was determined to be the most sensitive method (detection limit 1 myxospore equivalent of ribosomal DNA. Histology, however, had the advantage of assessing the impact of the parasite on the host. It was concluded that these parasites have the potential for significant ecological impacts, because of their high prevalence of infection and their ability to cause disease in

Heavy metal content in ash of energy crops growing in sewage-contaminated natural wetlands: Potential applications in agriculture and forestry?

Energy Technology Data Exchange (ETDEWEB)

Bonanno, Giuseppe, E-mail: bonanno.giuseppe@unict.it [Department of Biological, Geological and Environmental Sciences, University of Catania, Via Longo 19, 95125, Catania (Italy); Cirelli, Giuseppe Luigi; Toscano, Attilio [Department of Agri-Food and Environmental Systems Management, University of Catania, Via Santa Sofia 100, 95123, Catania (Italy); Giudice, Rosa Lo; Pavone, Pietro [Department of Biological, Geological and Environmental Sciences, University of Catania, Via Longo 19, 95125, Catania (Italy)

2013-05-01

One of the greatest current challenges is to find cost-effective and eco-friendly solutions to the ever increasing needs of modern society. Some plant species are suitable for a multitude of biotechnological applications such as bioenergy production and phytoremediation. A sustainable practice is to use energy crops to clean up polluted lands or to treat wastewater in constructed wetlands without claiming further arable land for biofuel production. However, the disposal of combustion by-products may add significant costs to the whole process, especially when it deals with toxic waste. This study aimed to investigate the possibility of recycling ash from energy biomass as a fertilizer for agriculture and forestry. In particular, the concentrations of Cd, Cr, Cu, Mn, Pb and Zn were analyzed in the plant tissues and corresponding ash of the grasses Phragmites australis and Arundo donax, collected in an urban stream affected by domestic sewage. Results showed that the metal concentration in ash is 1.5–3 times as high as the values in plant tissues. However, metal enriched ash showed much lower element concentrations than the legal limits for ash reutilization in agriculture and forestry. This study found that biomass ash from constructed wetlands may be considered as a potential fertilizer rather than hazardous waste. Energy from biomass can be a really sustainable and clean option not only through the reduction of greenhouse gas emissions, but also through ash recycling for beneficial purposes, thus minimizing the negative impacts of disposal. - Highlights: • Metal content in ash reflects the element concentrations in Phragmites australis and Arundo donax. • Metal enriched ash of both species may be recycled as fertilizers in agriculture and forestry. • Constructed wetlands may produce a large amount of plant ash-based fertilizers from P. australis and A. donax.

Fate of xenobiotic compounds and plants activity in reed bed sludge treatment

DEFF Research Database (Denmark)

Chen, Xijuan; Pauli, Udo; Rehfus, Stefan

different plants: bulrush (Typha), reed (Phragmites australis) and reed canary grass (Phalaris arundinacea) were planted into 12 containers with a size of 1m Х 1m X 1m which were builded with 20cm gravel and 50cm sludge to study the plants activity in sludge degradation process, 4 containers were left...

the relationships of the avifauna of the south west arid area of africa

African Journals Online (AJOL)

came from the north; zoological facts suggest that African birds must have evolved within the continent, with .... discovered one in central Tanganyika, appears to have evolved in the South West Arid but to have left these ... seems to me that leucotis is more similar, in size and plumage pattern, to verticalis than to australis.

Evaluation of effect of Ophiostoma novo-ulmi on four major wood ...

African Journals Online (AJOL)

Evaluation of effect of Ophiostoma novo-ulmi on four major wood species of the elm family in Rasht (North West of Iran) ... the diameter size of vessels and the number of xylary rays in four species: Ulmus carpinifolia, Ulmus glabra, Zelkova carpinifolia and Celtis australis as important factors in host resistance to elm disease.

Final Environmental Assessment for Long-Term Vegetation Control for Eglin Air Force Base, Florida

Science.gov (United States)

2008-07-14

domingensis Florida Black Bear Ursus americanus floridanus Phragmites Phragmites australis American Alligator Alligator mississippiensis White Cedar...Cont’d) Tulip Poplar Liriodendron tulipifera Indigo Snake Drymarchon corais Sweet Bay Magnolia Magnolia virginiana American Beaver Castor canadensis Red...Bay Persea borbonia Parula Warbler Parula americana Wetland and Riparian Ecological Association (Saltwater) Black Needle Rush Juncus roemerianus

[The fleas of mammals from the Ucayali River basin (the Peruvian Amazonia)].

Science.gov (United States)

Darskaia, N F; Malygin, V M

1996-01-01

The material collected from 57 specimens of 9 mammalian species in two localities of the Peruvian Amazonia includes 212 specimens of fleas belonging to four species (Polygenis klagesi, Ropalopsyllus lugubris, Rh. australis and Rothschildopsylla noctilionis). This is the first record of fleas in the Ucayali River basin. The majority of flea specimens were collected form three morphologically similar but karyotypically and electrophoretically distinct species of spiny rats of the genus Proechimys. These fleas belong to the species P. klagesi. The subspecies P. k. samuelis was collected from 32-chromosome spiny rats nearby Pucallpa (8 degrees 22' S, 74 degrees 43' W), whereas in the locality nearby the village Jenaro Errera (4 degrees 52' S, 73 degrees 39' W) only the nominative subspecies P. k. klagesi were collected from all three species of spiny rats. Other species of fleas have relatively less abundance. Six fleas Rh. l. lugubris were found on one specimen of Cuniculus paca; a single Rh. australis--on one specimen of Myoprocta pratti; and a single R. noctilionis--on one specimen of Eptesicus brasiliensis.

Nitrous oxide emission from polyculture constructed wetlands: Effect of plant species

Energy Technology Data Exchange (ETDEWEB)

Wang Yanhua [School of Environmental Science and Engineering, Shanghai Jiaotong University, 800 Dong Chuan Road, Min Hang, Shanghai 200240 (China); Inamori, Ryuhei [Faculty of Symbiotic Systems Science, Fukushima University, 1 Kanayagawa, Fukushima 960-1296 (Japan); Kong Hainan [School of Environmental Science and Engineering, Shanghai Jiaotong University, 800 Dong Chuan Road, Min Hang, Shanghai 200240 (China)], E-mail: remanda@126.com; Xu Kaiqin [National Institute for Environmental Studies, 16-2 Onogawa, Tsukuba 305-8506 (Japan); State Key Laboratory of Water Resources and Hydropower Engineering Science, Wuhan Unviversity, Wuhan 430072 (China); Inamori, Yuhei [Faculty of Symbiotic Systems Science, Fukushima University, 1 Kanayagawa, Fukushima 960-1296 (Japan); Kondo, Takashi [National Institute for Environmental Studies, 16-2 Onogawa, Tsukuba 305-8506 (Japan); Zhang Jixiang [School of Economics and Management, Southeast University, Nanjing, Jiangsu 210096 (China)

2008-03-15

Loss of nitrogen from the soil-plant system has raised environmental concern. This study assessed the fluxes of nitrous oxide (N{sub 2}O) in the subsurface flow constructed wetlands (CWs). To better understand the mechanism of N{sub 2}O emission, spatial distribution of ammonia-oxidizing bacteria (AOB) in four kinds of wetlands soil were compared. N{sub 2}O emission data showed large temporal and spatial variation ranging from -5.5 to 32.7 mg N{sub 2}O m{sup -2} d{sup -1}. The highest N{sub 2}O emission occurred in the cell planted with Phragmites australis and Zizania latifolia. Whereas, the lower emission rate were obtained in the cell planted with P. australis and Typha latifolia. These revealed that Z. latifolia stimulated the N{sub 2}O emission. Transportation of more organic matter and oxygen for AOB growth may be the reason. The study of AOB also supported this result, indicating that the root structure of Z. latifolia was favored by AOB for N{sub 2}O formation. - Zizania latifolia has a large contribution to global warming.

Root biomass production in populations of six rooted macrophytes in response to Cu exposure: intra-specific variability versus constitutive-like tolerance.

Science.gov (United States)

Marchand, L; Nsanganwimana, F; Lamy, J B; Quintela-Sabaris, C; Gonnelli, C; Colzi, I; Fletcher, T; Oustrière, N; Kolbas, A; Kidd, P; Bordas, F; Newell, P; Alvarenga, P; Deletic, A; Mench, M

2014-10-01

Intra-specific variability of root biomass production (RP) of six rooted macrophytes, i.e. Juncus effusus, Phragmites australis, Schoenoplectus lacustris, Typha latifolia, Phalaris arundinacea, and Iris pseudacorus grown from clones, in response to Cu exposure was investigated. Root biomass production varied widely for all these macrophytes in control conditions (0.08 μM) according to the sampling site. Root biomass production of T. latifolia and I. pseudacorus in the 2.5-25 μM Cu range depended on the sampling location but not on the Cu dose in the growth medium. For P. australis, J. effusus, S. lacustris, and P. arundinacea, an intra-specific variability of RP depending on both the sampling location and the Cu-dose was evidenced. This intra-specific variability of RP depending on the sampling location and of Cu-tolerance for these last four species suggests that Cu constitutive tolerance for all rooted macrophytes is not a species-wide trait but it exhibits variability for some species. Copyright © 2014 Elsevier Ltd. All rights reserved.

Methane emissions from a freshwater marsh in response to experimentally simulated global warming and nitrogen enrichment

DEFF Research Database (Denmark)

Flury, Sabine; McGinnis, Daniel Frank; Gessner, Mark O.

2010-01-01

We determined methane (CH4) emissions in a field enclosure experiment in a littoral freshwater marsh under the influence of experimentally simulated warming and enhanced nitrogen deposition. Methane emissions by ebullition from the marsh composed of Phragmites australis were measured with funnel ...... to the atmosphere, even when they occupy only relatively small littoral areas. More detailed investigations are clearly needed to assess whether global warming and nitrogen deposition can have climate feedbacks by altering methane fluxes from these wetlands.  ......We determined methane (CH4) emissions in a field enclosure experiment in a littoral freshwater marsh under the influence of experimentally simulated warming and enhanced nitrogen deposition. Methane emissions by ebullition from the marsh composed of Phragmites australis were measured with funnel...... traps deployed in a series of enclosures for two 3 week periods. Diffusive fluxes were estimated on the basis of measured CH4 concentrations and application of Fick's law. Neither diffusive nor ebullitive fluxes of methane were significantly affected by warming or nitrate enrichment, possibly because...

Evaluation de la contamination de la chaîne trophique par les éléments traces (Cu, Co, Zn, Pb, Cd, U, V et As dans le bassin de la Lufira supérieure (Katanga/RD Congo

Directory of Open Access Journals (Sweden)

Katemo Manda, B.

2010-01-01

Full Text Available Evaluation of Contamination of the Food Chain by Trace Elements (Cu, Co, Zn, Pb, Cd, U, V and As in the Basin of the Upper Lufira (Katanga/DR Congo. Seven trace elements (Cu, Co, Zn, Cd, Pb, U, V and As were analyzed using a HR ICP-MS in samples of water, plankton, leaves of Phragmites australis, muscle and gills of three fish species (Oreochromis macrochir, Tilapia rendalli, Clarias gariepinus collected in the basin of the upper Lufira. The results indicate a high copper (70.9 ppm and cobalt (32.3 ppm content in the effluent of complex hydrometallurgical Shituru. If contamination of rivers decreases with distance from the pollution source, the values are very high in lake Tshangalele for plankton and leaves of P. australis. For fish, the results indicate that Pb, U, V, Cu, Co and Cd accumulates preferentially in the gills but Zn accumulates more in the muscles. As accumulates in the same order of magnitude in both organs. These results confirm the pollution of the basin by the effluents from Lufira complex hydrometallurgical Shituru.

Description of two new associated infaunal decapod crustaceans (Axianassidae and Alpheidae from the tropical eastern Pacific

Directory of Open Access Journals (Sweden)

Arthur Anker

2015-08-01

Full Text Available Two new species of infaunal decapod crustaceans are described based on material collected in Bahía Málaga, Pacific coast of Colombia, in 2009. The mud-shrimp Axianassa darrylfelderi sp. nov. (Axianassidae appears to be most closely related to A. australis Rodrigues & Shimizu, 1992, A. canalis Kensley & Heard, 1990, and A. jamaicensis Kensley & Heard, 1990. The new species may be distinguished from each of them by a combination of morphological features, mainly on the uropodal exopod, antennal acicle, third maxilliped and first pleonite. The shrimp Leptalpheus canterakintzi sp. nov. (Alpheidae, associated with burrows of A. darrylfelderi sp. nov., undoubtedly represents the eastern Pacific sister species of the western Atlantic L. axianassae Dworschak & Coelho, 1999, which lives exclusively in burrows of A. australis. The two species are reliably distinguishable only by the proportions of the merus and propodus of the third pereiopod. Leptalpheus azuero Anker, 2011, previously known only from the Pacific coast of Panama, is reported for the first time from Bahía Málaga, Colombia.

Spatiotemporal distribution of the benthic macrofauna in an urbanized subtropical estuary: environmental variations and anthropogenic impacts

Directory of Open Access Journals (Sweden)

Pedro Rocha Mattos

Full Text Available Abstract This study was conducted in the Itajaí-Açu river lower estuary in Southern Brazil, in which we aimed to: (1 analyze spatiotemporal variations on the macrofauna; (2 search for relationships between environmental variables and the assembly and (3 evaluate the influence of capital dredging upon the assembly. Two hundred twenty eight samples were performed in four stations, two of which affected by dredging. Sediment (sand, silt and clay, organic matter and carbonate and water column´s variables (temperature, salinity, pH, dissolved oxygen, and turbidity were also assessed. We applied Principal Component Analysis for environmental variables and Hierarchical Clustering for biotic data. Correlations between environmental and biotic matrices were tested by Canonical Analysis of Principal Coordinates. Spatiotemporal variations in the assembly were tested by Permutational Multivariate Analysis of Variance. From the 21.839 organisms sampled, 97% was represented by the gastropod Heleobia australis. Despite the influence of the river discharge on the ecosystem, dredging was deleterious to the assembly, favoring opportunistic organisms such as H. australis.

Fungal Planet description sheets: 69-91.

Science.gov (United States)

Crous, P W; Groenewald, J Z; Shivas, R G; Edwards, J; Seifert, K A; Alfenas, A C; Alfenas, R F; Burgess, T I; Carnegie, A J; Hardy, G E St J; Hiscock, N; Hüberli, D; Jung, T; Louis-Seize, G; Okada, G; Pereira, O L; Stukely, M J C; Wang, W; White, G P; Young, A J; McTaggart, A R; Pascoe, I G; Porter, I J; Quaedvlieg, W

2011-06-01

Novel species of microfungi described in the present study include the following from Australia: Bagadiella victoriae and Bagadiella koalae on Eucalyptus spp., Catenulostroma eucalyptorum on Eucalyptus laevopinea, Cercospora eremochloae on Eremochloa bimaculata, Devriesia queenslandica on Scaevola taccada, Diaporthe musigena on Musa sp., Diaporthe acaciigena on Acacia retinodes, Leptoxyphium kurandae on Eucalyptus sp., Neofusicoccum grevilleae on Grevillea aurea, Phytophthora fluvialis from water in native bushland, Pseudocercospora cyathicola on Cyathea australis, and Teratosphaeria mareebensis on Eucalyptus sp. Other species include Passalora leptophlebiae on Eucalyptus leptophlebia (Brazil), Exophiala tremulae on Populus tremuloides and Dictyosporium stellatum from submerged wood (Canada), Mycosphaerella valgourgensis on Yucca sp. (France), Sclerostagonospora cycadis on Cycas revoluta (Japan), Rachicladosporium pini on Pinus monophylla (Netherlands), Mycosphaerella wachendorfiae on Wachendorfia thyrsifolia and Diaporthe rhusicola on Rhus pendulina (South Africa). Novel genera of hyphomycetes include Noosia banksiae on Banksia aemula (Australia), Utrechtiana cibiessia on Phragmites australis (Netherlands), and Funbolia dimorpha on blackened stem bark of an unidentified tree (USA). Morphological and culture characteristics along with ITS DNA barcodes are provided for all taxa.

Bleaching of melanin in the epidermis of South American fur seal and its application on enzyme immunohistochemistry

Directory of Open Access Journals (Sweden)

A.P. Silva

2011-03-01

Full Text Available The South American fur seal (Arctocephalus australis is an amphibious marine mammal distributed along the Atlantic and Pacific coasts of South America. The species is well adjusted to different habitats due to the morphology of its fin-like members and due to some adaptations in their integumentary system. Immunohistochemical studies are very important to evaluate the mechanisms of skin adaptation due the differential expression of the antigens present in the tissue depending of the region of the body surface. However, its strongly pigmented (melanin epidermis prevents the visualization of the immuno-histochemical chromogens markers. In this study a melanin bleaching method was developed aimed to allow the visualization of the chromogens without interfering in the antigen-antibody affinity for immunohistochemistry. The analysis of PCNA (proliferating cell nuclear antigen index in the epidermis of A. australis by immunohistochemistry with diaminobenzidine (DAB as chromogen was used to test the method. The bleaching of the melanin allowed to obtain the cell proliferation index in epidermis and to avoid false positive results without affecting the immunohistochemical results.

Test Area C-80 Complex Final Range Environmental Assessment, Revision 1

Science.gov (United States)

2009-08-14

to intense noise might contribute to the development and aggravation of stress -related conditions such as high blood pressure, coronary disease...produced by test and training missions and their associated expendables. Noise may directly inconvenience and/or stress humans and some wildlife...Sherman’s fox squirrel Sciuris niger shermani Phragmites Phragmites australis American alligator Alligator mississippiensis White cedar Chamaecyparis

Rassenonderzoek blauwe bes : verslag van de rassenproef blauwe bes in Horst 1998-2002 (HO98.7.01)

NARCIS (Netherlands)

Balkhoven-Baart, J.M.T.; Peppelman, G.

2003-01-01

Van 1998 t/m 2002 werd op de PPO locatie Horst-Meterik een rassenproef gedaan met 17 rassen van blauwe bes. Doel van de proef was nagaan wat de gebruikswaarde is van de neiuwe rassen voor de teelt in Nederland. De herkomst van de rassen was Nieuw-Zeeland, Australië en de Verenigde Staten. In de

The complete mitochondrial genome and phylogenetic position of the Philippines spurdog, Squalus montalbani.

Science.gov (United States)

Kemper, Jenny M; Naylor, Gavin J P

2016-11-01

We present the complete mitochondrial genome sequence (16 555 bp) of the Philippines spurdog, Squalus montalbani, currently listed as Vulnerable due to population declines and fishing pressures. A phylogenetic analysis was carried out on S. montalbani and representative shark mitogenomes. Squalus montalbani was placed within the Squaliformes as a sister taxon to Squalus acanthias and Cirrhigaleus australis.

From mammals back to birds: Host-switch of the acanthocephalan Corynosoma australe from pinnipeds to the Magellanic penguin Spheniscus magellanicus

Czech Academy of Sciences Publication Activity Database

Hernandez-Orts, J. S.; Brandao, M.; Georgieva, Simona; Raga, J. A.; Crespo, E.A.; Luque, J.L.; Aznar, F. J.

2017-01-01

Roč. 12, č. 10 (2017), č. článku e0183809. E-ISSN 1932-6203 Institutional support: RVO:60077344 Keywords : mitochondrial gene-sequences * parasite community structure * american sea lion * phylogenetic-relationships * arctocephalus-australis * polymorphidae acanthocephala * ecological specialization * evolutionary ecology * systematic position * helminth-parasites Subject RIV: EH - Ecology, Behaviour OBOR OECD: Ecology Impact factor: 2.806, year: 2016

PER 2009(4)

African Journals Online (AJOL)

PER Electronic Law Review - Potchefstoomse Elektroniese Regsblad

38 In Wes-Australië is die gekodifiseerde verweer van noodweer, soos vervat in die Criminal. Code, in 2008 op grond van ... 39 In Victoria word noodweer in die algemeen deur a 9AC en 9AE Crimes Act 1958 gereël, terwyl a 9AH spesifieke ...... uitg (Printing Things Potchefstroom 2005). Roth Briefing Paper No 3/07.

La ministre Bibeau annonce la nomination du président du CRDI et ...

International Development Research Centre (IDRC) Digital Library (Canada)

il y a 5 jours ... ... et chargé de cours associé à l'Université Griffith de South East Queensland, en Australie. Ancien professeur adjoint auxiliaire à la School of International and Public Affairs de l'Université Columbia, à New York; et ancien chercheur du Centre international pour la recherche en agroforesterie, à Nairobi.

.i.Utricularia./i. carnivory revisited: plants supply photosynthetic carbon to traps

Czech Academy of Sciences Publication Activity Database

Sirová, Dagmara; Borovec, Jakub; Šantrůčková, H.; Šantrůček, J.; Vrba, Jaroslav; Adamec, Lubomír

2010-01-01

Roč. 61, č. 1 (2010), s. 99-103 ISSN 0022-0957 R&D Projects: GA MZe(CZ) QH81012 Institutional research plan: CEZ:AV0Z60170517; CEZ:AV0Z60050516 Keywords : aquatic carnivorous plants * stable isotope labelling * carbon exudation * microbial community * Utricularia australis * Utricularia vulgaris Subject RIV: EH - Ecology, Behaviour Impact factor: 4.818, year: 2010

Strategic Aspects of Pacific Cooperation Proposals,

Science.gov (United States)

1983-08-01

Dist Special RESUME ANALYTIQUE Des groupes privfis, benfificiant d’un certain appui off iciel au Japon , aux E-U, en Australie et dana certains pays...et indirectes en termes de defense pour les E-U et le * Canada. Au sein d’une telle communautfi, le Japon pourrait jouer un rale en matiare de sicuritg

Una nueva especie de Adesmia (Leguminosae, Papilionoideae para la Argentina

Directory of Open Access Journals (Sweden)

Emilio A. Ulibarri

2010-01-01

Full Text Available Se describe e ilustra Adesmia australis (serie Frigidae, una nueva especie de la provincia de Santa Cruz, que se distingue de su especie más afín, A. frigida, por el número y tamaño de los folíolos, el tamaño de las flores y estípulas isomorfas.

Checklist of mammals from Mato Grosso do Sul, Brazil

Directory of Open Access Journals (Sweden)

Walfrido Moraes Tomas

Full Text Available Abstract We updated the checklist of mammals from Mato Grosso do Sul, Brazil based on primary records only. One hundred and sixty-six mammal species were listed as occurring in the state, 47 of them being medium to large, 47 small mammal and 73 bat species. The listed species are distributed in 31 families: Didelphidae (17 spp., Dasypodidae (7 spp., Myrmecophagidae (2 spp., Cebidae (1 sp., Callithrichidae (2 spp., Aotidae (1 sp., Pitheciidae (1 sp., Atelidae (1 sp., Leporidae (1 sp., Felidae (7 spp., Canidae (4 spp., Mustelidae (5 spp., Mephitidae (2 spp., Procyonidae (2 spp., Tapiridae (1 sp., Tayassuidae (2 spp., Cervidae (4 spp., Sciuridae (1 sp., Cricetidae (22 spp., Erethizontidae (1 sp., Caviidae (3 spp., Dasyproctidae (1 sp., Cuniculidae (1 sp., Echimyidae (4 spp., Phyllostomidae (41 spp., Emballonuridae (2 spp., Molossidae (16 spp., Vespertilionidae (9 spp., Mormoopidae (1 sp., Noctilionidae (2 spp., and Natalidade (1 sp.. These numbers represent an increase of fourteen species with primary records for the state in comparison with the previously published checklist. However, it is evident the scarcity of information at several regions of the state, and the need of implementation of regional zoological collections. The state of Mato Grosso do Sul represent only 4.19% of the Brazilian territory, but the number of mammal species reach 24.13% of the known species occurring in the country.

Biological Flora of the British Isles: Phragmites australis

Czech Academy of Sciences Publication Activity Database

Packer, J. G.; Meyerson, L. A.; Skálová, Hana; Pyšek, Petr; Kueffer, C.

2017-01-01

Roč. 105, č. 4 (2017), s. 1123-1162 ISSN 0022-0477 R&D Projects: GA ČR(CZ) GA14-15414S Grant - others:AV ČR(CZ) AP1002 Program:Akademická prémie - Praemium Academiae Institutional support: RVO:67985939 Keywords : common reed * genome size * plant invasion Subject RIV: EF - Botanics OBOR OECD: Plant sciences, botany Impact factor: 5.813, year: 2016

Ultrastructure of Proechinophthirus zumpti (Anoplura, Echinophthiriidae by scanning electron microscopy

Directory of Open Access Journals (Sweden)

Dolores del Carmen Castro

2002-09-01

Full Text Available The ultrastructure of Proechinophthirus zumpti Werneck, 1955, mainly the external chorionic features of the egg, is described through electronic microscopy techniques. This species was first cited in Argentina, infesting Arctocephalus australis (Zimmermann, 1873. The morphological adaptations of adults and nymphs are described in both species of Proechinophthirus parasitic on Otariidae: P. fluctus (Ferris, 1916 and P. zumpti.

Australian toon planted in Hawaii: tree quality, growth, and stocking

Science.gov (United States)

Herbert L. Wick; Robert E. Nelson; Libert K. Landgraf

1971-01-01

Tree quality and rates of growth and survival were higher in 5- to 8-year-old Australian toon (Toona australis) plantations on sites with deep soils, good drainage, and as or broken pahoehoe rock than in plantations on sites with poor drainage or unbroken pahoehoe rock. Stocking averaged 236 trees per acre. Spacing in initial plants should be about 6...

A spacing trial in Australian Toon ... an interim report

Science.gov (United States)

Herbert L. Wick; Robert E. Burgan

1970-01-01

Australian toon (Toona australis) was planted at four spacing intervals-6, 8, 10, and 12 feet-in a trial on the island of Hawaii. Measurement of 8-year-old trees showed that spacing interval did not affect diameter or height growth or survival; but basal area per acre decreased as spacing increased. A goal of 400 acceptable and desirable pole-sized...

Isolation, cultivation and genomic analysis of magnetosome biomineralization genes of a new genus of South-seeking magnetotactic cocci within the Alphaproteobacteria

Energy Technology Data Exchange (ETDEWEB)

Morillo, Viviana [Universidade Federal do Rio de Janeiro; Abreu, Fernanda [Universidade Federal do Rio de Janeiro; Araujo, Ana C [Universidade Federal do Rio de Janeiro; de Almeida, Luiz G [Laboratorio Nacional de Computacao Cientifica; Enrich-Prast, Alex [Universidade Federal do Rio de Janeiro; Farina, Marcos [Universidade Federal do Rio de Janeiro; de Vasconcelos, Ana T [Laboratorio Nacional de Computacao Cientifica; Bazylinski, Dennis A [Ames Laboratory; Lins, Ulysses [Universidade Federal do Rio de Janeiro

2014-01-01

Although magnetotactic bacteria (MTB) are ubiquitous in aquatic habitats, they are still considered fastidious microorganisms with regard to growth and cultivation with only a relatively low number of axenic cultures available to date. Here, we report the first axenic culture of an MTB isolated in the Southern Hemisphere (Itaipu Lagoon in Rio de Janeiro, Brazil). Cells of this new isolate are coccoid to ovoid in morphology and grow microaerophilically in semi-solid medium containing an oxygen concentration ([O2]) gradient either under chemoorganoheterotrophic or chemolithoautotrophic conditions. Each cell contains a single chain of approximately 10 elongated cuboctahedral magnetite (Fe3O4) magnetosomes. Phylogenetic analysis based on the 16S rRNA gene sequence shows that the coccoid MTB isolated in this study represents a new genus in the Alphaproteobacteria; the name Magnetofaba australis strain IT-1 is proposed. Preliminary genomic data obtained by pyrosequencing shows that M. australis strain IT-1 contains a genomic region with genes involved in biomineralization similar to those found in the most closely related magnetotactic cocci Magnetococcus marinus strain MC-1. However, organization of the magnetosome genes differs from M. marinus.

Concentrations of heavy metals and plant nutrients in water, sediments and aquatic macrophytes of anthropogenic lakes (former open cut brown coal mines) differing in stage of acidification

Energy Technology Data Exchange (ETDEWEB)

Samecka-Cymerman, A. [Department of Ecology and Nature Protection, Wroclaw University, ul. Kanonia 6/8, 50-328 Wroclaw (Poland); Kempers, A.J. [Department of Biogeology, University of Nijmegen, Toernooiveld, 6525 ED Nijmegen (Netherlands)

2001-12-17

Concentration of heavy metals (Al, Ba, Cd, Co, Cr, Cu, Fe, Mn, Ni, Pb, Sr, V and Zn) as well as macronutrients (N, P, K, Ca, Mg, S) were measured in water, bottom sediments and plants from anthropogenic lakes in West Poland. The collected plants were: Phragmites australis, Potamogeton natans, Iris pseudoacorus, Juncus effusus, Drepanocladus aduncus, Juncus bulbosus, Phalaris arundinacea, Carex remota and Calamagrostis epigeios. Two reference lakes were sampled for Nymphaea alba, Phragmites australis, Schoenoplectus lacustris, Typha angustifolia and Polygonum hydropiper. These plants contained elevated levels of Cd, Co, Cr, Cu and Mn, and part of the plants contained in addition elevated levels of Mn, Fe, Pb, Ni and Zn. Analyses of water indicated pollution with sulfates, Cd, Co, Ni, Zn, Pb and Cu, and bottom sediments indicated that some of the examined lakes were polluted with Cd, Co and Cr. Strong positive correlations were found between concentrations of Co in water and in plants and between Zn in sediments and plants, indicating the potential of plants for pollution monitoring for this metal. Heavy metal accumulation seemed to be directly associated with the exclusion of Ca and Mg.

Numerical anomalies in the dentition of southern fur seals and sea lions (Pinnipedia: Otariidae

Directory of Open Access Journals (Sweden)

Carolina Loch

2010-06-01

Full Text Available Cases of dental agenesis, supernumerary teeth and dental losses are presented in three species of South American Otariids: Arctocephalus australis (Zimmermann, 1783, A. tropicalis (Gray, 1872 and Otaria flavescens (Shaw, 1800. For the first time, congenital and acquired dental anomalies were comparatively diagnosed in skull samples from southern Brazil and nearby areas. The skulls and mandibles were accessed in the scientific collection of mammals of the Federal University of Santa Catarina, southern Brazil. Agenesis was found only among maxillary post-canine teeth, especially the distal ones (PC/6, due to an evolutionary trend towards reduction of the number of post-canine teeth in this family. Maxillary and mandibular supernumerary teeth were found in A. australis and A. tropicalis, but their positioning is unrelated to cases regarding phylogenetic and evolutionary implications. Dental losses were found in all species and different stages of alveolar obliteration suggest that this process is common in Otariids and does not affect their survival. The investigation of congenital and acquired dental anomalies in pinnipeds can provide information on dental formula evolution in Pinnipeds and in the phylogenetic relationships among Carnivora.

Assessing the effectiveness of pollutant removal by macrophytes in a floating wetland for wastewater treatment

Science.gov (United States)

Prajapati, Meera; van Bruggen, Johan J. A.; Dalu, Tatenda; Malla, Rabin

2017-12-01

The study aimed to evaluate the removal of pollutants by floating treatment wetlands (FTWs) using an edible floating plant, and emergent macrophytes. All experiments were performed under ambient conditions. Physico-chemical parameters were measured, along with microbiological analysis of biofilm within the roots, water column, and sludge and gravel zone. Nitrification and denitrification rates were high in the water zone of Azolla filiculoides, Lemna minor, Lactuca sativa, P. stratiotes, and Phragmites australis. Phosphate removal efficiencies were 23, 10, and 15% for the free-floating hydrophytes, emergent macrophytes, and control and edible plants, respectively. The microbial community was relatively more active in the root zone compared to other zones. Pistia stratiotes was found to be the efficient in ammonium (70%) and total nitrogen (59%) removal. Pistia stratiotes also showed the highest microbial activity of 1306 mg day-1, which was 62% of the total volume. Microbial activity was found in the water zone of all FTWs expect for P. australis. The use of P. stratiotes and the edible plant L. sativa could be a potential option to treat domestic wastewater due to relatively high nutrient and organic matter removal efficiency.

Application of Hyperspectal Techniques to Monitoring & Management of Invasive Plant Species Infestation

Science.gov (United States)

2008-01-09

Scirpus olnei, S. robustus, Hibiscus palustris, Eryngium virginianum. 1. Common reed (Phragmites australis) - large cane or bamboo-like grass...Index 2 760 695 R R plant stress status Zarco-Tejada (1998) PI3, Pigment Index 3 690 440 R R vegetation health , based on chlorophyll fluorescence...ratios Lichtenthaler et al. (1996) PI4, Pigment Index 4 740 440 R R vegetation health , based on chlorophyll fluorescence ratios

Phytoremediation of Pharmaceuticals - Preliminary Study

OpenAIRE

Kotyza, J. (Jan); Soudek, P. (Petr); Kafka, Z.; Vaněk, T. (Tomáš)

2010-01-01

Phytoremediation of selected pharmaceuticals (diclofenac, ibuprofen, and acetaminophen) using Armoracia rusticana and Linum usitatissimum cell cultures and by hydroponically cultivated Lupinus albus, Hordeum vulgaris, and Phragmites australis plants in laboratory conditions is described. During in vitro experiments, the best results for acetaminophen were achieved using Armoracia rusticana hairy root cultures, where 100% of the starting amount was removed from the media during eight days. To...

Benefits and costs of street trees in Lisbon

Science.gov (United States)

A.L. Soares; F.C. Rego; E.G. McPherson; J.R. Simpson; P.J. Peper; Q. Xiao

2011-01-01

It is well known that urban trees produce various types of benefits and costs. The computer tool i-Tree STRATUM helps quantify tree structure and function, as well as the value of some of these tree services in different municipalities. This study describes one of the first applications of STRATUM outside the U.S. Lisbon’s street trees are dominated by Celtis australis...

Removal of antibiotics from urban wastewater by constructed wetland optimization.

Science.gov (United States)

Hijosa-Valsero, María; Fink, Guido; Schlüsener, Michael P; Sidrach-Cardona, Ricardo; Martín-Villacorta, Javier; Ternes, Thomas; Bécares, Eloy

2011-04-01

Seven mesocosm-scale constructed wetlands (CWs), differing in their design characteristics, were set up in the open air to assess their efficiency to remove antibiotics from urban raw wastewater. A conventional wastewater treatment plant (WWTP) was simultaneously monitored. The experiment took place in autumn. An analytical methodology including HPLC-MS/MS was developed to measure antibiotic concentrations in the soluble water fraction, in the suspended solids fraction and in the WWTP sludge. Considering the soluble water fraction, the only easily eliminated antibiotics in the WWTP were doxycycline (61±38%) and sulfamethoxazole (60±26%). All the studied types of CWs were efficient for the removal of sulfamethoxazole (59±30-87±41%), as found in the WWTP, and, in addition, they removed trimethoprim (65±21-96±29%). The elimination of other antibiotics in CWs was limited by the specific system-configuration: amoxicillin (45±15%) was only eliminated by a free-water (FW) subsurface flow (SSF) CW planted with Typha angustifolia; doxycycline was removed in FW systems planted with T. angustifolia (65±34-75±40%), in a Phragmites australis-floating macrophytes system (62±31%) and in conventional horizontal SSF-systems (71±39%); clarithromycin was partially eliminated by an unplanted FW-SSF system (50±18%); erythromycin could only be removed by a P. australis-horizontal SSF system (64±30%); and ampicillin was eliminated by a T. angustifolia-floating macrophytes system (29±4%). Lincomycin was not removed by any of the systems (WWTP or CWs). The presence or absence of plants, the vegetal species (T. angustifolia or P. australis), the flow type and the CW design characteristics regulated the specific removal mechanisms. Therefore, CWs are not an overall solution to remove antibiotics from urban wastewater during cold seasons. However, more studies are needed to assess their ability in warmer periods and to determine the behaviour of full-scale systems. Copyright �

With the noose around the neck: Marine debris entangling otariid species.

Science.gov (United States)

Franco-Trecu, Valentina; Drago, Massimiliano; Katz, Helena; Machín, Emanuel; Marín, Yamandú

2017-01-01

Plastic debris in marine environments and its impact on wildlife species is becoming a problem of increasing concern. In pinnipeds, entanglements commonly consist of loops around the neck of non-biodegradable materials from fishing gear or commercial packaging, known as "neck collars". These entanglements can cause injuries, death by suffocation and starvation, and therefore they may add to the overall decrease in population. Our objective was to describe the entanglement of two species of otariids (Arctocephalus australis and Otaria flavescens) in the South West Atlantic Ocean. These two species have widely different population sizes and contrasting trends, being the O. flavescens population one order of magnitude lower in abundance with a negative population trend. A total number of 47 entangled individuals and the ingestion of a fishing sinker were recorded (A. australis: n = 26; O. flavescens: n = 22). For A. australis about 40% of the objects came from industrial fishing with which this species overlap their foraging areas, although also its lost or discarded gear can travel long distances. In O. flavescens 48% of observed injuries were very severe, which might indicate that they had been entangled for a long time. More than 60% of the objects came from artisanal and recreational fishing that operates within 5 nautical miles off the coast, which is probably related to coastal foraging habits of this species. Due to the frequent interaction between artisanal fisheries and O. flavescens, it is possible that entangled nets could be active gears. An important contribution to mitigate entanglements can be the development of education programs setting the scenario for effective communication, and exchange with involved fishermen to collect and recycle old fishing nets. Returning to natural fibers or replacement of the current materials used in fishing gear for biodegradable materials can also be a recommended mitigation measure. Copyright © 2016

Halocarbon emissions by selected tropical seaweeds: species-specific and compound-specific responses under changing pH.

Science.gov (United States)

Mithoo-Singh, Paramjeet Kaur; Keng, Fiona S-L; Phang, Siew-Moi; Leedham Elvidge, Emma C; Sturges, William T; Malin, Gill; Abd Rahman, Noorsaadah

2017-01-01

Five tropical seaweeds, Kappaphycus alvarezii (Doty) Doty ex P.C. Silva, Padina australis Hauck, Sargassum binderi Sonder ex J. Agardh (syn. S. aquifolium (Turner) C. Agardh), Sargassum siliquosum J. Agardh and Turbinaria conoides (J. Agardh) Kützing, were incubated in seawater of pH 8.0, 7.8 (ambient), 7.6, 7.4 and 7.2, to study the effects of changing seawater pH on halocarbon emissions. Eight halocarbon species known to be emitted by seaweeds were investigated: bromoform (CHBr 3 ), dibro-momethane (CH 2 Br 2 ), iodomethane (CH 3 I), diiodomethane (CH 2 I 2 ), bromoiodomethane (CH 2 BrI), bromochlorometh-ane (CH 2 BrCl), bromodichloromethane (CHBrCl 2 ), and dibro-mochloromethane (CHBr 2 Cl). These very short-lived halocarbon gases are believed to contribute to stratospheric halogen concentrations if released in the tropics. It was observed that the seaweeds emit all eight halocarbons assayed, with the exception of K. alvarezii and S. binderi for CH 2 I 2 and CH 3 I respectively, which were not measurable at the achievable limit of detection. The effect of pH on halocarbon emission by the seaweeds was shown to be species-specific and compound specific. The highest percentage changes in emissions for the halocarbons of interest were observed at the lower pH levels of 7.2 and 7.4 especially in Padina australis and Sargassum spp., showing that lower seawater pH causes elevated emissions of some halocarbon compounds. In general the seaweed least affected by pH change in terms of types of halocarbon emission, was P. australis . The commercially farmed seaweed K. alvarezii was very sensitive to pH change as shown by the high increases in most of the compounds in all pH levels relative to ambient. In terms of percentage decrease in maximum quantum yield of photosynthesis ( F v ∕ F m ) prior to and after incubation, there were no significant correlations with the various pH levels tested for all seaweeds. The correlation between percentage decrease in the maximum

Halocarbon emissions by selected tropical seaweeds: species-specific and compound-specific responses under changing pH

Directory of Open Access Journals (Sweden)

Paramjeet Kaur Mithoo-Singh

2017-01-01

Full Text Available Five tropical seaweeds, Kappaphycus alvarezii (Doty Doty ex P.C. Silva, Padina australis Hauck, Sargassum binderi Sonder ex J. Agardh (syn. S. aquifolium (Turner C. Agardh, Sargassum siliquosum J. Agardh and Turbinaria conoides (J. Agardh Kützing, were incubated in seawater of pH 8.0, 7.8 (ambient, 7.6, 7.4 and 7.2, to study the effects of changing seawater pH on halocarbon emissions. Eight halocarbon species known to be emitted by seaweeds were investigated: bromoform (CHBr3, dibro­momethane (CH2Br2, iodomethane (CH3I, diiodomethane (CH2I2, bromoiodomethane (CH2BrI, bromochlorometh­ane (CH2BrCl, bromodichloromethane (CHBrCl2, and dibro­mochloromethane (CHBr2Cl. These very short-lived halocarbon gases are believed to contribute to stratospheric halogen concentrations if released in the tropics. It was observed that the seaweeds emit all eight halocarbons assayed, with the exception of K. alvarezii and S. binderi for CH2I2 and CH3I respectively, which were not measurable at the achievable limit of detection. The effect of pH on halocarbon emission by the seaweeds was shown to be species-specific and compound specific. The highest percentage changes in emissions for the halocarbons of interest were observed at the lower pH levels of 7.2 and 7.4 especially in Padina australis and Sargassum spp., showing that lower seawater pH causes elevated emissions of some halocarbon compounds. In general the seaweed least affected by pH change in terms of types of halocarbon emission, was P. australis. The commercially farmed seaweed K. alvarezii was very sensitive to pH change as shown by the high increases in most of the compounds in all pH levels relative to ambient. In terms of percentage decrease in maximum quantum yield of photosynthesis (Fv∕Fm prior to and after incubation, there were no significant correlations with the various pH levels tested for all seaweeds. The correlation between percentage decrease in the maximum quantum yield of

Tulipa albanica (Liliaceae), a new species from northeastern Albania

DEFF Research Database (Denmark)

Shuka, Lulëzim; Tan, Kit; Siljak-Yakovlev, Sonja

2010-01-01

Tulipa albanica (Liliaceae) is illustrated and described as a new species from a serpentine area in Kukësi district, northeastern Albania. It is compared with T. scardica from the western Balkans (Macedonia and Kosovo) and with T. schrenkii from the Ukraine, Caucasus, Central and Southwest Asia...... size 54.15 (± 0.23) pg. Two different morphotypes of T. australis were noted as occurring on limestone or serpentine in Albania....

New species of Myxosporea from frogs and resurrection of the genus Cystodiscus Lutz, 1889 for species with myxospores in gallbladders of amphibians

Czech Academy of Sciences Publication Activity Database

Hartigan, A.; Fiala, Ivan; Dyková, Iva; Rose, K.; Phalen, D. N.; Šlapeta, J.

2012-01-01

Roč. 139, č. 4 (2012), s. 478-496 ISSN 0031-1820 R&D Projects: GA AV ČR KJB600960701 Grant - others:GA ČR(CZ) GP204/09/P519 Program:GP Institutional support: RVO:60077344 Keywords : Cystodiscus axonis * Cystodiscus australis * new species * Myxidium * Myxosporea * amphibians * frogs * tadpoles * brain * liver * disease * phylogeny Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine Impact factor: 2.355, year: 2012

SEROPREVALENCIA Y SEROTIPIFICACIÓN DE LEPTOSPIROSIS CANINA EN EL MUNICIPIO DE BUENAVENTURA (VALLE DEL CAUCA)

OpenAIRE

Romero Peñuela, Marlyn Hellen; Astudillo Hernández, Myriam; Quintero Martínez, Mauricio Elías

2009-01-01

El presente estudio tuvo como objetivo verificar la infección con serovares de Leptospira spp. en caninos con propietario en Buenaventura, Valle del Cauca, Colombia. Las muestras de suero fueron tomadas de 100 caninos y fueron probadas con los serogrupos de Leptospira interrogans: Bataviae, Mini, Autumnalis, Canicola, Shermani, Icterohaemorrhagiae, Cynopteri, Australis, Celledonis, Grippotyphosa, Hebdomadis, Javanica, Manhao, Pomona, Pyrogenes, Sejroe, Tarassovi y Ballum, usando la técnica de...

Long-term ionizing radiation impact on seed progeny of common reed in water bodies of the Chernobyl exclusive zone

International Nuclear Information System (INIS)

Shevtsova, N.L.; Yavnyuk, A.A.; Gudkov, D.Yi.

2012-01-01

Results of the investigation of common reed's (Phragmites australis (Trin) Ex. Steud.) biological characteristics under conditions of long-term ionizing radiation impact are represented. Indices of seeds' vitality and disorders are analyzed. Low vitality indices, significant ontogenesis disorders, and high percent of abnormalities of germs are determined in water bodies, where littoral plants receive the absorbed dose in a low-dose range of 1-12 cGy year -1 .

The Contemporary Land Mammals of Egypt (Including Sinai).

Science.gov (United States)

1980-08-15

dactylifera), Tamarix nilotica, and mats of Imperata cylin- drica and Juncus rigidus. The last, together with T nilotica, choke the salty stream bed of Wadi...bipinnata and Imperata cylindrical occur along the canal banks. Marshy areas are dominated byJuncus rigidus and Phragmites australis. Alhagi mannifera...mannifera and stands of Panicum turgidum, Imperata cylindrica, and l)esmostachya bi- pinnata occur on the deeper sand sheets. Trees (Maerua crassifolia

Development of anatomical structure of roots of Phragmites australis

Czech Academy of Sciences Publication Activity Database

Soukup, A.; Votrubová, O.; Čížková, Hana

2002-01-01

Roč. 153, - (2002), s. 277-287 ISSN 0028-646X R&D Projects: GA MŠk OC 844.20; GA MŠk VS96145 Institutional research plan: CEZ:AV0Z6005908 Keywords : Casparian bands * exodermis * endodermis * lignin * suberin * root anatomy * Phragmites Subject RIV: EF - Botanics Impact factor: 2.945, year: 2002

Biology, Management and Utilization of Common Reed Pharagnites australis.

Science.gov (United States)

1987-02-01

Vrije Universiteit Waterways Experiment Staticn Department of Ecology and Ecotoxicology Environmental Laboratory P.O. Box 7161 P.O. Box 631 1007 MC...Madelijn van der Werff Vrije Universiteit Department of Ecology and Ecotoxicology Amsterdam and John W. Simmers and Stratford H. Kay Waterways...lowing and cutting 67 5.2.4. Active regulation of the water table 68 5.5. Nature conservation 68 5.4. Reed cultivation 69 Z.4. 1. Reed harvest 69 6

A radiological study of the kiwi (Apteryx australis mantelli)

International Nuclear Information System (INIS)

Beale, G.

1985-01-01

A kiwi chick has been examined at intervals for four and a half years since hatching. The rate of skeletal maturation has been analysed from radiographs (x-ray photographs). Other aspects of the skeleton have been assessed, particularly the cervical spine. The results suggest that the thorax of the ancestors of the kiwi was more cephalically placed than at present and that four vertebrae classified as cervical were then in the thorax and carried ribs. Even in the modern kiwi vestigal ribs can be seen on the fifteenth cervical vertebra. Studies of the gastrointestinal tract have been carried out on other kiwis using a barium solution with videotaping and radiographic procedure. Anatomical and physiological observations, e.g., temperature, pulse and respiration studies have been made. On those birds requiring anaesthesia the effects of anaesthetic agents have been recorded. Some blood analysis has been done and there are observations on air sacs, the diaphragm and eggs. There is an appendix detailing the radiographic procedures used and the total amount of radiation administered, which was not significantly greater than natural gamma radiation over the same period

AGLUTININAS ANTILEPTÓSPIRA EM EQÜINOS NO ESTADO DE GOIÁS ANTILEPTOSPIRA AGGLUTININS IN EQUINES IN THE GOIÁS STATE, BRAZIL

Directory of Open Access Journals (Sweden)

Marly Francisca Cândido

2007-09-01

Full Text Available

Foram analisados 694 hemossoros de eqüinos, procedentes de sete rnunicípios goianos, encontrando-se uma positividade para aglutininas antileptóspira que variou de 8,8 a 25,0%, com o valor médio de 14,4%. Diferentes sorotipos foram pesquisados, pela técnica de GALTON et alii (1962, encontrando-se positividade para os sorotipos grippotyphosa, wolffi, ballum e australis. Os autores concluíram pela necessidade de prosseguimento de novas pesquisas, com a finalidade de averiguar-se a presença ou não de diferentes sorotipos observados em outros Estados e não encontrados na presente pesquisa, além da realização de estudo epidemiológico local e regional.

694 equine serum blood tests were made from horses of 7 counties of the State of Goiás. Positive rates of Leptospira agglutinins varied from 8.8 to 25.0% with an average of 14.4%. Different serum types were studied by the technique developed by GALTON et alii (1962 finding positiveness for the following serum types: grippotyphosa, wolffi, ballum and australis.

Levels and distribution of cobalt and nickel in the aquatic macrophytes found in Skadar Lake, Montenegro.

Science.gov (United States)

Kastratović, Vlatko; Bigović, Miljan; Jaćimović, Željko; Kosović, Milica; Đurović, Dijana; Krivokapić, Slađana

2018-02-06

Macrophytes react to changes in the quality of the environment in which they live (water/sediment), and they are good bioindicators of surface water conditions. In the present study, the content of the metals cobalt (Co) and nickel (Ni) was determined in the sediment, the water, and different organs of macrophytes from six localities around Lake Skadar, across four different seasons of year. The aquatic macrophytes that have been used as bioindicator species in this study are Phragmites australis (an emerged species), Ceratophyllum demersum (a submerged species), and Lemna minor (a floating species). The aim of this study was to determine the distribution of metals in macrophyte tissues and also to discover the degree of bioaccumulation of the investigated metals, depending both on the location and on the season. The content of Co and Ni in the examined parts of the macrophytes was in the range of 0.04-8.78 and 0.30-28.5 ppm, respectively. The greatest content of the investigated metal in the organs of P. australis and C. demersum was recorded at the beginning of and during the growing season. Greater concentrations of metals in the tissue of L. minor were observed at the end of the growing season.

The life cycle of Ascocotyle (Phagicola) longa (Digenea: Heterophyidae), a causative agent of fish-borne trematodosis.

Science.gov (United States)

Simões, Susana Balmant Emerique; Barbosa, Helene Santos; Santos, Cláudia Portes

2010-03-01

The complete life cycle of the trematode Ascocotyle (Phagicola) longa (Digenea: Heterophyidae) is elucidated by natural observation validated by experimental infections. The natural first intermediate host of A. (P.) longa, an agent of human heterophyiasis in Brazil, is the cochliopid snail Heleobia australis (new first intermediate host). Metacercariae were found encysted in the body musculature, heart, stomach, liver, kidney, spleen, gonads and mesentery of mullets Mugil liza. Hamsters Mesocricetus auratus were experimentally infected with metacercariae of A. (P.) longa obtained from the mullets, and the adults recovered were used to infect the snails H. australis. Rediae and cercariae of A. (P.) longa are described for the first time. The ultrastructure of the tegument of A. (P.) longa shows a change in spination pattern from the cercaria with single-pointed spines to the metacercaria and adult with multipointed, brush-shaped spines. The life cycle of A. (P.) longa is related to estuaries and coastal lagoons where the recruitment of mugilid juveniles occurs. The high prevalence (100%) of A. (P.) longa encysted in the mullets examined within the urban area of Rio de Janeiro indicates the potentially great public health impact of the consumption of raw mullets. Copyright 2009 Elsevier B.V. All rights reserved.

Contribució al coneixement de les algues epifítiques en llacunes litorals

Directory of Open Access Journals (Sweden)

Cambra, Jaume

1993-12-01

Full Text Available The results or a study on epiphytic algae in coastal lagoans are presented. Usually, the algal epiphytic assemblages on macrophytes are very diversified. The most important algal group are diatoms, with less abundance can appear green and blue-green algae. The aquatic plants shaw a very rich epiphytic flora. However, the Phragmttes australis stems are covered by dense populations or Cladophora glomerata v. crassior and Rhizoclonium riparium, as well as with a high number or subordinate species.

Es presenten els resultats sobre les algues epifítiques d'hidròfits i helòfits en llacunes litorals. En general, les poblacions d'algues són força diversificades, destacant el grup de les diatomees, seguides de lluny per les cloroficies y les cianoficies. En general totes les plantes aquàtiques es troben força epifitades. No obstant, les tiges de Phragmites australis presenten unes poblacions d'algues epifítiques molt importants. Que es troben dominades per Cladophora glomerata v. crassior o Rhizoclonium riparium, acompanyades per un gran nombre d'espècies subordinades.

Wetland craft plants in KwaZulu-Natal: an ecological review of har­vesting impacts and implications for sustainable utilization

Directory of Open Access Journals (Sweden)

C. H. Traynor

2010-07-01

Full Text Available In South Africa, wetland plants have been used for centuries and they continue to be harvested for subsistence and commercial purposes. Fibres for crafts are collected by cutting the aboveground parts. KwaZulu-Natal is one of the major basket-producing regions in southern Africa and at least twenty-two species of wetland plants are harvested for crafts. A literature review of the harvested species revealed that the impacts of cutting have only been extensively investigated for Phragmites australis (Cav. Steud. and Juncus kraussii Hochst. The review suggested that, where plants display strong seasonal aboveground productivity patterns, cutting should take place after shoot senescence and before new shoot emergence to minimize damage to plants. Cutting in the short term could increase the density of green stems. However, in the long term in  Phragmites australis, it may deplete the rhizome reserves and reduce the density of useable (longer and thicker culms.The opportunity for sustainable harvests was investigated by considering the geographic distribution, whether species are habitat specific or not, and local population sizes of the craft plants. Juncus kraussii is of the greatest conservation concern.Ecologically sustainable wetland plant harv esting could contribute to the wise use of wetlands, an approach promoted nationally and internationally.

Modeling the Effect of Plants and Peat on Evapotranspiration in Constructed Wetlands

Directory of Open Access Journals (Sweden)

Florent Chazarenc

2010-01-01

Full Text Available Evapotranspiration (ET in constructed wetlands (CWs represents a major factor affecting hydrodynamics and treatment performances. The presence of high ET was shown to improve global treatment performances, however ET is affected by a wide range of parameters including plant development and CWs age. Our study aimed at modelling the effect of plants and peat on ET in CWs; since we hypothesized peat could behave like the presence of accumulated organic matter in old CWs. Treatment performances, hydraulic behaviour, and ET rates were measured in eight 1 m2 CWs mesocosm (1 unplanted, 1 unplanted with peat, 2 planted with Phragmites australis, 2 planted with Typha latifolia and 2 planted with Phragmites australis with peat. Two models were built using first order kinetics to simulate COD and TKN removal with ET as an input. The effect of peat was positive on ET and was related to the better growth conditions it offered to macrophytes. Removal efficiency in pilot units with larger ET was higher for TKN. On average, results show for COD a k20 value of 0.88 d-1 and 0.36 d-1 for TKN. We hypothesized that the main effect of ET was to concentrate effluent, thus enhancing degradation rates.

Interactions between salt marsh plants and Cu nanoparticles - Effects on metal uptake and phytoremediation processes.

Science.gov (United States)

Andreotti, Federico; Mucha, Ana Paula; Caetano, Cátia; Rodrigues, Paula; Rocha Gomes, Carlos; Almeida, C Marisa R

2015-10-01

The increased use of metallic nanoparticles (NPs) raises the probability of finding NPs in the environment. A lot of information exists already regarding interactions between plants and metals, but information regarding interactions between metallic NPs and plants, including salt marsh plants, is still lacking. This work aimed to study interactions between CuO NPs and the salt marsh plants Halimione portulacoides and Phragmites australis. In addition, the potential of these plants for phytoremediation of Cu NPs was evaluated. Plants were exposed for 8 days to sediment elutriate solution doped either with CuO or with ionic Cu. Afterwards, total metal concentrations were determined in plant tissues. Both plants accumulated Cu in their roots, but this accumulation was 4 to 10 times lower when the metal was added in NP form. For P. australis, metal translocation occurred when the metal was added either in ionic or in NP form, but for H. portulacoides no metal translocation was observed when NPs were added to the medium. Therefore, interactions between plants and NPs differ with the plant species. These facts should be taken in consideration when applying these plants for phytoremediation of contaminated sediments in estuaries, as the environmental management of these very important ecological areas can be affected. Copyright © 2015 Elsevier Inc. All rights reserved.

Beauveria medogensis sp. nov., a new fungus of the entomopathogenic genus from China.

Science.gov (United States)

Imoulan, Abdessamad; Wu, Hai-Jun; Lu, Wei-Lai; Li, Yi; Li, Bin-Bin; Yang, Rei-Heng; Wang, Wen-Jing; Wang, Xiao-Liang; Kirk, Paul M; Yao, Yi-Jian

2016-09-01

Beauveria is among the most ubiquitous genera of entomopathogenic fungi throughout the world. A previously unknown species of the genus was recently discovered from a soil sample collected from Tibetan Plateau, China and is here described as new to science, B. medogensis sp. nov. The new species is distinguished from its closest relatives based on both morphological characterization and molecular phylogenetic analyses. Beauveria medogensis is characterized by globose to subglobose conidia, morphologically similar to some other species of in the genus, but was conclusively separated from those species in the phylogenetic analyses including sequences of four nuclear genes (RPB1, RPB2, TEF1 and Bloc). The new species was clustered in the analyses in a single terminal lineage which was grouped with B. australis sequences together as a sister clade to the B. brongniartii terminal clade. Although molecularly closely related, the new species is distinct morphologically from its closest sisters, B. australis and B. brongniartii, in producing globose to subglobose conidia rather than subglobose, broadly ellipsoid to ellipsoid conidia or ellipsoidal to cylindrical conidia. As isolated from a soil sample, the entomopathogenicity of the new species has been confirmed using Helicoverpa armigera and Tenebrio molitor larvae. Copyright © 2016 Elsevier Inc. All rights reserved.

Habitat heterogeneity influences restoration efficacy: Implications of a habitat-specific management regime for an invaded marsh

Science.gov (United States)

Tang, Long; Gao, Yang; Wang, Cheng-Huan; Li, Bo; Chen, Jia-Kuan; Zhao, Bin

2013-07-01

Invasive species have to be managed to prevent adverse consequences. Spartina alterniflora has invaded many marshes where salinity and inundation are often key factors affecting vegetation. The former was surface clipped twice and native Phragmites australis was planted in invaded zones to examine the effects of habitat properties on the efficacy of invader control and native restoration. The results showed that two clipping treatments almost eliminated S. alterniflora in the zones with long inundation periods of 80 h/15 d but stimulated compensatory growth of S. alterniflora in the zones with short inundation periods. Transplanted P. australis performed better over time in zones with low salinity (removal of the above-ground parts of S. alterniflora should be used only in the middle tidal zones and that native vegetation should be planted in zones above the mean high water level while the others zones in the saltmarsh should be restored to mud flats. Usually, invasive plants can flourish in highly heterogeneous habitats, which can influence management efficacy by influencing the re-growth of treated invaders and the performance of restored native species. Therefore, habitat-specific management regimes for invasive species can be expected to be more efficient because of their dependence on specific habitats.

Scaphitid ammonites from the Upper Cretaceous of KwaZulu-Natal and Eastern Cape Province, South Africa

Science.gov (United States)

Kennedy, William James; Klinger, Herbert Christian

2013-12-01

Kennedy, W.J. and Klinger, H.C. 2013. Scaphitid ammonites from the Upper Cretaceous of KwaZulu-Natal and Eastern Cape Province, South Africa. Acta Geologica Polonica, 63 (4), 527-543. Warszawa. Scaphitid ammonites are described and illustrated from the Upper Cretaceous of the coastal region of north-eastern South Africa. Scaphites kieslingswaldensis Langenhan and Grundey, 1891, Scaphites manasoaensis Collignon, 1965, and Yezoites concinna sp. nov. occur in the Coniacian part of the St Lucia Formation in northern KwaZulu-Natal. A further Yezoites sp. may also be from this level. Argentoscaphites corrugatus sp. nov. occurs in the Santonian to Lower Campanian Mzamba Formation on the northernmost coast of Eastern Cape Province. Yezoites australis sp. nov. occurs in the Upper Santonian part of the St Lucia and Mzamba formations of these areas, and Scaphites reesidei Collignon, 1969, is recorded from the Lower Campanian part of the Mzamba Formation. The scaphitid assemblage includes species previously described from Western Europe and Madagascar, together with Argentoscaphites, previously known only from Patagonia (and possibly South India). Dimorphism is recognised in Scaphites reesidei, Yezoites concinna sp. nov. and Y. australis sp. nov. Argentoscaphites corrugatus sp. nov. and Yezoites sp. are represented by microconchs only. Dimorphism has not been recognised in Scaphites kieslingswaldensis.

Molecular diversity among domestic guinea-pigs (Cavia porcellus and their close phylogenetic relationship with the Andean wild species Cavia tschudii Diversidad molecular entre cuyes domésticos (Cavia porcellus y su relación filogenética cercana con la especie silvestre andina Cavia tschudii

Directory of Open Access Journals (Sweden)

ÁNGEL E SPOTORNO

2004-06-01

Full Text Available To investigate the origin and diversity of domestic guinea-pigs Cavia porcellus (Linnaeus, 1758; Rodentia, Caviidae, we sequenced the mitochondrial cytochrome b gene of 12 domestic and 10 wild specimens from six species, including the two presumed as ancestral to the domestic one: Cavia tschudii and Cavia aperea. All maximum parsimony and maximum likelihood analyses grouped C. porcellus with C. tschudii (mean K2P distance = 3.2 %; best trees had 609 steps (CI = 0.796; Bremer support Index (SI = 28, and a _Ln = 4419.52, with 100 % and 97 % bootstrap support respectively. This clade, supported by three substitutions and 96 % bootstrap, is also obtained in the cladistic analysis of corresponding amino acids. When the C. aperea node was forced to join C. porcellus, these trees were consistently longer, less likely and robust, and with less defining characters than the optimal one. All C. porcellus sequences also clustered in a node defined by 15 substitutions. The sub-node containing animals from city markets, pet shops and laboratories was characterized by four substitutions (one non-silent, SI = 7, and 91 % bootstrap. Some South American C. porcellus, called "criollos" (creoles by local breeders, were more diverse. Probably, a particular clade from southern Peru and Chile may represent a pre-Columbian lineage. Mean K2P distance between C. tschudii and C. aperea was rather large, 7.7 %. Cavia appeared as a robust node (100 % bootstrap. These results indicate that C. tschudii is the species most closely related to C. porcellusPara investigar el origen y la divergencia de los cuyes domésticos Cavia porcellus (Linnaeus, 1758; Rodentia, Caviidae, secuenciamos el gen mitocondrial para citocromo b de 12 especímenes domésticos y 10 silvestres de seis especies, incluyendo las dos que se presumen como ancestro de la doméstica: C. tschudii y C. aperea. Todos los análisis de máxima parsimonia y máxima verosimilitud agruparon a C. porcellus con C

Subsurface flow constructed wetlands for the treatment of wastewater from different sources. Design and operation

OpenAIRE

Torrens Armengol, Antonina

2016-01-01

The aim of the thesis is to examine the viability of the subsurface constructed wetlands for the treatment of wastewater derived from three different sources (treatment ponds, pig farms and car wash facilities), and to evaluate the influence of design (size, type and depth of media, presence of Phragmites australis) and operational parameters (hydraulic load, dosing and feeding modes) on treatment efficiency and hydraulic behavior. Several studies were done in the framework of different ...

Public Attitudes to the Use of Wildlife by Aboriginal Australians: Marketing of Wildlife and its Conservation

OpenAIRE

Tisdell, Clement A.; Swarna Nantha, Hemanath

2005-01-01

Attitudes of a sample of the Australian public towards the subsistence use of wildlife by indigenous Australians and whether or not indigenous Australians should be allowed to sell wildlife and wildlife products is examined. It has been suggested that allowing such possibilities would provide economic incentives for nature conservation among local people. We explore whether those sampled believe that indigenous Australians should do more than other groups and institutions to conserve Australi...

Les plantations d' Eucalyptus au Sahel: distribution, importance ...

African Journals Online (AJOL)

Grâce à leur plasticité et leur rusticité, les espèces du genre Eucalyptus sont parmi les essences forestières les plus utilisées pour le reboisement en vue de lutter contre la désertification au Sahel. Toutefois, l'expansion rapide de ces espèces originaires d'Australie dans le Sahel, est surtout liée au succès économique de ...

Fungal Planet description sheets: 469-557.

Science.gov (United States)

Crous, P W; Wingfield, M J; Burgess, T I; Hardy, G E St J; Crane, C; Barrett, S; Cano-Lira, J F; Le Roux, J J; Thangavel, R; Guarro, J; Stchigel, A M; Martín, M P; Alfredo, D S; Barber, P A; Barreto, R W; Baseia, I G; Cano-Canals, J; Cheewangkoon, R; Ferreira, R J; Gené, J; Lechat, C; Moreno, G; Roets, F; Shivas, R G; Sousa, J O; Tan, Y P; Wiederhold, N P; Abell, S E; Accioly, T; Albizu, J L; Alves, J L; Antoniolli, Z I; Aplin, N; Araújo, J; Arzanlou, M; Bezerra, J D P; Bouchara, J-P; Carlavilla, J R; Castillo, A; Castroagudín, V L; Ceresini, P C; Claridge, G F; Coelho, G; Coimbra, V R M; Costa, L A; da Cunha, K C; da Silva, S S; Daniel, R; de Beer, Z W; Dueñas, M; Edwards, J; Enwistle, P; Fiuza, P O; Fournier, J; García, D; Gibertoni, T B; Giraud, S; Guevara-Suarez, M; Gusmão, L F P; Haituk, S; Heykoop, M; Hirooka, Y; Hofmann, T A; Houbraken, J; Hughes, D P; Kautmanová, I; Koppel, O; Koukol, O; Larsson, E; Latha, K P D; Lee, D H; Lisboa, D O; Lisboa, W S; López-Villalba, Á; Maciel, J L N; Manimohan, P; Manjón, J L; Marincowitz, S; Marney, T S; Meijer, M; Miller, A N; Olariaga, I; Paiva, L M; Piepenbring, M; Poveda-Molero, J C; Raj, K N A; Raja, H A; Rougeron, A; Salcedo, I; Samadi, R; Santos, T A B; Scarlett, K; Seifert, K A; Shuttleworth, L A; Silva, G A; Silva, M; Siqueira, J P Z; Souza-Motta, C M; Stephenson, S L; Sutton, D A; Tamakeaw, N; Telleria, M T; Valenzuela-Lopez, N; Viljoen, A; Visagie, C M; Vizzini, A; Wartchow, F; Wingfield, B D; Yurchenko, E; Zamora, J C; Groenewald, J Z

2016-12-01

Novel species of fungi described in this study include those from various countries as follows: Australia : Apiognomonia lasiopetali on Lasiopetalum sp., Blastacervulus eucalyptorum on Eucalyptus adesmophloia , Bullanockia australis (incl. Bullanockia gen. nov.) on Kingia australis , Caliciopsis eucalypti on Eucalyptus marginata , Celerioriella petrophiles on Petrophile teretifolia , Coleophoma xanthosiae on Xanthosia rotundifolia , Coniothyrium hakeae on Hakea sp., Diatrypella banksiae on Banksia formosa , Disculoides corymbiae on Corymbia calophylla , Elsinoë eelemani on Melaleuca alternifolia , Elsinoë eucalyptigena on Eucalyptus kingsmillii , Elsinoë preissianae on Eucalyptus preissiana , Eucasphaeria rustici on Eucalyptus creta , Hyweljonesia queenslandica (incl. Hyweljonesia gen. nov.) on the cocoon of an unidentified microlepidoptera, Mycodiella eucalypti (incl. Mycodiella gen. nov.) on Eucalyptus diversicolor , Myrtapenidiella sporadicae on Eucalyptus sporadica , Neocrinula xanthorrhoeae (incl. Neocrinula gen. nov.) on Xanthorrhoea sp., Ophiocordyceps nooreniae on dead ant, Phaeosphaeriopsis agavacearum on Agave sp., Phlogicylindrium mokarei on Eucalyptus sp., Phyllosticta acaciigena on Acacia suaveolens , Pleurophoma acaciae on Acacia glaucoptera , Pyrenochaeta hakeae on Hakea sp., Readeriella lehmannii on Eucalyptus lehmannii , Saccharata banksiae on Banksia grandis , Saccharata daviesiae on Daviesia pachyphylla , Saccharata eucalyptorum on Eucalyptus bigalerita , Saccharata hakeae on Hakea baxteri , Saccharata hakeicola on Hakea victoria , Saccharata lambertiae on Lambertia ericifolia , Saccharata petrophiles on Petrophile sp., Saccharata petrophilicola on Petrophile fastigiata , Sphaerellopsis hakeae on Hakea sp., and Teichospora kingiae on Kingia australis. Brazil : Adautomilanezia caesalpiniae (incl . Adautomilanezia gen. nov.) on Caesalpina echinata , Arthrophiala arthrospora (incl. Arthrophiala gen. nov.) on Sagittaria montevidensis , Diaporthe

Comparative morphology, histology and growth of the dental plates of the Devonian dipnoan Chirodipterus.

Science.gov (United States)

Smith, M M; Campbell, K S

1987-10-14

The dental plates of the Devonian lungfish Chirodipterus australis Miles (Osteichthyes; Dipnoi) are shown to have achieved their characteristic morphology by a growth process different from that assumed for the plates of genera such as Dipterus. Each plate was thickened by the addition of layers of bone that also extended the plate labially, thus providing the base on which and into which dentine grew. Distinctive features of the dentition are: (a) labial increase of the dentine mass by the addition of blister-like denticles of simple enamel-covered dentine, which is initially ingrown by pleromic dentine and subsequently resorbed and replaced by petrodentine; (b) increase in the midline by a similar process that results in the addition of one (or possibly two) new ridges; (c) resorption of the posterior edge of the pterygoid plates and the posterior and posteromedial edges of the prearticular plates, with subsequent development over the resorbed surfaces of several generations of simple regenerative dentine; (d) resorption and redeposition of pleromic dentine and bone in a triangular region posteromedially on the pterygoid plates; (e) the formation of tuberosities that simulate teeth at a short distance in from the labial edge, by four processes: formation of an undulating plate margin, differential growth of petrodentine (hard compact dentine) within the pulp cavity, differential wear of the petrodentine and the adjacent bone plus pleromic dentine, and slightly greater growth of the petrodentine towards the occlusal surface relative to the adjacent bone and dentine; (f) expansion of the large flat surfaces of the plates by gradual replacement of the bone and dentine at the proximal ends of the furrows and also by the development of linkages of petrodentine across the furrows; (g) development of isolated tuberosities on the flat posterolateral parts of the plates. The petrodentine of the ridges, tuberosities and plateaus of the plates is indistinguishable

Effect of different plant species in pilot constructed wetlands for wastewater reuse in agriculture

Directory of Open Access Journals (Sweden)

Salvatore Barbagallo

2013-09-01

Full Text Available In this paper the first results of an experiment carried out in Southern Italy (Sicily on the evapotranspiration (ET and removal in constructed wetlands with five plant species are presented. The pilot plant used for this study is made of twelve horizontal sub-surface flow constructed wetlands (each with a surface area of 4.5 m2 functioning in parallel, and it is used for tertiary treatment of part of the effluents from a conventional municipal wastewater treatment plant (trickling filter. Two beds are unplanted (control while ten beds are planted with five different macrophyte species: Cyperus papyrus, Vetiveria zizanoides, Miscanthus x giganteus, Arundo donax and Phragmites australis (i.e., every specie is planted in two beds to have a replication. The influent flow rate is measured in continuous by an electronic flow meter. The effluent is evaluated by an automatic system that measure the discharged volume for each bed. Physical, chemical and microbiological analyses were carried out on wastewater samples collected at the inlet of CW plant and at the outlet of the twelve beds. An automatic weather station is installed close to the experimental plant, measuring air temperature, wind speed and direction, rainfall, global radiation, relative humidity. This allows to calculate the reference Evapotranspiration (ET0 with the Penman-Monteith formula, while the ET of different plant species is measured through the water balance of the beds. The first results show no great differences in the mean removal performances of the different plant species for TSS, COD and E.coli, ranged from, respectively, 82% to 88%, 60% to 64% and 2.7 to 3.1 Ulog. The average removal efficiency of nutrient (64% for TN; 61 for NH4-N, 31% for PO4-P in the P.australis beds was higher than that other beds. From April to November 2012 ET measured for plant species were completely different from ET0 and ETcontrol, underlining the strong effect of vegetation. The cumulative

Mental health literacy as a function of remoteness of residence: an Australian national study

OpenAIRE

Jorm Anthony F; Christensen Helen; Griffiths Kathleen M

2009-01-01

Abstract Background Although there have been many population studies of mental health literacy, little is known about the mental health literacy of people who reside in rural areas. This study sought to determine the impact of remoteness on public knowledge of depression and schizophrenia. Methods The mental health literacy of residents of major cities, inner regional, and outer-remote (including outer regional, remote, and very remote) regions were compared using data from a 2003–04 Australi...

Treating urban sewage using constructed wetlands; Depuracion de aguas residuales urbanas mediante humedales contruidos

Energy Technology Data Exchange (ETDEWEB)

Garcia, J. [ETS Camins, Canals i Ports. UPC. Barcelona (Spain); Ruiz, A. [Biologa. Barcelona. (Spain); Junqueras, X. [Biologo. Barcelona (Spain)

1997-09-01

Constructed wetlands are a low-cost alternative for treating sewage from small urbanized areas. The ``Can Massaguer`` children`s holiday home has a 230 m``2 subsurface flow wetland for secondary treatment of the sewage generated by 130 people. The system comprises two porous substrate beds with macrophytes (ditch reed, Phragmites australis) and entry and exit units. Its high purification performance and nil running costs make it ideal for treating wastewaters from small built-up areas. (Author)

Die sendingkonferensie van die G.E.S. te Kaapstad op 2–6 Augustus 1976 – ’n terugblik

Directory of Open Access Journals (Sweden)

L. J. Botha

1977-05-01

Full Text Available Dit is inderdaad ’n grootse ervaring om ’n byeenkoms van Gereformeerdgesinde Christene van oor die hele wêreld by te woon. Die ekumeniese karakter van die konferensie te Kaapstad blyk duidelik uit die presensielys. Daar was afgevaardigdes van Gereformeerdgesinde kerke vanuit Malawi, Nigerië, Rhodesië, Suid-Afrika, Suidwes-Afrika, Zambië, Siri Lanka, Japan, Frankryk, Noord-Ierland, Nederland, Skotland, V.S.A., Suid-Amerika, Australië, Indonesië en Nieu-Seeland.

Mapping of the extinction in Giant Molecular Clouds using optical star counts

OpenAIRE

Cambresy, L.

1999-01-01

This paper presents large scale extinction maps of most nearby Giant Molecular Clouds of the Galaxy (Lupus, rho-Ophiuchus, Scorpius, Coalsack, Taurus, Chamaeleon, Musca, Corona Australis, Serpens, IC 5146, Vela, Orion, Monoceros R1 and R2, Rosette, Carina) derived from a star count method using an adaptive grid and a wavelet decomposition applied to the optical data provided by the USNO-Precision Measuring Machine. The distribution of the extinction in the clouds leads to estimate their total...

Effects of Spartina alterniflora Invasion on Soil Respiration in the Yangtze River Estuary, China

Science.gov (United States)

Bu, Naishun; Qu, Junfeng; Li, Zhaolei; Li, Gang; Zhao, Hua; Zhao, Bin; Li, Bo; Chen, Jiakuan; Fang, Changming

2015-01-01

Many studies have found that plant invasion can enhance soil organic carbon (SOC) pools, by increasing net primary production (NPP) and/or decreased soil respiration. While most studies have focused on C input, little attention has been paid to plant invasion effects on soil respiration, especially in wetland ecosystems. Our study examined the effects of Spartina alterniflora invasion on soil respiration and C dynamics in the Yangtze River estuary. The estuary was originally occupied by two native plant species: Phragmites australis in the high tide zone and Scirpus mariqueter in the low tide zone. Mean soil respiration rates were 185.8 and 142.3 mg CO2 m−2 h−1 in S. alterniflora and P. australis stands in the high tide zone, and 159.7 and 112.0 mg CO2 m−2 h−1 in S. alterniflora and S. mariqueter stands in the low tide zone, respectively. Aboveground NPP (ANPP), SOC, and microbial biomass were also significantly higher in the S. alterniflora stands than in the two native plant stands. S. alterniflora invasion did not significantly change soil inorganic carbon or pH. Our results indicated that enhanced ANPP by S. alterniflora exceeded invasion-induced C loss through soil respiration. This suggests that S. alterniflora invasion into the Yangtze River estuary could strengthen the net C sink of wetlands in the context of global climate change. PMID:25799512

Seasonal biodiversity and ecological studies on the epiphytic microalgae communities in polluted and unpolluted aquatic ecosystem at Assiut, Egypt

Directory of Open Access Journals (Sweden)

Adam Mahmoud S.

2017-12-01

Full Text Available A qualitative and quantitative study on epiphytic microalgae was carried out seasonally from November 2015 to August 2016 to follow up their community structures on aquatic macrophytes related to some physico-chemical properties of two polluted and unpolluted water bodies at Assiut, Egypt. A total of 169 species related to 64 genera of epiphytic microalgae were recorded. The most dominant algal group was Bacillariophyceae (43.2%, followed by Chlorophyceae (34.91%, Cyanophyceae (20.71% and Euglenophyceae (1.18%. The total number of epiphytic algae fluctuated between 11.1 × 104 ind.g-1 plant dry wt. on Phragmites australis in summer at Nazlet Abdellah (polluted site and 10.02 × 107 ind.g-1 plant dry wt. on Myriophyllum spicatum in winter at El-Wasta (unpolluted site. Some epiphytic microalgae were dominant as Pseudanabaena limnetica, Calothrix braunii, Scenedesmus acutus, and Ulnaria ulna. Others were specific on certain macrophytes as Aphanocapsa thermalis and Ulothrix sp., which grow on Phragmites australis, while Synechocystis minuscula attached itself on Myriophyllum spicatum. Analysis of PERMANOVA showed that the most important factors that induced the variation in epiphytic microalgae were the temporal variation and host plant. Water temperature, pH, nitrate, chloride, phosphate and total dissolved salts were the highest abiotic factors correlated with the variation in composition of epiphytic microalgae.

Development of autochthonous microbial consortia for enhanced phytoremediation of salt-marsh sediments contaminated with cadmium.

Science.gov (United States)

Teixeira, Catarina; Almeida, C Marisa R; Nunes da Silva, Marta; Bordalo, Adriano A; Mucha, Ana P

2014-09-15

Microbial assisted phytoremediation is a promising, though yet poorly explored, new remediation technique. The aim of this study was to develop autochthonous microbial consortia resistant to cadmium that could enhance phytoremediation of salt-marsh sediments contaminated with this metal. The microbial consortia were selectively enriched from rhizosediments colonized by Juncus maritimus and Phragmites australis. The obtained consortia presented similar microbial abundance but a fairly different community structure, showing that the microbial community was a function of the sediment from which the consortia were enriched. The effect of the bioaugmentation with the developed consortia on cadmium uptake, and the microbial community structure associated to the different sediments were assessed using a microcosm experiment. Our results showed that the addition of the cadmium resistant microbial consortia increased J. maritimus metal phytostabilization capacity. On the other hand, in P. australis, microbial consortia amendment promoted metal phytoextraction. The addition of the consortia did not alter the bacterial structure present in the sediments at the end of the experiments. This study provides new evidences that the development of autochthonous microbial consortia for enhanced phytoremediation of salt-marsh sediments contaminated with cadmium might be a simple, efficient, and environmental friendly remediation procedure. Development of autochthonous microbial consortia resistant to cadmium that enhanced phytoremediation by salt-marsh plants, without a long term effect on sediment bacterial diversity. Copyright © 2014 Elsevier B.V. All rights reserved.

Effects of Spartina alterniflora invasion on soil respiration in the Yangtze River estuary, China.

Science.gov (United States)

Bu, Naishun; Qu, Junfeng; Li, Zhaolei; Li, Gang; Zhao, Hua; Zhao, Bin; Li, Bo; Chen, Jiakuan; Fang, Changming

2015-01-01

Many studies have found that plant invasion can enhance soil organic carbon (SOC) pools, by increasing net primary production (NPP) and/or decreased soil respiration. While most studies have focused on C input, little attention has been paid to plant invasion effects on soil respiration, especially in wetland ecosystems. Our study examined the effects of Spartina alterniflora invasion on soil respiration and C dynamics in the Yangtze River estuary. The estuary was originally occupied by two native plant species: Phragmites australis in the high tide zone and Scirpus mariqueter in the low tide zone. Mean soil respiration rates were 185.8 and 142.3 mg CO2 m(-2) h(-1) in S. alterniflora and P. australis stands in the high tide zone, and 159.7 and 112.0 mg CO2 m(-2) h(-1) in S. alterniflora and S. mariqueter stands in the low tide zone, respectively. Aboveground NPP (ANPP), SOC, and microbial biomass were also significantly higher in the S. alterniflora stands than in the two native plant stands. S. alterniflora invasion did not significantly change soil inorganic carbon or pH. Our results indicated that enhanced ANPP by S. alterniflora exceeded invasion-induced C loss through soil respiration. This suggests that S. alterniflora invasion into the Yangtze River estuary could strengthen the net C sink of wetlands in the context of global climate change.

Location and associated carbon storage of erosional escarpments of seagrass Posidonia mats

Directory of Open Access Journals (Sweden)

Oscar eSerrano

2016-03-01

Full Text Available Seagrasses of the genus Posidonia can form an irregular seascape due to erosional processes exposing thick walls of organic matter-rich soils. However, little is known about the location and characteristics of these particular formations. Here we provide comprehensive estimates of organic carbon (Corg storage in P. oceanica and P. australis meadows, while providing insight into their location and mechanisms of formation, and highlighting future research directions. Erosional reef escarpments are restricted to shallow highly productive P. oceanica meadows from the Mediterranean Sea and P. australis meadows from the Indian Ocean, and sustain the existence of Corg-rich deposits in surrounding meadows. The thickness of the mat escarpments can reach up to 3 m and their length can vary from few to hundreds meters. Mechanisms of formation appear to differ among sites, from naturally-induced escarpments by wave action and/or tidal flow to human-induced escarpments by dredging activities. The inter-twined remains of seagrass shoots within the sediment matrix consolidate the sandy substrate and hold the exposed Posidonia mat escarpments together, maintaining a semi-rigid structure. This phenomenon is unusual but of exceptional importance in marine biogeochemical cycles, revealing the largest Corg sinks among seagrasses worldwide (ranging from 15-176 kg Corg m-2 in 2 m-thick mats accumulated at 2-249 g Corg m-2 yr-1 over 300 to 3000 yr.

Revegetation dynamics after 15 years of rewetting in two extracted peatlands in Sweden

Directory of Open Access Journals (Sweden)

S.A. Kozlov

2016-02-01

Full Text Available The restoration of extracted peatlands poses challenges with regard to their recolonisation by vegetation. The most significant problems are unstable water levels, destroyed propagule bank, and temperature fluctuations on bare peat surfaces. Rewetting is considered necessary for the re-establishment of peat-forming vegetation. Revegetation was investigated in a long-term field study at two rewetted extracted peatland sites in south-central Sweden, namely Västkärr (originally a lagg fen and Porla (originally a bog. Both sites were expanses of bare peat before rewetting. Rewetting procedures were applied in 1999 and strongly promoted plant colonisation. At Västkärr, colonisation started in the first year after rewetting, mostly by species that were not found during repeat vegetation surveys 15 years later. By 2014, Västkärr was a shallow lake surrounded by mesotrophic and eutrophic vegetation with species such as Carex rostrata, Lemna minor, Typha latifolia, Phalaris arundinacea and Phragmites australis. Revegetation of the Porla site was slower and started with Eriophorum vaginatum and Polytrichum spp. Sphagnum mosses appeared after six years and had established quite well after 13 years. A residual Sphagnum peat layer, inflowing surface water and groundwater provided spatially variable nutrient conditions. Sphagnum species and E. vaginatum established in nutrient-poor areas, while C. rostrata, P. australis and Eriophorum angustifolium colonised more nutrient-rich locations.

Effects of Spartina alterniflora invasion on soil respiration in the Yangtze River estuary, China.

Directory of Open Access Journals (Sweden)

Naishun Bu

Full Text Available Many studies have found that plant invasion can enhance soil organic carbon (SOC pools, by increasing net primary production (NPP and/or decreased soil respiration. While most studies have focused on C input, little attention has been paid to plant invasion effects on soil respiration, especially in wetland ecosystems. Our study examined the effects of Spartina alterniflora invasion on soil respiration and C dynamics in the Yangtze River estuary. The estuary was originally occupied by two native plant species: Phragmites australis in the high tide zone and Scirpus mariqueter in the low tide zone. Mean soil respiration rates were 185.8 and 142.3 mg CO2 m(-2 h(-1 in S. alterniflora and P. australis stands in the high tide zone, and 159.7 and 112.0 mg CO2 m(-2 h(-1 in S. alterniflora and S. mariqueter stands in the low tide zone, respectively. Aboveground NPP (ANPP, SOC, and microbial biomass were also significantly higher in the S. alterniflora stands than in the two native plant stands. S. alterniflora invasion did not significantly change soil inorganic carbon or pH. Our results indicated that enhanced ANPP by S. alterniflora exceeded invasion-induced C loss through soil respiration. This suggests that S. alterniflora invasion into the Yangtze River estuary could strengthen the net C sink of wetlands in the context of global climate change.

[Soil respiration dynamics and its controlling factors of typical vegetation communities on meadow steppes in the western Songnen Plain].

Science.gov (United States)

Wang, Ming; Liu, Xing-Tu; Li, Xiu-Jun; Zhang, Ji-Tao; Wang, Guo-Dong; Lu, Xin-Rui; Li, Xiao-Yu

2014-01-01

In order to accurately explore the soil respiration dynamics and its controlling factors of typical vegetation types in the western Songnen Plain, soil respiration rates of Chloris virgata, Puccinellia distans, Phragmites australis and Leymus chinensis communities were measured. The results showed that the diurnal curves of soil respiration rates of the four vegetation communities had simple peak values, which appeared at 11:00-15:00, and the valley values occurred at 21:00-1:00 or 3:00-5:00. The seasonal dynamic patterns of their soil respiration rates were similar, with the maximum (3.21-4.84 micromol CO2 x m(-2) x s(-1)) occurring in July and August and the minimum (0.46-1.51 micromol CO2 x m(-2) x s(-1)) in October. The soil respiration rates of the four vegetation communities had significant exponential correlations with ambient air temperature and soil temperature. Soil moisture, however, only played an important role in affecting the soil respiration rate of C. virgata community while air humidity near the soil surface was significantly correlated with the soil respiration rates of P. australis and L. chinensis communities. The soil salt contents seriously constrained the CO2 dioxide emission, and the soil pH, electrical conductivity (EC), exchangeable sodium percentage (ESP) could explain 87%-91% spatial variations of the soil respiration rate.

Isolation of fucoxanthin and fatty acids analysis of Padina australis ...

African Journals Online (AJOL)

GREGORY

2011-12-16

Dec 16, 2011 ... flame-ionization detector (FID) and a capillary column (Omegawax-. 320; 30 m x 0.32 mm i.d.; Supelco, Bellefonte, PA). The carrier gas was helium at a flow ..... resulted in formation of nuclear condensation, which was clearly evident in inverted microscope. The effect of fucoxanthin disappeared on H1299 ...

Phragmites australis as a model organism for studying plant invasions

Czech Academy of Sciences Publication Activity Database

Meyerson, L. A.; Cronin, J. T.; Pyšek, Petr

2016-01-01

Roč. 18, č. 9 (2016), s. 2421-2431 ISSN 1387-3547 R&D Projects: GA ČR(CZ) GA14-15414S Grant - others:AV ČR(CZ) AP1002 Program:Akademická prémie - Praemium Academiae Institutional support: RVO:67985939 Keywords : common reed * model species * global climate change Subject RIV: EH - Ecology, Behaviour Impact factor: 2.473, year: 2016

A voyage to Terra Australis: human-mediated dispersal of cats.

Science.gov (United States)

Koch, K; Algar, D; Searle, J B; Pfenninger, M; Schwenk, K

2015-12-04

Cats have been transported as human commensals worldwide giving rise to many feral populations. In Australia, feral cats have caused decline and extinction of native mammals, but their time of introduction and origin is unclear. Here, we investigate hypotheses of cat arrival pre- or post-European settlement, and the potential for admixture between cats of different invasion events. We analyse the genetic structure and diversity of feral cats from six locations on mainland Australia, seven Australian islands and samples from Southeast Asia and Europe using microsatellite and mitochondrial DNA data. Our results based on phylogeographic model selection are consistent with a European origin of cats in Australia. We find genetic distinctiveness of Australian mainland samples compared with Dirk Hartog Island, Flinders Island, Tasman Island and Cocos (Keeling) Island samples, and genetic similarities between some of the island populations. Historical records suggest that introduction of cats to these islands occurred at the time of European exploration and/or in connection with the pearling, whaling and sealing trades early in the 19th century. On-going influx of domestic cats into the feral cat population is apparently causing the Australian mainland populations to be genetically differentiated from those island populations, which likely are remnants of the historically introduced cat genotypes. A mainly European origin of feral cats in Australia, with possible secondary introductions from Asia following the initial establishment of cats in Australia is reasonable. The islands surrounding Australia may represent founding populations and are of particular interest. The results of the study provide an important timeframe for the impact of feral cats on native species in Australia.

Novel Conopeptides of Largely Unexplored Indo Pacific Conus sp.

OpenAIRE

Lebbe, Eline K. M.; Ghequire, Maarten G. K.; Peigneur, Steve; Mille, Bea G.; Devi, Prabha; Ravichandran, Samuthirapandian; Waelkens, Etienne; D?Souza, Lisette; De Mot, Ren?; Tytgat, Jan

2016-01-01

Cone snails are predatory creatures using venom as a weapon for prey capture and defense. Since this venom is neurotoxic, the venom gland is considered as an enormous collection of pharmacologically interesting compounds having a broad spectrum of targets. As such, cone snail peptides represent an interesting treasure for drug development. Here, we report five novel peptides isolated from the venom of Conus longurionis, Conus asiaticus and Conus australis. Lo6/7a and Lo6/7b were retrieved fro...

Understanding the Use-wears on Non-retouched Shells Mytilus galloprovincialis. and Ruditapes decussatus by Performing Wood Working Experiment: An Experimental Approach

International Nuclear Information System (INIS)

Tumung, Laxmi; Bazgir, Behrouz; Ahmadi, Kamran; Shadmehr, Abdolkarim

2012-01-01

This paper is an experimental attempt to understand the use-wear comes on non-retouched shells Ruditapes decussatus and Mytilus galloprovincialis. These species have been selected due to their variation in shape, size and edge type. In wood working experiment Celtus australis wood is used to perform the activities like scrapping and cutting wood. The ESEM results show the usewears in the form of linear marks, edge rounding, edge facture, polish and micro-pitting. Experiments also showed some macro-fractures.

Vertical flow soil filter for the elimination of micro pollutants from storm and waste water

DEFF Research Database (Denmark)

Janzen, Niklas; Banzhaf, Stefan; Scheytt, Traugott

2009-01-01

A technical scale activated soil filter has been used to study the elimination rates of diverse environmentally relevant micro pollutants from storm and waste water. The filter was made of layers of peat, sand and gravel. The upper (organic) layer was planted with reed (phragmites australis......) to prevent clogging and was spiked with activated sludge to enhance microbial biomass and biodegradation potential. Compounds used as UV filters, antioxidants or plasticizers, namely 4-methylbenzylidene camphor (4-MBC), benzophenone-3 (BP-3), butylated hydroxytoluene (BHT), N-butylbenzenesulfonamide (NBBS...

Management of Protected Areas and Its Effect on an Ecosystem Function: Removal of Prosopis flexuosa Seeds by Mammals in Argentinian Drylands

Science.gov (United States)

Campos, Valeria E.; Miguel, Florencia; Cona, Mónica I.

2016-01-01

The ecological function of animal seed dispersal depends on species interactions and can be affected by drivers such as the management interventions applied to protected areas. This study was conducted in two protected areas in the Monte Desert: a fenced reserve with grazing exclusion and absence of large native mammals (the Man and Biosphere Ñacuñán Reserve; FR) and an unfenced reserve with low densities of large native and domestic animals (Ischigualasto Park; UFR). The study focuses on Prosopis flexuosa seed removal by different functional mammal groups: “seed predators”, “scatter-hoarders”, and “opportunistic frugivores”. Under both interventions, the relative contribution to seed removal by different functional mammal groups was assessed, as well as how these groups respond to habitat heterogeneity (i.e. vegetation structure) at different spatial scales. Camera traps were used to identify mammal species removing P. flexuosa seeds and to quantify seed removal; remote sensing data helped analyze habitat heterogeneity. In the FR, the major fruit removers were a seed predator (Graomys griseoflavus) and a scatter-hoarder (Microcavia asutralis). In the UFR, the main seed removers were the opportunistic frugivores (Lycalopex griseus and Dolichotis patagonum), who removed more seeds than the seed predator in the FR. The FR shows higher habitat homogeneity than the UFR, and functional groups respond differently to habitat heterogeneity at different spatial scales. In the FR, because large herbivores are locally extinct (e.g. Lama guanicoe) and domestic herbivores are excluded, important functions of large herbivores are missing, such as the maintenance of habitat heterogeneity, which provides habitats for medium-sized opportunistic frugivores with consequent improvement of quality and quantity of seed dispersal services. In the UFR, with low densities of large herbivores, probably one important ecosystem function this group performs is to increase

Management of Protected Areas and Its Effect on an Ecosystem Function: Removal of Prosopis flexuosa Seeds by Mammals in Argentinian Drylands.

Directory of Open Access Journals (Sweden)

Claudia M Campos

Full Text Available The ecological function of animal seed dispersal depends on species interactions and can be affected by drivers such as the management interventions applied to protected areas. This study was conducted in two protected areas in the Monte Desert: a fenced reserve with grazing exclusion and absence of large native mammals (the Man and Biosphere Ñacuñán Reserve; FR and an unfenced reserve with low densities of large native and domestic animals (Ischigualasto Park; UFR. The study focuses on Prosopis flexuosa seed removal by different functional mammal groups: "seed predators", "scatter-hoarders", and "opportunistic frugivores". Under both interventions, the relative contribution to seed removal by different functional mammal groups was assessed, as well as how these groups respond to habitat heterogeneity (i.e. vegetation structure at different spatial scales. Camera traps were used to identify mammal species removing P. flexuosa seeds and to quantify seed removal; remote sensing data helped analyze habitat heterogeneity. In the FR, the major fruit removers were a seed predator (Graomys griseoflavus and a scatter-hoarder (Microcavia asutralis. In the UFR, the main seed removers were the opportunistic frugivores (Lycalopex griseus and Dolichotis patagonum, who removed more seeds than the seed predator in the FR. The FR shows higher habitat homogeneity than the UFR, and functional groups respond differently to habitat heterogeneity at different spatial scales. In the FR, because large herbivores are locally extinct (e.g. Lama guanicoe and domestic herbivores are excluded, important functions of large herbivores are missing, such as the maintenance of habitat heterogeneity, which provides habitats for medium-sized opportunistic frugivores with consequent improvement of quality and quantity of seed dispersal services. In the UFR, with low densities of large herbivores, probably one important ecosystem function this group performs is to increase

Susceptibility of riparian wetland plants to perfluorooctanoic acid (PFOA) accumulation.

Science.gov (United States)

Mudumbi, J B N; Ntwampe, S K O; Muganza, M; Okonkwo, J O

2014-01-01

As plants have been shown to accumulate organic compounds from contaminated sediments, there is a potential for long-lasting ecological impact as a result of contaminant accumulation in riparian areas of wetlands, particularly the accumulation of non-biodegradable contaminants such as perfluorooctanoic acid (PFOA). In this study, commonly found riparian wetland plants including reeds, i.e., Xanthium strumarium, Phragmites australis, Schoenoplectus corymbosus, Ruppia maritime; Populus canescens, Polygonum salicifolium, Cyperus congestus; Persicaria amphibian, Ficus carica, Artemisia schmidtiana, Eichhornia crassipes, were studied to determine their susceptibility to PFOA accumulation from PFOA contaminated riparian sediment with a known PFOA concentration, using liquid chromatography/tandem mass spectrometry (LC/MS/MS). The bioconcentration factor (BCF) indicated that the plants affinity to PFOA accumulation was; E. crassipes, > P. sali-cifolium, > C. congestus, > P. x canescens, > P. amphibian, > F. carica, > A. schmidtiana, > X. strumarium,> P. australis, > R. maritime, > S. corymbosus. The concentration of PFOA in the plants and/or reeds was in the range 11.7 to 38 ng/g, with a BCF range of 0.05 to 0.37. The highest BCF was observed in sediment for which its core water had a high salinity, total organic carbon and a pH which was near neutral. As the studied plants had a higher affinity for PFOA, the resultant effect is that riparian plants such as E. crassipes, X. strumarium, and P. salicifolium, typified by a fibrous rooting system, which grow closer to the water edge, exacerbate the accumulation of PFOA in riparian wetlands.

Feeding ecology of Rhabdosargus holubi (family Sparidae) in multiple vegetated refugia of selected warm temperate estuaries in South Africa

Science.gov (United States)

Nel, L.; Strydom, N. A.; Perissinotto, R.; Adams, J. B.; Lemley, D. A.

2017-10-01

Estuarine marine-dependent species, such as Rhabdosargus holubi, depend greatly on structured sheltered environments and important feeding areas provided by estuaries. In this study, we investigate the ecological feeding niches of the estuarine marine-dependent sparid, R. holubi, by using conventional stomach contents and stable isotope methods (δ13C and δ15N signatures). The study has been carried out in five temperate estuaries in order to understand how fish feed in multiple intertidal vegetated habitats. These habitats included the submerged seagrass, Zostera capensis, and both previously unexplored small intertidal cord grass, Spartina maritima, and the common reed, Phragmites australis. The diet varied amongst habitats, estuaries and fish sizes and data consistently confirmed their omnivorous diet relating to ontogenetic niche shifts. Stomach contents revealed the importance of benthic prey within both the S. maritima and P. australis habitats in the absence of large intertidal vegetation, available during low tides. Similarly, isotopic mixing models showed that R. holubi from these habitats have a greater isotopic niche compared to the Z. capensis habitat, due to their limited availability during the falling tide, suggesting migration between available habitats. Stable isotopes confirmed that R. holubi actively feeds on the epiphytic algae (especially diatoms) covering the leaves and stalks of plant matter, as supported by Bayesian mixing models. These findings add to the current knowledge regarding habitat partitioning in multiple aquatic vegetation types critical to fish ecology and the effective management and conservation of estuaries.

Serological survey on Leptospira infection in slaughtered swine in North-Central Italy.

Science.gov (United States)

Bertelloni, F; Turchi, B; Vattiata, E; Viola, P; Pardini, S; Cerri, D; Fratini, F

2018-05-30

Swine can act as asymptomatic carriers of some Leptospira serovars. In this study, 1194 sera from 61 farms located in five different Regions of North-West Italy were collected from slaughtered healthy pigs. Presence of antibody against four Leptospira serovars was evaluated. Overall, 52.5% of analysed farms presented at least one positive animal and 34.4% presented at least one positive swine with titre ⩾1:400. A percentage of 16.6% sera was positive and 5.9% samples presented a positive titre ⩾1:400. Tuscany and Lombardy showed the highest percentage of positive farms (64.3% and 54.6%, respectively) and sera (28.5% and 13.3%, respectively), probably due to environmental conditions and potential risk factors, which promote maintenance and spreading of Leptospira in these areas. The main represented serogroups were Australis (21.3% positive farms, 8.2% positive sera) and Pomona (18.0% positive farms, 8.1% positive sera). In swine, these serogroups are the most detected worldwide; however, our results seem to highlight a reemerging of serogroup Pomona in pigs in investigated areas. A low percentage of sera (0.6%) scored positive to Canicola, leaving an open question on the role of pigs in the epidemiology of this serovar. Higher antibody titres were detected for serogroups Australis and Pomona. Swine leptospirosis is probably underestimated in Italy and could represent a potential risk for animal and human health.

Genotypic Diversity and Short-term Response to Shading Stress in a Threatened Seagrass: Does Low Diversity Mean Low Resilience?

Directory of Open Access Journals (Sweden)

Suzanna M. Evans

2017-08-01

Full Text Available Seagrasses that are predominantly clonal often have low levels of genetic variation within populations and predicting their response to changing conditions requires an understanding of whether genetic variation confers increased resistance to environmental stressors. A higher level of genetic diversity is assumed to benefit threatened species due to the increased likelihood of those populations having genotypes that can persist under environmental change. To test this idea, we conducted an in situ shading experiment with six geographically distinct meadows of the threatened seagrass Posidonia australis that vary in genetic diversity. Different genotypes within meadows varied widely in their physiological and growth responses to reduced light during a simulated short-term turbidity event. The majority of meadows were resistant to the sudden reduction in light availability, but a small subset of meadows with low genotypic diversity were particularly vulnerable to the early effects of shading, showing substantially reduced growth rates after only 3 weeks. Using the photosynthetic performance (maximum quantum yield of known genotypes, we simulated meadows of varying genetic diversity to show that higher diversity can increase meadow resilience to stress by ensuring a high probability of including a high-performing genotype. These results support the hypothesis that complementarity among genotypes enhances the adaptive capacity of a population, and have significant implications for the conservation of declining P. australis meadows close to the species range edge on the east coast of Australia, where the genotypic diversity is low.

Genotypic Diversity and Short-term Response to Shading Stress in a Threatened Seagrass: Does Low Diversity Mean Low Resilience?

Science.gov (United States)

Evans, Suzanna M; Vergés, Adriana; Poore, Alistair G B

2017-01-01

Seagrasses that are predominantly clonal often have low levels of genetic variation within populations and predicting their response to changing conditions requires an understanding of whether genetic variation confers increased resistance to environmental stressors. A higher level of genetic diversity is assumed to benefit threatened species due to the increased likelihood of those populations having genotypes that can persist under environmental change. To test this idea, we conducted an in situ shading experiment with six geographically distinct meadows of the threatened seagrass Posidonia australis that vary in genetic diversity. Different genotypes within meadows varied widely in their physiological and growth responses to reduced light during a simulated short-term turbidity event. The majority of meadows were resistant to the sudden reduction in light availability, but a small subset of meadows with low genotypic diversity were particularly vulnerable to the early effects of shading, showing substantially reduced growth rates after only 3 weeks. Using the photosynthetic performance (maximum quantum yield) of known genotypes, we simulated meadows of varying genetic diversity to show that higher diversity can increase meadow resilience to stress by ensuring a high probability of including a high-performing genotype. These results support the hypothesis that complementarity among genotypes enhances the adaptive capacity of a population, and have significant implications for the conservation of declining P. australis meadows close to the species range edge on the east coast of Australia, where the genotypic diversity is low.

Karyology of eight species of bats (Mammalia: Chiroptera) from Hainan Island, China.

Science.gov (United States)

Wu, Yi; Motokawa, Masaharu; Li, Yu-Chun; Harada, Masashi; Chen, Zhong; Lin, Liang-Kong

2009-10-20

Karyotypes and chromosomal data are presented for eight bat species representing two families (Rhinolophidae and Vespertilionidae) from Hainan Island, China. The species investigated were Rhinolophus lepidus (2n = 62, FN = 60), R. pusillus (2n = 62, FN = 60), R. affinis (2n = 62, FN = 60), R. sinicus (2n = 36, FN = 60), Myotis horsfieldi (2n = 44, FN = 52), Pipistrellus abramus (2n = 26, FN = 44), Miniopterus australis (2n = 46, FN = 50) and M. schreibersii (2n = 46, FN = 50). The karyotype of Rhinolophus lepidus is reported for the first time.

Abréviations

OpenAIRE

2013-01-01

A AELE – Association européenne de libre échangeAIE – Agence internationale de l’énergieAIEA – Agence internationale de l’énergie atomiqueAMF – Arrangement concernant le commerce international des textiles, dit Arrangement multifibresAPD – Aide publique au développement B BAD – Banque africaine de développementBNS – Banque nationale suisse C CAD – Comité d’aide au développement de l’OCDE ; regroupe les pays suivants Australie, Autriche, Belgique, Canada, Danemark, Finlande, France, Allemagne,...

Christopher E. Forth et Bertrand Taithe (dir, French Masculinities: History, Culture and Politics

Directory of Open Access Journals (Sweden)

Régis Revenin

2007-11-01

Full Text Available Cet ouvrage collectif, dirigé par Christopher E. Forth, historien à l’Australian National University à Canberra [Australie], et par Bertrand Taithe, professeur d’histoire culturelle à l’Université de Manchester [Royaume-Uni], offre une très intéressante contribution, en langue anglaise, à l’histoire du genre en France, particulièrement à l’histoire des hommes et des masculinités à l’époque contemporaine.L’ouvrage propose une très riche introduction sous la plume des deux directeurs d’ouvrage,...

Minimizing the impacts of livestock. Treatment of slurry and water reuse on farms; Minimizacion de los impactos de la ganaderia. Tratamientos del purin y reutilizacion

Energy Technology Data Exchange (ETDEWEB)

Caballero, A.; Faz, A.; Bautista Lobera, J.; Palop, A

2009-07-01

In this study, wastewater from farms was treated using constructed wetlands, in a experimental farm, CIFEA, located in Lorca (Murcia), which is an important pig production area (southeast Spain). We have used horizontal sub-surface flow constructed wetlands with Phragmites australis, adapted to the semiarid climate of the area. We have obtained important removals of electrical conductivity by 28 %, total suspended solids by 93%, sedimentable solids by 100%, chemical oxygen demand by 87%, total phosphorus by 85%, copper by 92% and total nitrogen by 81%. (Author) 5 refs.

Croissance et production de matières de Typha australis (SCHUM ...

African Journals Online (AJOL)

SARAH

28 févr. 2015 ... RESUME. Objectifs : Les plantes invasives entraînent un dysfonctionnement des écosystèmes particulièrement dans les zones humides à vocation agricole comme celle des « Niayes » où le niveau de l'eau fluctue au cours de l'année. La présente étude a pour but d'apprécier la croissance et la production ...

A microestrutura e o desenvolvimento dos órgãos genitais masculinos de preás (Galea spixii criados em cativeiro The microstructure and development of male genital organs of Spix's yellow-toothed cavy (Galea spixii bred in captivity

Directory of Open Access Journals (Sweden)

Paulo R.S. Santos

2012-12-01

Full Text Available O preá do semiárido nordestino (Galea spixii é um roedor pertencente à família Caviidae. São encontrados nas regiões da Caatinga e do Cerrado Brasileiro e se reproduz ao longo do ano, apresentando um período de gestação de 48 dias e uma ninhada de 2 a 4 crias. O objetivo deste estudo foi caracterizar histologicamente os componentes estruturais dos órgãos genitais de preás machos relacionando com a evolução cronológica destes órgãos na espécie. Foram utilizados para análise animais ao nascimento e aos 15, 30, 45, 60, 75, 90, 105, 120 e aos 150 dias de idade. Fragmentos do epidídimo, ducto deferente, pênis e glândulas sexuais acessórias foram coletados, fixados e processados para descrição em microscopia de luz. O epidídimo apresentou epitélio colunar simples e em cada fase sexual notou-se diferença quanto ao tamanho do lúmen tubular e à presença de espermatozóides no lúmen aos 45 dias de idade. O epitélio do ducto deferente no preá mostrou-se pseudo-estratificado colunar com crescente presença de estereocilios com o avanço da idade. A glândula vesicular no preá apresentou uma mucosa com pregueamento variado, de acordo com a fase do desenvolvimento sexual. A próstata mostrou-se pouco desenvolvida, com lúmen pequeno nos preás ao nascimento e aos 15 dias de idade; aos 45 dias mostrou-se com um pregueamento do epitélio variável. Os órgãos genitais masculinos do preá passaram por transformações morfológicas no decorrer da idade e com o desenvolvimento sexual, isso colaborou para a determinação do início da fase da puberdade, que na espécie em estudo foi aos 45 dias de idade.The Spix's yellow-toothed cavy (Galea spixii from the Brazilian northeastern semi-arid is a rodent that does belong to the family Caviidae. They are found in regions of the Caatinga and Cerrado, and reproduces throughout the year, with a gestation period of 48 days and a litter of 2 to 4 pups. The aim of this study was to

Instability in newly-established wetlands? Trajectories of floristic change in the re-flooded Hula peatland, northern Israel

Directory of Open Access Journals (Sweden)

D. Kaplan

2012-01-01

Full Text Available Drainage of the 6,000 ha Hula Lake and peatland in northern Israel in the late 1950s caused the loss of a very diverse and rare ecosystem and an important phytogeographic meeting zone for Holarctic and Palaeotropical species. Draining the Hula peatland was only partially successful in creating a large fertile area for cultivation, and in 1994 this led the authorities to re-flood 100 ha of the valley—the Agamon (Agmon—with the aim of rehabilitating the diverse wetland landscape, promoting ecotourism and creating a clear-water body that would contribute to the purification of Lake Kinneret. The vegetation of the restored wetland was monitored for ten years (1997–2006, recording the establishment and abundance of vascular plant species. More than 20 emergent, submerged and riparian species became established. Like a number of other shallow-water wetlands, the Agmon is characterised by considerable ecological fluctuations. This has been expressed in prominent floristic changes in the Agamon since it was created. An increased abundance of Ceratophyllum demersum and Najas minor and a decline in Potamogeton spp., Najas delilei and filamentous algae have been observed. A long-term decline in water level and sediment accumulation has brought about a significant rise in the incidence of Phragmites australis, Typha domingensis and Ludwigia stolonifera in the south-eastern area. A GIS analysis of changes in species dominance shows fluctuations over the years, with only a partial trend of succession towards a P. australis, T. domingensis and L. stolonifera community.

Skull ontogeny and modularity in two species of Lagenorhynchus: Morphological and ecological implications.

Science.gov (United States)

Del Castillo, Daniela L; Viglino, Mariana; Flores, David A; Cappozzo, Humberto L

2017-02-01

Comparisons of skull shape between closely related species can provide information on the role that phylogeny and function play in cranial evolution. We used 3D-anatomical landmarks in order to study the skull ontogeny of two closely related species, Lagenorhynchus obscurus and Lagenorhynchus australis, with a total sample of 52 skulls. We found shared trends between species, such as the relative compression of the neurocranium and the enlargement of the rostrum during ontogeny. However, these are common mammalian features, associated with prenatal brain development and sensory capsules. Moreover, we found a posterior displacement of the external nares and infraorbital foramina, and a strong development of the rostrum in an anteroposterior direction. Such trends are associated with the process of telescoping and have been observed in postnatal ontogeny of other odontocetes, suggesting a constraint in the pattern. Interspecific differences related to the deepness of facial region, robustness of the feeding apparatus and rostrum orientation may be related with the specific lifestyles of L. obscurus and L. australis. We also tested the presence of three different modules in the skull (basicranium, neurocranium, rostrum), all of which presented strong integration. Only the rostrum showed a different ontogenetic trajectory between species. Even though we detected directional asymmetry, changes in this feature along ontogeny were not detectable. Because asymmetry may be related to echolocation, our results suggest a functional importance of directional asymmetry from the beginning of postnatal life. J. Morphol. 278:203-214, 2017. © 2016 Wiley Periodicals,Inc. © 2016 Wiley Periodicals, Inc.

The phytoremediation ability of a polyculture constructed wetland to treat boron from mine effluent

International Nuclear Information System (INIS)

Türker, Onur Can; Böcük, Harun; Yakar, Anıl

2013-01-01

Highlights: ► We assessed the phytoremediation ability of a polyculture constructed wetland (PCW) to treat boron (B) from mine effluent. ► B in mine effluent decreased from 187 mg l −1 to 123 mg l −1 (32% removal rate) through the PCW. ► Estimated methane production, energy yields and electrical energy yields of the PCW increased with biomass production. ► Cattails accumulated more than 250 mg kg −1 B and common reed accumulated 38 mg kg −1 B at the end of the experiment. -- Abstract: This study focuses on describing the ability of a small-scale, subsurface-flow-polyculture-constructed wetland (PCW) to treat boron (B) mine effluent from the world's largest borax mine (Kırka, Turkey) under field conditions. This application is among the first effluent treatment methods of this type in both Turkey and the world. This study represents an important resource on how subsurface-flow-constructed wetlands could be used to treat B mine effluents in the field conditions. To this end, an experimental wetland was vegetated with common reed (Phragmites australis) and cattails (Typha latifolia), and mine effluent was moved through the wetland. The results of the present study show that B concentrations of the mine effluent decreased from 187 to 123 mg l −1 (32% removal rate) on average. The T. latifolia individuals absorbed a total of 250 mg kg −1 whereas P. australis in the PCW absorbed a total of 38 mg kg −1 B during the research period

Novel Conopeptides of Largely Unexplored Indo Pacific Conus sp.

Directory of Open Access Journals (Sweden)

Eline K. M. Lebbe

2016-10-01

Full Text Available Cone snails are predatory creatures using venom as a weapon for prey capture and defense. Since this venom is neurotoxic, the venom gland is considered as an enormous collection of pharmacologically interesting compounds having a broad spectrum of targets. As such, cone snail peptides represent an interesting treasure for drug development. Here, we report five novel peptides isolated from the venom of Conus longurionis, Conus asiaticus and Conus australis. Lo6/7a and Lo6/7b were retrieved from C. longurionis and have a cysteine framework VI/VII. Lo6/7b has an exceptional amino acid sequence because no similar conopeptide has been described to date (similarity percentage <50%. A third peptide, Asi3a from C. asiaticus, has a typical framework III Cys arrangement, classifying the peptide in the M-superfamily. Asi14a, another peptide of C. asiaticus, belongs to framework XIV peptides and has a unique amino acid sequence. Finally, AusB is a novel conopeptide from C. australis. The peptide has only one disulfide bond, but is structurally very different as compared to other disulfide-poor peptides. The peptides were screened on nAChRs, NaV and KV channels depending on their cysteine framework and proposed classification. No targets could be attributed to the peptides, pointing to novel functionalities. Moreover, in the quest of identifying novel pharmacological targets, the peptides were tested for antagonistic activity against a broad panel of Gram-negative and Gram-positive bacteria, as well as two yeast strains.

Novel Conopeptides of Largely Unexplored Indo Pacific Conus sp.

Science.gov (United States)

Lebbe, Eline K M; Ghequire, Maarten G K; Peigneur, Steve; Mille, Bea G; Devi, Prabha; Ravichandran, Samuthirapandian; Waelkens, Etienne; D'Souza, Lisette; De Mot, René; Tytgat, Jan

2016-10-27

Cone snails are predatory creatures using venom as a weapon for prey capture and defense. Since this venom is neurotoxic, the venom gland is considered as an enormous collection of pharmacologically interesting compounds having a broad spectrum of targets. As such, cone snail peptides represent an interesting treasure for drug development. Here, we report five novel peptides isolated from the venom of Conus longurionis , Conus asiaticus and Conus australis . Lo6/7a and Lo6/7b were retrieved from C. longurionis and have a cysteine framework VI/VII. Lo6/7b has an exceptional amino acid sequence because no similar conopeptide has been described to date (similarity percentage <50%). A third peptide, Asi3a from C. asiaticus , has a typical framework III Cys arrangement, classifying the peptide in the M-superfamily. Asi14a, another peptide of C. asiaticus , belongs to framework XIV peptides and has a unique amino acid sequence. Finally, AusB is a novel conopeptide from C. australis . The peptide has only one disulfide bond, but is structurally very different as compared to other disulfide-poor peptides. The peptides were screened on nAChRs, Na V and K V channels depending on their cysteine framework and proposed classification. No targets could be attributed to the peptides, pointing to novel functionalities. Moreover, in the quest of identifying novel pharmacological targets, the peptides were tested for antagonistic activity against a broad panel of Gram-negative and Gram-positive bacteria, as well as two yeast strains.

Influences of micro-geomorphology on the stoichiometry of C, N and P in Chenier Island soils and plants in the Yellow River Delta, China.

Science.gov (United States)

Qu, Fanzhu; Meng, Ling; Yu, Junbao; Liu, Jingtao; Sun, Jingkuan; Yang, Hongjun; Dong, Linshui

2017-01-01

Studies have indicated that consistent or well-constrained (relatively low variability) carbon:nitrogen:phosphorus (C:N:P) ratios exist in large-scale ecosystems, including both marine and terrestrial ecosystems. Little is known about the C, N and P stoichiometric ratios that exist in the soils and plants of Chenier Island in the Yellow River Delta (YRD). We examined the distribution patterns and relationships of C, N and P stoichiometry in the soils and plants of Chenier Island, as well as the potential influences of the island's micro-geomorphology. Based on a study of four soil profile categories and Phragmites australis and Suaeda heteroptera plant tissues, our results showed that micro-geomorphology could leave a distinct imprint on the soil and plant elemental stoichiometry of Chenier Island; significant variation in the atomic C:N:P ratios (RCNP) existed in soils and plants, indicating that the RCNP values in both the soil and plants are not well constrained at the Chenier Island scale. RCN and RCP in Chenier Island soils were high, whereas the RNP values were comparatively low, indicating that the ecosystems of Chenier Island are nutrient-limited by N and P. However, the RNP values in P. australis and S. heteroptera plant tissues were high, suggesting that the plants of Chenier Island are nutrient-limited by P. Finally, we suggest that soil and plant N:P ratios may be good indicators of the soil and plant nutrient status during soil development and plant growth, which could be a useful reference for restoring the degraded soils of Chenier Island.

Comparative ecological transcriptomics and the contribution of gene expression to the evolutionary potential of a threatened fish.

Science.gov (United States)

Brauer, Chris J; Unmack, Peter J; Beheregaray, Luciano B

2017-12-01

Understanding whether small populations with low genetic diversity can respond to rapid environmental change via phenotypic plasticity is an outstanding research question in biology. RNA sequencing (RNA-seq) has recently provided the opportunity to examine variation in gene expression, a surrogate for phenotypic variation, in nonmodel species. We used a comparative RNA-seq approach to assess expression variation within and among adaptively divergent populations of a threatened freshwater fish, Nannoperca australis, found across a steep hydroclimatic gradient in the Murray-Darling Basin, Australia. These populations evolved under contrasting selective environments (e.g., dry/hot lowland; wet/cold upland) and represent opposite ends of the species' spectrum of genetic diversity and population size. We tested the hypothesis that environmental variation among isolated populations has driven the evolution of divergent expression at ecologically important genes using differential expression (DE) analysis and an anova-based comparative phylogenetic expression variance and evolution model framework based on 27,425 de novo assembled transcripts. Additionally, we tested whether gene expression variance within populations was correlated with levels of standing genetic diversity. We identified 290 DE candidate transcripts, 33 transcripts with evidence for high expression plasticity, and 50 candidates for divergent selection on gene expression after accounting for phylogenetic structure. Variance in gene expression appeared unrelated to levels of genetic diversity. Functional annotation of the candidate transcripts revealed that variation in water quality is an important factor influencing expression variation for N. australis. Our findings suggest that gene expression variation can contribute to the evolutionary potential of small populations. © 2017 John Wiley & Sons Ltd.

Inter-Annual Variability of Area-Scaled Gaseous Carbon Emissions from Wetland Soils in the Liaohe Delta, China.

Science.gov (United States)

Ye, Siyuan; Krauss, Ken W; Brix, Hans; Wei, Mengjie; Olsson, Linda; Yu, Xueyang; Ma, Xueying; Wang, Jin; Yuan, Hongming; Zhao, Guangming; Ding, Xigui; Moss, Rebecca F

2016-01-01

Global management of wetlands to suppress greenhouse gas (GHG) emissions, facilitate carbon (C) sequestration, and reduce atmospheric CO2 concentrations while simultaneously promoting agricultural gains is paramount. However, studies that relate variability in CO2 and CH4 emissions at large spatial scales are limited. We investigated three-year emissions of soil CO2 and CH4 from the primary wetland types of the Liaohe Delta, China, by focusing on a total wetland area of 3287 km2. One percent is Suaeda salsa, 24% is Phragmites australis, and 75% is rice. While S. salsa wetlands are under somewhat natural tidal influence, P. australis and rice are managed hydrologically for paper and food, respectively. Total C emissions from CO2 and CH4 from these wetland soils were 2.9 Tg C/year, ranging from 2.5 to 3.3 Tg C/year depending on the year assessed. Primary emissions were from CO2 (~98%). Photosynthetic uptake of CO2 would mitigate most of the soil CO2 emissions, but CH4 emissions would persist. Overall, CH4 fluxes were high when soil temperatures were >18°C and pore water salinity emissions from rice habitat alone in the Liaohe Delta represent 0.2% of CH4 carbon emissions globally from rice. With such a large area and interannual sensitivity in soil GHG fluxes, management practices in the Delta and similar wetlands around the world have the potential not only to influence local C budgeting, but also to influence global biogeochemical cycling.

Does fire severity influence shrub resprouting after spring prescribed burning?

Science.gov (United States)

Fernández, Cristina; Vega, José A.; Fonturbel, Teresa

2013-04-01

Prescribed burning is commonly used to reduce the risk of severe wildfire. However, further information about the associated environmental effects is required to help forest managers select the most appropriate treatment. To address this question, we evaluated if fire severity during spring prescribed burning significantly affects the resprouting ability of two common shrub species in shrubland under a Mediterranean climate in NW Spain. Fire behaviour and temperatures were recorded in tagged individuals of Erica australis and Pterospartum tridentatum during prescribed burning. The number and length of resprouted shoots were measured three times (6, 12 and 18 months) after the prescribed burning. The influence of a series of fire severity indicators on some plant resprouting vigour parameters was tested by canonical correlation analysis. Six months and one year after prescribed burning, soil burn severity (measured by the absolute reduction in depth of the organic soil layer, maximum temperatures in the organic soil layer and the mineral soil surface during burning and the post-fire depth of the organic soil layer) reduced the resprouting vigour of E. australis and P. tridentatum. In contrast, direct measurements of fire effects on plants (minimum branch diameter, duration of temperatures above 300 °C in the shrub crown and fireline intensity) did not affect the post-fire plant vigour. Soil burn severity during spring prescribed burning significantly affected the short-term resprouting vigour in a mixed heathland in Galicia. The lack of effects eighteen months after prescribed burning indicates the high resilience of these species and illustrates the need to conciliate fire prevention and conservation goals.

Shrub resprouting response after fuel reduction treatments: comparison of prescribed burning, clearing and mastication.

Science.gov (United States)

Fernández, Cristina; Vega, José A; Fonturbel, Teresa

2013-03-15

Fuel reduction treatments are commonly used to reduce the risk of severe wildfire. However, more information about the effects on plant resprouting is needed to help land managers select the most appropriate treatment. To address this question, we evaluated the resprouting ability of five shrub species after the application of different types of fuel reduction methods (prescribed burning, clearing and mastication) in two contrasting shrubland areas in northern Spain. The shrub species were Erica australis, Pterospartum tridentatum and Halimium lasianthum spp. alyssoides, Ulex gallii and Erica cinerea. For most of the species under study (E. australis, P. tridentatum, H. lasianthum spp. alyssoides and U. gallii), neither plant mortality nor the number nor length of sprouted shoots per plant differed between treatments, although in E. cinerea the number of shoots was more negatively affected by prescribed burning than by clearing or mastication. The pre-treatment plant size did not affect plant mortality or plant resprouting response, suggesting that this parameter alone is not a good indicator of plant resprouting after fuel reduction treatments. Stem minimum diameter after treatments, a proxy of treatment severity, was not related to plant mortality, number or length of resprouted shoots. The duration of temperatures higher than 300 °C during burning in plant crown had a negative effect on the length of resprouted shoots, only in E. cinerea. The results show that fuel reduction treatments did not prevent shrub response in any case. Some reflections on the applicability of treatments are discussed. Copyright © 2013 Elsevier Ltd. All rights reserved.

A multi-adaptive framework for the crop choice in paludicultural cropping systems

Directory of Open Access Journals (Sweden)

Nicola Silvestri

2017-03-01

Full Text Available The conventional cultivation of drained peatland causes peat oxidation, soil subsidence, nutrient loss, increasing greenhouse gas emissions and biodiversity reduction. Paludiculture has been identified as an alternative management strategy consisting in the cultivation of biomass on wet and rewetted peatlands. This strategy can save these habitats and restore the ecosystem services provided by the peatlands both on the local and global scale. This paper illustrates the most important features to optimise the crop choice phase which is the crucial point for the success of paludiculture systems. A multi-adaptive framework was proposed. It was based on four points that should be checked to identify suitable crops for paludicultural cropping system: biological traits, biomass production, attitude to cultivation and biomass quality. The main agronomic implications were explored with the help of some results from a plurennial open-field experimentation carried out in a paludicultural system set up in the Massaciuccoli Lake Basin (Tuscany, Italy and a complete example of the method application was provided. The tested crops were Arundo donax L., Miscanthus×giganteus Greef et Deuter, Phragmites australis L., Populus×canadensis Moench. and Salix alba L. The results showed a different level of suitability ascribable to the different plant species proving that the proposed framework can discriminate the behaviour of tested crops. Phragmites australis L. was the most suitable crop whereas Populus×canadensis Moench and Miscanthus×giganteus Greef et Deuter (in the case of biogas conversion occupied the last positions in the ranking.

Senay Banu, Beyond Turkey’s Borders. Long-Distance Kemalism, State Politics and the Turkish Diaspora, I.B. Tauris, 2013, 288 p.

Directory of Open Access Journals (Sweden)

Aude Signoles

2015-01-01

Full Text Available L’ouvrage de Banu Senay (BS devrait susciter l’attention des lecteurs intéressés à la fois par la fabrique du nationalisme turc et les comportements diasporiques, tant ses apports sur les plans empiriques, méthodologiques et théoriques, sont indéniables. Tiré d’une thèse en anthropologie de l’Université Macquarie (Sidney à partir d’une enquête de terrain réalisée auprès des populations turques résidant en Australie, ce travail de recherche nuance nombre d’analyses qui associent la circulati...

Dicty_cDB: Contig-U15766-1 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available AF250284 ) Amsacta moorei entomopoxvirus, complete genome. 34 2.6 17 ( CW609064 ) OA_ABa0149O20.f OA_ABa Oryza australie...6 8.9 7 ( CT561949 ) A BAC library has been constructed from cultivar ... 30 9.0 4 ( EK214431 ) 1095460111787 Global-Ocean-Sampli...277657 ) CITBI-E1-2518H21.TF CITBI-E1 Homo sapiens genomic... 46 9.2 1 ( EJ243648 ) 1095333029509 Global-Ocean-Sampli...cf*pnhlvqei*ckpfvp*wlrrqklnvpqrklikrpnki ypi*nmpyvnkf*qklkdsltilimfpmplvhpfynskrfhrqfqyfningqvlhhwmlq synn*m... AF538053 ) Monosiga brevicollis mitochondrion, complete genome. 34 0.10 12 ( EJ982583 ) 1093022164217 Global-Ocean-Sampli

Humans, Fish, and Whales: How Right Whales Modify Calling Behavior in Response to Shifting Background Noise Conditions.

Science.gov (United States)

Parks, Susan E; Groch, Karina; Flores, Paulo; Sousa-Lima, Renata; Urazghildiiev, Ildar R

2016-01-01

This study investigates the role of behavioral plasticity in the variation of sound production of southern right whales (Eubalaena australis) in response to changes in the ambient background noise conditions. Data were collected from southern right whales in Brazilian waters in October and November 2011. The goal of this study was to quantify differences in right whale vocalizations recorded in low background noise as a control, fish chorus noise, and vessel noise. Variation in call parameters were detected among the three background noise conditions and have implications for future studies of noise effects on whale sound production.

Factorial's composition of Lake Abha, Southwestern Saudi Arabia

International Nuclear Information System (INIS)

El-Beheiry, M.A.H

2007-01-01

The study analyzes the vegetation along Lake Abha in Southwestern Saudi Arabia. A total of 42 plant species were recorded. The annuals decrease and the biennials and perennials increase along the moisture gradient form the terraces to the free-water zone. Six vegetation clusters were identified. The most important are clusters which were identified by the presence of the following species: Phragmites australis, Juncus punctorius, Typha domingensis, Cyperus rotundus, Datura innoxia, Cynodon dactylon, Cornulaca monacantha and Potamogeton nododsus. Each of these communities has been analyzed by classification and ordination techniques and its habitat described and discussed. (author)

Land degradation and halophytic plant diversity of milleyha wetland ecosystem (samandag-hatay), Turkey

International Nuclear Information System (INIS)

Altay, V.

2012-01-01

Investigations were undertaken during 2010-2011 to study effect of human induced land degradation on structure of some halophytic plant communities. Over all 183 taxa of vascular plant were recorded. Out of these 76 were of typical halophytes. The dominant plant taxa were; Phragmites australis, Halimione portulacoides and Bolboschoenus maritimus. The threatened categories of these taxa were identified from the Red Data Book of Turkey together with their distribution. The impact of degradation on the habitats due to land use for agriculture, organic and inorganic waste disposal and housing for tourisitc purposes were identified and conservation measures were outlined in this study. (author)

Biogeochemical features of aquatic plants in the Selenga River delta

Science.gov (United States)

Shinkareva, Galina; Lychagin, Mikhail

2014-05-01

The Selenga River system provides more than a half of the Lake Baikal total inflow. The river collects a significant amount of pollutants (e.g. heavy metals) from the whole basin. These substances are partially deposited within the Selenga delta, and partially are transported further to the lake. A generous amount of aquatic plants grow in the delta area according to its favorable conditions. This vegetation works as a specific biofilter. It accumulates suspended particles and sorbs some heavy metals from the water. The study aimed to reveal the species of macrophytes which could be mostly important for biomonitoring according to their chemical composition. The field campaign took place in the Selenga River delta in July-August of 2011 (high water period) and in June of 2012 (low water period). 14 species of aquatic plants were collected: water starwort Callitriche hermaphroditica, small yellow pond lily Nuphar pumila, pondweeds Potamogeton crispus, P. pectinatus, P. friesii, broadleaf cattail Typha latifolia, hornwort or coontail Ceratophyllum demersum, arrowhead Sagittaria natans, flowering rush (or grass rush) Butomus umbellatus, reed Phragmites australis, parrot's feather Myriophyllum spicatum, the common mare's tail Hippuris vulgaris, Batrachium trichophyllum, canadian waterweed Elodea canadensis. The samples were dried, grinded up and digested in a mixture of HNO3 and H2O2. The chemical composition of the plant material was defined using ICP-MS and ICP-AES methods. Concentrations of Fe, Mn, Cr, Ni, Cu, B, Zn, V, Co, As, Mo, Pb, and U were considered. The study revealed that Potamogeton pectinatus and Myriophyllum spicatum concentrate elements during both high and low water periods. Conversely the Butomus umbellatus and Phragmites australis contain small amount of heavy metals. The reed as true grasses usually accumulates fewer amounts of elements than other macrophytes. To compare biogeochemical specialization of different species we suggest to use

Water level, vegetation composition, and plant productivity explain greenhouse gas fluxes in temperate cutover fens after inundation

Science.gov (United States)

Minke, Merten; Augustin, Jürgen; Burlo, Andrei; Yarmashuk, Tatsiana; Chuvashova, Hanna; Thiele, Annett; Freibauer, Annette; Tikhonov, Vitalij; Hoffmann, Mathias

2016-07-01

Peat extraction leaves a land surface with a strong relief of deep cutover areas and higher ridges. Rewetting inundates the deep parts, while less deeply extracted zones remain at or above the water level. In temperate fens the flooded areas are colonized by helophytes such as Eriophorum angustifolium, Carex spp., Typha latifolia or Phragmites australis dependent on water depth. Reeds of Typha and Phragmites are reported as large sources of methane, but data on net CO2 uptake are contradictory for Typha and rare for Phragmites. Here, we analyze the effect of vegetation, water level and nutrient conditions on greenhouse gas (GHG) emissions for representative vegetation types along water level gradients at two rewetted cutover fens (mesotrophic and eutrophic) in Belarus. Greenhouse gas emissions were measured campaign-wise with manual chambers every 2 to 4 weeks for 2 years and interpolated by modelling. All sites had negligible nitrous oxide exchange rates. Most sites were carbon sinks and small GHG sources. Methane emissions generally increased with net ecosystem CO2 uptake. Mesotrophic small sedge reeds with water table around the land surface were small GHG sources in the range of 2.3 to 4.2 t CO2 eq. ha-1 yr-1. Eutrophic tall sedge - Typha latifolia reeds on newly formed floating mats were substantial net GHG emitters in the range of 25.1 to 39.1 t CO2 eq. ha-1 yr. They represent transient vegetation stages. Phragmites reeds ranged between -1.7 to 4.2 t CO2 eq. ha-1 yr-1 with an overall mean GHG emission of 1.3 t CO2 eq. ha-1 yr-1. The annual CO2 balance was best explained by vegetation biomass, which includes the role of vegetation composition and species. Methane emissions were obviously driven by biological activity of vegetation and soil organisms. Shallow flooding of cutover temperate fens is a suitable measure to arrive at low GHG emissions. Phragmites australis establishment should be promoted in deeper flooded areas and will lead to moderate, but

Typology and Geographic Geotectonic Distribution of Uranium Deposits Typologie et répartition géographique/géotectonique des gisements d'uranium

Directory of Open Access Journals (Sweden)

Dahlkamp F. J.

2006-11-01

Full Text Available In the last ten years, twenty new uranium deposits have been discovered. They provide nearly 50% of the known and reasonably assured resources. The most important deposits known in the past by size and ore grade were those found in oligomictic quartz pebble conglomerates, sandstones and, to a lesser extent, hydrothermal veins. The types found more recently, which are greater in quantity than the former ones, are of the vein type (Canada, Australia as well as of the intrusive type (Rössing, Namibia and in calcretes (Yeelirrie, Australia and acid volcanic rocks (Mexico. Several classifications have been worked out in the past (E. W. Heinrich, 1958; M. Roubault, 1958; A. Mancher, 1962. More recently new data have enabled these classifications to be extended on a worldwide basis (Ruzicka, 1971; Ziegler, 1974; Dahlkamp, 1974, 1978 or on a regional basis (McMillon for Canada, 1978; Ingram for Australia, 1974. This classification attempt takes all available useful data into consideration to define different types of uranium deposits in as comprehensive and strict a manner as possible. Pendant les dix dernières années 20 nouveaux types de gisements d'uranium ont été découverts. Ils contribuent à assurer près de 50 % des ressources connues raisonnablement assurées. Dans le passé, les gisements les plus importants par la taille et la teneur en minerai étaient ceux des conglomérats à galets de quartz monogéniques, ceux des grès et, dans une plus faible mesure, ceux des filons hydrothermaux. Les nouveaux types connus, qui dépassent les premiers par la quantité, sont classés en gisements filoniens (Canada, Australie aussi bien qu'en intrusifs (Rössing, Namibie, en calcrêtes (Yeelirie, Australie et volcaniques acides (Mexique. Plusieurs classifications furent élaborées dans le passé (E. W. Heinrich, 1958 ; M. Roubault, 1958 ; A. Mancher, 1962. Plus récemment les données recueillies ont permis de les développer sur une base mondiale

Dieta de Leopardus colocolo (Carnivora: Felidae en la Reserva Nacional de Junín, Junín, Perú

Directory of Open Access Journals (Sweden)

Ursula Fajardo

2014-05-01

Full Text Available Este estudio caracteriza la dieta de Leopardus colocolo en los alrededores del lago Junín, en el centro del Perú, a partir de los restos de las presas presentes en 43 heces. El origen de las heces del predador se determinó a partir del ADN mitocondrial de las células epiteliales intestinales adheridas a la superficie de las heces, utilizando como marcador la región de control. Los restos de las presas fueron identificados utilizando literatura especializada y la comparación con especímenes de colección, identificando un total of 14 ítems alimenticios pertenecientes a mamíferos de las familias Cricetidae (6, Chinchillidae (1 y Caviidae (1 y aves de las familias Anatidae (3 y Rallidae (2, y un grupo de aves no identificadas (1. Los roedores fueron el principal componente de la dieta de L. colocolo, en frecuencia y biomasa, seguido por las aves. Entre los ítems alimenticios consumidos, el roedor cricétido pequeño Calomys sp. fue el más frecuente; sin embargo, el mayor aporte de biomasa relativa fue proporcionado por el roedor mediano Cavia tschudii. La amplitud de nicho obtenida fue baja (Bsta= 0.17, indicando una dieta especializada. Nuestros resultados confirman que, como ocurre con la mayoría de felinos pequeños neotropicales, L. colocolo es un predador especializado en la captura de vertebrados, principalmente mamíferos pequeños. No se registró variación estacional en la dieta y el análisis de las clases de edad de los roedores cricétidos mostró que los adultos fueron los más consumidos. Se infiere que L. colocolo tiene un patrón de actividad diurno y nocturno.

Assessing leaf spectral properties of Phragmites australis impacted by acid mine drainage

CSIR Research Space (South Africa)

Van Deventer, Heidi

2014-07-01

Full Text Available decrease in the NIR24, and similarly the radionuclides Cs and Sr at Chernobyl were highly negatively correlated to the REP, green and NIR regions26. An opposite trend was observed in plants exposed to Cd24, Pb27, a combination of heavy metals (As, Cd, Cr.... Davids C, Tyler AN. Detecting contamination-induced tree stress within the Chernobyl exclusion zone. Remote Sens Environ. 2003;85(1):30–38. http:// dx.doi.org/10.1016/S0034-4257(02)00184-0 Research Article Assessing leaf spectral properties of Phragmites...

Stem parasitic plant Cuscuta australis (dodder) transfers herbivory-induced signals among plants.

Science.gov (United States)

Hettenhausen, Christian; Li, Juan; Zhuang, Huifu; Sun, Huanhuan; Xu, Yuxing; Qi, Jinfeng; Zhang, Jingxiong; Lei, Yunting; Qin, Yan; Sun, Guiling; Wang, Lei; Baldwin, Ian T; Wu, Jianqiang

2017-08-08

Cuscuta spp. (i.e., dodders) are stem parasites that naturally graft to their host plants to extract water and nutrients; multiple adjacent hosts are often parasitized by one or more Cuscuta plants simultaneously, forming connected plant clusters. Metabolites, proteins, and mRNAs are known to be transferred from hosts to Cuscuta , and Cuscuta bridges even facilitate host-to-host virus movement. Whether Cuscuta bridges transmit ecologically meaningful signals remains unknown. Here we show that, when host plants are connected by Cuscuta bridges, systemic herbivory signals are transmitted from attacked plants to unattacked plants, as revealed by the large transcriptomic changes in the attacked local leaves, undamaged systemic leaves of the attacked plants, and leaves of unattacked but connected hosts. The interplant signaling is largely dependent on the jasmonic acid pathway of the damaged local plants, and can be found among conspecific or heterospecific hosts of different families. Importantly, herbivore attack of one host plant elevates defensive metabolites in the other systemic Cuscuta bridge-connected hosts, resulting in enhanced resistance against insects even in several consecutively Cuscuta -connected host plants over long distances (> 100 cm). By facilitating plant-to-plant signaling, Cuscuta provides an information-based means of countering the resource-based fitness costs to their hosts.

Genomic Sequence of a Ranavirus Isolated from Short-Finned Eel (Anguilla australis)

DEFF Research Database (Denmark)

Subramaniam, Kuttichantran; Toffan, Anna; Cappellozza, Elisabetta

2016-01-01

The short-finned eel ranavirus (SERV) was isolated from short-finned eel imported to Italy from New Zealand. Phylogenomic analyses revealed that SERV is a unique member of the genus Ranavirus, family Iridoviridae, branching at the base of the tree near other fish ranaviruses....

Genetic diversity and dispersal of Phragmites australis in a small river system

Czech Academy of Sciences Publication Activity Database

Fér, T.; Hroudová, Zdenka

2009-01-01

Roč. 90, č. 2 (2009), s. 165-171 ISSN 0304-3770 R&D Projects: GA AV ČR KJB6111304 Institutional research plan: CEZ:AV0Z60050516 Keywords : genetic variation * long-distance dispersal * spatial autocorrelation Subject RIV: EF - Botanics Impact factor: 1.697, year: 2009

Phytoremediation of explosives for laboratory to real application

Energy Technology Data Exchange (ETDEWEB)

Vanek, T.; Vavrikova, Z.; Podlipna, R. [Inst. of Organic Chemistry and Biochemistry, Academy of Sciences of the Czech Republic, Prague (Czech Republic). Dept. of Plant Tissue Cultures; Gerth, A. [BioPlanta GmbH, Leipzig (Germany)

2006-07-01

This paper discussed the phytoremediation of 2,4,6-trinitrotoluene (TNT) contaminated soil at former ammunition factories in the Czech Republic and Germany. The uptake, degradation, and distribution of the compounds in various plants were evaluated. Characterization and identification of TNT degradation products is difficult due to the insoluble fractions bound in the plant cells. Rheum palmatum culture was supplemented with naphthaleneacetic acid and casein hydrolysate. The plant species Phragmites australis and Typha latifolia were cultivated and supplemented with vitamins. Roots were induced on the hormone-free medium during a 4 to 5 week cultivation period. 2,4,6-trinitrotoluene, glyceroltrinitrate and pentaerytritoltetranitrate were obtained from an ammunition factory. Explosives were added into the cultivation medium at a concentration of 50 mg/l during the first part of the experiment, as well as repeatedly at 10 and 50 mg/l during the second part of the experiment. The uptake of TNT by R. palmatum was determined over 24 hours. The initial concentration of TNT decreased to 50 per cent within half an hour. No TNT could be detected after 6 hours. At least 90 per cent of TNT was taken up by the plant species Phragmites, Typha and Juncus in 10 days. Faster uptake was determined in plants with roots. Phragmites australis was recommended as the best candidate for practical application as it forms a prolific biomass necessary for efficient biodegradation and is able to grow almost everywhere. A pilot-scale installation of constructed wetland containing nitroester explosives showed that the plants were able to clean water containing 270 mg/l of nitroesters and their by-products over a period of 30 days. 38 refs., 8 figs.

Levantamento soroepidemiológico de leptospirose em trabalhadores do serviço de saneamento ambiental em localidade urbana da região sul do Brasil Serological survey of leptospirosis among environmental sanitation workers in an urban locality in southern Brazil

Directory of Open Access Journals (Sweden)

Laerte Pereira de Almeida

1994-02-01

Full Text Available A pesquisa de aglutininas anti-Leptospira, pela técnica de soroaglutinação microscópica, em soros de trabalhadores dos serviços de águas, bueiros e galerias, esgotos, coleta de lixo e limpeza pública, do Município de Pelotas, RS, Brasil, revelou 10,4% de reagentes a um ou mais sorovares; não houve diferenças significantes entre as proporções de reagentes de cada um dos setores de trabalho. Foram identificados 12 sorovares diferentes; castelonis e australis, apesar de mais freqüentes, não apresentaram diferenças estatisticamente significantes com os demais. Constatou-se que 86,9% das amostras apresentavam títulos aglutinantes compreendidos entre 100 e 400; as proporções de soros com títulos iguais a 100 e 400 foram superiores às dos títulos 800, 1.600 e 3.200 (p Sera from 386 environmental sanitation workers, concerned with water supply, drains and drainage galleries, sewers, garbage collection and road sweepers, were examined for leptospiral agglutinins by the microscopic agglutination test. Altogether 40 of the 386 workers (10.4% were positive to one or more serovars; however, the difference in seropositivity between the professional categories was not significant (p > 0.05. Twelve serovars were recorded among the seropositive workers with predominance of L. castelonis and L. australis; but the difference between the serovars was not statistically significant (p > 0.05. Of the seropositive workers, 86.9% had agglutination titres > 100 and < 400; the rates for titres 100 and 400 were higher than 800, 1,600 and 3,200 (p < 0.05.

Three new stingrays (Myliobatiformes: Dasyatidae) from the Indo-West Pacific.

Science.gov (United States)

Last, Peter R; White, William T; Naylor, Gavin

2016-08-05

Three undescribed stingrays were discovered as part of a broader revision of the family Dasyatidae that formed part of the Chondrichthyan Tree of Life project. This research forms part of a sequence of papers on rays aimed at describing unnamed species for inclusion in a multi-authored guide to rays of the world. The first part of this series focused on a redefinition of genera of the family Dasyatidae. The new Indo-West Pacific taxa are represented by separate genera from three dasyatid subfamilies: Himantura australis sp. nov. (northern Australia and Papua New Guinea), Taeniura lessoni sp. nov. (Melanesia) and Telatrygon biasa sp. nov. (Indo-Malay Archipelago). Himantura australis sp. nov., which belongs to a complex of four closely related reticulate whiprays, differs subtly from its congeners in coloration, morphometrics and distribution. Taeniura lessoni sp. nov. is the second species in a genus containing the widely-distributed T. lymma, which is possibly the most abundant stingray in shallow coral-reef habitats of the Indo-Pacific, with the new species apparently restricted to Melanesia. Taeniura lessoni sp. nov. is distinguishable by the absence of a distinctive pair of vivid blue longitudinal stripes on the dorsolateral edges of the tail which is one of the most distinctive features of T. lymma. Telatrygon biasa sp. nov. belongs to a small, recently designated genus of stingrays represented by four species in the tropical Indo-West Pacific. Telatrygon biasa sp. nov. differs from these species in morphometrics. The new species differs markedly from T. zugei in its NADH2 sequence. Telatrygon crozieri is resurrected as a valid northern Indian Ocean representative of the T. zugei complex.

A new species of Nyanzachoerus (Cetartiodactyla: Suidae from the late Miocene Toros-Ménalla, Chad, central Africa.

Directory of Open Access Journals (Sweden)

Jean-Renaud Boisserie

Full Text Available During the latest Miocene and the early Pliocene, tetraconodontine suids were the most predominant large omnivorous mammals in Africa. Yet, new species were often identified on the grounds of limited evidence, a situation impacting their value for biochronological correlations as well as for environmental and biogeographical reconstructions. The description of the most abundant known collection of craniodental remains attributed to the tetraconodontine Nyanzachoerus helps to improve this situation. These specimens were collected in the upper Miocene deposits at Toros-Ménalla, northern Chad, central Africa, by the Mission Paléoanthropologique Franco-Tchadienne. We compared them with Nyanzachoerus from eastern and southern Africa, using extant species as a reference for patterns of morphological variation. Thanks to a large sample of observations, our work focused as much on craniomandibular morphology as on dental morphology and metrics (improved by an index scoring for the complexity of distal third molars and a detailed investigation of premolar-molar ratios. We recognized two taxa at Toros-Ménalla: Nyanzachoerus khinzir nov. sp. and Ny. cf. australis. We also revised the taxonomic status for other species, including: the restriction of Ny. syrticus to its holotype specimen from Sahabi (Libya, the resurrection of the nomen Ny. tulotos, and the synonymy of Ny. kuseralensis with Ny. waylandi. At Toros-Ménalla, Ny. khinzir was the only suid coexisting with the anthracotheriid Libycosaurus and the hominid Sahelanthropus, whereas Ny. cf. australis was associated with a different, probably younger faunal context. Nyanzachoerus. khinzir, which probably had a diversified diet, supports a latest Miocene biogeographical distinction between central Africa and eastern Africa.

Preliminary notes on brain weight variation across labrid fish species with different levels of cooperative behaviour

Institute of Scientific and Technical Information of China (English)

Marta C.SOARES; Gon(c)alo I.ANDR(E); José R.PAULA

2015-01-01

Brain size and weight vary tremendously in the animal kingdom.It has been suggested that brain structural development must evolve balanced between the advantages of dealing with greater social challenges and the energetic costs of maintaining and developing larger brains.Here we ask if interspecific differences in cooperative behaviour (i.e.cleaning behaviour) are related to brain weight variations in four close-related species of Labrid fish:two are obligatory cleanerfish throughout their entire life (Labroides dimidiatus and L.bicolor),one facultative cleaner fish Labropsis australis and one last species that never engage in cleaning Labrichthys unilineatus.We first search for the link between the rate of species' cooperation and its relative brain weight,and finally,if the degree of social complexity and cooperation are reflected in the weight of its major brain substructures.Overall,no differences were found in relative brain weight (in relation to body weight) across species.Fine-scale differences were solely demonstrated for the facultative cleaner L.australis,at the brainstem level.Furthermore,data visual examination indicates that the average cerebellum and brainstem weights appear to be larger for L.dimidiatus.Because variation was solely found at specific brain areas (such as cerebellum and brainstem) and not for the whole brain weight values,it suggests that species social-ecological and cognitive demands may be directly contributing to a selective investment in relevant brain areas.This study provides first preliminary evidence that links potential differences in cognitive ability in cooperative behaviour to how these may mediate the evolution of brain structural development in non-mammal vertebrate groups [Current Zoology 61 (2):274-280,2015].

Seasonal dynamics of trace elements in tidal salt marsh soils as affected by the flow-sediment regulation regime.

Directory of Open Access Journals (Sweden)

Junhong Bai

Full Text Available Soil profiles were collected in three salt marshes with different plant species (i.e. Phragmites australis, Tamarix chinensis and Suaeda salsa in the Yellow River Delta (YRD of China during three seasons (summer and fall of 2007 and the following spring of 2008 after the flow-sediment regulation regime. Total elemental contents of As, Cd, Cu, Pb and Zn were determined using inductively coupled plasma atomic absorption spectrometry to investigate temporal variations in trace elements in soil profiles of the three salt marshes, assess the enrichment levels and ecological risks of these trace elements in three sampling seasons and identify their influencing factors. Trace elements did not change significantly along soil profiles at each site in each sampling season. The highest value for each sampling site was observed in summer and the lowest one in fall. Soils in both P. australis and S. salsa wetlands tended to have higher trace element levels than those in T. chinensis wetland. Compared to other elements, both Cd and As had higher enrichment factors exceeding moderate enrichment levels. However, the toxic unit (TU values of these trace elements did not exceed probable effect levels. Correlation analysis showed that these trace elements were closely linked to soil properties such as moisture, sulfur, salinity, soil organic matter, soil texture and pH values. Principal component analysis showed that the sampling season affected by the flow-sediment regulation regime was the dominant factor influencing the distribution patterns of these trace elements in soils, and plant community type was another important factor. The findings of this study could contribute to wetland conservation and management in coastal regions affected by the hydrological engineering.

The phytoremediation ability of a polyculture constructed wetland to treat boron from mine effluent

Energy Technology Data Exchange (ETDEWEB)

Türker, Onur Can [Faculty of Science and Letters, Department of Biology, Aksaray University, Aksaray (Turkey); Böcük, Harun, E-mail: hbocuk@anadolu.edu.tr [Faculty of Science, Department of Biology, Anadolu University, Eskişehir (Turkey); Yakar, Anıl [Faculty of Science, Department of Biology, Anadolu University, Eskişehir (Turkey)

2013-05-15

Highlights: ► We assessed the phytoremediation ability of a polyculture constructed wetland (PCW) to treat boron (B) from mine effluent. ► B in mine effluent decreased from 187 mg l{sup −1} to 123 mg l{sup −1} (32% removal rate) through the PCW. ► Estimated methane production, energy yields and electrical energy yields of the PCW increased with biomass production. ► Cattails accumulated more than 250 mg kg{sup −1} B and common reed accumulated 38 mg kg{sup −1} B at the end of the experiment. -- Abstract: This study focuses on describing the ability of a small-scale, subsurface-flow-polyculture-constructed wetland (PCW) to treat boron (B) mine effluent from the world's largest borax mine (Kırka, Turkey) under field conditions. This application is among the first effluent treatment methods of this type in both Turkey and the world. This study represents an important resource on how subsurface-flow-constructed wetlands could be used to treat B mine effluents in the field conditions. To this end, an experimental wetland was vegetated with common reed (Phragmites australis) and cattails (Typha latifolia), and mine effluent was moved through the wetland. The results of the present study show that B concentrations of the mine effluent decreased from 187 to 123 mg l{sup −1} (32% removal rate) on average. The T. latifolia individuals absorbed a total of 250 mg kg{sup −1} whereas P. australis in the PCW absorbed a total of 38 mg kg{sup −1} B during the research period.

Maternal body size and condition determine calf growth rates in southern right whales

DEFF Research Database (Denmark)

Christiansen, Fredrik; Vivier, Fabien; Charlton, Claire

2018-01-01

The cost of reproduction is a key parameter determining a species' life history strategy. Despite exhibiting some of the fastest offspring growth rates among mammals, the cost of reproduction in baleen whales is largely unknown since standard field metabolic techniques cannot be applied. We...... quantified the cost of reproduction for southern right whales Eubalaena australis over a 3 mo breeding season. We did this by determining the relationship between calf growth rate and maternal rate of loss in energy reserves, using repeated measurements of body volume obtained from unmanned aerial vehicle...... period, and highlights the importance of sufficient maternal energy reserves for reproduction in this capital breeding species....

Aurorae in Australian Aboriginal Traditions

Science.gov (United States)

Hamacher, Duane W.

2013-07-01

Transient celestial phenomena feature prominently in the astronomical knowledge and traditions of Aboriginal Australians. In this paper, I collect accounts of the Aurora Australis from the literature regarding Aboriginal culture. Using previous studies of meteors, eclipses, and comets in Aboriginal traditions, I anticipate that the physical properties of aurora, such as their generally red colour as seen from southern Australia, will be associated with fire, death, blood, and evil spirits. The survey reveals this to be the case and also explores historical auroral events in Aboriginal cultures, aurorae in rock art, and briefly compares Aboriginal auroral traditions with other global indigenous groups, including the Maori of New Zealand.

Macrophytes of the Grlište reservoir (Serbia: Fifteen years after its establishment

Directory of Open Access Journals (Sweden)

Stanković Ž.

2009-01-01

Full Text Available A large number of macrophytes, often in dense populations, have developed on the Grlište Reservoir, Serbia over a period of 15 years. Fast development of vegetation is a consequence of anthropogenic impact in lake management. The methodology used in this research covered 100% of the water body, including all areas with or without aquatic plants. The results indicate that plant communities are still in the early phase of development. This leaves space for future development of competitor macrophyte species (Najas marina, Eleocharis palustris, Typha latifolia, Typha angustifolia, Phragmites australis, etc. capable of endangering stability of the lake, which will tend toward eutrophication.

La république en Grande-Bretagne aujourd’hui : une idée anglaise

Directory of Open Access Journals (Sweden)

Antoine MIOCHE

2003-10-01

Full Text Available Il peut paraître y avoir un paradoxe à parler de république aujourd’hui en Grande-Bretagne en ceci que seule ou presque la Grande-Bretagne, de ce qui fut le vaste Empire britannique, est demeurée une monarchie. Des États-Unis à la Rhodésie, en passant par l’Inde et l’Irlande (à l’exception importante du nord de l’île, les anciens territoires britanniques ont opté majoritairement pour un régime parlementaire non monarchique, l’Australie, le Canada et la Nouvelle-Zélande étant d’intéressantes ...

Identités nationales, identités « raciales » en Océanie

OpenAIRE

Rodd, Adrien

2016-01-01

La tentation de fonder une affirmation identitaire nationale sur une adéquation entre ‘race’ et nation a marqué les discours et les politiques en Océanie, à l’instar d’autres régions du monde. Cet article se donne pour objectif d’analyser la manière dont l’impératif d’unité nationale s’y est appuyé sur la perception ou la mise en avant d’une homogénéité non seulement culturelle mais ethnique ou « raciale », accompagnée parfois de politiques d’exclusion des minorités. En Australie et en Nouvel...