WorldWideScience

Sample records for micans coleoptera scolytidae

  1. Plants of an Eucalyptus clone damaged by Scolytidae and Platypodidae (Coleoptera Plantas de Eucalyptus atacadas por Scolytidae e Platypodidae (Coleoptera

    Directory of Open Access Journals (Sweden)

    José Cola Zanuncio

    2005-05-01

    Full Text Available Species of Scolytidae and Platypodidae were evaluated in a plantation using a clone of Eucalyptus grandis x Eucalyptus urophylla in the State of Minas Gerais, Brazil. Wood disks with galleries were taken from 15 eucalyptus trees between 0.5 and 1.5 m height. After collection, all trees attacked were burned. Woodborers obtained from these disks were identified as Premnobius cavipennis, Premnobius ambitiosus, Dryocoetoides cristatus (Coleoptera: Scolytidae and Euplatypus parallelus (Coleoptera: Platypodidae. This is the first report of D. cristatus, a Brazilian native species, damaging eucalyptus, which shows its adaptation to this plant.O objetivo deste trabalho foi avaliar o ataque de Scolytidae e Platypodidae em talhão de clone Eucalyptus grandis x Eucalyptus urophylla na região de Montes Claros, Estado de Minas Gerais, Brasil. Discos de madeira com galerias desses insetos foram retirados de 15 árvores de eucalipto entre 0,5 e 1,5 m de altura. Após a coleta deste material, as árvores atacadas foram queimadas. Os indivíduos da ordem Coleoptera obtidos desses discos foram identificados como Premnobius cavipennis, Premnobius ambitiosus e Dryocoetoides cristatus (Coleoptera: Scolytidae e Euplatypus parallelus (Coleoptera: Platypodidae. O ataque de D. cristatus, espécie nativa do Brasil, ao eucalipto ainda não havia sido relatado, o que mostra sua adaptação a essa planta.

  2. Development of an improved attractive lure for the pine shoot beetle, Tomicus piniperda (Coleoptera: Scolytidae)

    Science.gov (United States)

    Therese M. Poland; Peter de Groot; Stephen Burke; David Wakarchuk; Robert A. Haack; Reginald Nott; Taylor Scarr

    2003-01-01

    1) The pine shoot beetle, Tomicus piniperda (L.) (Coleoptera: Scolytidae), is an exotic pest of pine, Pinus spp., and was first discovered in North America in 1992. 2) Although primary attraction to host volatiles has been clearly demonstrated for T. piniperda, the existence and role of secondary attraction to...

  3. Fine fluorescent powder marking study of dispersal in the spruce bark beetle, Ips typographus (Coleoptera: Scolytidae)

    Czech Academy of Sciences Publication Activity Database

    Doležal, Petr; Okrouhlík, Jan; Davídková, Markéta

    2016-01-01

    Roč. 113, JAN 07 (2016), s. 1-8 E-ISSN 1802-8829 Grant - others:Forests of the Czech Republic(CZ) 08/2009; MŠMT(CZ) LH12098 Institutional support: RVO:60077344 Keywords : Coleoptera * Scolytidae * Ips typographus Subject RIV: EH - Ecology, Behaviour Impact factor: 1.167, year: 2016 http://www.eje.cz/pdfs/eje/2016/01/01.pdf

  4. Development of a satellite-based hazard rating system for Dendrctonus frontallis (Coleoptera: Scolytidae) in the Ouachita Mountains of Arkansas

    Science.gov (United States)

    Stephen Cook; Shane Cherry; Karen Humes; James Guldin; Christopher Williams

    2007-01-01

    The southern pine beetle, Dendroctonus frontalis Zimmermann (Coleoptera: Scolytidae), is the most damaging forest insect pest of pines (Pinus spp.) throughout the southeastern United States. Hazard rating schemes have been developed for D. frontalis, but for these schemes to be accurate and effective, they...

  5. Detection and quantification of Leptographium wageneri, the cause of black-stain root disease, from bark beetles (Coleoptera: Scolytidae) in North California using regular and real-time PCR

    Science.gov (United States)

    Wolfgang Schweigkofler; William J. Otrosina; Sheri L. Smith; Daniel R. Cluck; Kevin Maeda; Kabir G. Peay; Matteo Garbelotto

    2005-01-01

    Black-stain root disease is a threat to conifer forests in western North America. The disease is caused by the ophiostomatoid fungus Leptographium wageneri (W.B. Kendr.) M.J. Wingf., which is associated with a number of bark beetle (Coleoptera: Scolytidae) and weevil species (Coleoptera: Curculionidae). We developed a polymerase chain reaction test...

  6. Limonene: attractant kairomone for white pine cone beetles (Coleoptera: Scolytidae) in an Eastern white pine seed orchard in Western North Carolina

    Science.gov (United States)

    Daniel R. Miller

    2007-01-01

    I report on the attraction of the white pine cone beetle, Canophthorus coniperda (Schwarz) (Coleoptera: Scolytidae), to traps baited with the host monoterpene limonene in western North Carolina. Both (+)- and (-)-limonene attracted male and female cone beetles to Japenese beetle traps in an eastern white pine, Pinus strobus L. seed...

  7. CONTRIBUTION FOR THE DIAGNOSIS AND CONTROL OF THE BARK BEETLES OF GENUS IPS (COLEOPTERA: SCOLYTIDAE) IN THE PINE FOREST OF CUBA

    OpenAIRE

    René Alberto López Castilla; Fidel Góngora Rojas; Celia Guerra Rivero; Enrique de Zayas Izaguirre; Antonio Fernández Vera; Natividad Triguero Isasi

    2009-01-01

    There are four pines species endemic from Cuba with width importance, from the Conservation of the Forest Genetic Resources at regional level to the mitigation of the climatic change. Their economical importance is due to forming pure forest stand of fast growth and of straight trunk. The bark beetle of the genus Ips De Geer (Coleoptera: Scolytidae) and the associate mushrooms from the complex Ophiostomatoid (Ceratocystidaceae: Microascales Phylum Ascomycotina) are those that cause the bigge...

  8. Ambrosia Beetle (Coleoptera: Scolytidae) Species, Flight, and Attack on Living Eastern Cottonwood Trees.

    Energy Technology Data Exchange (ETDEWEB)

    Coyle, D R; D.C. Booth: M.S. Wallace

    2005-12-01

    ABSTRACT In spring 2002, ambrosia beetles (Coleoptera: Scolytidae) infested an intensively managed 22-ha tree plantation on the upper coastal plain of South Carolina. Nearly 3,500 scolytids representing 28 species were captured in ethanol-baited traps from 18 June 2002 to 18 April 2004. More than 88% of total captures were exotic species. Five species [Dryoxylon onoharaensum (Murayama), Euwallacea validus (Eichhoff), Pseudopityophthorus minutissimus (Zimmermann), Xyleborus atratus Eichhoff, and Xyleborus impressus Eichhoff]) were collected in South Carolina for the first time. Of four tree species in the plantation, eastern cottonwood, Populus deltoides Bartram, was the only one attacked, with nearly 40% of the trees sustaining ambrosia beetle damage. Clone ST66 sustained more damage than clone S7C15. ST66 trees receiving fertilization were attacked more frequently than trees receiving irrigation, irrigation_fertilization, or controls, although the number of S7C15 trees attacked did not differ among treatments. The study location is near major shipping ports; our results demonstrate the necessity for intensive monitoring programs to determine the arrival, spread, ecology, and impact of exotic scolytids.

  9. Occurrence of Euplatypus parallelus, Euplatypus sp. (col.: Euplatypodidae and Xyleborus affinis (col.: Scolytidae in Pinus sp. in Ribas do Rio Pardo, Mato Grosso do Sul, Brazil

    Directory of Open Access Journals (Sweden)

    Zanuncio José Cola

    2002-01-01

    Full Text Available Wood borer species of the families Euplatypodidae and Scolytidae were observed attacking trees of Pinus sp. in the Municipality of Ribas do Rio Pardo, state of Mato Grosso do Sul, Brazil, in March 2000. This plantation had been previously burned in an accidental fire in January 2000, causing the trees to become partially or totally unhealthy, rendering them more susceptible to attack of these pests. Galleries of these wood borers were opened with a chisel to observe parameters such as their direction and form of these galleries. Species observed as wood borers of Pinus sp. were Euplatypus parallelus, Euplatypus sp. (Coleoptera: Euplatypodidae and Xyleborus affinis (Coleoptera: Scolytidae.

  10. The response of Dendroctonus valens (Coleoptera: Scolytidae) and Temnochila chlorodia (Coleoptera: Trogossitidae) to Ips paraconfusus (Coleoptera: Scolytidae) pheromone components and verbenone

    Science.gov (United States)

    Christopher J. Fettig; Stepehen R. McKelvey; Christopher P. Dabney; Robert R. Borys

    2007-01-01

    The red turpentine beetle, Dendroctonus valens LeConte, 1860 (Coleoptera: Curculionidae, Scolytinae), is a common bark beetle species found throughout much of North America and China. In 2004, we observed that California fivespined ips, Ips paraconfusus Lanier, 1970 (Coleoptera: Curculionidae, Scolytinae), attack densities in logging debris were inversely related to D...

  11. Dose-Dependent and Species-Specific Responses of Pine Bark Beetles (Coeoptera: Scolytidae) to Monoterpenes in Association with Phermones

    Science.gov (United States)

    Daniel R. Miller; John H. Borden

    2000-01-01

    Monoterpenes affected the attraction of three sympatric species of bark beetles (Coleoptera: Scolytidae) to pheromone-baited multiple-funnel traps in stands of lodgepole pine. Catches of Ips pini(Say) in traps baited with its pheromone, ipsdienol, were directly related to the release rates of 3-carene, ß-pphellandrene, and ß-pinene. Catches of

  12. Producción masiva automatizada de la broca del café Hypothenemus hampei Ferrari (Coleóptera: Scolytidae) y de sus parasitoides sobre dietas artificiales

    Science.gov (United States)

    This article reviews the current state of knowledge concerning the mass rearing system of the coffee berry borer, cbb, Hypothenemus hampei (Ferrari) (Coleoptera: Scolytidae), and its African parasitoids: the ectoparasitoids Cephalonomia stephanoderis (Betrem) and Prorops nasuta ((Waterston) (Hymenop...

  13. ß-Phellandrene: Kairomone for Pine Engraver, Ips pini (Say) (Coleoptera: Scolytidae)

    Science.gov (United States)

    Daniel R. Miller; John H. Borden

    1990-01-01

    The responses of Ips pini (Scolytidae) to multiple-funnel traps baited with the pheromone, ipsdienol, and various monoterpenes were determined in stands of lodgepole pine in southern and central British Columbia. Ips pini was attracted to both ipsdienol and ß-phellandrene, demonstrating that ß-phellandrene is a kairomone for this...

  14. On some Scolytidae and Platypodidae (Coleoptera), mainly from Africa and the oriental region

    NARCIS (Netherlands)

    Browne, F.G.

    1965-01-01

    During the past year I have had the opportunity of examining several interesting collections of Scolytidae and Platypodidae from Ghana, Ivory Coast, Kenya, Nigeria and Uganda, as well as most of Dr. E. Mjöberg's older collections made in Sarawak. It is more convenient to deal with new species, and

  15. Responses of Ips pini (Say), Pityogenes knechteli Swaine and Associated Beetles (Coleoptera) to Host Monoterpenes in Stands of Lodgepole Pine

    Science.gov (United States)

    Daniel R. Miller; John H. Borden

    2003-01-01

    We conducted seven experiments in stands of mature lodgepole pine in southern British Columbia to elucidate the role of host volatiles in the semiochemical ecology of the pine engraver, Ips pini (Say) (Coleoptera: Scolytidae), with particular reference to the behavioral responses of predators and competing species of bark beetles. Our results demonstrated that the...

  16. Efecto de la dieta artificial MP sobre la emergencia y relacion de sexos de Phymastichus coffea (Hymenoptera:Eulophidae) mantenido sobre su hueped, Hypothenemus hampei (Coleoptera: Scloytidae)a traves de generaciones contin

    Science.gov (United States)

    Phymastichus coffea La Salle (Hymenoptera: Eulophidae) is an endoparasitoid that attacks the adult coffee berry borer, Hypothenemus hampei Ferrari (Coleoptera: Scolytidae). The MP diet developed by Portilla and Streett is the only reported diet that allows cultures of P. coffea to develop and repr...

  17. Evaluation of funnel traps for characterizing the bark beetle (Coleoptera: Scolytidae) communities in ponderosa pine forests of north-central Arizona.

    Science.gov (United States)

    Hayes, Christopher J; DeGomez, Tom E; Clancy, Karen M; Williams, Kelly K; McMillin, Joel D; Anhold, John A

    2008-08-01

    Lindgren funnel traps baited with aggregation pheromones are widely used to monitor and manage populations of economically important bark beetles (Coleoptera: Scolytidae). This study was designed to advance our understanding of how funnel trap catches assess bark beetle communities and relative abundance of individual species. In the second year (2005) of a 3-yr study of the bark beetle community structure in north-central Arizona pine (Pinus spp.) forests, we collected data on stand structure, site conditions, and local bark beetle-induced tree mortality at each trap site. We also collected samples of bark from infested (brood) trees near trap sites to identify and determine the population density of bark beetles that were attacking ponderosa pine, Pinus ponderosa Douglas ex Lawson, in the area surrounding the traps. Multiple regression models indicated that the number of Dendroctonus and Ips beetles captured in 2005 was inversely related to elevation of the trap site, and positively associated with the amount of ponderosa pine in the stand surrounding the site. Traps located closer to brood trees also captured more beetles. The relationship between trap catches and host tree mortality was weak and inconsistent in forest stands surrounding the funnel traps, suggesting that trap catches do not provide a good estimate of local beetle-induced tree mortality. However, pheromone-baited funnel trap data and data from gallery identification in bark samples produced statistically similar relative abundance profiles for the five species of bark beetles that we examined, indicating that funnel trap data provided a good assessment of species presence and relative abundance.

  18. Ecological interactions of bark beetles with host trees

    Science.gov (United States)

    Certain species of bark beetles in the insect order Coleoptera, family Curculionidae (formerly Scolytidae) are keystone species in forest ecosystems. However, the tree-killing and woodboring bark and ambrosia beetles are also among the most damaging insects of forest products including lumber, paper...

  19. Bark beetle Polygraphus proximus: a new aggressive far eastern invader on Abies species in Siberia and European Russia

    Science.gov (United States)

    Yuri Baranchikov; Evgeniy Akulov; Sergey. Astapenko

    2011-01-01

    Polygraphus proximus Brandford (Coleoptera: Scolytidae) is a common feeder on Far Eastern firs: Abies nephrolepis, A. hollophyll, and A. sachalinensis. Its native range occupies northeastern China, Korea, Japan, Kurile and Sakhalin Islands, and the southern part of the Russian Far East (Primorskiy and...

  20. Population dynamics and distribution of the coffee berry borer ...

    African Journals Online (AJOL)

    Population dynamics and distribution of coffee berry borer, Hypothenemus hampei (Ferrari) (Coleoptera: Scolytidae) were studied on Coffea arabica L. in southwestern region of Ethiopia. Thirty coffee trees were sampled at weekly intervals from 2000 to 2001. Findings of this study showed that coffee berry borer population ...

  1. The response of saprotrophic beetles to coast live oaks infected with Phytophthora ramorum

    Science.gov (United States)

    Brice A. McPherson; Nadir Ebilgin; David L. Wood; Pavel Svihra; Andrew J. Storer; Richard B. Standiford

    2006-01-01

    Saprotro phic ambrosia and bark beetles (Coleoptera: Scolytidae) tunnel into the bark overlying cankers caused by Phytophthora ramorum in coast live oaks, Quercus agrifolia. These insects are characteristically reported to colonize freshly dead or moribund trees (Furniss and Carolin, 1977). However, the initial attacks by these...

  2. Abridged life tables for Cephalonomia stephanoderis and Prorops nasuta (Hymenoptera: Bethylidae) Parasitoids of Hypothenemus hampei (Coleoptera: Scolytidae) reared on artificial diet

    Science.gov (United States)

    Biological aspects and demographic parameters of Cephalonomia stephanoderis Betrem (Hymenoptera: Bethylidae) and Prorops nasuta Waterston (Hymenoptera: Bethylidae) parasitoids of the coffee berry borer (CBB), Hypothenemus hampei (Ferrari) (Coleoptera: Curculionidae: Scolytinae) were investigated usi...

  3. Effectiveness of permethrin plus-C (Masterline®) and carbaryl (Sevin SL®) for protecting individual, high-value pines from bark beetle attack

    Science.gov (United States)

    Christopher J. Fettig; Thomas E. DeGomez; Kenneth E. Gibson; Christopher J. Dabney; Robert R. Borys

    2006-01-01

    Bark beetles (Coleoptera: Scolytidae) are commonly recognized as the most important mortality agent in western coniferous forests. High value trees, such as those located in residential, recreational, or administrative sites, are particularly susceptible to attack. Regardless of landowner objectives, tree losses in these unique environments generally have a...

  4. Evaluation naturelle de l'impact de Beauveria bassiana ...

    African Journals Online (AJOL)

    A study of finding out natural enemies of the coffee cherry borer beetle Coffea canephora, Hypothenemus hampei (Ferrari) (Coleoptera, Scolytidae) was carried out at two ecologically different sites of Cameroon: Nkoemvone in the South region of the country and Nkolbisson around Yaoundé in the central region. For six ...

  5. Walnut twig beetle: update on the biology and chemical ecology of a vector of an invasive fatal disease of walnut in the western U.S.

    Science.gov (United States)

    Steven J. Seybold; Andrew D. Graves; Tom W. Coleman

    2011-01-01

    The walnut twig beetle, Pityophthorus juglandis Blackman (Coleoptera: Scolytidae) (sensu Wood 2007), is a native North American bark beetle that has been recently implicated as the vector of thousand cankers disease of walnut trees in the western U.S. (Tisserat et al. 2009, Utley et al. 2009, Seybold et al. 2010).

  6. Phytophthora ramorum infection in coast live oaks and Shreve's oaks treated with insecticide to prevent beetle colonization

    Science.gov (United States)

    Brice A. McPherson; David L. Wood; David M. Rizzo; Pavel Svihra; Steve Tjosvold; Andrew J. Storer; Richard B. Standiford

    2006-01-01

    As the name implies, sudden oak death, caused by Phytophthora ramorum, kills many, if not most of the coast live oaks, Quercus agrifolia, that become infected (McPherson and others, 2005). Several genera of ambrosia and bark beetles (Coleoptera: Scolytidae) colonize bleeding (infected) trees and are suspected to hasten tree death....

  7. Xylem monoterpenes of pines: distribution, variation, genetics, function

    Science.gov (United States)

    Richard Smith

    2000-01-01

    The monoterpenes of about 16,000 xylem resin samples of pine (Pinus) speciesand hybrids—largely from the western United States—were analyzed in this long-term study of the resistance of pines to attack by bark beetles (Coleoptera:Scolytidae), with special emphasis on resistance to the western pine beetle(Dendroctonus brevicomis). The samples were analyzed by gas liquid...

  8. Coleópteros (Bostrichidae, Platypodidae e Scolytidae em um fragmento de cerrado da baixada Cuiabana / Coleopterans (Bostrichidae, Platypodidae e Scolytidae in fragment of savannah in baixada Cuiabana

    Directory of Open Access Journals (Sweden)

    José Renato Maurício da Rocha

    2011-04-01

    Full Text Available O objetivo desta pesquisa foi qualificar e quantificar as populações de Bostrichidae, Platypodidae e Scolytidae que ocorrem associadas a um fragmento de cerrado nos períodos de seca (maio a outubro e de chuva (novembro a abril, no município de Cuiabá, estado de Mato Grosso. As coletas foram quinzenais e ocorreram de abril de 2008 a março de 2009. Foram utilizadas seis armadilhas etanólicas, iscadas com álcool etílico combustível hidratado. Os exemplares coletados foram triados, contados e identificados nos Laboratórios de Proteção Florestal da Universidade Federal de Mato Grosso e da Universidade Federal do Paraná. Foram realizados estudos faunísticos de dominância, constância, freqüência, abundância e de diversidade. Também foi desenvolvido estudo de flutuação populacional, de correlação com a tempertura, umidade relativa, precipitação pluvial e testes de médias entre as espécies. Foram identificadas 25 espécies, sendo cinco de Bostrichidae, duas de Platypodidae e 18 de Scolytidae. Foi coletado um total de 874 indivíduos, dos quais 588 foram coletados no período de seca e 286 no período de chuva. Bostrichopsis uncinata, Cryptocarenus diadematus, Xyleborus affinis e Xyleborus retusus foram as espécies mais numerosas no período de seca, enquanto Bostrichopsis uncinata, Xyleborus affinis e Xyleborus ferrugineus foram mais representativas no período de chuvas. As espécies Cryptocarenus diadematus, Xyleborus affinis e Xyleborus retusus ocorreram como dominante, muito abundante, muito frequente e constante somente no período seco, enquanto que no período de chuvas Xyleborus affinis ocorreu como super dominante, super abundante, super frequente e constante. No período de seca, os índices de Equitatibilidade e de Shannon-Wiener foram mais expressivos quando comparados com os obtidos nos meses de chuva.AbstractThe purpose of this research was to qualify and quantify the populations of Bostrichidae, Platypodidae

  9. Two new species of Corticeus from Mexico and honduras (Coleoptera: Tenebrionidae)

    Science.gov (United States)

    Charles A. Triphlehorn; John C. Moser

    1970-01-01

    The genus Cortiecus Piller and Mitterpacher is represented on every continent except Antartica. Blackwelder (1945, p. 533) lists 10 species from Central and South America and Arnett (1963, p. 685) lists 13 from the United States. Most occur with bark beetles (Family Scolytidae), but their roles are poorly understood. Some authors have called them...

  10. Attraction of Tomicus yunnanensis (Coleoptera: Scolytidae to Yunnan Pine Logs with and without Periderm or Phloem: An Effective Monitoring Bait

    Directory of Open Access Journals (Sweden)

    Rong Chun Lu

    2012-01-01

    Full Text Available The Yunnan pine shoot beetle, Tomicus yunnanensis Kirkendall and Faccoli (Coleoptera: Scolytinae is an important pest of Yunnan pine (Pinus yunnanensis Franch in China. Experiments with host log baits were done to develop a pest monitoring system using host tree kairomone. Five Yunnan pine logs (each 10–15 cm diam. × 30-cm long in a trap-log bundle were treated by peeling periderm (outer bark off to expose the phloem, and half of each log was covered with sticky adhesive to capture any attracted adult beetles. Significantly, more beetles were attracted and caught on the periderm-peeled logs (ca 30 beetles/m2 log surface/day than on untreated control logs with adhesive (ca 2.5/m2/day. No significant differences were observed between catches on logs taken from lower or upper halves of Yunnan pines. T. yunnanensis flies mostly during the afternoon according to trap catches throughout the day. Attraction to the periderm-peeled logs decreased considerably when they were peeled further to remove the phloem, indicating phloem volatiles play a role in selection of the host by the beetle. The readily-available log baits appear useful for monitoring pine shoot beetle populations in integrated pest management programs.

  11. Molecular markers detect cryptic predation on coffee berry borer (Coleoptera: Curculionidae) by silvanid and laemophloeid flat bark beetles (Coleoptera: Silvanidae, Laemophloeidae) in coffee beans

    Science.gov (United States)

    The coffee berry borer, Hypothenemus hampei(Coleoptera: Curculionidae)(Ferrari), is a serious pest of coffee worldwide and has been recently introduced in Hawai’i, first detected in the state in 2010. Adult silvanid flat bark beetles, Cathartus quadricollis (Coleoptera: Silvanidae) and adult laemoph...

  12. Attraction of Hylastes opacus (Coleoptera: Scolytidae) to nonanal

    Science.gov (United States)

    Peter de Groot; Therese M. Poland

    2003-01-01

    Hylastes opacus Erichson is a recently introduced bark beetle in North America (Bright and Skidmore 1997; Hoebeke 1994; Rabaglia and Cavey 1994; Wood 1992). It is widely distributed in the Palearctic region, where it usually breeds in stumps and roots of dead or dying pines (Pinus) and occasionally other conifers (Hoebeke 1994)....

  13. Parasitism and olfactory responses of Dastarcus helophoroides (Coleoptera: Bothrideridae) to different Cerambycid hosts

    Science.gov (United States)

    Jian-Rong Wei; Zhong-Qi Yang; Therese M. Poland; Jia-Wei. Du

    2009-01-01

    Dastarcus helophoroides (Fairmaire) (Coleoptera: Bothrideridae) is an important natural enemy of longhorned beetles (Coleoptera: Cerambycidae). It is distributed throughout most Provinces in China. We investigated whether there were differences among D. helophoroides populations collected from different hosts in different...

  14. Het voorkomen van de glanskevers van het genus Caprophilus in Nederland (Coleoptera: Nitidulidae)

    NARCIS (Netherlands)

    Oude, de J.

    2005-01-01

    The occurrence of nitidulid beetles of the genus Carpophilus in the Netherlands (Coleoptera: Nitidulidae) Some species of the genus Carpophilus (Coleoptera: Nitidulidae) may act as pests of stored products like cocoabeans, peanuts, dried fruits like figs and dates, imported from tropical or

  15. Estados inmaduros de Ancognatha ustulata (Coleoptera: Melolonthidae: Dynastinae: Cyclocephalini Immature stages of Ancognatha ustulata (Coleoptera: Melolonthidae: Dynastinae: Cyclocephalini

    Directory of Open Access Journals (Sweden)

    Jhon César Neita-Moreno

    2008-12-01

    Full Text Available Se describen y se ilustran por primera vez la larva de tercer estadio y la pupa de Ancognatha ustulata Burmeister, 1847 (Coleoptera: Melolonthidae: Dynastinae: Cyclocephalini. Se aportan datos sobre la biología de la especie y su distribución en Colombia. Se proporciona una clave para la identificación de las larvas de tercer estadio conocidas de las especies del género Ancognatha Erichson.The third instar larva and pupa of Ancognatha ustulata Burmeister, 1847 (Coleoptera: Melolonthidae: Dynastinae: Cyclocephalini are described and illustrated for the first time. New data on larval biology and distribution of the species in Colombia are included. A key to the known third stage larvae of Ancognatha Erichson is provided.

  16. Occurrence of pathogens in associated living bark beetles (Col., Scolytidae) from different spruce stands in Austria

    Czech Academy of Sciences Publication Activity Database

    Händel, U.; Wegensteiner, R.; Weiser, Jaroslav; Žižka, Zdeněk

    2003-01-01

    Roč. 76, - (2003), s. 22-32 ISSN 1436-5693 Institutional research plan: CEZ:AV0Z5020903; CEZ:AV0Z5007907 Keywords : Ips-typographus Coleoptera- mickrospora Subject RIV: EE - Microbiology, Virology Impact factor: 0.197, year: 2003

  17. Coleoptera species of forensic importance from Brazil: an updated list

    Directory of Open Access Journals (Sweden)

    Lúcia Massutti de Almeida

    2015-12-01

    Full Text Available ABSTRACT A list of the Coleoptera of importance from Brazil, based on published records was compiled. The checklist contains 345 species of 16 families allocated to 16 states of the country. In addition, three species of two families are registered for the first time. The fauna of Coleoptera of forensic importance is still not entirely known and future collection efforts and taxonomic reviews could increase the number of known species considerably in the near future.

  18. Coleoptera associated with macrophytes of the genus Salvinia in four oxbow lakes in two river basins in southeast Brazil.

    Science.gov (United States)

    Paula-Bueno, M C; Fonseca-Gessner, A A

    2015-11-01

    Macrophytes in oxbow lakes represent an important substrate for the Coleoptera. Two oxbow lakes the Rio Paranapanema were studied and the other two Rio Mogi-Guaçu, in the State de São Paulo, Brasil. In this study, there is greater similarity between the communities of Coleoptera of lakes greater connectivity with the main river channel or the difference in the species of Salvinia collected in the lakes studied interferes Coleoptera fauna that uses as substrate. A total of 9,222 specimens of Coleoptera were collected and identified in 10 families and 40 genera. The analysis MDS for abundance of Coleoptera showed the grouping of the oxbow lakes the Paranapanema River and a distancing the oxbow lakes the Mogi-Guaçu. The PERMANOVA test did not reveal any difference in the fauna between the wet and dry periods. It was concluded that the connectivity between river and lake is not decisive for the richness and abundance of aquatic fauna of Coleoptera. Therefore, the richness and abundance of aquatic Coleoptera associated vary with the species of Salvinia used as substrate.

  19. Coleoptera associated with macrophytes of the genus Salvinia in four oxbow lakes in two river basins in southeast Brazil

    Directory of Open Access Journals (Sweden)

    M. C. Paula-Bueno

    Full Text Available Abstract Macrophytes in oxbow lakes represent an important substrate for the Coleoptera. Two oxbow lakes the Rio Paranapanema were studied and the other two Rio Mogi-Guaçu, in the State de São Paulo, Brasil. In this study, there is greater similarity between the communities of Coleoptera of lakes greater connectivity with the main river channel or the difference in the species of Salvinia collected in the lakes studied interferes Coleoptera fauna that uses as substrate. A total of 9,222 specimens of Coleoptera were collected and identified in 10 families and 40 genera. The analysis MDS for abundance of Coleoptera showed the grouping of the oxbow lakes the Paranapanema River and a distancing the oxbow lakes the Mogi-Guaçu. The PERMANOVA test did not reveal any difference in the fauna between the wet and dry periods. It was concluded that the connectivity between river and lake is not decisive for the richness and abundance of aquatic fauna of Coleoptera. Therefore, the richness and abundance of aquatic Coleoptera associated vary with the species of Salvinia used as substrate.

  20. Sampling methods for Graphoderus bilineatus (Coleoptera: Dytiscidae).

    NARCIS (Netherlands)

    Koese, B.; Cuppen, J.G.M.

    2006-01-01

    Onderzoek naar vangmethodes voor Graphoderus bilineatus (Coleoptera: Dytiscidae) Als onderdeel van een integrale studie naar de waterroofkever Graphoderus bilineatus in Nederland (in opdracht van het ministerie van lnv), werd een vergelijkend onderzoek uitgevoerd naar verschillende

  1. Aquatic Coleoptera assemblages in protected wetlands of North-western Spain

    Directory of Open Access Journals (Sweden)

    Amaia Pérez-Bilbao

    2014-02-01

    Full Text Available Wetlands are diverse and productive ecosystems endangered by human pressure, which degradation implies a biodiversity loss worldwide. Among the biological assemblages of these habitats, aquatic Coleoptera is one of the most diverse and useful groups when assessing the ecological conditions of the ecosystems they inhabit. The aims of the present study were to analyze the diversity and composition of aquatic Coleoptera assemblages in 24 wetlands protected by the Natura 2000 network of North-western Spain and the influence of environmental variables on the distribution of species, in order to detect differences between the different types of standing water habitats. A total of 11,136 individuals of 105 species belonging to 12 families of aquatic Coleoptera (Gyrinidae, Haliplidae, Noteridae, Paelobiidae, Dytiscidae, Helophoridae, Hydrochidae, Hydrophilidae, Hydraenidae, Scirtidae, Elmidae and Dryopidae were collected. In general, wetlands presented high richness and diversity values, Dytiscidae and Hydrophilidae having the highest species richness. Most of recorded species have a wide biogeographical distribution and only 12 endemic ones were captured. Cluster and Non-Metric Multi-Dimensional Scaling (NMDS analyses showed the clustering of the studied ponds and lagoons in four groups based on biological data. In general, the wetlands of each group seem to have distinct aquatic Coleoptera faunas, as showed by the most representative species. A combination of altitude, SST and hydroperiod was the best explaining factor of the distribution of the species throughout the study area. This study shows the high biodiversity of standing water habitats in North-western Spain and the usefulness of water beetles in establishing habitat typologies.

  2. Predation by Flat Bark Beetles (Coleoptera: Silvanidae and Laemophloeidae) on Coffee Berry Borer (Coleoptera: Curculionidae) in Hawaii coffee

    Science.gov (United States)

    Coffee berry borer(CBB), Hypothenemus hampei, is a serious pest of coffee worldwide and a new invasive pest in Hawaii. Adult flat bark beetles, mainly Leptophloeus sp.(75%) and Cathartus quadricollis(21%) (Coleoptera: Laemophloeidae and Silvanidae, respectively), were found feeding in CBB-infested c...

  3. Sex- and Size-Related Patterns of Carrion Visitation in Necrodes littoralis (Coleoptera: Silphidae) and Creophilus maxillosus (Coleoptera: Staphylinidae).

    Science.gov (United States)

    Mądra-Bielewicz, Anna; Frątczak-Łagiewska, Katarzyna; Matuszewski, Szymon

    2017-09-01

    The estimation of postmortem interval (PMI) based on successional patterns of adult insects is largely limited, due to the lack of potential PMI markers. Sex and size of adult insects could be easily used for such estimation. In this study, sex- and size-related patterns of carrion attendance by adult insects were analyzed in Necrodes littoralis (Coleoptera: Silphidae) and Creophilus maxillosus (Coleoptera: Staphylinidae). For both species, abundance of males and females changed similarly during decomposition. A slightly female-biased sex ratio was recorded in N. littoralis. Females of N. littoralis started visiting carcasses, on average, one day earlier than males. There was a rise in size of males of N. littoralis at the end of decomposition, whereas for females of both species and males of C. maxillosus, no size-related patterns of carrion visitation were found. Current results demonstrate that size and sex of adult carrion beetles are poor indicators of PMI. © 2016 American Academy of Forensic Sciences.

  4. Vertical Distribution and Daily Flight Periodicity of Ambrosia Beetles (Coleoptera: Curculionidae) in Florida Avocado Orchards Affected by Laurel Wilt.

    Science.gov (United States)

    Menocal, Octavio; Kendra, Paul E; Montgomery, Wayne S; Crane, Jonathan H; Carrillo, Daniel

    2018-03-08

    Ambrosia beetles have emerged as significant pests of avocado ((Persea americana Mill. [Laurales: Lauraceae])) due to their association with pathogenic fungal symbionts, most notably Raffaelea lauricola T.C. Harr., Fraedrich & Aghayeva (Ophiostomatales: Ophiostomataceae), the causal agent of the laurel wilt (LW) disease. We evaluated the interaction of ambrosia beetles with host avocado trees by documenting their flight height and daily flight periodicity in Florida orchards with LW. Flight height was assessed passively in three avocado orchards by using ladder-like arrays of unbaited sticky traps arranged at three levels (low: 0-2 m; middle: 2-4 m; high: 4-6 m). In total, 1,306 individuals of 12 Scolytinae species were intercepted, but six accounted for ~95% of the captures: Xyleborus volvulus (Fabricius) (Coleoptera: Curculionidae), Xyleborinus saxesenii Ratzeburg (Coleoptera: Curculionidae), Euplatypus parallelus (Fabricius) (Coleoptera: Curculionidae), Xyleborus bispinatus Eichhoff (Coleoptera: Curculionidae), Xyleborus affinis Eichhoff (Coleoptera: Curculionidae), and Hypothenemus sp. (Coleoptera: Curculionidae). The primary vector of R. lauricola, Xyleborus glabratus Eichhoff (Coleoptera: Curculionidae), was not detected. Females of X. volvulus showed a preference for flight at low levels and X. bispinatus for the low and middle levels; however, captures of all other species were comparable at all heights. At a fourth orchard, a baiting method was used to document flight periodicity. Females of X. saxesenii and Hypothenemus sp. were observed in flight 2-2.5 h prior to sunset; X. bispinatus, X. volvulus, and X. affinis initiated flight at ~1 h before sunset and Xylosandrus crassiusculus (Motschulsky) (Coleoptera: Curculionidae) at 30 min prior to sunset. Results suggest that ambrosia beetles in South Florida fly near sunset (when light intensity and wind speed decrease) at much greater heights than previously assumed and have species-specific patterns in host

  5. Primer registro de Hippodamia variegata (Goeze 1777) (Coleoptera: Coccinellidae) en el Perú.

    OpenAIRE

    Bustamante-Navarrete, Abdhiel; Marquina-Montesinos, Edgar Luis; Elme-Tumpay, Araseli

    2017-01-01

    First report of Hippodamia variegata (Goeze 1777) (Coleoptera: Coccinellidae) in Peru. The first record of Hippodamia variegata (Goeze 1777) (Coleoptera: Coccinellidae) in Peru is reported, which also constitutes the highest record of the species. This introduced species is already established in the rest of the continent, but its presence in Peru is confirmed in this contribution. A distribution map and a key to distinguish the two species of this genus present in Peru are presented.

  6. New synonymy in Cuban Tilloclytus (Coleoptera: Cerambycidae: Anaglyptini)

    Science.gov (United States)

    Examination of holotypes of Tilloclytus (Coleoptera: Cerambycidae: Anaglyptini) in the Fernando de Zayas collection (Havana, Cuba) and the Museum of Comparative Zoology, Harvard University reveals that T. elongatus Zayas (1975) is a new synonym of T. rufipes Fisher (1942)....

  7. Bio-edafology of the Coleoptera order, in three Colombia Natural Regions

    International Nuclear Information System (INIS)

    Camero R, Edgar; Chamorro B, Clara

    1997-01-01

    The characterization of Coleoptera families is showed to three different Colombian Natural Regions. This is given in relation with biological and environmental factors, different vegetation covers and soil uses. In addition to it, susceptible Coleoptera taxa are determined when natural conditions are disturbed. Methodically, a literature subject research was made, and Barber and Berlesse traps were used to organism extractions from superficial and under superficial soil. Horizons diversity, riches and constancy index were determined to each family. Results show different diversity, riches and constancy values to each family, as much in each natural region, such as to each soil use

  8. [Infestation of the human digestive system with beetle larvae (Coleoptera: Cantharidae): a case report].

    Science.gov (United States)

    Yılmaz, Hasan; Taş Cengiz, Zeynep; Dülger, Ahmet Cumhur; Ekici, Pınar

    2014-12-01

    This study was conducted to report the digestive system infestation caused by the larvae of Coleoptera in a female pediatric patient. She was admitted to our hospital with the complaints of emergence of insect larvae from her vomit and feces, abdominal pain, inguinal pain, lack of appetite, hair loss, excessive cleaning behavior, extreme irritability, and distractibility. The larvae observed typically had the morphology of the larvae of insects related to the Cantharidae family in the Coleoptera order. For treatment, a single dose of albendazole (400 mg) was used. Consequently, in the present case, it was seen that the larvae of Coleoptera incidentally taken orally could continue to live for a period in the digestive tract of people, without losing vitality, and the larvae caused a variety of symptoms due to both their toxic agents and the possible irritation they caused.

  9. COPROPHANAEUS MORENOI ARNAUD, 1982 (COLEOPTERA: SCARABAEIDAE: SCARABAEINAE) IN THE GORGONA NATIONAL NATURAL PARK (COLOMBIAN PACIFIC OCEAN)

    OpenAIRE

    Cultid Medina, Carlos A; Giraldo López, Alan

    2012-01-01

    A new record of the dung beetle Coprophanaeus morenoi Arnaud, 1982 (Coleoptera: Scarabaeidae: Scarabaeinae), for the Gorgona Natural National Park (Gorgona NNP, Colombia) in the Colombian Pacific Ocean is presented. Se presenta un nuevo registro del escarabajo estercolero Coprophanaeus morenoi Arnaud, 1982 (Coleoptera: Scarabaeidae: Scarabaeinae), para el Parque Natural Nacional Gorgona, en el océano Pacifico colombiano.

  10. A coffee berry borer (Coleoptera: Curculionidae: Scolytinae) bibliography

    Science.gov (United States)

    One hundred years ago, one of the most significant biological invasions of an agricultural insect pest in the Americas was initiated. Endemic to Africa, the coffee berry borer (Hypothenemus hampei; Coleoptera: Curculionidae) was accidentally introduced to Brazil in 1913 and years later invaded coffe...

  11. Tanyproctini (Coleoptera: Scarabaeidae: Melolonthinae) of Socotra Island

    Czech Academy of Sciences Publication Activity Database

    Král, D.; Sehnal, R.; Bezděk, Aleš

    2012-01-01

    Roč. 52, suppl. 2 (2012), s. 153-182 ISSN 0374-1036 Grant - others:Ministry of Education, Youth and Sports (CZ) LA10036/MSMT Institutional support: RVO:60077344 Keywords : Coleoptera * Scarabaeidae * Melolonthinae Subject RIV: EG - Zoology Impact factor: 0.963, year: 2012 http://www.aemnp.eu/PDF/52_s2/52_S2_153.pdf

  12. Biologi Hama Kumbang Penggerek Pucuk Kelapa Sawit (Oryctes rhinoceros L.) (Coleoptera: Scarabaeidae) Di Rumah Kassa

    OpenAIRE

    Sejahtra, Ahmad

    2011-01-01

    Ahmad Sejahtra, "BIOLOGY SHOOT BORERS BEETLE PEST OF COCONUT PALM (Oryctes rhinoceros L.) (Coleoptera: Scarabaeidae) AT KASSA HOUSE", Under supervised by Ms Marheni and Ms Fatima Zahara. This study aims to determine biological pest of oil palm bud weevil (Oryctes rhinoceros L.) (Coleoptera: Scarabaeidae) at home kassa. The experiment was conducted on people's plantations in PERUMNAS Simalingkar starting from September 2010 until April 2011. Research using observational methods for this resear...

  13. Heavy metals in carabids (Coleoptera, Carabidae

    Directory of Open Access Journals (Sweden)

    Ruslan Butovsky

    2011-05-01

    Full Text Available Carabid beetles (Coleoptera, Carabidae are one of the most studied soil groups in relation to heavy metal (HM accumulation and use for bioindication of environmental pollution. Accumulation of Zn and Cu in carabid beetles was species-, sex- and trophic group-specific. No differences were found in HM contents between omnivorous and carnivorous species. The use of carabid beetles as indicators of HM accumulation appears to be rather limited.

  14. The evolution of asymmetric genitalia in Coleoptera.

    Science.gov (United States)

    Schilthuizen, Menno; de Jong, Paulien; van Beek, Rick; Hoogenboom, Tamara; Schlochtern, Melanie Meijer Zu

    2016-12-19

    The evolution of asymmetry in male genitalia is a pervasive and recurrent phenomenon across almost the entire animal kingdom. Although in some taxa the asymmetry may be a response to the evolution of one-sided, male-above copulation from a more ancestral female-above condition, in other taxa, such as Mammalia and Coleoptera, this explanation appears insufficient. We carried out an informal assessment of genital asymmetry across the Coleoptera and found that male genital asymmetry is present in 43% of all beetle families, and at all within-family taxonomic levels. In the most diverse group, Cucujiformia, however, genital asymmetry is comparatively rare. We also reconstructed the phylogeny of the leiodid tribe Cholevini, and mapped aspects of genital asymmetry on the tree, revealing that endophallus sclerites, endophallus, median lobe and parameres are, in a nested fashion, increasingly unlikely to have evolved asymmetry. We interpret these results in the light of cryptic female choice versus sexually antagonistic coevolution and advocate further ways in which the phenomenon may be better understood.This article is part of the themed issue 'Provocative questions in left-right asymmetry'. © 2016 The Authors.

  15. Feeding by phototrophic red-tide dinoflagellates on the ubiquitous marine diatom Skeletonema costatum.

    Science.gov (United States)

    Du Yoo, Yeong; Jeong, Hae Jin; Kim, Mi Seon; Kang, Nam Seon; Song, Jae Yoon; Shin, Woongghi; Kim, Kwang Young; Lee, Kitack

    2009-01-01

    We investigated feeding by phototrophic red-tide dinoflagellates on the ubiquitous diatom Skeletonema costatum to explore whether dinoflagellates are able to feed on S. costatum, inside the protoplasm of target dinoflagellate cells observed under compound microscope, confocal microscope, epifluorescence microscope, and transmission electron microscope (TEM) after adding living and fluorescently labeled S. costatum (FLSc). To explore effects of dinoflagellate predator size on ingestion rates of S. costatum, we measured ingestion rates of seven dinoflagellates at a single prey concentration. In addition, we measured ingestion rates of the common phototrophic dinoflagellates Prorocentrum micans and Gonyaulax polygramma on S. costatum as a function of prey concentration. We calculated grazing coefficients by combining field data on abundances of P. micans and G. polygramma on co-occurring S. costatum with laboratory data on ingestion rates obtained in the present study. All phototrophic dinoflagellate predators tested (i.e. Akashiwo sanguinea, Amphidinium carterae, Alexandrium catenella, Alexandrium tamarense, Cochlodinium polykrikoides, G. polygramma, Gymnodinium catenatum, Gymnodinium impudicum, Heterocapsa rotundata, Heterocapsa triquetra, Lingulodinium polyedrum, Prorocentrum donghaiense, P. micans, Prorocentrum minimum, Prorocentrum triestinum, and Scrippsiella trochoidea) were able to ingest S. costatum. When mean prey concentrations were 170-260 ng C/ml (i.e. 6,500-10,000 cells/ml), the ingestion rates of G. polygramma, H. rotundata, H. triquetra, L. polyedrum, P. donghaiense, P. micans, and P. triestinum on S. costatum (0.007-0.081 ng C/dinoflagellate/d [0.2-3.0 cells/dinoflagellate/d]) were positively correlated with predator size. With increasing mean prey concentration of ca 1-3,440 ng C/ml (40-132,200 cells/ml), the ingestion rates of P. micans and G. polygramma on S. costatum continuously increased. At the given prey concentrations, the maximum ingestion

  16. Acoustic detection of Rhynchophorus ferrugineus (Coleoptera: Dryophthoridae) and Oryctes elegans (Coleoptera: Scarabaeidae) in Phoenix dactylifera (Arecales: Arecacae) trees and offshoots in Saudi Arabian orchards

    Science.gov (United States)

    Rhynchophorus ferrugineus (Olivier) (Coleoptera: Dryophthoridae) larvae are cryptic, internal-tissue feeding pests of palm trees that are difficult to detect until after they have caused severe economic damage; consequently, infestations may remain undetected until they are widespread in an orchard....

  17. First record of Molorchus minor minor (Linnaeus (Coleoptera, Cerambycidae in Brazil

    Directory of Open Access Journals (Sweden)

    Ubirajara R. Martins

    2015-03-01

    Full Text Available Molorchus minor minor (Linnaeus (Coleoptera, Cerambycidae is recorded for the first time in Brazil (Bahia. It was originally described from Europe and is currently widely distributed in that continent and Asia.

  18. Changing distributions of Cantharidae and Buprestidae within Great Britain (Coleoptera)

    NARCIS (Netherlands)

    Alexander, K.

    2003-01-01

    Changing distributions of Cantharidae and Buprestidae within Great Britain (Coleoptera) Data are presented on the distribution of selected species from two coleopteran families chosen to represent a random slice of the British fauna. The species have been chosen as exhibiting extremes of range

  19. Análise faunística de coleópteros em sistema silvipastoril

    Directory of Open Access Journals (Sweden)

    Alexander Machado Auad

    2011-01-01

    Full Text Available The aim of this study was to conduct a survey of beetles (Coleoptera in a silvopastoral system, estimating constancy, abundance, richness, diversity of families and seasonality, from July 2006 to June 2008. The study was carried out at the Embrapa Dairy Cattle station, in Coronel Pacheco, Minas Gerais, Brazil. The beetles were collected in Malaise traps, fortnightly, and taken to the laboratory for analysis. A total of 26 families, 294 morphospecies and 1,606 specimens were found. The Elateridae, Mordellidae, Chrysomelidae, Coccinellidae and Curculionidae families were the most abundant, rich and diverse. The Scarabaeidae and Scolytidae families were also among the most abundant, and the Cerambycidae family was among the richest, while the Bruchidae and Carabidae families presented high diversity. The largest number of individuals and morphospecies sampled occurred during the period of rain. November 2007 presented the most (n = 535 specimens captures of any month, followed by October 2006, September 2007, March and April of 2008.

  20. Pheromones in White Pine Cone Beetle, Conophthorus coniperdu (Schwarz) (Coleoptera: Scolytidae)

    Science.gov (United States)

    Goran Birgersson; Gary L. DeBarr; Peter de Groot; Mark J. Dalusky; Harold D. Pierce; John H. Borden; Holger Meyer; Wittko Francke; Karl E. Espelie; C. Wayne Berisford

    1995-01-01

    Female white pine cone beetles, Conophrhorus coniperda, attacking second-year cones of eastern white pine, Pinus strobus L., produced a sex-specific pheromone that attracted conspecific males in laboratory bioassays and to field traps. Beetle response was enhanced by host monoterpenes. The female-produced compound was identified in...

  1. Soil and saproxylic species (Coleoptera, Collembola, Araneae in primeval forests from the Northern part of South-Easthern Carpathians

    Directory of Open Access Journals (Sweden)

    Eugen Nițu

    2009-12-01

    Full Text Available In 2006-2007 we carried out faunal investigations in the vernal, estival and autumnal seasons in the scientific reserve "Codrul Secular Giumalău" using quantitative sampling methods. We identified 189 species of Coleoptera, 70 of Collembola and 20 of Araneae. Of these, 11 phytophagous, 18 myceto/xylo-mycetophagous, 9 mixophagous, 18 xylo- and cambio-xylemophagous, 38 saproxylophagous, 125 (55 Coleoptera, 70 Collembola detritivorous (sapro-, copro- and necrophagous, 60 (40 Coleoptera, 20 Aranea predators/parasitoids. Hymenaphorura polonica Pomorski, 1990 (Collembola, and Leiodes rhaeticus Erichson, 1845 (Coleoptera, Leiodidae, are recorded for the first time in the Romanian fauna. The rare species and characteristic species for the old primeval spruce forests are analysed for each studied taxonomic group. The species richness and faunal diversity from the Giumalău primeval spruce forest are compared with those of other very well preserved forests from the Carpathians scientific reserves (Codrul Secular Slătioara, Pietrosul Rodnei. The species abundances were used to compute the similarity indexes between the sampled sectors of forest and to perform Cluster Analysis. We observed that the dead wood in the 2nd-6th phases of decomposition has a great influence not only on the saproxylic species but also on the soil fauna like ground beetles (Carabidae that use the logs as ecologic microrefuges (winter refugees or diurnal refugees. The structure of the soil fauna is influenced by wood extraction from the forest ecosystem or by natural perturbations, this consisting in the appearance of opportunistic species as Orchesella pontica (Collembola and in decreasing of species richness of Carabidae (Coleoptera.

  2. Soil and saproxylic species (Coleoptera, Collembola, Araneae in primeval forests from the northern part of South-Easthern Carpathians

    Directory of Open Access Journals (Sweden)

    Eugen Nitu

    2009-11-01

    Full Text Available In 2006-2007 we carried out faunal investigations in the vernal, estival and autumnal seasons in the scientific reserve "Codrul Secular Giumalãu" using quantitative sampling methods. We identified 189 species of Coleoptera, 70 of Collembola and 20 of Araneae. Of these, 11 phytophagous, 18 myceto/xylo-mycetophagous,9 mixophagous, 18 xylo- and cambio-xylemophagous, 38 saproxylophagous,125 (55 Coleoptera, 70 Collembola detritivorous (sapro-, copro- andnecrophagous, 60 (40 Coleoptera, 20 Aranea predators/parasitoids. Hymenaphorura polonica Pomorski, 1990 (Collembola, and Leiodes rhaeticus Erichson, 1845 (Coleoptera, Leiodidae, are recorded for the first time in the Romanian fauna. The rare species and characteristic species for the old primeval spruce forests are analysed for each studied taxonomic group. The species richness and faunal diversity from the Giumalãu primeval spruce forest are compared with those of other very well preserved forests from the Carpathians scientific reserves (Codrul Secular Slãtioara,Pietrosul Rodnei. The species abundances were used to compute the similarity indexes between the sampled sectors of forest and to perform Cluster Analysis. We observed that the dead wood in the 2nd-6th phases of decomposition has a great influence not only on the saproxylic species but also on the soil fauna like ground beetles(Carabidae that use the logs as ecologic microrefuges (winter refugees or diurnal refugees. The structure of the soil fauna is influenced by wood extraction from the forest ecosystem or by natural perturbations, this consisting in the appearance of opportunistic species as Orchesella pontica (Collembola and in decreasing ofspecies richness of Carabidae (Coleoptera.

  3. Attractant and disruptant semiochemicals for Dendroctonus jeffreyi (Coleoptera: Curculionidae: Scolytinae)

    Science.gov (United States)

    Brian Strom; Smith S.L.; Brownie C.

    2013-01-01

    Jeffrey pine, Pinus jeffreyi Greville and Balfour, is a dominant yellow pine and important overstory component of forests growing on diverse sites from southwestern Oregon to Baja California to western Nevada. The Jeffrey pine beetle, Dedroctonus jeffreyi Hopkins (Coleoptera: Curculionidae: Scolytinae), is monophagous on Jeffrey...

  4. Diversity of forensic rove beetles (Coleoptera, Staphylinidae) associated with decaying pig carcass in a forest biotope.

    Science.gov (United States)

    Dekeirsschieter, Jessica; Frederick, Christine; Verheggen, Francois J; Drugmand, Didier; Haubruge, Eric

    2013-07-01

    Most forensic studies are focused on Diptera pattern colonization while neglecting Coleoptera succession. So far, little information is available on the postmortem colonization by beetles and the decomposition process they initiate under temperate biogeoclimatic countries. These beetles have, however, been referred to as being part of the entomofaunal colonization of a dead body. Forensic entomologists need increased databases detailing the distribution, ecology, and phenology of necrophagous insects, including staphylinids (Coleoptera, Staphylinidae). While pig carcasses are commonly used in forensic entomology studies to surrogate human decomposition and to investigate the entomofaunal succession, very few works have been conducted in Europe on large carcasses. Our work reports the monitoring of the presence of adult rove beetles (Coleoptera, Staphylinidae) on decaying pig carcasses in a forest biotope during four seasons (spring, summer, fall, and winter). A total of 23 genera comprising 60 species of rove beetles were collected from pig carcasses. © 2013 American Academy of Forensic Sciences.

  5. Molecular Markers Detect Cryptic Predation on Coffee Berry Borer (Coleoptera: Curculionidae) by Silvanid and Laemophloeid Flat Bark Beetles (Coleoptera: Silvanidae, Laemophloeidae) in Coffee Beans.

    Science.gov (United States)

    Sim, Sheina B; Yoneishi, Nicole M; Brill, Eva; Geib, Scott M; Follett, Peter A

    2016-02-01

    The coffee berry borer, Hypothenemus hampei (Ferrari) (Coleoptera: Curculionidae), is a serious pest of coffee worldwide. It was first detected in Hawai'i in 2010. Two predatory beetles, Cathartus quadricollis (Coleoptera: Silvanidae) and Leptophloeus sp. (Coleoptera: Laemophloeidae), have been observed in H. hampei-infested coffee. Under laboratory conditions, colony-reared C. quadricollis and Leptophloeus sp. prey upon all life stages of H. hampei. However, the H. hampei life cycle occurs almost exclusively within a coffee bean obscured from direct observation. Thus, it is unknown if C. quadricollis and Leptophloeus sp. consume H. hampei as prey in the wild. To demonstrate predation of H. hampei by C. quadricollis and Leptophloeus sp., a molecular assay was developed utilizing species-specific primers targeting short regions of the mitochondrial COI gene to determine species presence. Using these primers, wild C. quadricollis and Leptophloeus sp. were collected and screened for the presence of H. hampei DNA using PCR. Analysis of collections from five coffee farms revealed predation of C. quadricollis and Leptophloeus sp. on H. hampei. Further laboratory testing showed that H. hampei DNA could be detected in predators for as long as 48 h after feeding, indicating the farm-caught predators had preyed on H. hampei within 2 d of sampling. This study demonstrates the utility of molecular markers for the study of the ecology of predators and prey with cryptic behavior, and suggests C. quadricollis and Leptophloeus sp. might be useful biocontrol agents against H. hampei. Published by Oxford University Press on behalf of Entomological Society of America 2015. This work is written by US Government employees and is in the public domain in the US.

  6. Using Malaise traps to sample ground beetles (Coleoptera: Carabidae)

    Science.gov (United States)

    Michael D. Ulyshen; James L. Hanula; Scott Horn

    2005-01-01

    Pitfall traps provide an easy and inexpensive way to sample ground-dwelling arthropods (Spence and Niemela 1994; Spence et al. 1997; Abildsnes and Tommeras 2000) and have been used exclusively in many studies of the abundance and diversity of ground beetles (Coleoptera: Carabidae). Despite the popularity of this trapping technique, pitfall traps have many disadvantages...

  7. Distribution and habitat of Graphoderus bilineatus in the Netherlands (Coleoptera: Dytiscidae).

    NARCIS (Netherlands)

    Cuppen, J.G.M.; Koese, B.; Sierdsema, H.

    2006-01-01

    Verspreiding en biotopen van Graphoderus bilineatus (Coleoptera: Dytiscidae) De verspreiding en biotopen van de gestreepte waterroofkever Graphoderus bilineatus zijn in 2004 en 2005 onderzocht in opdracht van de provincie Zuid-Holland en het Ministerie van lnv. Deze waterroofkever is wettelijk

  8. The Peritelini (Coleoptera: Curculionidae, Entiminae of the Vitale collection

    Directory of Open Access Journals (Sweden)

    Cosimo Baviera

    2016-01-01

    Full Text Available The collection of Peritelini (Coleoptera Curculionidae Entiminae currently stored in the Vitale collection of Messina University is an element of great importance for studies of taxonomy and biogeography of these rarely collected weevils. All species are commented in relation to the contributions to this taxonomic group, published on several occasions by the authors.

  9. Immatures of Acanthocinini (Coleoptera, Cerambycidae, Lamiinae

    Directory of Open Access Journals (Sweden)

    Sônia A. Casari

    2014-06-01

    Full Text Available Immatures of Acanthocinini (Coleoptera, Cerambycidae, Lamiinae. Larva and pupa of Eutrypanus dorsalis (Germar, 1928, collected in trunks of Pinus elliottii Engelm., and Paratenthras martinsi Monné, 1998, collected in spathes of Scheelea phalerata (Mart. ex Spreng. Burret, are described and illustrated. Larva and pupa of Lophopoeum timbouvae Lameere, 1884, collected in Hymenaea corbaril L., Enterolobium contortisiliquum (Vell. Morong and Pterogyne nitens Tul., are redescribed and illustrated. A table with all described immatures of Lamiinae, and a comparison among the immatures of Acanthocinini are presented. Biological notes and new records are also included.

  10. Morphometric analysis of instar variation in Tenebrio molitor (Coleoptera: Tenebrionidae)

    Science.gov (United States)

    Measurements of head capsule, mandible, metanotum, and body weight were done on larvae of Tenebrio molitor L. (Coleoptera: Tenebrionide) from the second to the last instar. Instar number varied from 14 to 18, but 15 or 16 instars were the most common. The value of dimensional measurements was evalua...

  11. Review of the genus Ceresium Newman, 1842 (Coleoptera: Cerambycidae) in Fiji

    Science.gov (United States)

    A taxonomic review of the genus Ceresium (Coleoptera: Cerambycidae) found within the Fiji Islands is presented. A total of 17 species is treated. Full morphological descriptions and comparative images of each species are included, along with a dichotomous key for their identification....

  12. Bioacoustics of Acanthoscelides obtectus (Coleoptera: Chrysomelidae: Bruchinae) on Phaseolus vulgaris (Fabaceae)

    Science.gov (United States)

    Acanthoscelides obtectus (Say) (Coleoptera: Chrysomelidae), is an economically important pest of common bean Phaseolus vulgaris L. (Fabaceae) in the tropics and subtropics. It is difficult to detect the presence of A. obtectus because the larvae are cryptic and spend most of their developmental time...

  13. Review of the genus Ceresium Newman, 1842 (Coleoptera, Cerambycidae) in Fiji

    Science.gov (United States)

    Waqa-Sakiti, Hilda; Winder, Linton; Lingafelter, Steven W.

    2015-01-01

    Abstract A taxonomic review of the genus Ceresium (Coleoptera: Cerambycidae) found within the Fiji Islands is presented. A total of 17 species is treated. Full morphological descriptions and comparative images of each species are included, along with a dichotomous key for their identification. PMID:26692805

  14. Flight propensty of Anoplophora glabripennis, an Asian longhorned beetle (Coleoptera: Cerambycidae)

    Science.gov (United States)

    J. A. Francese; B. Wang; D. R. Lance; Z. Xu; S. Zong; Y. Luo; A. J. Sawyer; V. C. Mastro

    2003-01-01

    Anoplophora glabripennis (Coleoptera: Cerambycidae) (Motschulsky), is a recently introduced pest of hardwoods. Research to study its flight behavior was conducted in the field in Ningxia Autonomous Region, Peoples' Republic of China. To study the flight propensity of A. glabripennis, adult beetles were observed in population...

  15. A predictive distribution model for Graphoderus bilineatus in the Netherlands (Coleoptera: Dytiscidae).

    NARCIS (Netherlands)

    Sierdsema, H.; Cuppen, J.G.M.

    2006-01-01

    Een voorspellend verspreidingsmodel voor de gestreepte waterroofkever Graphoderus bilineatus in Nederland (Coleoptera: Dytiscidae) Op verzoek van de Provincie Zuid-Holland en het Ministerie van lnv is het huidige voorkomen en de biotoopvoorkeur van de gestreepte waterroofkever Graphoderus bilineatus

  16. Aggregation pheromone compounds of the black larder beetle Dermestes haemorrhoidalis Kuster (Coleoptera: Dermestidae)

    NARCIS (Netherlands)

    Korada, R.R.; Griepink, F.C.

    2011-01-01

    Gas chromatography with simultaneous flame ionisation and electroantennographic detection (GCEAD) and gas chromatography with mass spectrometry analysis (GCMS) of abdominal extracts of adult male Dermestes haemorrhoidalis Kuster (Coleoptera: Dermestidae) revealed the presence of

  17. Characterization of an Aggregation Pheromone in Hylesinus pruinosus (Coleoptera: Curculionidae: Scolytinae)

    Science.gov (United States)

    William Shepherd; Brian Sullivan; Bradley Hoosier; JoAnne Barrett; Tessa Bauman

    2010-01-01

    We conducted laboratory and field bioassays to characterize the pheromone system of an ash bark beetle, Hylesinus pruinosus Eichhoff (Coleoptera: Curculionidae: Scolytinae). Solitary females in newly initiated galleries in ash logs produced (+)-exo-brevicomin, whereas male beetles paired with females produced (+)-endo-brevicomin, lesser quantities of...

  18. 1825 (Coleoptera: Cerambycidae

    Directory of Open Access Journals (Sweden)

    Márcia d´Avila

    2006-01-01

    Full Text Available The erva-mate (Ilex paraguariensis A.St.-Hil. has a social, cultural and economic importance in the southern states of Brazil. The pure stands of this culture was responsible for the increase of many species of insects. Hedypathes betulinus (Klug, 1825 (Coleoptera: Cerambycidae is considered the main pest from an economic viewpoint because of its difficult control and potential for damage. The larval phase occurs inside the twings and trunks, what makes more difficult to deal with its detention and management. Cultural and mechanical management are the most indicated, such as collection of adults, prunning and burning of plant parts damaged by the insect, balanced nutrition, adequate plant density and maintenance of areas with native vegetation or also the introduction of policulture. These strategies may increase the agroecossystem balance and thus a reduction of the insect-pest to an aceptable level. Therefore, the objective of this study was to assemble and the discuss the information on the bioecology and management of erva-mate borer.

  19. Repeated losses of TTAGG telomere repeats in evolution of beetles (Coleoptera)

    Czech Academy of Sciences Publication Activity Database

    Frydrychová, Radmila; Marec, František

    2002-01-01

    Roč. 115, - (2002), s. 179-187 ISSN 0016-6707 R&D Projects: GA ČR GA206/00/0750; GA AV ČR KSK5052113 Institutional research plan: CEZ:AV0Z5007907 Keywords : chromosomes * Coleoptera * phylogeny Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 1.063, year: 2002

  20. Susceptibility of Agrilus planipennis (Coleoptera: Buprestidae) to Beauveria bassiana and Metarhizium anisopliae

    Science.gov (United States)

    Houping Lui; Leah S. Bauer

    2006-01-01

    The susceptibility of Agrilus planipennis Fairmaire (Coleoptera: Buprestidae) to selected strains of the entomopathogenic fungi Beauveria bassiana (Balsamo) Vuillemin and Metarhizium anisopliae (Metschnikoff) Sorokin was evaluated through bioassays with direct immersion or foliar exposure under laboratory conditions. Results showed that A. planipennis adults were...

  1. New species of Scolytodes (Coleoptera: Scolytidae from Costa Rica and Panamá

    Directory of Open Access Journals (Sweden)

    Bjarte H. Jordal

    1998-06-01

    Full Text Available Seven species of Scolytodes (tribe Ctenophorini are described as new to science: S. concavus and S. circumsetosus (from Ficus branches, La Selva, S. montanus (Monteverde, S. nudifrons (Las Cruces near San Vito, and S. triangulus (fogging sample, La Selva, all from Costa Rica, and S. ungulatus (Cerro Punta and S. punctifrons (from Astronium graveolens, Canal Zone, both from Panama. New distributional and host plant data are given for the following species: S. amoenus (Ficus branch, La Selva, and the first record south of Mexico, S. immanis (Cerro de La Muerte, S. impressus (Xylopia branch, Peninsula de Osa, S. ochromae (Ochroma branch, La Selva, S. piceus (fogging sample, La Selva, the first low altitude record, and S. swieteniae (fogging sample, La Selva and Braulio Carrillo, the first exact locality data, all from Costa Rica, and S. nanellus (Barro Colorado Island from Panama.

  2. Emergence of Buprestidae, Cerambycidae, and Scolytinae (Coleoptera) from mountain pine beetle-killed and fire-killed ponderosa pines in the Black Hills, South Dakota, USA

    Science.gov (United States)

    Sheryl L. Costello; William R. Jacobi; Jose F. Negron

    2013-01-01

    Wood borers (Coleoptera: Cerambycidae and Buprestidae) and bark beetles (Coleoptera: Curculionidae) infest ponderosa pines, Pinus ponderosa P. Lawson and C. Lawson, killed by mountain pine beetle (MPB), Dendroctonus ponderosae Hopkins, and fire. No data is available comparing wood borer and bark beetle densities or species guilds associated with MPB-killed or fire-...

  3. Peculiarities of the imago Coleoptera (Insecta groups overwintering in various substrata of the Reserve «Galichya Gora»

    Directory of Open Access Journals (Sweden)

    Mikhail N. Tsurikov

    2016-05-01

    Full Text Available During the 1997–2006 and 2010–2011winter seasons, in the area of Morozova Gora (the nature reserve "Galichya Gora", in Russia, 1200 samples of various substrata were taken, most of which were 4500 cm3 in volume. In total, 41,854 specimens of 690 species belonging to 52 Coleoptera families were registered at overwintering sites. The analysis of the peculiarities of imago Coleoptera groups in the major winter habitats showed that in most of the investigated substrata representatives of the Staphylinidae family prevailed both in terms of species diversity and number. It is only under the bark of trees and in deadwood that Carabidae are the most numerous, whereas Latridiidae are prevalent in tinder fungi. Turf has the maximal species saturation during the winter season (the highest percentage of species referring to 18 families was registered here, as well as plant litter (10 families, with turf being the preference of 8 families richest in species diversity. The imagos of a number of families relatively rich in species – Cantharidae, Malachiidae, Melandryidae, Mordellidae, Oedemeridae, Meloidae, Scraptiidae and Anthribidae – were not found at overwintering sites, which is explained by the preimaginal overwintering of most representatives of the abovementioned families. It was shown that in substrata which are the least suitable for the overwintering of the imago of most Coleoptera species, the highest percentage of the predominant species was registered since more accessible substrata are used as overwintering sites by the same species from different habitats, which decreases the concentration of imago beetles of certain species there. A study of the peculiarities of species distribution (with no less than 30 specimens among overwintering sites showed that the largest number of stenotopic species was registered in droppings (9 species. Then follow the substrata (in decreasing order: turf (5, hay (grass sward, haymow, meadow (4, decomposing

  4. Papel dos besouros (Insecta, Coleoptera na Entomologia Forense

    Directory of Open Access Journals (Sweden)

    Wellington Emanuel dos Santos

    2014-12-01

    Full Text Available Esse trabalho apresenta uma revisão do papel que os besouros (Insecta, Coleoptera desempenham na Entomologia Forense. Discussões sobre ocorrência em cadáveres humanos e carcaças animais, estimativas de Intervalo Pós-Morte (IPM, estudos realizados no Brasil e em outros países, principais famílias de importância forense e aspectos biológicos, ecológicos e biogeográficos das espécies são apresentadas.

  5. Los coleópteros y heterópteros acuáticos del Parque Nacional Calilegua (Provincia de Jujuy, Argentina Aquatic Coleoptera and Heteroptera from Calilegua National Park (Jujuy Province, Argentina

    Directory of Open Access Journals (Sweden)

    Patricia L. M. Torres

    2008-06-01

    Full Text Available Se expone una lista de las especies de Coleoptera y Heteroptera presentes en los cuerpos de agua del Parque Nacional Calilegua. Se registraron 51 especies de Coleoptera incluidas en 28 géneros y cinco familias, y 37 especies de Heteroptera distribuidas en 22 géneros y 10 familias; sólo cuatro especies de Coleoptera y cinco de Heteroptera fueron citadas previamente del parque. Se mencionan por primera vez para la Argentina dos especies de Veliidae (Heteroptera: Rhagovelia trista Gould y Platyvelia brachialis (Stål, así como una especie y un género de Dytiscidae (Coleoptera: Desmopachria chei K. B. Miller y Bidessonotus Régimbart. Además, es la primera ocasión en que se mencionan para la provincia de Jujuy 24 especies y 11 géneros de Coleoptera (Leuronectes Sharp, Bidessonotus, Hypodessus Guignot, Desmopachria Babington, Celina Aubé, Gyrinus Linné, Haliplus Latreille, Hydrocanthus Say, Suphis Aubé, Anacaena Thomson, Derallus Sharp y 19 especies y 12 géneros de Heteroptera (Mesovelia Mulsant & Rey, Hebrus Curtis, Merragata White, Microvelia Westwood, Rhagovelia Mayr, Platyvelia J. T. Polhemus & D. A. Polhemus, Limnogonus Stål, Curicta Stål, Ranatra Fabricius, Centrocorisa Lundblad, Pelocoris Stål, Neoplea Esaki & China.A list of the species of aquatic Coleoptera and Heteroptera occurring in Calilegua National Park is presented. Fifty-one species of Coleoptera included in 28 genera and five families, and 37 species of Heteroptera belonging to 22 genera and 10 families were recorded. Only four species of Coleoptera and five of Heteroptera had been previously cited from the park. Two species of Veliidae (Heteroptera (Rhagovelia trista Gould, Platyvelia brachialis (Stål, along with one species and one genus of Dytiscidae (Coleoptera (Desmopachria chei K. B. Miller, Bidessonotus Régimbart are new records for Argentina. Twenty-four species and 11 genera of Coleoptera (Leuronectes Sharp, Bidessonotus, Hypodessus Guignot, Desmopachria

  6. Behavioral assays for evaluating host preferences of Euwallacea nr. fornicatus (Coleoptera: Curculionidae: Scolytinae).

    Science.gov (United States)

    In 2010, the exotic ambrosia beetle, Euwallacea nr. fornicatus Eichhoff (Coleoptera: Curculionidae: Scolytinae) was first discovered in Florida avocado groves. Introduction of its symbiotic Fusarium spp. fungi into galleries in the xylem tissue results in Fusarium-dieback disease. Unlike most ambros...

  7. Canuschiza of Socotra Island (Coleoptera: Scarabaeidae: Melolonthinae). Part 2. Canuschiza minuta species group

    Czech Academy of Sciences Publication Activity Database

    Sehnal, R.; Král, D.; Bezděk, Aleš

    2017-01-01

    Roč. 57, č. 3 (2017), s. 77-86 ISSN 0374-1036 Institutional support: RVO:60077344 Keywords : Coleoptera * Scarabaeoidea * Scarabaeidae Subject RIV: EG - Zoology OBOR OECD: Zoology Impact factor: 0.632, year: 2016 https://www.biotaxa.org/AEMNP/article/view/35052

  8. Study on the genus Daptus ground-beetles (Coleoptera: Carabidae from Korea

    Directory of Open Access Journals (Sweden)

    Ik Je Choi

    2016-03-01

    Full Text Available A genus Daptus Fischer von Waldheim, 1823 of the tribe Harpalini Bonelli, 1810 (Coleoptera: Carabidae is reported for the first time from Korea, based on the Daptus vittatus Fischer von Waldheim from Incheon, Korea. Redescription of the species and illustrations of diagnostic characteristics, including genitalia characteristics of both sexes, are provided.

  9. Scymnus camptodromus (Coleoptera: Coccinellidae) larval development and predation of hemlock woolly adelgid (Hemiptera: Adelgidae)

    Science.gov (United States)

    Samita Limbu; Melody A. Keena; David Long; Nancy Ostiguy; Kelli. Hoover

    2015-01-01

    Development time and prey consumption of Scymnus (Neopullus) camptodromus Yu and Liu (Coleoptera: Coccinellidae) larvae by instar, strain, and temperature were evaluated. S. camptodromus, a specialist predator of hemlock woolly adelgid Adelges tsugae (Annand) (Hemiptera:...

  10. Rove beetles of medical importance in Brazil (Coleoptera, Staphylinidae, Paederinae

    Directory of Open Access Journals (Sweden)

    Juliana S. Vieira

    2014-09-01

    Full Text Available Rove beetles of medical importance in Brazil (Coleoptera, Staphylinidae, Paederinae. The rove beetles of the genus Paederus Fabricius, 1775 are the most important group within Coleoptera causing dermatitis around the world. The medical importance of Paederus depends on its toxic hemolymph released when these beetles are crushed on human skin. The effects are mainly dermatitis linearis and some sporadic cases of conjunctivitis. In Brazil seven species of Paederus are known to cause dermatitis: P. amazonicus Sharp, 1876, P. brasiliensis Erichson, 1840, P. columbinus Laporte, 1835, P. ferus Erichson, 1840, P. mutans Sharp, 1876, P. protensus Sharp, 1876 stat. rev., and Paederus rutilicornis Erichson, 1840. Paederus mutans and P. protensus are for the first time recorded as of medical importance, whereas the record of P. rutilicornis in Brazil is doubtful. All seven species are redescribed and a dichotomous key is provided. The geographic distributions of all species are documented. The results provided here include the most recent and relevant taxonomic revision of Paederus of the Neotropical region, the first identification key for Brazilian species and the increase of recorded species of medical importance in the world.

  11. ESCARABAJOS TIGRE (COLEOPTERA: CICINDELIDAE DEL MUSEO ENTOMOLÓGICO FRANCISCO LUÍS GALLEGO: NUEVOS REGISTROS PARA DEPARTAMENTOS DE COLOMBIA TIGER BEETLES (COLEOPTERA: CICINDELIDAE AT THE ENTOMOLOGICAL MUSEUM FRANCISCO LUÍS GALLEGO: NEW RECORDS

    Directory of Open Access Journals (Sweden)

    Manuel Alejandro Ramírez Mora

    2008-06-01

    Full Text Available Se registran por primera vez las especies de escarabajos tigre (Coleoptera: Cicindelidae presentes en el Museo Entomológico Francisco Luis Gallego (MEFLG. Se identificaron 167 especimenes distribuidos en ocho géneros y 27 especies, se reportan 24 nuevos registros para diferentes departamentos de Colombia. Se señalan aspectos importantes de la taxonomía y sistemática del grupo. Además, se presentan comentarios biológicos y de distribución de las especies.Tiger beetles (Coleoptera: Cicindelidae species at the Museo Entomológico Francisco Luis Gallego (MEFLG are registered by first time. 167 specimens in 8 genus and 27 species were identified, 24 new records for different Colombian states are reported. Some important aspects of the group’s taxonomy and systematic are pointed. Additionally, species’ biological and distributional comments are presented.

  12. A systematic revision of Baconia Lewis (Coleoptera, Histeridae, Exosternini

    Directory of Open Access Journals (Sweden)

    Michael Caterino

    2013-10-01

    . angusta Schmidt, 1893a, B. incognita sp. n., B. guartela sp. n., B. bullifrons sp. n., B. cavei sp. n., B. subtilis sp. n., B. dentipes sp. n., B. rubripennis sp. n., B. lunatifrons sp. n.], B. aeneomicans group [B. aeneomicans (Horn, 1873, B. pulchella sp. n., B. quercea sp. n., B. stephani sp. n., B. irinae sp. n., B. fornix sp. n., B. slipinskii Mazur, 1981, B. submetallica sp. n., B. diminua sp. n., B. rufescens sp. n., B. punctiventer sp. n., B. aulaea sp. n., B. mustax sp. n., B. plebeia sp. n., B. castanea sp. n., B. lescheni sp. n., B. oblonga sp. n., B. animata sp. n., B. teredina sp. n., B. chujoi (Cooman, 1941, B. barbarus (Cooman, 1934, B. reposita sp. n., B. kubani sp. n., B. wallacea sp. n., B. bigemina sp. n., B. adebratti sp. n., B. silvestris sp. n.], B. cylindrica group [B. cylindrica sp. n., B. chatzimanolisi sp. n.], B. gibbifer group [B. gibbifer sp. n., B. piluliformis sp. n., B. maquipucunae sp. n., B. tenuipes sp. n., B. tuberculifer sp. n., B. globosa sp. n.], B. insolita group [B. insolita (Schmidt, 1893a, comb. n., B. burmeisteri (Marseul, 1870, B. tricolor sp. n., B. pilicauda sp. n.], B. riouka group [B. riouka (Marseul, 1861, B. azuripennis sp. n.], B. famelica group [B. famelica sp. n., B. grossii sp. n., B. redemptor sp. n., B. fortis sp. n., B. longipes sp. n., B. katieae sp. n., B. cavifrons (Lewis, 1893, comb. n., B. haeterioides sp. n.], B. micans group [B. micans (Schmidt, 1889a, B. carinifrons sp. n., B. fulgida (Schmidt, 1889c], Baconia incertae sedis [B. chilense (Redtenbacher, 1867, B. glauca (Marseul, 1884, B. coerulea (Bickhardt, 1917, B. angulifrons sp. n., B. sanguinea sp. n., B. viridimicans (Schmidt, 1893b, B. nayarita sp. n., B. viridis sp. n., B. purpurata sp. n., B. aenea sp. n., B. clemens sp. n., B. leivasi sp. n., B. atricolor sp. n.]. We designate lectotypes for the following species: Baconia loricata Lewis, 1885, Phelister gounellei Marseul, 1887, Baconia jubaris Lewis, 1901, Baconia festiva Lewis, 1891, Platysoma

  13. A systematic revision of Baconia Lewis (Coleoptera, Histeridae, Exosternini).

    Science.gov (United States)

    Caterino, Michael S; Tishechkin, Alexey K

    2013-01-01

    turgifrons sp. n., Baconia crassa sp. n., Baconia anthracina sp. n., Baconia emarginata sp. n., Baconia obsoleta sp. n.], Baconia ruficauda group [Baconia ruficauda sp. n., Baconia repens sp. n.], Baconia angusta group [Baconia angusta Schmidt, 1893a, Baconia incognita sp. n., Baconia guartela sp. n., Baconia bullifrons sp. n., Baconia cavei sp. n., Baconia subtilis sp. n., Baconia dentipes sp. n., Baconia rubripennis sp. n., Baconia lunatifrons sp. n.], Baconia aeneomicans group [Baconia aeneomicans (Horn, 1873), Baconia pulchella sp. n., Baconia quercea sp. n., Baconia stephani sp. n., Baconia irinae sp. n., Baconia fornix sp. n., Baconia slipinskii Mazur, 1981, Baconia submetallica sp. n., Baconia diminua sp. n., Baconia rufescens sp. n., Baconia punctiventer sp. n., Baconia aulaea sp. n., Baconia mustax sp. n., Baconia plebeia sp. n., Baconia castanea sp. n., Baconia lescheni sp. n., Baconia oblonga sp. n., Baconia animata sp. n., Baconia teredina sp. n., Baconia chujoi (Cooman, 1941), Baconia barbarus (Cooman, 1934), Baconia reposita sp. n., Baconia kubani sp. n., Baconia wallacea sp. n., Baconia bigemina sp. n., Baconia adebratti sp. n., Baconia silvestris sp. n.], Baconia cylindrica group [Baconia cylindrica sp. n., Baconia chatzimanolisi sp. n.], Baconia gibbifer group [Baconia gibbifer sp. n., B. piluliformis sp. n., Baconia maquipucunae sp. n., Baconia tenuipes sp. n., Baconia tuberculifer sp. n., Baconia globosa sp. n.], Baconia insolita group [Baconia insolita (Schmidt, 1893a), comb. n., Baconia burmeisteri (Marseul, 1870), Baconia tricolor sp. n., Baconia pilicauda sp. n.], Baconia riouka group [Baconia riouka (Marseul, 1861), Baconia azuripennis sp. n.], Baconia famelica group [Baconia famelica sp. n., Baconia grossii sp. n., Baconia redemptor sp. n., Baconia fortis sp. n., Baconia longipes sp. n., Baconia katieae sp. n., Baconia cavifrons (Lewis, 1893), comb. n., Baconia haeterioides sp. n.], Baconia micans group [Baconia micans (Schmidt, 1889a), Baconia

  14. Temperature influences on diapause induction and survival in the boll weevil (Coleoptera: Curculionidae)

    Science.gov (United States)

    The boll weevil, Anthonomus grandis grandis Boheman (Coleoptera: Curculionidae), has been the most important pest of cotton (Gossypium spp.) wherever it occurs. Although eradication programs in the U.S. have reduced the range of this pest, the weevil remains an intractable problem in subtropical Tex...

  15. Two new fossil species of Cryptocephalus Geoffroy (Coleoptera: Chrysomelidae) from Baltic and Dominican Amber

    Science.gov (United States)

    Two new species of Cryptocephalus Geoffroy (Coleoptera: Chrysomelidae) are described and illustrated from fossil resin: Cryptocephalus groehni sp. nov (Baltic amber) and Cryptocephalus kheelorum sp. nov. (Dominican amber). These are the first described species of Cryptocephalinae from fossil resin. ...

  16. Plant compounds insecticide activity against Coleoptera pests of stored products

    OpenAIRE

    MOREIRA, M.D.; PICANÇO, M.C.; BARBOSA, L.C. de A.; GUEDES, R.N.C.; CAMPOS, M.R. de; SILVA, G.A.; MARTINS, J.C.

    2008-01-01

    The objective of this work was to screen plants with insecticide activity, in order to isolate, identify and assess the bioactivity of insecticide compounds present in these plants, against Coleoptera pests of stored products: Oryzaephilus surinamensis L. (Silvanidae), Rhyzopertha dominica F. (Bostrichidae) and Sitophilus zeamais Mots. (Curculionidae). The plant species used were: basil (Ocimum selloi Benth.), rue (Ruta graveolens L.), lion's ear (Leonotis nepetifolia (L.) R.Br.), jimson weed...

  17. Stomanomala subcostata (Coleoptera: Scarabaeidae), the first record of ruteline chafer from Socotra Archipelago, Yemen

    Czech Academy of Sciences Publication Activity Database

    Bezděk, Aleš; Král, D.; Limbourg, P.

    2017-01-01

    Roč. 57, č. 3 (2017), s. 87-91 ISSN 0374-1036 Institutional support: RVO:60077344 Keywords : Coleoptera * Scarabaeidae * Rutelinae Subject RIV: EG - Zoology OBOR OECD: Zoology Impact factor: 0.632, year: 2016 https://www.biotaxa.org/AEMNP/article/view/35053

  18. Entomofauna Associada a Galhos de Acacia mangium Willd. Roletados por Oncideres saga (Dalman (Coleoptera: Cerambycidae

    Directory of Open Access Journals (Sweden)

    Gláucia Cordeiro

    2010-04-01

    Abstract. The study of the insects associated with branches and stems girdled by Oncideres saga (Dalman is important to know its possible natural enemies. Therefore, these work had the objective of register the insects associated with branches and stems girdled of Acacia mangium Willd. by this twig girdler beetle, in Coimbra, state of Minas Gerais, Brazil. Stems and branches of A. mangium were collected in January/2007 to April/2007. This material has been inspected, stored in plastic bags, and kept in a room with controlled conditions (25.4 ± 0.3°C and 66.7 ± 1.4%. It was noted the presence of a non-determined species of Scolytidae and the emergence of four species of Cerambycidae: Engyum quadrinotatum Thomsom; Eburodacrys sexmaculata (Olivier; Achryson surinamum (Linnaeus and Neoclytus pusillus (Laporte & Gory. It can be concluded that studies are needed with the objective of verify the behavior of these insects in relation with twig girdler O. saga.

  19. A comparison of trap type and height for capturing cerambycid beetles (Coleoptera)

    Science.gov (United States)

    Elizabeth E. Graham; Therese M. Poland; Deborah G. McCullough; Jocelyn G. Millar

    2012-01-01

    Wood-boring beetles in the family Cerambycidae (Coleoptera) play important roles in many forest ecosystems. However, increasing numbers of invasive cerambycid species are transported to new countries by global commerce and threaten forest health in the United States and worldwide. Our goal was to identify effective detection tools for a broad array of cerambycid...

  20. Ocorrência de Migdolus fryanus (Coleoptera: Cerambycidae em plantios de Pinus caribaea var. hondurensis Occurrence of Migdolus fryanus (Coleoptera: Cerambycidae in Pinus caribaea hondurensis plantations

    Directory of Open Access Journals (Sweden)

    Carlos Frederico Wilcken

    2005-02-01

    Full Text Available Larvas de Migdolus fryanus Westwood (Coleoptera: Cerambycidae foram encontradas danificando raízes de mudas de P. caribaea var. hondurensis (Sénéel Barr. & Golf. no Estado de São Paulo. Isso aumenta a importância dessa espécie, cujos danos, em espécies florestais, têm aumentado, principalmente, em plantios de eucalipto. Esse é o primeiro registro de M. fryanus em plantios de Pinus, e o referido inseto pode ser considerado uma nova praga dessa espécie florestal. Detalhes das características morfológicas e biológicas, danos e possíveis métodos de controle de M. fryanus são discutidos.Larvae of Migdolus fryanus Westwood (Coleoptera: Cerambycidae were found damaging roots of young plants of P. caribaea hondurensis (Sénéel Barr. & Golf. in the State of São Paulo, Brazil. This fact increases the importance of this species because the damages have been increasing in forest species specially in eucalyptus plantations. This is the first record of M. fryanus in pine plantations and this insect can be considered a pest of pine plants. Details on the morphology and biological characteristics, damage and possible control methods to M. fryanus are discussed.

  1. Dispersal of Agrilus planipennis (Coleoptera: Buprestidae) from discrete epicenters in two outlier sites

    Science.gov (United States)

    N.W. Siegert; D.G. McCullough; D.W. Williams; I. Fraser; T.M. Poland; S.J. Pierce

    2010-01-01

    Emerald ash borer, Agrilus planipennis (Fairmaire) (Coleoptera: Buprestidae), a phloem- feeding beetle native to Asia, has become one of the most destructive forest pests in North America. Since it was Þrst identified in 2002 in southeast Michigan and Windsor, Ontario, dozens of isolated A. planipennis populations have been...

  2. A contribution to the rove beetles (Coleoptera: Staphylinidae, Paederinae in north of Iran

    Directory of Open Access Journals (Sweden)

    Masoud Mohammadi Dehcheshmeh

    2016-12-01

    Full Text Available In this paper, 19 species of rove beetles (Coleoptera: Staphylinidae, belonging to the subfamily Paederinae Fleming 1821, were collected from Mazandaran province, north of Iran, during 2015-2016. Two species, Rugilus angustatus Geoffroy 1758 and Astenus lyonessius (joy 1908 are reported for the first time from Iran.

  3. Patterns of tree species usage by long-horned beetles (Coleoptera: Cerambycidae) in Fiji

    Czech Academy of Sciences Publication Activity Database

    Waqa-Sakiti, H.; Stewart, A.; Čížek, Lukáš; Hodge, S.

    2014-01-01

    Roč. 68, č. 1 (2014), s. 57-64 ISSN 0030-8870 R&D Projects: GA ČR GAP504/12/1952 Institutional support: RVO:60077344 Keywords : Coleoptera Subject RIV: EH - Ecology, Behaviour Impact factor: 0.924, year: 2014 http://www.bioone.org/doi/pdf/10.2984/68.1.5

  4. Characterization of white grub (Melolonthidae; Coleoptera in salak plantation based on morphology and protein banding pattern

    Directory of Open Access Journals (Sweden)

    SUGIYARTO

    2009-07-01

    Full Text Available Maryati KT, Sugiyarto. 2010. Characterization of white grub (Melolonthidae; Coleoptera in salak plantation based on morphology and protein banding pattern. Nusantara Bioscience 1: 72-77. This research aims to find out the white grub (Melolonthidae; Coleoptera variability based on the morphological characteristic and protein banding pattern found in ”salak pondoh” farm in Regencies of Sleman, Yogyakarta and Magelang, Central Java. Each area has five sampling points. Morphological analysis on white grub was conducted using descriptive method and analysis on protein banding pattern was conducted using qualitative analysis based on the presence or absent of band pattern on the gel, and qualitatively based on the relative mobility value (Rf of protein. The result indicated that the white grub in Sleman and Magelang, based on morphology characteristic is only one species, namely Holothricia sp. Based on the protein banding pattern, the white grub sample have differences of protein band number and protein molecular weight. Key words: Salacca zalacca, white grub, morphology, protein banding pattern.Abstrak. Maryati KT, Sugiyarto. 2010. Karakterisasi lundi putih (Melolonthidae: Coleoptera pada pertanaman salak berdasarkan ciri morfologi dan pola pita protein. Nusantara Bioscience 1: 72-77. Penelitian ini bertujuan untuk mengetahui keanekaragaman lundi putih (Melolonthidae; Coleoptera berdasarkan ciri morfologi dan pola pita protein yang ditemukan di lahan pertanaman salak pondoh di Kabupaten Sleman, Yogyakarta dan Kabupaten Magelang, Jawa Tengah. Pada masing-masing wilayah diambil lima titik sampling. Analisis morfologi lundi putih digunakan metode deskriptif, dan analisis pola pita protein digunakan analisis kualitatif berdasarkan muncul tidaknya pola pita pada gel, dan secara kuantitatif berdasarkan nilai mobilitas relatif protein (RF. Hasil penelitian menunjukkan bahwa sampel lundi putih di Kabupaten Sleman dan Magelang, berdasar karakter

  5. Illustrated guide to the emerald ash borer, Agrilus planipennis Fairmaire and related species (Coleoptera, Buprestidae)

    Science.gov (United States)

    The 33 species of Agrilus (Coleoptera: Buprestidae) hypothesized to be most closely related to Agrilus planipennis Fairmaire (the emerald ash borer), are described and illustrated. Morphology (adults and immatures), biology, distribution, detailed taxonomic history and systematics are presented fo...

  6. Revision of the genus Endochilus Weise (Coleoptera: Coccinellidae: Chilocorini)

    Science.gov (United States)

    Łączyński, Piotr; Tomaszewska, Wioletta

    2014-01-01

    Abstract The members of the endemic African genus EndochilusWeise, 1898 (Coleoptera: Coccinellidae: Chilocorini) are redescribed, diagnosed, and illustrated. Lectotypes are designated for Endochilus compater Weise, Endochilus minor Weise, Endochilus plagiatus Sicard, Endochilus rubicundus Weise, and Endochilus styx Sicard. One new species is described: Endochilus abdominalissp. nov. Notes on the genus and nomenclatural history for each species are provided. A key for iden- tification of all species is presented. Adult characters concerning similarities of Endochilus to other genera of African Chilocorini are discussed. PMID:25373218

  7. Description of a new species of Bothynus Hope from Argentina and Bolivia (Coleoptera: Scarabaeidae: Dynastinae).

    Science.gov (United States)

    Hardy, Martin

    2017-12-04

    A new species of Bothynus Hope, 1837 (Coleoptera: Scarabaeidae: Dynastinae: Pentodontini) is described from the eastern Andes in South America. The new species is unique in the genus for having the elytra and part of the pronotum covered with small setae.

  8. The tribe Phanaeini (Coleoptera: Scarabaeidae: Scarabaeinae in Peru

    Directory of Open Access Journals (Sweden)

    Luis Figueroa

    2014-10-01

    Full Text Available We examine the occurrence of the tribe Phanaeini (Coleoptera: Scarabaeidae: Scarabaeinae in Peru based on the collection at Museo de Historia Natural of the Universidad Nacional Mayor de San Marcos and on data provided in literature. Each species is presented with citations of its diagnosis, distribution and related comments. Peruvian Phanaeini includes 30 species in nine genera: Coprophanaeus, Dendropaemon, Gromphas, Oruscatus, Oxysternon, Phanaeus, Sulcophanaeus, Tetramereia and Megatharsis. Oruscatus davus is the only species distributed in the high Andes; Phanaeus lunaris and P. achilles occur in the northern arid zone shared by Peru and Ecuador; the remaining species are Amazonian.

  9. Karagöl (Yamanlar, İzmir'ün Sucul Coleoptera (Classis: Insecta Faunasına Katkılar.

    Directory of Open Access Journals (Sweden)

    Esat Tarık Topkara

    2015-12-01

    Full Text Available Bu çalışmada, Karagöl (Yamanlar-İzmir’den 18 Mayıs 2006 tarihinde yapılan örnekleme sonucu elde edilen sucul Coleoptera örnekleri değerlendirilmiştir. Sistematik açıdan yapılan değerlendirmede, Adephaga altfamilyasının Gyrinidae ve Dytiscidae familyalarına ait 4 tür, Polyphaga altfamilyasının Helophoridae, Hydrophilidae, Hydraenidae ve Dryopidae familyalarına ait 7 tür tespit edilmiştir. Tespit edilen türler bu gölün sucul Coleoptera faunası için yeni kayıt niteliğindedir

  10. Coleoborers (Coleoptera: Cerambycidae, Curculionidae associated to culture wastes in mango crops in José de Freitas county – Piauí/ Coleobrocas (Coleoptera: Cerambycidae, Curculionidae associadas a restos culturais da cultura da manga (Mangifera indica L. – Anacardiaceae no município de José de Freitas – Piauí

    Directory of Open Access Journals (Sweden)

    Sávio Silveira Feitosa

    2007-08-01

    Full Text Available The coleoborers use the wood to complete part of their cycle of life. In search for food they can make galleries and cause damages in the structure of the plant, allowing the entrance of pathogenic individuals that will harm the development of the crop. This research was carried out from January to May 2005 aiming to get information on the species of coleoborers associated to crop wastes in the area of mango crop, in José de Freitas county - Piauí. The insects had been collected in areas of Tommy Atkins, Keitt, Kent and Palmer varieties, in 10 fallen branches, with approximately 50 cm long and 2.5 cm of diameter, that were taken to the plant health laboratory of Centro de Ciências Agrárias in Universidade Federal do Piauí. The coleoborers were removed from the wood, assembled in entomologic pins and sent to the Instituto Biológico in São Paulo SP for species identification. The coleoborers Hypothenemus sp. (Coleoptera: Curculionidae: Scolytinae, Xyleborus sp. (Coleoptera: Curculionidae: Scolytinae and Orthostoma chryseis (Bates, 1970 (Coleoptera: Cerambycidae were found.As coleobrocas usam a madeira para realizar o seu ciclo de vida, fazendo galerias e causando danos na estrutura da planta e em certas situações, permitindo a entrada de patógenos. Este trabalho foi realizado de janeiro a maio de 2005 objetivando identificar e obter informações sobre as espécies de coleobrocas associadas a restos de cultura em área de cultivo de manga, no município de José de Freitas-Piauí. Foram coletados em cada área das variedades Tommy Atkins, Keitt, Kent e Palmer, dez ramos caídos, com aproximadamente 50 cm de comprimento e 2,5 cm de diâmetro, que foram levados ao laboratório de Fitossanidade do Centro de Ciências Agrárias da Universidade Federal do Piauí. As coleobrocas adultas foram retiradas da madeira, montadas em alfinetes entomológicos e enviadas ao Instituto Biológico em São Paulo-SP para identificação das espécies. Foram

  11. Host range expansion and increased damage potential of Euwallacea nr. fornicatus (Coleoptera: Curculionidae) in Florida

    Science.gov (United States)

    Ambrosia beetles in the Euwallacea nr. fornicatus complex (Coleoptera: Curculionidae) vector Fusarium spp. fungi pathogenic to susceptible hosts, including avocado. The Florida avocado production area in Miami-Dade County was surveyed for E. nr. fornicatus upon observations of initial damage in 2016...

  12. Tanyproctus (Tanyproctus) arher (Coleoptera: Scarabaeidae: Melolonthinae: Tanyproctini), a new species from the Socotra Island, Yemen

    Czech Academy of Sciences Publication Activity Database

    Bezděk, Aleš; Sehnal, R.; Král, D.

    2013-01-01

    Roč. 3737, č. 2 (2013), s. 191-196 ISSN 1175-5326 Institutional support: RVO:60077344 Keywords : Coleoptera * Scarabaeoidea * Scarabaeidae Subject RIV: EG - Zoology Impact factor: 1.060, year: 2013 http://www.mapress.com/zootaxa/2013/f/zt03737p196.pdf

  13. Molecular Diagnostic for Boll Weevil (Coleoptera: Curculionidae) Based on Amplification of Three Species-specific Microsatellites

    Science.gov (United States)

    The boll weevil, Anthonomus grandis Boheman (Coleoptera: Curculionidae), is a serious pest of cultivated cotton in the Americas, and reinfestation of zones from which they have been eradicated is of perpetual concern. Extensive arrays of pheromone traps monitor for reintroductions, but occasionally...

  14. Impact of Adult Weight, Density, and Age on Reproduction of Tenebrio molitor (Coleoptera: Tenebrionidae)

    Science.gov (United States)

    The impact of adult weight, age, and density on reproduction of Tenebrio molitor L. (Coleoptera: Tenebrionidae) was studied. The impact of adult weight on reproduction was determined in two ways: 1) counting the daily progeny of individual adult pairs of known weight and analyzing the data with line...

  15. The Use of Monoterpenes as Kairomones by Ips latidens (LeConte) (Coleoptera: Scolytidae)

    Science.gov (United States)

    D.R. Miller; J.H. Borden

    1990-01-01

    The responses of Ips lutidens (LeConte) to multiple-funnel traps baited with various monoterpenes were determined in stands of lodgepole pine in British Columbia. ß-Phellandrene was attractive to I. lutidens in the absence of the pheromone ipsenol ß-Phellandrene increased the attraction of I. lutidens to...

  16. Field Bioassays of Synthetic Pheromones and Host Monoterpenes for Conophthorus coniperda (Coleoptera: Scolytidae)

    Science.gov (United States)

    Peter de Groot; Gary L. DeBarr; Goran Birgersson

    1998-01-01

    Four major monoterpenes, (±)-a-pinene,1 (S)-(-)-ß-pinene,(R)-(+)-limonene, and myrcene are found in the cones of eastern white pines, Pinus strobus L. Mixtures ofthese, as well as. a-pinene or ß-pinene alone. increased catches of male white pine cone...

  17. ESPECIES DE DRYOPHTHORINAE (COLEOPTERA: CURCULIONIDAE ASOCIADAS A PLÁTANO Y BANANO (Musa spp. EN COLOMBIA

    Directory of Open Access Journals (Sweden)

    JOSE RUBIO-GOMEZ

    2009-05-01

    Full Text Available RESUMEN Se presenta una sinopsis de los escarabajos de la subfamilia Dryophthorinae (Coleoptera: Curculionidae asociados a cultivos de plátano y banano en Colombia. Adicionalmente se ofrecen claves ilustradas para las especies del país. Se registran seis especies asociadas a dichos cultivos: Cosmopolites sordidus (Germar, 1824, Metamasius hemipterus (Linnaeus, 1758, Metamasius hebetatus (Gyllenhal, 1838, Metamasius submaculatus Champion, 1910, Rhyncophorus palmarum (Linnaeus, 1758 y Polytus mellerborgii (Boheman, 1838. Palabras clave: picudos, plátano, banano, Polytus, Colombia. ABSTRACT This synopsis is about beetle’s subfamily Dryophthorinae (Coleoptera: Curculionidae associated to plantain and banana crops. Additionally keys illustrated for the species of the country are offered. Six species associated to these cultures are registered: Cosmopolites sordidus (Germar, 1824, Metamasius hemipterus (Linnaeus, 1758, Metamasius hebetatus (Gyllenhal, 1838, Metamasius submaculatus Champion, 1910, Rhyncophorus palmarum (Linnaeus, 1758 y Polytus mellerborgii (Boheman, 1838. Key words: weevils, plantain, banana, Polytus, Colombia.

  18. Upper lethal temperature limits of the common furniture beetle Anobium punctatum (Coleoptera: Anobiidae)

    DEFF Research Database (Denmark)

    Hansen, Lise Stengård; Jensen, Karl-Martin Vagn

    1996-01-01

    The susceptibility of the egg, larval and adult stages of Anobium punctatum De Geer (Coleoptera: Anobiidae) to heat (46-54°C, 25-30% RH) was investigated. The larval stage was found to be most tolerant to heat. Very short exposure (5 min) of the larvae to temperatures of 52°C and above led to 100...

  19. Checklist of beetles (Coleoptera of Canada and Alaska. Second edition

    Directory of Open Access Journals (Sweden)

    Yves Bousquet

    2013-12-01

    Full Text Available All 8237 species-group taxa of Coleoptera known to occur in Canada and Alaska are recorded by province/territory or state, along with their author(s and year of publication, in a classification framework. Only presence of taxa in each Canadian province or territory and Alaska is noted. Labrador is considered a distinct geographical entity. Adventive and Holarctic species-group taxa are indicated. References to pertinent identification keys are given under the corresponding supraspecific taxa in the data archive.

  20. Use of nutrient self selection as a diet refining tool in Tenebrio molitor (Coleoptera: Tenebrionidae)

    Science.gov (United States)

    A new method to refine existing dietary supplements for improving production of the yellow mealworm, Tenebrio molitor L. (Coleoptera: Tenebrionidae), was tested. Self selected ratios of 6 dietary ingredients by T. molitor larvae were used to produce a dietary supplement. This supplement was compared...

  1. De brede geelgerande waterroofkever Dytiscus latissimus na 38 jaar weer in Nederland opgedoken (Coleoptera: Dytiscidae).

    NARCIS (Netherlands)

    Dijk, van G.

    2006-01-01

    Dytiscus latissimus after 38 years rediscovered in the Netherlands in 2005 (Coleoptera: Dytiscidae) In 2005 two males of the water beetle Dytiscus latissimus were caught near Uffelte (province of Drenthe). The species is endangered throughout its range and was thought to be extinct in the

  2. Entomopathogens in conjunction with imidacloprid could be used to manage wireworms (Coleoptera: Elateridae) on spring wheat

    Science.gov (United States)

    The soil-dwelling larvae of click beetles (wireworms) (Coleoptera: Elateridae) are serious pests of several agricultural crops worldwide. Hypnoidus bicolor and Limonius californicus are two major wireworm species damaging to spring wheat, particularly in the Golden Triangle, an important cereal-grow...

  3. Spatio-temporal analysis of Xyleborus glabratus (Coleoptera: Circulionidae: Scolytinae) Invasion in Eastern U.S. Forests

    Science.gov (United States)

    F.H. Koch; W.D. Smith

    2008-01-01

    The non-native redbay ambrosia beetle, Xyleborus glabratus Eichhoff (Coleoptera: Curculionidae: Scolytinae), has recently emerged as a signiÞcant pest of southeastern U.S. coastal forests. SpeciÞcally, a fungal symbiont (Raffaelea sp.) of X. glabratus has caused mortality of redbay (Persea borbonia...

  4. Microbial control of Agrilus planipennis (Coleoptera: Buprestidae) with Beauveria bassiana strain GHA: field applications

    Science.gov (United States)

    Houping Liu; Leah S. Bauer

    2008-01-01

    The effects of Beauveria bassiana strain GHA, applied as BotaniGard ES, on newly colonised and well-established populations of emerald ash borer, Agrilus planipennis (Coleoptera: Buprestidae) were evaluated in the field using foliar and trunk sprays in Michigan in 2004-2005. Results from field trials at a newly colonised white ash...

  5. Novas espécies de Onciderini (Coleoptera, Cerambycidae, Lamiinae da Bolívia

    Directory of Open Access Journals (Sweden)

    Ubirajara R. Martins

    2008-01-01

    Full Text Available Novas espécies descritas da Bolívia, Santa Cruz: Trachysomus apipunga sp. nov., Hesychotypa aotinga sp. nov., Cacostola apyraiuba sp. nov. and Glypthaga nearnsi sp. nov.New species of Onciderini (Coleoptera, Cerambycidae, Lamiinae from Bolivia. New species described from Santa Cruz: Trachysomus apipunga sp. nov., Hesychotypa aotinga sp. nov., Cacostola apyraiuba sp. nov. and Glypthaga nearnsi sp. nov.

  6. Four new species of Phyllophaga Harris (Coleoptera: Scarabaeidae: Melolonthinae) from western Cuba.

    Science.gov (United States)

    Serrano, Annery; Morón, Miguel Ángel

    2017-12-07

    Four new species in the genus Phyllophaga Harris 1827, subgenus Cnemarachis Saylor 1942 (Coleoptera: Scarabaeidae: Melolonthinae) from Cuba are described: Phyllophaga barroi new species, Phyllophaga guanahacabibensis new species, Phyllophaga pauli new species, and Phyllophaga sabanalamarensis new species. Each species is illustrated using photographs of the habitus, diagnostic features, and male aedeagi. A map is provided showing the geographical distributions of the new species.

  7. New distribution record of Cybocephalus kathrynae (Coleoptera, Cybocephalidae on Mona Island, Puerto Rico

    Directory of Open Access Journals (Sweden)

    Jean Carlos Curbelo-Rodríguez

    2012-03-01

    Full Text Available New distribution record of Cybocephalus Kathrynae (Coleoptera, Cybocephalidae on Mona Island, Puerto Rico. A new record of Cybocephalus kathrynae T.R. Smith (Cybocephalidae is reported for Puerto Rico. Adults were collected from the flowers of Mammillaria nivosa (Cactaceae on Mona Island Reserve. Prior to this study, this beetle species was only reported for Monroe and Miami-Dade Counties, Florida, USA.

  8. Screening and isolation of the algicidal compounds from marine green alga Ulva intestinalis

    Science.gov (United States)

    Sun, Xue; Jin, Haoliang; Zhang, Lin; Hu, Wei; Li, Yahe; Xu, Nianjun

    2016-07-01

    Twenty species of seaweed were collected from the coast of Zhejiang, China, extracted with ethanol, and screened for algicidal activity against red tide microalgae Heterosigma akashiwo and Prorocentrum micans. Inhibitory effects of fresh and dried tißsues of green alga Ulva intestinalis were assessed and the main algicidal compounds were isolated, purified, and identified. Five seaweed species, U. intestinalis, U. fasciata, Grateloupia romosissima, Chondria crassicaulis, and Gracilariopsis lemaneiformis, were investigated for their algicidal activities. Fresh tissues of 8.0 and 16.0 mg/mL of U. intestinalis dissolved in media significantly inhibited growth of H. akashiwo and P. micans, respectively. Dried tissue and ethyl acetate (EtOAc) extracts of U. intestinalis at greater than 1.2 and 0.04 mg/mL, respectively, were fatal to H. akashiwo, while its water and EtOAc extracts in excess of 0.96 and 0.32 mg/mL, respectively, were lethal to P. micans. Three algicidal compounds in the EtOAc extracts were identified as 15-ethoxy-(6z,9z,12z)-hexadecatrienoic acid (I), (6E,9E,12E)-(2-acetoxy- β-D-glucose)-octadecatrienoic acid ester (II) and hexadecanoic acid (III). Of these, compound II displayed the most potent algicidal activity with IC50 values of 4.9 and 14.1 µg/mL for H. akashiwo and P. micans, respectively. Compound I showed moderate algicidal activity with IC50 values of 13.4 and 24.7 µg/mL for H. akashiwo and P. micans, respectively. These findings suggested that certain macroalgae or products therefrom could be used as effective biological control agents against red tide algae.

  9. First contact pheromone identified for a longhorned beetle (Coleoptera: Cerambycidae) in the subfamily Prioninae

    Science.gov (United States)

    Annie E. Spikes; Matthew A. Paschen; Jocelyn G. Miller; Jardel A. Moreira; Paul B. Hamel; Nathan M. Schiff; Matthew D. Ginzel

    2010-01-01

    Little is known of the reproductive behavior of longhorned beetles (Coleoptera: Cerambycidae) in the subfamily Prioninae. Mallodon dasystomus (Say), the hardwood stump borer, is a widely distributed prionine that is native to the southern U.S. Here, we explored the chemically-mediated mating behavior of M dasystomus, and tested the hypothesis that males recognize...

  10. The hydraulic mechanism in the hind wing veins of Cybister japonicus Sharp (order: Coleoptera

    Directory of Open Access Journals (Sweden)

    Jiyu Sun

    2016-06-01

    Full Text Available The diving beetles (Dytiscidae, Coleoptera are families of water beetles. When they see light, they fly to the light source directly from the water. Their hind wings are thin and fragile under the protection of their elytra (forewings. When the beetle is at rest the hind wings are folded over the abdomen of the beetle and when in flight they unfold to provide the necessary aerodynamic forces. In this paper, the unfolding process of the hind wing of Cybister japonicus Sharp (order: Coleoptera was investigated. The motion characteristics of the blood in the veins of the structure system show that the veins have microfluidic control over the hydraulic mechanism of the unfolding process. A model is established, and the hind wing extending process is simulated. The blood flow and pressure changes are discussed. The driving mechanism for hydraulic control of the folding and unfolding actions of beetle hind wings is put forward. This can assist the design of new deployable micro air vehicles and bioinspired deployable systems.

  11. Morphological and isozymic banding pattern study of white grubs (Coleoptera: Melolonthidae as pest of bark crop in mounth Merapi’s slope.

    Directory of Open Access Journals (Sweden)

    SUGIYARTO

    2008-07-01

    Full Text Available White grub (Coleoptera: Melolonthidae is a group of soil pest at any agrosystem., especially at Salak pondoh (Salacca zalacca (Gaert. Voss. crop. The characteristics of this specimen were very crucial to be studied in order to find the exact biocontrol. The aim of this research was to know the characteristics of white grubs (Melolonthidae: Coleoptera based on morphological and isozyme banding patterns. This research was conducted on August - November 2007 at Sleman and Magelang districts for the morphological purposes, while for the isozyme data were conducted at Sub Laboratory Biology, Central Laboratory of Sebelas Maret University Surakarta. Sample was taken by using stratified random sampling method, on five stations. Polyacrylamide gel electrophoresis (PAGE using the vertical type was taken to isozyme analysis. The enzyme used in this research were peroxidase and esterase to detect the isozyme banding patterns. The results showed that there was no morphological variation of white grubs (Melolonthidae: Coleoptera at salak pondoh agroecosystem in Mounth Merapi’s slope. Based on this character, there was one species of white grub found, i.e. Holotrichia javana. There was a genetic variation based on the variation of isozyme banding patterns.

  12. Avoidance of nonhost plants by a bark beetle, Pityogenes bidentatus, in a forest of odors

    Science.gov (United States)

    Byers, John A.; Zhang, Qing-He; Birgersson, Göran

    The bark beetle, Pityogenes bidentatus (Coleoptera: Scolytidae), searches in mixed conifer and deciduous forests of northern Europe for suitable branches of its host, Scots pine (Pinus sylvestris). We tested whether odors from several diverse nonhost trees and plants common in the habitat (e.g., mountain ash, Sorbus aucuparia; oak, Quercus robur; alder buckthorn, Frangula alnus; blueberry, Vaccinium myrtillus; raspberry, Rubus idaeus; and grass, Deschampsia flexuosa) would reduce the attraction of the bark beetle to traps releasing its aggregation pheromone components in the field. Volatiles from the leaves or bark of each of these plants significantly reduced the attraction of the beetles to their pheromone. Odors collected from these nonhosts and analyzed by GC/MS contained monoterpenes, sesquiterpenes, and ``green-leaf'' alcohols, several of which (e.g., 1-octene-3-ol and β-caryophyllene) reduced the attraction to pheromone in the field and elicited electroantennographic responses. In the laboratory, reproduction by the beetle was marginal in nonhost Norway spruce, Picea abies, and was absent in the other nonhost trees. Olfactory avoidance of unsuitable nonhosts may have evolved due to advantages in avoiding mistakes during host selection.

  13. Variation in enantiospecific attraction of Ips avulsus (Coleoptera: Curculionidae) to the pheromone ipsdienol in Georgia.

    Science.gov (United States)

    Daniel Miller; Jeremy Allison

    2011-01-01

    In 2006, we tested the responses of the small southern pine engraver, Ips avulsus (Eichhoff) (Coleoptera: Curculionidae), to multiple-funnel traps baited with (+)-, (-)-, and (+/-)- ipsdienol. Three experiments were conducted in Georgia with all traps co-baited with one of the following lure combinations, respectively: experiment 1, ipsenol; experiment 2, lanierone and...

  14. Ground beetles (Coleoptera, Carabidae agrocenoses of spring and winter wheat

    Directory of Open Access Journals (Sweden)

    Luboš Purchart

    2005-01-01

    Full Text Available On two monitoring areas of the Central Institute for Supervising and Testing in Agriculture (ÚKZÚZ loaded with risk elements we carried out investigations of beetles of the family Carabidae (Coleoptera in agricultural stands of winter and spring wheat. The focus of the present study is on synecological characteristics and in some extent on the impact of agricultural practise on the population and seasonal dynamics of the most important representatives of ground beetles. This paper precedes the following article aimed to contents of heavy metals in ground beetles.

  15. Acoustic assessment of Beauveria bassiana (Hypocreales: Clavicipitaceae) effects on Rhynchophorus ferrugineus (Coleoptera: Dryophthoridae) larval activity and mortality

    Science.gov (United States)

    Rhynchophorus ferrugineus (Olivier) (Coleoptera: Dryophthoridae), the red palm weevil, is an economically important palm tree pest in subtropical regions of the world. Previous studies have shown that R. ferrugineus can be infected and killed by the entomopathogenic fungus, Beauveria bassiana. Howev...

  16. Avaliação de inseticidas no controle de Sitophilus oryzae (Linnaeus (Coleoptera, Curculionidae e Rhyzopertha dominica (Fabricius (Coleoptera, Bostrichidae em trigo armazenado Efficacy of insecticides to control Sitophilus oryzae (Linnaeus (Coleoptera, Curculionidae and Rhyzopertha dominica (Fabricius (Coleoptera, Bostrichidae in stored wheat

    Directory of Open Access Journals (Sweden)

    Rui S. Furiatti

    1999-03-01

    Full Text Available The efficiency of insecticides against Sitophilus oryzae (Linnaeus, 1763 (Coleoptera, Curculionidae and Rhyzopertha dominica (Fabricius, 1792 (Coleoptera, Bostrichidae was determined exposing them to treated wheat in laboratory. Each plot, which was composed by 1.2 kg of wheat grain, was treated with 5 ml of the concentration/kg of wheat using a propelling air atomizer. Fifteen days after treatment 50 g samples of the grain were taken, from each plot, placed in plastic jars into which 10 adult insects of each species were released. This was repeated every 30 days until 165 days after treatment. The number of dead insects was counted 15 days after each infestation thus the evaluations were made at 30, 60, 90, 120, 150 and 180 days after the insecticide application. Esfenvalerate+fenitrothion+pyperonil butoxide (0,375+7,5+3,0 and 0,5+10,0+4,0 g a.i./t, fenitrothion+esfen-valerate (7,5+0,375 and 10,0+0,375 g a.i./t, fenitrothion+synergised deltamethrin (7,5+0,375 g a.i./t and fenitrothion (7,5 g a.i./t were effective against Sitophilus oryzae until 180 days after treatment. Esfenvalerate+fenitrothion+pyperonil butoxide (0,5+10,0+4,0 g a.i./t, fenitrothion+esfenvalerate (7,5+0,375 and 10,0+0,375 g a.i./t, fenitrothion+synergised deltamethrin (7,5+0,375 g a.i./t were effective against R. dominica until 180 days after treatment. Synergised deltamethrin (0,375 g a.i./t was effective against S. oryzae until 150 days and against R. dominica until 120 days after treatment. Esfenvalerate (0,5 g a.i./t was ineffective against S. oryzae and effective until 60 days after treatment against R. dominica. Fenitrothion (7,5 g a.i./t was ineffective against R. dominica. The use of mixtures of organophosphorus plus pyrethroids were more effective against S. oryzae and R. dominica when compared with these insecticides used alone.

  17. Dryophthorinae Species (Coleoptera: Curculionidae) Associted to Platain and Banana crops (Musaspp.) in Colombia

    OpenAIRE

    SEPÚLVEDA-CANO, PAULA A; RUBIO-GÓMEZ, JOSÉ D

    2009-01-01

    Se presenta una sinopsis de los escarabajos de la subfamilia Dryophthorinae (Coleoptera: Curculionidae) asociados a cultivos de plátano y banano en Colombia. Adicionalmente se ofrecen claves ilustradas para las especies del país. Se registran seis especies asociadas a dichos cultivos: Cosmopolites sordidus (Germar, 1824), Metamasius hemipterus (Linnaeus, 1758), Metamasius hebetatus (Gyllenhal, 1838), Metamasius submaculatus Champion, 1910, Rhyncophorus palmarum (Linnaeus, 1758) y Polytus mell...

  18. Influence of temperature on spring flight initiation for southwestern ponderosa pine bark beetles (Coleoptera: Curculionidae, Scolytinae)

    Science.gov (United States)

    M. L. Gaylord; K. K. Williams; R. W. Hofstetter; J. D. McMillin; T. E. Degomez; M. R. Wagner

    2008-01-01

    Determination of temperature requirements for many economically important insects is a cornerstone of pest management. For bark beetles (Coleoptera: Curculionidae, Scolytinae), this information can facilitate timing of management strategies. Our goals were to determine temperature predictors for flight initiation of three species of Ips bark beetles...

  19. Hydraena Kugelann, 1794 (Coleoptera, Hydraenidae) from the Seychelles, Indian Ocean, with description of a new species.

    Science.gov (United States)

    Jäch, Manfred A; Delgado, Juan A

    2016-01-01

    Hydraena matyoti sp. n. (Coleoptera, Hydraenidae) is described from the Seychelles, Indian Ocean. Hydraena mahensis Scott, 1913 is redescribed. The latter is here recorded from La Digue for the first time. A key to the species of the genus Hydraena Kugelann, 1794 of the Seychelles is presented.

  20. Ground beetle (Coleoptera: Carabidae) assemblages in the Conservation Reserve Program crop rotation systems in Interior Alaska

    Science.gov (United States)

    Adult ground beetles (Coleoptera: Carabidae) abundance and diversity were documented on Conservation Research Program (CRP) agricultural lands in Delta Junction, Alaska (64ºN, 145º W). Twenty species were documented based on a total sample of 6,116 specimens collected during 2006 and 2007. Two speci...

  1. New faunistic records of ground beetles (Coleoptera, Carabidae from Hormozgan province, Iran

    Directory of Open Access Journals (Sweden)

    Azadbakhsh Saeed

    2016-09-01

    Full Text Available This paper presents the results of a faunal study of ground beetles (Coleoptera: Carabidae from Hormozgan province in southern Iran, which was carried out from winter 2015 to winter 2016. A total of 30 species belonging to 18 genera were collected and identified. Two species – Calodromius mayeti and Elaphropus (Tachyura biblis – are reported from Iran for the first time; in addition, the occurrence of several species in Iran was confirmed.

  2. Nuevas citas de Coleoptera acuáticos y Megaloptera para la provincia de Chubut (Argentina New records of aquatic Coleoptera and Megaloptera from Chubut province (Argentina

    Directory of Open Access Journals (Sweden)

    Miguel Archangelsky

    2004-12-01

    Full Text Available Se informa acerca de nuevos hallazgos de coleópteros acuáticos, de Dytiscidae, Gyrinidae, Hydrophilidae y Elmidae para la provincia de Chubut (Argentina. También se cita por primera vez a las Sialidae (Megaloptera, género Protosialis Weele, para la República Argentina.New records of aquatic Coleoptera, in the families Dytiscidae, Gyrinidae, Hydrophilidae and Elmidae, are reported for the Chubut province (Argentina. The Sialidae (Megaloptera, genus Protosialis Weele, is reported for the first time in Argentina.

  3. Seasonal dynamics of saproxylic beetles (Coleoptera occurring in decaying birch (Betula spp. wood in the Kampinos National Park

    Directory of Open Access Journals (Sweden)

    Sawoniewicz Michał

    2015-09-01

    Full Text Available The aim of the study was to identify the seasonal changes in the number of saproxylic beetles connected with birch in the Kampinos National Park. The research was conducted for 12 consecutive months in research areas representing 10 different site types. The beetles were collected from wood using photoeclectors. The largest number of species was collected in April and the lowest in January. An increase in number occurred during spring and summer months for species associated only with rotting wood, fructifications of tree fungi, the subcortical environment and hollows. In the same period the number of species not associated or potentially associated with decaying trees and wood decreased. During winter months, the differences in the number of trapped specimens were the smallest. The proportion of zoophagous species amongst the collected specimen increased in autumn and winter. The share of saprophagous species was the highest during the summer-autumn period and the share of mycetophages (jointly with myxomycophages was the highest during spring and summer. We distinguished two separate groups of Coleoptera with the first one (‘summer group’ including species trapped during late-spring and summer months, while the second one (‘winter group’ includes species found in autumn, winter and early-spring months. In the ‘summer group’, an average of 55.8 species was trapped each month with 331.2 specimen of Coleoptera, while in the ʻwinter group’ an average of 56.1 species with 228.4 Coleoptera specimen were caught.

  4. Functional Response of the Predators Alloeocranum biannulipes (Hemiptera: Reduviidae) and Teretrius nigrescens (Coleoptera: Histeridae) Feeding on Dinoderus porcellus (Coleoptera: Bostrichidae) Infesting Yam Chips.

    Science.gov (United States)

    Loko, Y L; Djagoun, A D; Dannon, E A; Datinon, B; Dansi, A; Thomas-Odjo, A A; Tamo, M

    2017-02-01

    The functional response and some predation parameters of the predators Alloeocranum biannulipes Montrouzier & Signoret (Hemiptera: Reduviidea) and Teretrius nigrescens Lewis (Coleoptera: Histeridae) were evaluated at five different densities of larvae and pupae of Dinoderus porcellus Lesne (Coleoptera: Bostrichidae) with the aim to understand their roles in the biological control of this major pest of stored yam chips. Experiments were performed in petri dishes at 25 ± 1 °C, 60 ± 10% RH, and a photoperiod of 12:12 (L:D) h in a controlled temperature room. Both predators showed Type II of functional response with respect to larvae, determined by a logistic regression model. However, T. nigrescens significantly killed more larvae of D. porcellus compared with A. biannulipes. This behavior, however, changed to a linear functional response (Type I), when pupae of D. porcellus were offered to both predators, possibly because of their immobility. In addition, there was no significant difference between T. nigrescens and A. biannulipes in terms of the killed pupae. Parameters of the Holling disc equation for both predators were estimated. Estimated handling time on larvae of D. porcellus for T. nigrescens and A. biannulipes was 0.254 and 0.677 h and the rate of searching efficiency was 0.289 and 0.348 h-1, respectively. Results indicated that T. nigrescens was a more suitable candidate for augmentative release for D. porcellus control than A. biannulipes. However, semifield studies are required to draw firm conclusions. © The Authors 2016. Published by Oxford University Press on behalf of Entomological Society of America. All rights reserved. For Permissions, please email: journals.permissions@oup.com.

  5. Role of emerald ash borer (Coleoptera: Buprestidae) larval vibrations in host-quality assessments by Tetrastichus planipennisi (Hymenoptera: Eulophidae)

    Science.gov (United States)

    Michael D. Ulyshen; Richard W. Mankin; Yigen Chen; Jian J. Duan; Therese M. Poland; Leah S. Bauer

    2011-01-01

    The biological control agent Tetrastichus planipennisi Yang (Hymenoptera: Eulophidae) is a gregarious larval endoparasitoid of the emerald ash borer, Agrilus planipennis Fairmaire (Coleoptera: Buprestidae), an invasive cambium-feeding species responsible for recent, widespread mortality of ash (Fraxinus spp.) in...

  6. An annotated synopsis of the powder post beetles of Iran (Coleoptera: Bostrichoidea: Bostrichidae

    Directory of Open Access Journals (Sweden)

    Lan-Yu Liu

    2016-07-01

    Full Text Available An annotated synopsis of Iranian Bostrichidae (Coleoptera: Bostrichoidea is provided as a basis for future studies, with notes on distribution, host plants, biology and economic importance. In total, 31 species from 18 genera and 4 subfamilies (Bostrichinae, Dinoderinae, Lyctinae and Psoinae are listed from Iran. Sinoxylon anale Lesne, 1897, Sinoxylon perforans (Schrank, 1789, Stephanopachys linearis (Kugelann, 1792 and Xylopertha retusa (Olivier, 1790 are new records for Iran.

  7. Comparison of trap types, placement, and colors for monitoring Anthonomus musculus (Coleoptera: Curculionidae) adults in highbush blueberries

    Science.gov (United States)

    Cranberry weevil, Anthonomus musculus Say (Coleoptera: Curculionidae), is a key pest of highbush blueberries in the northeast USA. To date, however, no trapping system has been developed to successfully monitor this pest. In 2012-2014, studies were conducted in commercial blueberry farms in New Jers...

  8. Distribution of the longhorned beetle Callipogon relictus (Coleoptera: Cerambycidae) in Northeast Asia.

    Science.gov (United States)

    Yi, Dae-Am; Kuprin, Alexander V; Bae, Yeon Jae

    2018-01-02

    The distribution of the longhorned beetle Callipogon (Eoxenus) relictus Semenov, 1899 (Coleoptera: Cerambycidae) in Northeast Asia was summarized for the first time, based on the examination of comprehensive material. Callipogon relictus is the only representative of the genus Callipogon in the Palearctic region. Its distribution ranges from Shanxi province (China) in the south, northward through the Korean Peninsula to Amur Oblast (Russia), and from Inner Mongolia (China) in the west to the coastal area of the Russian Far East.

  9. Hydraena Kugelann, 1794 (Coleoptera, Hydraenidae from the Seychelles, Indian Ocean, with description of a new species

    Directory of Open Access Journals (Sweden)

    Manfred A. Jäch

    2016-10-01

    Full Text Available Hydraena matyoti sp. n. (Coleoptera, Hydraenidae is described from the Seychelles, Indian Ocean. Hydraena mahensis Scott, 1913 is redescribed. The latter is here recorded from La Digue for the first time. A key to the species of the genus Hydraena Kugelann, 1794 of the Seychelles is presented.

  10. Interactions between the pathogenic bacterium Vibrio parahaemolyticus and red-tide dinoflagellates

    Science.gov (United States)

    Seong, Kyeong Ah; Jeong, Hae Jin

    2011-06-01

    Vibrio parahaemolyticus is a common pathogenic bacterium in marine and estuarine waters. To investigate interactions between V. parahaemolyticus and co-occurring redtide dinoflagellates, we monitored the daily abundance of 5 common red tide dinoflagellates in laboratory culture; Amphidinium carterae, Cochlodinium ploykrikoides, Gymnodinium impudicum, Prorocentrum micans, and P. minimum. Additionally, we measured the ingestion rate of each dinoflagellate on V. parahaemolyticus as a function of prey concentration. Each of the dinoflagellates responded differently to the abundance of V. parahaemolyticus. The abundances of A. carterae and P. micans were not lowered by V. parahaemolyticus, whereas that of C. polykrikodes was lowered considerably. The harmful effect depended on bacterial concentration and incubation time. Most C. polykrikoides cells died after 1 hour incubation when the V. parahaemolyticus concentration was 1.4×107 cells ml-1, while cells died within 2 days of incubation when the bacterial concentration was 1.5×106 cells ml-1. With increasing V. parahaemolyticus concentration, ingestion rates of P. micans, P. minimum, and A. carterae on the prey increased, whereas that on C. polykrikoides decreased. The maximum or highest ingestion rates of P. micans, P. minimum, and A. carterae on V. parahaemolyticus were 55, 5, and 2 cells alga-1 h-1, respectively. The results of the present study suggest that V. parahaemolyticus can be both the killer and prey for some red tide dinoflagellates.

  11. Trapping Phyllophaga spp. (Coleoptera: Scarabaeidae: Melolonthinae) in the United States and Canada using sex attractants

    Science.gov (United States)

    Paul S. Robbins; Steven R. Alm; Charles D. Armstrong; Anne L. Averill; Thomas C. Baker; Robert J. Bauernfiend; Frederick P. Baxendale; S. Kris Braman; Rick L. Brandenburg; Daniel B. Cash; Gary J. Couch; Richard S. Cowles; Robert L. Crocker; Zandra D. DeLamar; Timothy G. Dittl; Sheila M. Fitzpatrick; Kathy L. Flanders; Tom Forgatsch; Timothy J. Gibb; Bruce D. Gill; Daniel O. Gilrein; Clyde S. Gorsuch; Abner M. Hammond; Patricia D. Hastings; David W. Held; Paul R. Heller; Rose T. Hiskes; James L. Holliman; William G. Hudson; Michael G. Klein; Vera L. Krischik; David J. Lee; Charles E. Linn; Nancy J. Luce; Kenna E. MacKenzie; Catherine M. Mannion; Sridhar Polavarapu; Daniel A. Potter; Wendell L. Roelofs; Brian M. Rovals; Glenn A. Salsbury; Nathan M. Schiff; David J. Shetlar; Margaret Skinner; Beverly L. Sparks; Jessica A. Sutschek; Timothy P. Sutschek; Stanley R. Swier; Martha M. Sylvia; Niel J. Vickers; Patricia J. Vittum; Richard Weidman; Donald C. Weber; R. Chris Williamson; Michael G. Villani

    2006-01-01

    The sex pheromone of the scarab beetle, Phyllophaga anxia, is a blend of the methyl esters of two amino acids, L-valine and L-isoleucine. A field trapping study was conducted, deploying different blends of the two compounds at 59 locations in the United States and Canada. More than 57,000 males of 61 Phyllophaga species (Coleoptera...

  12. Self-selection of two diet components by Tennebrio molitor (Coleoptera: Tenebrionidae) larvae and its impact on fitness

    Science.gov (United States)

    We studied the ability of Tenebrio molitor L. (Coleoptera: Tenebrionidae) to self-select optimal ratios of two dietary components to approach nutritional balance and maximum fitness. Life table analysis was used to determine the fitness of T. molitor developing in diet mixtures comprised of four dif...

  13. A phloem sandwich allowing attack and colonization by bark beetles (Coleoptera: Scolytidae) and associates

    Science.gov (United States)

    Andrew D. Taylor; Jane L. Hayes; John C. Moser

    1992-01-01

    Much of the life cycles of bark beetles and their associates are spent under the bark of the host tree and are impossible to observe under completely natural conditions. To observe the behavior and development of insects in the phloem layer, phloem sandwiches have been developed, in which a piece of bark and phloem is removed from a live tree and pressed against a...

  14. Retention of external and internal markers by southern pine beetles (Coleoptera: Scolytidae) during gallery

    Science.gov (United States)

    Douglas J. Rhodes; Jane Leslie Hayes; Chris Steiner

    1998-01-01

    If retained, markers used in mark-release-recapture studies of bark beetle dispersal could provide valuable tools in the determination of post-dispersal fate. Retention of the internal marker rubidium (Rb) and of the external marker fluorescent powder during egg gallery construction, oviposition, and feeding were quantified at intervals from 0 to 96 hours by allowing...

  15. E-Myrcenol: A New Pheromone for the Pine Engraver, Ips Pini (Say) (Coleoptera: Scolytidae)

    Science.gov (United States)

    D.R. Miller; G. Gries; J.H. Borden

    1990-01-01

    E-Myrcenol reduced catches of the pine engraver, Ips pini (Say), to ipsdienol-baited, multiple-funnel traps in a dose-dependent fashion. The sex ratio was unaffected by E-myrcenol treatments. Lures containing E-myrcenol in ethanol solution failed to protect freshly cut logs of lodgepole pine from attack by

  16. A checklist of the genus Blosyrus Schoenherr (Coleoptera: Curculionidae: Entiminae of the world

    Directory of Open Access Journals (Sweden)

    G. Mahendiran

    2013-08-01

    Full Text Available An annotated checklist of Blosyrus Schoenherr (Coleoptera: Curculionidae: Entiminae comprising 101 species with their updated nomenclature, synonyms and distribution is given. The distribution pattern indicates that the genus is diversified mostly in the Sub-Saharan Africa and Asia regions. Out of 101 species, 92 occur in Sub-Saharan Africa. From India, eight species were recorded. In India, the distribution is mainly in West Bengal, Assam, Maharashtra, Andhra Pradesh, Karnataka and Tamil Nadu.

  17. Investigations on the aquatic Coleoptera (Classis: Insecta fauna of some mountain lakes in the eastern Black Sea range (Turkey.

    Directory of Open Access Journals (Sweden)

    Esat Tarık Topkara

    2015-12-01

    Full Text Available Doğu Karadeniz dağ silsilesindeki bazı dağ göllerinin sucul Coleoptera (Classis: Insecta faunası üzerine araştırmalar. Doğu Karadeniz (Türkiye dağ silsilesindeki yüksek dağ göllerinin sucul Coleoptera faunasını belirlemek amacıyla yapılan bu araştırma, 2005-2007 yıllarında Temmuz ve Ağustos aylarında 22 gölde gerçekleştirilmiştir. Örneklemeler göllerin littoral bölgesinde ve el kepçeleri kullanılarak yapılmıştır. Toplanan örneklerin taksonomik açıdan incelenmesiyle, 4 familyaya ait 21 takson (Dytiscidae 11, Helophoridae 7, Hydraenidae 2, Elmidae 1 tespit edilmiştir

  18. Walking stability of Rhyzopertha dominica (Fabricius, 1792 (Coleoptera: Bostrichidae

    Directory of Open Access Journals (Sweden)

    E. M. Pires

    Full Text Available Abstract Results obtained in studies can contribute to the advancement of science and innovative methods and techniques for developing practical activities. Reporting conditions that may restrict the implementation of research is critical to ensure the optimal development of further technical studies. The objective of this study was to assess the walking stability of R. dominica on a flat and smooth surface. The study was based on the determination of mortality, morphology and walking stability of the insect outside the grain mass, on a flat and smooth surface. Mortality of adults of this Coleoptera in conditions with and without food was similar, which explains the difficulty that this insect had for accessing the food source on the flat and smooth surface. The measurements of body length (BOL, width (BOW and height (BOH of R. dominica were compared with those of Tribolium castaneum (Coleoptera: Tenebrionidae, which showed good ability to walk in these conditions. This study indicated that the former presents lower BOL and BOW, and greater BOH than the second, and all these variables showed differences when analyzed simultaneously by means of the construction of multivariate morphometric indices (Width × Height, Length × Height and Height × Length × Width. These morphometric variables, together with the definition of the geometry most similar to the body shape, resulted in determination of the center of gravity (CG and static rollover threshold (SRTgeom for both species. Rhyzopertha dominica and T. castaneum presented CGs considered high and low, respectively, and together with the values obtained for SRTgeom, may justify that R. dominica can be considered a less stable species during movement, and presents greater risk of rollover on flat and smooth surfaces.

  19. Attraction of Agrilus planipennis (Coleoptera: Buprestidae) and other buprestids to sticky traps of various colors and shapes

    Science.gov (United States)

    Toby R. Petrice; Robert A. Haack; Therese M. Poland

    2013-01-01

    The family Buprestidae (Coleoptera) contains numerous economically significant species, including the emerald ash borer (EAB), Agrilus planipennis Fairmaire, first discovered in North America in 2002. Effective traps for monitoring spread and population densities of EAB and other buprestids are needed. Studies were conducted in 2008 to test different...

  20. Biology and natural enemies of Agrilus fleischeri (Coleoptera:Buprestidae), a newly emerging destructive buprestid pest in Northeast China

    Science.gov (United States)

    The jewel beetle Agrilus fleischeri Obenberger (Coleoptera: Buprestidae) is a newly emerging major pest of poplar trees (Populus spp.) in northeast China and is responsible for the poplar mortality throughout its distribution range. In order to determine how to manage this pest effectively, we stud...

  1. Description and phylogeny of a new microsporidium from the elm leaf beetle, Xanthogaleruca luteola Muller, 1766 (Coleoptera: Chrysomelidae)

    Science.gov (United States)

    This study describes a new genus and species of microsporidia which is a pathogen of the elm leaf beetle, Xanthogaleruca luteola Muller, 1776 (Coleoptera: Chrysomelidae). The beetles were collected from Istanbul in Turkey. All developmental stages are uninucleate and in direct contact with the host ...

  2. Responses by Dendroctonus frontalis and Dendroctonus mesoamericanus (Coleoptera: Curculionidae) to Ssemiochemical lures in Chiapas, Mexico: possible roles of pheromones during joint host attacks

    Science.gov (United States)

    Alicia Nino-Dominguez; Brian T. Sullivan; Jose H. Lopez-Urbina; Jorge E. Macias-Samano

    2016-01-01

    In southern Mexico and Central America, the southern pine beetle Dendroctonus frontalis Zimmermann (Coleoptera: Curculionidae: Scolytinae) commonly colonizes host trees simultaneously with Dendroctonus mesoamericanus Armend

  3. Intra-annual variation in responses by flying southern pine beetles (Coleoptera: Curculionidae: Scolytinae) to pheromone component endo-brevicomin

    Science.gov (United States)

    Brian T. Sullivan; Cavell Brownie; JoAnne P. Barrett

    2016-01-01

    The southern pine beetle Dendroctonus frontalis Zimmermann (Coleoptera: Curculionidae: Scolytinae) is attracted to an aggregation pheromone that includes the multifunctional pheromone component endobrevicomin. The effect of endo-brevicomin on attractive lures varies from strong enhancement to reduction of beetle attraction depending upon release rate, lure component...

  4. Adaptation of the Egg of the Desert Beetle, Microdera punctipennis (Coleoptera: Tenebrionidae), to Arid Environment

    Science.gov (United States)

    Wang, Yan; Shi, Meng; Hou, Xiaojuan; Meng, Shanshan; Zhang, Fuchun; Ma, Ji

    2014-01-01

    Abstract Microdera punctipennis Kaszab (Coleoptera: Tenebrionidae) is an endemic species in Guerbantonggut desert in China. To explore the ways that M. punctipennis egg adapts to dry desert environment, morphological characteristics of the egg was investigated along with the egg of the nondesert beetle Tenebrio molitor (Coleoptera: Tenebrionidae). Water loss rate and survival rate of these eggs under different dry treatments (relative humidity0, 10, and 20%) were measured to evaluate the desiccation resistance of the eggs at different developmental stages (day 0, 2, and 5 eggs). Our results showed that the 50-egg weight in T. molitor was heavier than M. punctipennis , while the 50-first-instar larva weight in T. molitor was almost the same as in M. punctipennis . The water loss rate of M. punctipennis egg under dry conditions was significantly lower than T. molitor , and the egg survival rate was significantly higher than T. molitor . The estimated developmental threshold temperature of M. punctipennis egg was 18.30°C, and the critical thermal maximum of M. punctipennis egg is above 39°C. These features partly account for the adaptability of M. punctipennis to desert environment in egg stage. PMID:25525108

  5. Estirpes de Bacillus thuringiensis efetivas contra insetos das ordens Lepidoptera, Coleoptera e Diptera Bacillus thuringiensis strains effective against insects of Lepidoptera, Coleoptera and Diptera orders

    Directory of Open Access Journals (Sweden)

    Lílian Botelho Praça

    2004-01-01

    Full Text Available O objetivo deste trabalho foi selecionar entre 300 estirpes de Bacillus thuringiensis as efetivas simultaneamente contra larvas de Spodoptera frugiperda J.E. Smith e Anticarsia gemmatalis Hübner (Lepidoptera: Noctuidae, Anthonomus grandis Boheman (Coleoptera: Curculionidae, Aedes aegypti Linnaeus e Culex quinquefasciatus Say (Diptera: Culicidae. Foram selecionadas duas estirpes de B. thuringiensis, denominadas S234 e S997, que apresentaram atividade contra as três ordens de insetos. As estirpes foram caracterizadas por métodos morfológicos, bioquímicos e moleculares. As mesmas apresentaram duas proteínas principais de 130 e 65 kDa, produtos de reação em cadeia da polimerase de tamanho esperado para a detecção dos genes cry1Aa, cry1Ab, cry1Ac, cry1B e cry2 e cristais bipiramidais, cubóides e esféricos.The aim of this work was to select among 300 strains of Bacillus thuringiensis those which are simultaneously effective against larvae of Spodoptera frugiperda J.E. Smith and Anticarsia gemmatalis Hübner (Lepidoptera: Noctuidae, Anthonomus grandis Boheman (Coleoptera: Curculionidae, Aedes aegypti Linnaeus and Culex quinquefasciatus Say (Diptera: Culicidae. Two strains of B. thuringiensis were selected, S234 and S997, which presented activity against those three insect orders. Both strains were characterized by morphological, biochemical and molecular methods. They have presented two main proteins with 130 and 65 kDa, polimerase chain reaction products with expected sizes for detection of the genes cry1Aa, cry1Ab, cry1Ac, cry1B and cry2 and bipiramidal, cubical and spherical crystals.

  6. Effect of temperature on reproduction and embryonic development of the cabbage stem flea beetle, Psylliodes chrysocephala L., (Coleoptera: Chrysomelidae)

    DEFF Research Database (Denmark)

    Mathiasen, Helle; Sørensen, Helle; Bligaard, J.

    2015-01-01

    The cabbage stem flea beetle, Psylliodes chrysocephala (L.) (Coleoptera: Chrysomelidae), is a major pest of winter oilseed rape. Despite the importance of this pest, detailed information on reproduction to predict risk of crop damage is lacking. This study investigates the effect of temperature...

  7. Levantamento da fauna de Coleoptera (Insecta associada à carcaça de roedores na região Sul do Brasil

    Directory of Open Access Journals (Sweden)

    Vinícius Costa-Silva

    2017-12-01

    Abstract. Coleoptera (Arthropoda, Insecta is considered one of the most important organism groups associated with organic matter decomposition and therefore may be useful to elucidate issues in the criminal context. The richness and abundance of beetles, including the necrophagous species, may vary according to climatic and physiogeographic conditions in different regions, thus the knowledge of the local entomofauna becomes relevant. Thereby, this study aimed to survey the local fauna and register the seasonal behavior of Coleoptera species associated with rodent carcasses exposed in a rural environment at Santa Maria, Rio Grande do Sul, Brazil (29°43'02.88"S 53°43'52.24"W. The collections were carried out quarterly throughout 12 months. Four Rattus norvegicus (Berkenhout carcasses weighing approximately 400 g were exposed, simultaneously, in each season, protected by a steel cage. Four pitfall traps were arranged around each carcass. A total of 1,856 specimens belonging to 14 families of Coleoptera were collected. The greatest abundance was observed during spring (N= 1,006, followed by summer (N= 518, winter (N= 319 and fall (N= 26. Records of the necrophagous entomofauna of Rio Grande do Sul are still scarce. Beyond contributing to the database promotion of the necrophagous species of beetle as a forensic purpose, it is expected that this paper may instigate the achievement of more faunistic surveys, regarding the biodiversity matter of two singular biomes present in the South region, Pampa and Atlantic Forest.Â

  8. Danos de Conotrachelus dubiae (Coleoptera: curculionidae em frutos de camu-camu (Myrciaria dubia na Amazônia Central Damage of camu-camu (Myrciaria dubia fruits by Conotrachelus dubiae (Coleoptera: curculionidae in Central Amazonia

    Directory of Open Access Journals (Sweden)

    Sidney Alberto do Nascimento Ferreira

    2003-12-01

    Full Text Available No Brasil, a ocorrência de Conotrachelus dubiae O'Brien, 1995 (Coleoptera: Curculionidae em camu-camu [Myrciaria dubia (H.B.K. McVaugh, Myrtaceae] tinha sido constatada somente em populações naturais. Relata-se sua ocorrência em um cultivo experimental, onde se avaliou os danos de C. dubiae em frutos de camu-camu, em diferentes graus de amadurecimento, entre 1999 e 2003. Os danos causados pela larva aumentaram com o amadurecimento dos frutos, havendo maior comprometimento da polpa do fruto (30 a 90% do que das sementes (7%. A incidência desse inseto pode implicar em perdas quantitativas significativas na produção de camu-camu.In Brazil, the occurrence of Conotrachelus dubiae O'Brien, 1995 (Coleoptera: Curculionidae in camu-camu [Myrciaria dubia (H.B.K. McVaugh, Myrtaceae] had only been verified in natural populations. This report describes its occurrence in an experimental cultivation, where damage of camu-camu fruits by C. dubiae at different ripening stages was evaluated between 1999 and 2003. The damage caused by the larva increased with the degree of ripening of the fruits, with greater damage of fruit pulp (30 to 90% than to seeds (7%. The incidence of this insect may cause significant quantitative losses in the camu-camu production.

  9. Biology and life history of Argopistes tsekooni (Coleoptera: Chrysomelidae) in China, a promising biological control agent of Chinese privet.

    Science.gov (United States)

    Y-Z Zhang; J. Sun; J.L. Hanula

    2009-01-01

    The biology and life history of Argopistes tsekooni Chen (Coleoptera: Chrysomelidae), a potential biological control agent of Chinese privet, Ligustrum sinense Lour., was studied under laboratory and outdoor conditions in Huangshan City of Anhui Province, China, in 2006. A. tsekooni larvae are leafminers that...

  10. Micro-CT unveils the secret life of the coffee berry borer (Hypothenemus hampei; Coleoptera, Curculionidae: Scolytinae) inside coffee berries

    Science.gov (United States)

    The coffee berry borer (Hypothenemus hampei (Ferrari); Coleoptera: Curculionidae: Scolytinae) is the most important insect pest of coffee worldwide, and due to the cryptic life habit of the insect inside coffee berries, effective pest management strategies have been difficult to develop. In this pap...

  11. Evaluation of lure combinations containing essential oils and volatile spiroketals for detection of host-seeking Xyleborus glabratus (Coleoptera: Curculionidae: Scolytinae)

    Science.gov (United States)

    The invasive redbay ambrosia beetle, Xyleborus glabratus Eichhoff (Coleoptera: Curculionidae: Scolytinae) vectors the fungal pathogen (Raffaelea lauricola) that causes laurel wilt, a disease responsible for widespread mortality of trees in the Lauraceae in the southeastern U.S. Early detection of in...

  12. Nuevos datos de distribución de los Cholevinae hipogeos del Atlas marroquí (Coleoptera, Leiodidae

    Directory of Open Access Journals (Sweden)

    Fresneda, J.

    2006-12-01

    Full Text Available New distribution data for the hypogean Cholevinae from the Moroccan Atlas (Coleoptera, Leiodidae The authors report new findings on the distribution of Speonemadus maroccanus (Jeannel, 1936, Nargus (Demochrus rufipennis (Lucas, 1846, Choleva (Choleva kocheri Henrot, 1962 and Catops fuscus fuscoides Reitter, 1909. The geonemy of these species is updated and the research is illustrated with maps of their distribution.

  13. Flight periodicity of the Douglas-fir beetle, Dendroctonus pseudotsugae Hopkins (Coleoptera: Curculionidae: Scolytinae) in Colorado, U.S.A

    Science.gov (United States)

    Jose F. Negron; Willis C. Schaupp; Lee Pederson

    2011-01-01

    There are about 500 species of bark beetles (Coleoptera: Curculionidae: Scolytinae) in the United States (Wood 1982). A number of them are important disturbance agents in forested ecosystems, occasionally creating large tracts of dead trees. One eruptive species is the Douglas-fir beetle, Dendroctonus pseudotsugae Hopkins, which utilizes Douglas-fir, Pseudotsuga...

  14. Effects of pheromone and plant volatile release rates and ratios on trapping Anoplophora glabripennis (Coleoptera: Cerambycidae) in China

    Science.gov (United States)

    P.S. Meng; R.T. Trotter; M.A. Keena; T.C. Baker; S. Yan; E.G. Schwartzberg; K. Hoover

    2014-01-01

    Native to China and Korea, the Asian longhorned beetle, Anoplophora glabripennis (Motschulsky) (Coleoptera: Cerambycidae), is a polyphagous wood-boring pest for which a trapping system would greatly benefit eradication and management programs in both the introduced and native ranges. Over two field seasons, a total of 160 flight intercept panel traps...

  15. Microbial control of emerald ash borer, Agrilus planipennis (Coleoptera: Buprestidae) with Beauveria bassiana strain GHA: Greenhouse and field trials

    Science.gov (United States)

    Houping Liu; Leah S. Bauer

    2008-01-01

    In 2003-2004, the lethal and sublethal effects of Beauveria bassiana strain GHA on emerald ash borer, Agrilus planipennis (Coleoptera: Buprestidae) adults and larvae were evaluated using topical spray and fungal band treatments in the greenhouse and field. B. bassiana strain GHA was moderately effective against...

  16. Developmental plasticity in Tenebrio molitor (Coleoptera: Tenebrionidae): Analysis of Instar Variation in Number and Development Time under Different Diets

    Science.gov (United States)

    The variation in instar number and the pattern of sequential instar development time of Tenebrio molitor L. (Coleoptera: Tenebrionidae) was studied under 4 different diet regimes. Addition of dietary supplements consisting of dry potato or a mix of dry potato and dry egg whites significantly reduced...

  17. Distribution of trunk-injected 14C-imidacloprid in ash trees and effects on emerald ash borer (Coleoptera: Buprestidae) adults

    Science.gov (United States)

    David Mota-Sánchez; Bert M. Cregg; Deborah G. McCullough; Therese M. Poland; Robert M. Hollingworth

    2009-01-01

    The emerald ash borer (EAB), Agrilus planipennis (Coleoptera: Buprestidae) is a destructive exotic pest of North American ash (Fraxinus sp.) trees. Trunk injection of imidacloprid is commonly used to protect landscape ash trees from A. planipennis damage. Efficacy can vary and little is known about the...

  18. Limited predation potential by adult and larval lady beetles (Coleoptera: Coccinellidae) on Nezara viridula (Hemiptera: Pentatomidae) eggs and nymphs

    Science.gov (United States)

    The Coccinellidae (Coleoptera) co-occur in many habitats with many arthropods that are of suitable size as prey. The Pentatomidae (Hemiptera) are one such group of insects with eggs and early instars that could be susceptible to predation by Coccinellidae. The objective of this laboratory study wa...

  19. Rearing Xyleborus volvulus (Coleoptera: Curculionidae) on Media Containing Sawdust from Avocado or Silkbay, with or without Raffaelea lauricola (Ophiostomatales: Ophiostomataceae)

    Science.gov (United States)

    Like other ambrosia beetles, Xyleborus volvulus Fabricius (Coleoptera: Curculionidae) lives in a mutualistic symbiotic relationship with fungi that serve as food source. Until recently, X. volvulus was not considered a pest, and none of its symbionts were considered plant pathogens. However, recent ...

  20. A diversidade inventarial de Coleoptera (Insecta em uma paisagem antropizada do Bioma Araucária The inventory diversity of Coleoptera (Insecta of an anthropized landscape in the Biome Araucaria

    Directory of Open Access Journals (Sweden)

    Norma G. Ganho

    2005-12-01

    Full Text Available Como parte do Projeto PROVIVE, foram analisadas a riqueza de espécies, a composição taxonômica, a proporção de espécies raras e a constância taxonômica ao nível de família relacionada à riqueza de espécies, em comunidades de Coleoptera, em Vila Velha, Ponta Grossa, Paraná. Os dados foram obtidos a partir de coletas através de armadilha malaise no estrato do sub-bosque de cinco áreas com diferentes graus de intervenção antrópica, de setembro de 1999 a agosto de 2000. As 52 semanas de amostragem nas cinco áreas resultaram na coleta de 10.822 indivíduos de 1659 espécies. Todas as áreas apresentaram alta riqueza de espécies e diversidade, como indicado por vários índices. A área em estágio mais avançado de sucessão vegetal foi menos rica do que aquelas em estágio inicial/intermediária. De acordo com diferentes estimadores de riqueza de espécies, o número de espécies coletadas poderia aumentar de 22-123% com o aumento do esforço de coleta. As áreas menos conservadas foram mais ricas em espécies raras ("singletons", "doubletons" e únicas do que as mais conservadas. Nas cinco áreas houve uma constância taxonômica entre as famílias mais ricas (Curculionidae, Chrysomelidae, Cerambycidae, Staphylinidae, Mordelidae, Elateridae, Scarabaeidae, Coccinellidae e Tenebrionidae envolvendo 60% do total de espécies, como observado para a abundância de indivíduos. A existência de um padrão de constância taxonômica de famílias, quando considerados 60% da riqueza de espécies e/ou de abundância de indivíduos por local, poderá tornar mais fácil e rápido o estudo de comunidades de Coleoptera, habilitando a ordem a ser um táxon indicador de condições ambientais de áreas florestadas.The species richness, taxonomic composition, rare species, and taxonomic constancy at family level were studied in communities of Coleoptera in Vila Velha, Ponta Grossa, Paraná, as part of PROVIVE project. The data were gathered

  1. Can Emerald ash borer, Agrilus planipennis (Coleoptera: Buprestidae), emerge from logs two summers after infested trees are cut?

    Science.gov (United States)

    Toby R. Petrice; Robert A. Haack

    2007-01-01

    Emerald ash borer (EAB), Agrilus planipennis Fairmaire (Coleoptera: Buprestidae), is a serious invasive pest of ash trees (Fraxinus spp.) in North America. Much of EAB's range expansion has been attributed to human-assisted movement of infested items such as ash logs and firewood. It is unclear the amount of time that logs cut...

  2. Monitoring the establishment and flight phenology of parasitoids of emerald ash borer (Coleoptera: Buprestidae) in Michigan by using sentinel eggs and larvae

    Science.gov (United States)

    Kristopher J. Abell; Leah S. Bauer; Deborah L. Miller; Jian J. Duan; Roy G. Van Driesche

    2016-01-01

    The emerald ash borer, Agrilus planipennis Fairmaire (Coleoptera: Buprestidae), is an important invasive pest of ash (Fraxinus) trees in North America. Two larval parasitoid species, Tetrastichus planipennisi Yang (Hymenoptera: Eulophidae) and Spathius agrili Yang (Hymenoptera:...

  3. A new Icimauna Martins & Galileo, 1991, from the Bolivian orocline (Coleoptera, Cerambycidae, Lamiinae, Hemilophini).

    Science.gov (United States)

    Santos-Silva, Antonio; Perger, Robert

    2017-04-07

    The Neotropical longhorned beetle tribe Hemilophini has been reviewed by Martins & Galileo (2014a, b) and currently contains 542 species (Monné 2017). Some of the most conspicuous longhorned beetle taxa are found in this tribe, for example species with a pair of cephalic horns (Phoebe Audinet-Serville, 1835), or others that strongly resemble to noxious Lycidae (Coleoptera) (e.g. Apeba Martins & Galileo, 1991, Calocosmus Chevrolat, 1862, or Lycidola Thomson, 1864) (see Lingafelter 2013; Martins & Galileo 2014a, b).

  4. Associação forética entre larvas de Rheotanytarsus (Chironomidae, Tanytarsini e adultos de Elmidae (Coleoptera, coletados em córregos no Parque Estadual de Campos do Jordão, São Paulo, Brasil Phoretic association between larvae of Rheotanytarsus and adult of Coleoptera, collected from State Park Campos do Jordão, São Paulo State, Brazil

    Directory of Open Access Journals (Sweden)

    Melissa O. Segura

    2007-06-01

    Full Text Available Esta nota registra a ocorrência de foresia entre larvas de Rheotanytarsus Thienemann & Bause, 1913 (Chironomidae, Tanytarsini e adultos de Hexacylloepus Hinton, 1940 e Microcylloepus Hinton, 1935 (Coleoptera, Elmidae. Os exemplares foram obtidos em córregos no Parque Estadual de Campos de Jordão, Estado de São Paulo, Brasil.This note reports phoresy between larvae of Rheotanytarsus Thienemann & Bause, 1913 (Chironominae, Tanytarsini and adult of Hexacylloepus Hinton, 1940 and Microcylloepus Hinton, 1935 (Coleoptera, Elmidae. The specimens had been collected in streams from State Park Campos do Jordão, São Paulo State, Brazil.

  5. Especies de dryophthorinae (coleoptera: curculionidae) asociadas a plátano y banano (musa spp.) en colombia

    OpenAIRE

    RUBIO-GOMEZ, JOSE; SEPULVEDA-CANO, PAULA

    2009-01-01

    RESUMEN

    Se presenta una sinopsis de los escarabajos de la subfamilia Dryophthorinae (Coleoptera: Curculionidae) asociados a cultivos de plátano y banano en Colombia. Adicionalmente se ofrecen claves ilustradas para las especies del país. Se registran seis especies asociadas a dichos cultivos: Cosmopolites sordidus (Germar, 1824), Metamasius hemipterus (Linnaeus, 1758), Metamasius hebetatus (Gyllenhal, 1838), Metamasius submaculatus Champion, 1910, Rhyncophorus palmarum...

  6. Sanitation options for managing oak wood infested with the invasive goldspotted oak borer (Coleoptera: Buprestidae) in Southern California

    Science.gov (United States)

    Michael I. Jones; Tom W. Coleman; Andrew D. Graves; Mary Louise. Flint; Steven J. Seybold

    2013-01-01

    Movement of invasive wood-boring insects in wood products presents a threat to forest health and a management challenge for public and private land managers. The goldspotted oak borer, Agrilus auroguttatus Schaeffer (Coleoptera: Buprestidae), is a new pest in San Diego and Riverside Cos., CA, believed to have been introduced on firewood. This beetle...

  7. Biology of Pityophthorus pulchellus tuberculatus (Coleoptera: Curculionidae: Scolytinae) in Lodgepole Pine in Northern Idaho.

    Science.gov (United States)

    Furniss, Malcolm M; Kegley, Sandra J

    2018-04-19

    The twig beetle, Pityophthorus pulchellus tuberculatus Eichhoff, infests dead branches of pines in western United States and Canada, including lodgepole pine, Pinus contorta Douglas, in northern Idaho. Adult broods overwintered in their host and emerged and colonized new hosts in late April. Males initiated galleries and were joined by up to seven females, each of which constructed an egg gallery radiating from a central chamber. Galleries had an average of 4.7 egg niches each with an egg that was large relative to the mother beetle. Two larval instars were recognized. Dentition of larval mandibles differed in shape from that in literature. Mature larvae pupated either in a cell excavated on the wood surface or in a cell below the wood surface. First-generation adults mined extensively in the inner bark and wood before emerging to infest new trees in late June. Their progeny became adults beginning in early August and likewise mined and fed on the inner bark and wood before overwintering. Predacious beetles present as larvae in the galleries included Enoclerus lecontei (Wolcott) (Coleoptera: Cleridae) and Lasconotus sp. (Coleoptera: Zopheridae). Parasitoid Hymenoptera reared from infested trees were Cosmophorus pityophthori Rohwer (Braconidae), Phasmidiasta n. sp. (Braconidae), Spathius sp. (Braconidae), Acerocephala n. sp. (Pteromalidae), Metacolus fasciatus Girault (Pteromalidae), Rhaphitelus maculatus Walker (Pteromalidae), Rhopalicus sp. (Pteromalidae), and an unidentified pteromalid.

  8. Otiorhynchus spp. (Coleoptera: Curculionidae) as pests in horticulture: genetics and management options with entomopathogenic fungi

    OpenAIRE

    Hirsch, Jacqueline

    2012-01-01

    Worldwide, weevils of the genus Otiorhynchus (Coleoptera: Curculionidae) cause damage with detrimental economic effects to many horticultural crops due to the root feeding of their larvae as well as foliage feeding of their adults. Aside from the black vine weevil Otiorhynchus sulcatus, which is the best-known pest within this genus, numerous other Otiorhynchus species have been increasingly recognized as pests in recent years. Nocturnal adult weevils and soil-inhibiting larvae are in princip...

  9. Distribución y patrones de diversidad de los Afódidos en la Comunidad de Madrid (Coleoptera, Scarabaeoidea, Aphodiidae, Aphodiinae y Psammodiinae

    Directory of Open Access Journals (Sweden)

    Hortal, J.

    2006-05-01

    Full Text Available In this work we present an updated checklist of the Aphodiidae (Coleoptera, Scarabaeoidea from Comunidad de Madrid (Spain. In addition, the observed and potential distributions of the 70 species found in Madrid are mapped. The potential spatial distributions of species richness, rarity and endemism in this region are also mapped. Finally, we discuss briefly the origin of the observed patterns.

    En este trabajo se presenta un inventario actualizado de los Aphodiidae (Coleoptera, Scarabaeoidea de la Comunidad de Madrid. Además, se presentan mapas de la distribución observada y potencial de las 70 especies encontradas en Madrid, así como de la distribución espacial de la riqueza, rareza, y endemicidad potencial en la región. Finalmente, se discute brevemente el origen de los patrones observados.

  10. Influence of elevation on bark beetle (Coleoptera: Curculionidae, Scolytinae) community structure and flight periodicity in ponderosa pine forests of Arizona

    Science.gov (United States)

    Kelly K. Williams; Joel D. McMillin; Tom E. DeGomez; Karen M. Clancy; Andy Miller

    2008-01-01

    We examined abundance and flight periodicity of five Ips and six Dendroctonus species (Coleoptera: Curculionidae, Scolytinae) among three different elevation bands in ponderosa pine (Pinus ponderosa Douglas ex. Lawson) forests of northcentral Arizona. Bark beetle populations were monitored at 10 sites in each of three elevation...

  11. Red Turpentine Beetle, Dendroctonus valens LeConte (Coleoptera: Scolytidae), Response to Host Semiochemicals in China

    Science.gov (United States)

    Jianghua Sun; Zhengwan Miao; Zhen Zhang; Zhongning Zhan; Nancy Gillette

    2004-01-01

    The response of the introduced red turpentine beetle, Dendroctonus valens LeConte, to host semiochemicals in Shanxi Province, China, was distinctly different from that reported in previous studies conducted in the western part of the native range of D. valens in the central Sierra Nevada, CA. This Þnding suggests either that...

  12. (S)-(+)-Ipsdienol: Interspecific Inhibition of Ips latidens (LeConte) by Ips pini (Say) (Coleoptera: Scolytidae)

    Science.gov (United States)

    Daniel R. Miller; John H. Borden

    1992-01-01

    In south-central British Columbia, the attraction of Ips latidens (LeConte) to its pheromone, ipsenol, was inhibited by (S)-(+)-ipsdienol, a pheromone for I. pini (Say). (R)-(-)-Ipsdienol had no effect on I. latidens. (S)-(+)-lpsdienol probably plays a role in interspecific communication between the two species...

  13. On the Biology of the Bark Beetle Scolytus nitidus Schedl (Coleoptera: Scolytidae Attacking Apple Orchards

    Directory of Open Access Journals (Sweden)

    LAKATOS, Ferenc

    2007-01-01

    Full Text Available The biological characters of Scolytus nitidus were investigated both in the field and in thelaboratory as well. This common shot-hole borer overwinters in larval stage on apple trees in Kashmir.After emergence the adults fly to suitable trees and undergo maturation feeding for 4-6 days. Thecopulation takes place at the entrance hole. The maternal gallery is one armed longitudinal, in average4.6 cm long. The female lays 52 eggs on an average. The eggs hatch in 5 to 7 days. The larvae have 5instars and complete their development in 38 to 50 days constructing larval galleries 5-8 cm in length.The larvae pupate for 6-18 days and finally the adults emerge to attack new suitable trees. The adultslive for 45-60 days and the total life-span of this species ranges from 97 to 124 days. The seasonaldistribution of various life stages and the number of generations were also recorded.

  14. An annotated checklist of the aquatic Polyphaga (Coleoptera) of Egypt I. Family Hydraenidae.

    Science.gov (United States)

    Salah, Mohamed; Cueto, Juan Antonio Régil; Valladares, Luis F

    2014-10-16

    Data from previous literature were used to compile a checklist of the Egyptian fauna of Hydraenidae (Coleoptera). The checklist includes data on the type localities, type specimens, descriptors, distributions and previous literature for 15 valid species belonging to 3 genera (Hydraena, Limnebius and Ochthebius). Ochthebius was represented by 13 species, while Hydraena and Limnebius were represented only by a single species for each of them. The present study provides a summary that can serve as the basis for future progress in the knowledge of the Egyptian Hydraenidae. 

  15. Survival and phenology of Agrilus planipennis (Coleoptera: Buprestidae) reared on a newly developed artificial diet free of host material

    Science.gov (United States)

    Melody A. Keena; Hannah Nadel; Juli. Gould

    2015-01-01

    The final phase in the development of an artificial diet that contains no ash host material and the phenology of the emerald ash borer, Agrilus planipennis Fairmaire (Coleoptera: Bupresidae) on that diet are documented. A diet containing powdered ash phloem exists, but host material introduces potential variability and contamination, and the cost and...

  16. The historical role of Ips hauseri (Coleoptera: Curculionidae) in the spruce forest of Ile-Alatausky and Medeo National Parks

    Science.gov (United States)

    N. Mukhamadiev; A. Lynch; C. O' Connor; A. Sagitov; N. Ashikbaev; I. Panyushkina

    2014-01-01

    On 17 May and 27 June 2011 severe cyclonic storms damaged several hundred hectares of spruce forest (Picea schrenkiana) in the Tian Shan Mountains. Bark beetle populations increased rapidly in dead and damaged trees, particularly Ips hauseri, I. typographus, I. sexdentatus, and Piiyogenesperfossus (all Coleoptera: Curculionidae), and there is concern about the...

  17. Coleópteros de Colombia: 50 Especies llamativas (Insecta: Coleoptera Un Manual Educativo. Pág. 205-208

    Directory of Open Access Journals (Sweden)

    Maritza Yurieth García Montes

    2013-03-01

    Full Text Available Coleópteros de Colombia- 50 especies llamativas (Insecta: Coleoptera un manual educativo, se presenta como requisito parcial para optar al título de Licenciada en Biología de la UPN, y surge de la necesidad de iniciar programas de sensibilización y movilización frente a la Biota Colombiana, debido a la alta biodiversidad de Colombia, alto grado de amenaza y bajo conocimiento de las especies (Humboldt, 1995. Como docentes, sabemos que la conservación de la biodiversidad es un desafío para la comunidad educativa, y que se requieren más trabajos, que promuevan conocimientos y valores apropiados frente a los recursos naturales. De allí, que el manual educativo, busque acercar a estudiantes, profesores de secundaria y público en general, al conocimiento, importancia y utilidad de los Coleópteros (Insecta: Coleoptera. Estableciéndose como una opción, en el proceso de enseñanza- aprendizaje de la biología, al combinar la investigación biológica y pedagógica alrededor de la escuela.

  18. Podisus distinctus (Heteroptera: Pentatomidae) females are lighter feeding on Tenebrio molitor (Coleoptera: Tenebrionidae) pupae subjected to ventral nerve cord transection

    Science.gov (United States)

    The movement observed in the Tenebrio molitor L., 1758 (Coleoptera: Tenebrionidae) pupae can be a type of defense strategy. This makes it significant to study the development and reproduction of the predatory stinkbugs Asopinae with the immobilized pupae of this prey. The aim was to evaluate the per...

  19. Distribución espacio-temporal de hormigas en un gradiente de luz, dentro de un sistema agroforestal de café, en Turrialba, Costa Rica

    Directory of Open Access Journals (Sweden)

    Edgar H Varón

    2007-12-01

    Full Text Available En los sistemas agroforestales de café (Coffea arabica L. de Mesoamérica es frecuente la presencia de árboles de sombra. Estos sistemas pueden albergar una rica entomofauna, incluyendo hormigas, la cuales podrían depredar a plagas claves en dichos sistemas. Sin embargo, se desconoce el papel de la sombra sobre la distribución y abundancia de dichas hormigas, lo cual podría sugerir pautas para manipular ciertas condiciones de su hábitat y lograr su conservación e incremento. Por tanto, se estudió el efecto de la sombra sobre la distribución espacial y temporal de tres especies de hormigas (Solenopsis geminata, Pheidole radoszkowskii y Crematogaster curvispinosa que pueden depredar a la broca del café, Hypothenemus hampei (Coleoptera: Scolytidae y al barrenador de las meliáceas, Hypsipyla grandella. Para ello se evaluó su abundancia a través de un gradiente de sol-sombra en un cafetal con cuatro parcelas alternas (desde pleno sol hasta sombra total, en Turrialba, Costa Rica. En la comunidad estudiada se recolectaron 28 especies de hormigas, de las cuales S. geminata fue la dominante (79 % del total de individuos, seguida por P. radoszkowskii (16 %. S. geminata y C. curvispinosa prefirieron las áreas soleadas, mientras que P. radoszkowskii no mostró una preferencia definida. Asimismo, en cuanto a su ubicación, S. geminata predominó en el suelo, mientras que P. radoszkowskii y C. curvispinosa lo hicieron en los arbustos de café.Temporal and spatial distribution of ants in a light gradient, in a coffee agroforestry system, Turrialba, Costa Rica. Shade trees are frequently present in coffee (Coffea arabica L. agroforestry systems of Mesoamerica. These systems can harbor a rich entomofauna, including ants, which could be predators of key pests in these systems. However, the role of shade on the distribution and abundance of these ants is unknown, yet such knowledge could suggest guidelines for manipulating certain environmental

  20. Espécies de Gorybia Pascoe (Coleoptera, Cerambycidae, Piezocerini ocorrentes na Bolívia

    Directory of Open Access Journals (Sweden)

    Maria Helena M. Galileo

    2013-03-01

    Full Text Available Species of Gorybia Pascoe (Coleoptera, Cerambycidae, Piezocerini occurring in Bolivia. The genus Gorybia (Cerambycinae, Piezocerini consists of 45 described species with seven species recorded from Bolivia. Nine new species are described herein from Bolivia: G. abnormalis sp. nov.; G. alveolata sp. nov.; G. asyka sp. nov.; G. florida sp. nov.; G. inarmata sp. nov.; G. longithorax sp. nov.; G. guenda sp. nov.; G. tuberosa sp. nov. and G. wappesi sp. nov. A key to the species now known to occur in Bolivia is included.

  1. Fauna de coleópteros aquáticos (insect: coleoptera na Amazônia central, Brasil Aquatic Beetlefauna (insecta: coleoptera in Central Amazonia, Brazil

    Directory of Open Access Journals (Sweden)

    Cesar João Benetti

    2003-12-01

    Full Text Available Foram coletados 888 exemplares de Coleoptera aquáticos nos municípios de Manaus, Manacapuru e Presidente Figueiredo (AM, de fevereiro de 2000 a agosto de 2002, distribuídos em 12 famílias, 50 gêneros e 88 espécies ou morfoespécies. Novas ocorrências para o Brasil, incluem as seguintes espécies de Dytiscidae: Hydrodessus robinae, H. surinamensis, Hypodessus frustrator, Neobidessus confusus, N. spangleri e N. woodruffi. Os gêneros Agaporomorphus (Dytiscidae e Pronoterus (Noteridae são registrados pela primeira vez para o estado do Amazonas, assim como as espécies: P. punctipennis e Suphisellus nigrinus (Noteridae; Agaporomorphus grandisinuatus, Bidessonotus tibialis, Derovatellus lentus,Desmopachria nitida, Hydaticus xanthomelas, Laccophilus tarsalis, Liodessus affinis e Megadytes laevigatus (Dytiscidae. A família Dytiscidae foi a que apresentou maior riqueza, com 34 espécies, seguida de Hydrophilidae, com 20 e Noteridae, com 12 espécies. Os gêneros com maior número de espécies foram Gyretes (Gyrinidae e Suphisellus (Noteridae com 6 espécies, Copelatus (Dytiscidae e Tropisternus (Hydrophilidae, com 5 espécies.In this work, 888 specimens of aquatic Coleoptera were collected in Manaus, Manacapuru and Presidente Figueiredo counties (AM, distributed in 12 families, 50 genera and 88 species or morphospecies. New occurrences in Brasil include the following species of Dytiscidae: Hydrodessus robinae, H. surinamensis, Hypodessus frustrator, Neobidessus confusus, N. spangleri and N. woodruffi. The genera Agaporomorphus (Dytiscidae and Pronoterus (Noteridae were reported for the first time in the State of Amazonas, as well as the species P. punctipennis and Suphisellus nigrinus (Noteridae; Agaporomorphus grandisinuatus, Bidessonotus tibialis, Derovatellus lentus,Desmopachria nitida, Hydaticus xanthomelas, Laccophilus tarsalis, Liodessus affinis and Megadytes laevigatus (Dytiscidae. The family Dytiscidae presented the highest richness

  2. Evaluating the use of plastic bags to prevent escape of the emerald ash borer, Agrilus planipennis (Coleoptera: Buprestidae) from firewood

    Science.gov (United States)

    Therese M. Poland; Tina M. Ciaramitaro; Deepa S. Pureswaran; Andrea Diss-Torrance

    2008-01-01

    The emerald ash borer, Agrilus planipennis Fairmaire (Coleoptera: Buprestidae), is a highly destructive exotic pest of ash (Fraxinus) in North America. Human movement of infested logs, primarily pieces of firewood, is a major pathway for long distance spread of the beetle. Firewood may be confiscated at campgrounds, rest-areas, and...

  3. Brachylophora, a new brachypterous genus of Rhopalophorini (Coleoptera, Cerambycidae

    Directory of Open Access Journals (Sweden)

    Robin O. S. Clarke

    2011-06-01

    Full Text Available Brachylophora, a new brachypterous genus of Rhopalophorini (Coleoptera, Cerambycidae. Brachylophora auricollis (Bruch, 1918 comb. nov. = Pasiphyle auricollis Bruch, 1918, originally described from Argentina (Salta, is redescribed and illustrated. Although with reduced elytra, the genus is transferred from Rhinotragini to Rhopalophorini based on the following characters: eyes well separated in both sexes, frons between eyes depressed and lacking frontal suture; pro-, meso-, and metasternum planar; mesothorax parallel-sided, not at all declivous before mesosternal process; metasternum large, together with mesosternum twice length of prosternum, metepisternum very wide, entire suture separating it from metasternum clearly visible when viewed from below; female ovipositor shortened with short cylindrical styles; and, more generally, structural features of hind legs, and surface ornamentation. Habitus similar to Coremia group. Bolivian specimens were netted as they visited flowers of Croton sp. (Euphorbiaceae.

  4. EFFECTS OF WEEVILS (INSECTA: COLEOPTERA: CURCULIONIDAE) CONTROL PRODUCTS, OVER THE GROWTH, DEVELOPMENT, AND PRODUCTION OF PLANTAIN

    OpenAIRE

    M. Muñoz, Liliana; Cañas, Guillermo L.; Urrea, Aura I.; Guarín, Juan H.

    2013-01-01

    In a farm in the municipality of Andes (Antioquia, Colombia), parcels were planted with Dominico Hartón plantain associated with Caturra-type coffee, where weevil damage (Insecta: Coleoptera: Curculionidae) occurred in 100% of the plantain plants, corms of approximately 2 kg were planted under the same association system. From the sowing until harvest, six types of products were applied every two months on these plantations: chemical of the region (Clorpirifos and Carboxin + Thiram), Carbofur...

  5. Alphus marinonii sp. nov., nova espécie para o Peru e Brasil (Coleoptera, Cerambycidae, Lamiinae

    Directory of Open Access Journals (Sweden)

    Diego de Santana Souza

    2013-03-01

    Full Text Available Alphus marinonii sp. nov., new species from Peru and Brazil (Coleoptera, Cerambycidae, Lamiinae. A new species of Alphus, A. marinonii sp. nov., from Peru and Brazil (Rondônia is described. Key to identification and pictures for the four species of the genus are provided. Notes on distribution of A. tuberosus are included, with a new record for Peru and Brazil (Goiás and Mato Grosso do Sul.

  6. Gross anatomy of central nervous system in firefly, Pteroptyx tener (Coleoptera: Lampyridae)

    Science.gov (United States)

    Hudawiyah, Nur; Wahida, O. Nurul; Norela, S.

    2015-09-01

    This paper describes for the first time the organization and fine structure of the central nervous system (CNS) in the fireflies, Pteroptyx tener (Coleoptera: Lampyridae). The morphology of the CNS was examined by using Carl Zeiss AxioScope A1 photomicroscope with iSolution Lite software. Some specific structural features such as the localization of protocerebrum, deutocerebrum and tritocerebrum in the brain region were analyzed. Other than that, the nerve cord and its peripheral structure were also analyzed. This study suggests that, there is a very obvious difference between male and female central nervous system which illustrates that they may differ in function in controlling physiological and behavioral activities.

  7. Evaluating the virulence and longevity of non-woven fiber bands impregnated with Metarhizium anisopliae against the Asian longhorned beetle, Anoplophora glabripennis (Coleoptera: Cerambycidae)

    Science.gov (United States)

    Ryan P. Shanley; Melody Keena; Micheal M. Wheeler; Jarrod Leland; Ann E. Hajek

    2009-01-01

    Fiber bands impregnated with entomopathogenic fungi (=fungal bands) provide an effective method for controlling the invasive Asian longhorned beetle, Anoplophora glabripennis (Motschulsky) (Coleoptera: Cerambycidae). In this study we investigated the effective longevity of fungal bands for use against A. glabripennis, using...

  8. Entomopathogenic fungi as a biological control agents for the vector of the laurel wilt disease, the redbay ambrosia beetle, Xyleborus glabratus (Coleoptera: Curculionidae)

    Science.gov (United States)

    The redbay ambrosia beetle (RAB), Xyleborus glabratus (Coleoptera: Curculionidae: Scolytinae) vectors the fungal pathogen, Raffaelea lauricola, which causes laurel wilt (LW), a lethal disease of trees in the family Lauraceae, including the most commercially important crop in this family, avocado, Pe...

  9. Damage of camu-camu (Myrciaria dubia) fruits by Conotrachelus dubiae (Coleoptera: curculionidae) in Central Amazonia

    OpenAIRE

    Ferreira, Sidney Alberto do Nascimento; Gentil, Daniel Felipe de Oliveira; Silva, Neliton Marques da

    2003-01-01

    No Brasil, a ocorrência de Conotrachelus dubiae O'Brien, 1995 (Coleoptera: Curculionidae) em camu-camu [Myrciaria dubia (H.B.K.) McVaugh, Myrtaceae] tinha sido constatada somente em populações naturais. Relata-se sua ocorrência em um cultivo experimental, onde se avaliou os danos de C. dubiae em frutos de camu-camu, em diferentes graus de amadurecimento, entre 1999 e 2003. Os danos causados pela larva aumentaram com o amadurecimento dos frutos, havendo maior comprometimento da polpa do fruto ...

  10. A new species of oobius trjapitzin (hymenoptera:encyrtidae) from the russian far east that parasitizes eggs of emerald ash borer (coleoptera:buprestidae)

    Science.gov (United States)

    A new egg parasitoid of the emerald ash borer Agrilus planipennis Fairmaire (Coleoptera: Buprestidae) from the Russian Far East, Oobius primorskyensis Yao et Duan is described. Both morphological characters and analysis of DNA sequence divergence suggest that this species is different from the previ...

  11. Orientation behavior of the predator Laricobius nigrinus (Coleoptera: Derodontidae) to hemlock woolly adelgid and host tree odors in a multi-chambered olfactometer

    Science.gov (United States)

    Kimberly F. Wallin; Tanya M. Latty; Darrell W. Ross

    2011-01-01

    We studied the adult ambulatory response of the predator, Laricobius nigrinus Fender (Coleoptera: Derodontidae), to odors from its prey, Adelges tsugae Annand, the hemlock woolly adelgid, and foliage of hemlock woolly adelgid, host hemlocks (Tsuga spp.), and other conifers. Both the predator and hemlock woolly...

  12. Toxomerus duplicatus Wiedemann, 1830 (Diptera: Syrphidae preying on Microtheca spp. (Coleoptera: Chrysomelidae larvae

    Directory of Open Access Journals (Sweden)

    VS Sturza

    Full Text Available Microtheca spp. (Coleoptera: Chrysomelidae are insect pests primarily related to Brassicaceae crops. In the State of Rio Grande do Sul (RS, southern Brazil, they are found on forage turnip, Raphanus sativus L. var. oleiferus Metzg., which is commonly grown during fall/winter seasons. This work reports the predation of Microtheca spp. larvae by Toxomerus duplicatus Wiedemann, 1830 (Diptera: Syrphidae larvae, on forage turnip crop, in Santa Maria, RS. This register provides new information about Microtheca spp. natural enemies in Brazil, which might be a new option for integrate pest management of these species.

  13. The response of ground beetles (Coleoptera: Carabidae) to selection cutting in a South Carolina bottomland hardwood forest

    Science.gov (United States)

    Michael D. Ulyshen; James L. Hanula; Scott Horn; John C. Kilgo; Christopher E. Moorman

    2005-01-01

    We compared the response of ground beetles (Coleoptera: Carabidae) to the creation of canopy gaps of different size (0.13, 0.26, and 0.50 ha) and age (1 and 7 years) in a bottomland hardwood forest (South Carolina, USA). Samples were collected four times in 2001 by malaise and pitfall traps placed at the center and edge of each gap, and 50 m into the surrounding forest...

  14. Micafungin induced apoptosis in Candida parapsilosis independent of its susceptibility to micafungin

    Directory of Open Access Journals (Sweden)

    Fazal Shirazi

    2015-10-01

    Full Text Available We hypothesized that the cell wall inhibitor micafungin (MICA induces apoptosis in both MICA-susceptible (MICA-S and MICA–non-susceptible (MICA-NS Candida parapsilosis. Antifungal activity and apoptosis were analyzed in MICA-S and MICA-NS C. parapsilosis strains following exposure to micafungin for 3 h at 37°C in RPMI 1640 medium. Apoptosis was characterized by detecting phosphatidylserine externalization (PS, plasma membrane integrity, reactive oxygen species (ROS generation, mitochondrial membrane potential changes, adenosine triphosphate (ATP release, and caspase-like activity. Apoptosis was detected in MICA exposed (0.25 to 1 mg/L susceptible C. parapsilosis strains and was associated with apoptosis of 20-52% of analyzed cells versus only 5-30% of apoptosis in MICA-NS cells exposed to micafungin (0.5 to 2 mg/L; P = 0.001. The MICA antifungal activity was correlated with apoptotic cells showing increased dihydrorhodamine-123 staining (indicating ROS production, Rh-123 staining (decreased mitochondrial membrane potential, elevated ATP, and increased metacaspase activity. In conclusion, MICA is pro-apoptotic in MICA-S cells, but still exerts apoptotic effects in MICA –NS C. parapsilosis.

  15. Species of beetles (Coleoptera; Scarabaeidae associated to banana (Musa spp. in Ceballos, Ciego de Avila, Cuba

    Directory of Open Access Journals (Sweden)

    Maria Luisa Sisne Luis

    2016-03-01

    Full Text Available A white light trap was placed in bananas plantations, according to Sisne, 2009 and MINAG, 1985, in the Citric enterprise of Ciego de Ávila during the period between May and July of 2010 with the objective of determining the composition of genus and species of the order Coleoptera family Scarabaeidae associated to the agroecosystem. The species Cyclocephala cubana Chapin, Phyllophaga puberula Duval, and Phyllophaga patruelis Chev. are associated to bananas crops in these areas.

  16. Significantly higher Carabid beetle (Coleoptera: Carabidae) catch in conventionally than in organically managed Christmas tree plantations

    DEFF Research Database (Denmark)

    Bagge, Søren; Lund, Malthe; Rønn, Regin

    2012-01-01

    Carabid beetles play an important role as consumers of pest organisms in forestry and agriculture. Application of pesticides may negatively affect abundance and activity of carabid beetles, thus reducing their potential beneficial effect. We investigated how abundance and diversity of pitfall...... trapped carabid beetles (Coleoptera, Carabidae) varied between conventionally and organically managed Caucasian Fir (Abies nordmanniana (Stev.)) plantations, in northern Zealand, Denmark. We recorded significantly higher numbers of carabid beetle specimens and species at conventionally than at organically...

  17. Effectiveness of Cedar Oil Products for Preventing Host Use by Ips avulsus (Eichhoff) (Coleoptera: Curculionidae) in a Modified Small-Bolt Assay

    Science.gov (United States)

    B. L. Strom; L. M. Roton

    2011-01-01

    Insecticide products based on cedar oil are readily available, but evaluations against pine bark beetles (Coleoptera: Curculionidae: Scolytinae) are lacking. In the southeastern U.S., the southern pine beetle, Dendroctonus frontalis Zimm, is the major bark beetle pest for which tree protectants are applied. However, Ips avulsus (Eichhoff) are more consistently...

  18. Behavioral responses of Laricobius spp.and hybrids (Coleoptera: Derodontidae) to hemlock woolly adelgid and adelgid host tree odors in an olfactometer

    Science.gov (United States)

    Arielle L. Arsenault; Nathan P. Havill; Albert E. Mayfield; Kimberly F. Wallin

    2015-01-01

    The predatory species Laricobius nigrinus (Fender) and Laricobius osakensis (Shiyake and Montgomery) (Coleoptera: Derodontidae) have been released for biological control of hemlock woolly adelgid (Adelges tsugae; Hemiptera: Adelgidae) in eastern North America. L. osakensis is native to Japan, whereas L. nigrinus is endemic to the Pacific Northwest of the United States...

  19. Habitat preferences of ground beetle (Coleoptera: Carabidae) species in the northern Black Hills of South Dakota.

    Science.gov (United States)

    Bergmann, David J; Brandenburg, Dylan; Petit, Samantha; Gabel, Mark

    2012-10-01

    Ground beetles (Coleoptera: Carabidae) are a major component of terrestrial invertebrate communities and have been used as bioindicators of habitat change and disturbance. The Black Hills of South Dakota is a small area with a high biodiversity, but the ground beetles of this region are little studied. The habitat preferences of ground beetles in the Black Hills are unknown, and baseline data must be collected if these beetles are to be used in the future as bioindicators. Ground beetles (Coleoptera: Carabidae) were collected from pitfall traps at two sites in each of five kinds of habitats (grassland, bur oak-ironwood forests, ponderosa pine-common juniper forests, aspen-pine forests, and a spruce forest) from which habitat structure characteristics and plant abundance data also were collected. In total, 27 species of ground beetles were identified. Although some species, such as Dicaelus sculptilis Say were found in most habitats, other species showed distinct habitat preferences: Poecilus lucublandus (Say) preferred oak forests, Pasimachus elongatus LeConte preferred grasslands, and Calathus ingratus Dejean preferred high-elevation aspen-pine forests. Pterostichus adstrictus Escholtz was found only in woodlands, and Carabus taedatus Say strictly in higher elevation (over 1,500 m) aspen or coniferous woods, and may represent relict populations of boreal species. Elevation, exposure to sunlight, and cover of woody plants strongly influence the structure of carabid communities in the Black Hills.

  20. Boundaries in ground beetle (Coleoptera: Carabidae) and environmental variables at the edges of forest patches with residential developments

    OpenAIRE

    Davis, Doreen E.; Gagné, Sara A.

    2018-01-01

    Background Few studies of edge effects on wildlife objectively identify habitat edges or explore non-linear responses. In this paper, we build on ground beetle (Coleoptera: Carabidae) research that has begun to address these domains by using triangulation wombling to identify boundaries in beetle community structure and composition at the edges of forest patches with residential developments. We hypothesized that edges are characterized by boundaries in environmental variables that correspond...

  1. Rozšíření rýhovců Rhysodes sulcatus (Fabricius, 1787) a Omoglymmius germari (Ganglbauer, 1892) (Coleoptera: Rhysodidae) v České republice

    Czech Academy of Sciences Publication Activity Database

    Konvička, Ondřej; Čížek, Lukáš

    2015-01-01

    Roč. 6, Sept 1 (2015), s. 111-114 ISSN 1804-2732 R&D Projects: GA ČR GAP504/12/1952 Institutional support: RVO:60077344 Keywords : Coleoptera * distributional maps * faunistics Subject RIV: EH - Ecology, Behaviour

  2. Nesaeoduvalius (gen. n. vailatii sp. n., from Euboia island (Eastern Greece (Coleoptera: Carabidae, Trechinae

    Directory of Open Access Journals (Sweden)

    Achille Casale

    2016-06-01

    Full Text Available Nesaeoduvalius (new genus vailatii Casale & Giachino, new species (Coleoptera: Carabidae: Trechini is described and illustrated from the Euboia (Evvia island (eastern Greece. The new taxon belongs to the Duvalius “isotopic” trechine lineage, but is markedly characterized by the peculiar combination of several morphological features in the general shape, chaetotaxy of head, serrate lateral margins of elytra, and features of male genitalia (both in median lobe of aedeagus and endophallus. Its putative position amongst the trechines of the Duvalius phyletic lineage is discussed. Data on the distribution and habitat of this new, insular and unexpected taxon are also provided.

  3. Relative effects of exophytic predation, endophytic predation, and intraspecific competition on a subcortical herbivore: consequences to the reproduction of Ips pini and Thanasimus dubius.

    Science.gov (United States)

    Aukema, Brian H; Raffa, Kenneth F

    2002-12-01

    We used a laboratory assay to partition the effects of predation and intraspecific competition on the establishment, mating success, and brood development of an endophytic herbivore. We selected a system in which the same predator feeds both exophytically and endophytically on the same prey, to evaluate the role of herbivore feeding guild on predator numerical and functional responses. The bark beetle, Ips pini (Coleoptera: Scolytidae) reproduces within the stems of conifers. Males establish mating chambers under the bark, produce aggregation pheromones, and are subsequently joined by females that construct ovipositional galleries. Thanasimus dubius (Coleoptera: Cleridae) adults prey on adults alighting on the bark surface. T. dubius females then oviposit at the bark beetles' entrance sites, and their larvae prey on developing bark beetle larvae within the tree. We imposed a controlled 3×3 factorial design of prey and predator adult densities on red pine logs. Both predation and competition decreased I. pini reproduction. However, the per capita effect of predation was greater than competition, with one adult T. dubius reducing herbivore reproduction by an equivalent amount as four to five competing males and their harems. Increased densities of adult T. dubius on the plant surface reduced the number of prey captured per predator. Total predation on adults and larvae was similar. However, adult T. dubius on the plant surface ate approximately 18-35 times more I. pini per day than did their endophytic larvae. Within the plant, cannibalism among T. dubius, low herbivore densities, limited feeding times, and presumably the complex gallery architecture of I. pini reduced the number of predator progeny. The progeny of I. pini showed even sex ratios in the absence of predators, but were female biased when predators were present. We quantified a relatively narrow set of predator and prey densities that can generate replacement rates greater than one for this predator

  4. Mass Trapping and Classical Biological Control of Rhynchophorus palmarum L. 1794 (Coleoptera: Curculionidae. A hypothesis based in morphological evidences.

    Directory of Open Access Journals (Sweden)

    Flávio Miguens

    2011-07-01

    Resumo. Coleópteros têm sido descritos como pragas e vetores de nematódeos causadores de Anel Vermelho em diversas palmeiras da família Arecaceae. Rhynchophorus palmarum L (Coleoptera: Curculionidae é uma praga que afeta a cocoicultura e outras palmeiras; e, vetor de Bursaphelencus cocophilus (Cobb Baujard (Nematoda, agente etiológico de Anel Vermelho e de outros nematódeos. Atualmente, recomenda-se o emprego de inimigos naturais e parasitas no manejo integrado de pragas; dentre elas, Rhynchophorinae. Armadilhas de coleta massal são recomendadas no manejo integrado de pragas. Nosso estudo relata, na cocoicultura, a eficiência de armadilhas artesanais de baixo custo e a utilização cariomônios (toletes de cana-de-açúcar e cariômonios mais feromônios (toletes de cana-de-açúcar e machos adultos de R. palmarum como atrativos nas armadilhas. Ácaros ectoparasitas foram identificados nestes coleópteros, por microscopia, que podem ser propostos como parte do manejo integrado desta praga. Armadilhas de coleta massal com cariômonios foram eficientes na captura de R. palmarum e outros Curculionidae. No entanto, armadilhas de coleta massal com cariômonios e feromônios aumentaram a atratividade, em relação às primeiras, para este Coleoptera e Cosmopolites sordidus (Germar (Coleoptera: Curculionidae. Eventualmente, exemplares de R. palmarum apresentavam infecção fúngica. Ácaros ectoparasitas infestavam mais de 50% dos exemplares de R. palmarum. A microanatomia destes ácaros e sua interação com R. palmarum foi preliminarmente descrita. Todos os estágios do ciclo de vida destes ácaros foram identificados no compartimento dos élitros. As evidências morfológicas suportam a hipótese de que estes ácaros podem ser empregados no controle biológico de R. palmarum em um programa de manejo integrado.

  5. Xyleborus bispinatus (Coleoptera: Curculionidae) reared on artificial media using sawdust from avocado or silkbay in presence or absence of the laurel wilt pathogen (Raffaelea lauricola).

    Science.gov (United States)

    Xyleborus bispinatus Eichhoff (Coleoptera: Curculionidae) was reported in Florida for the first time in 2013. Previously, it was unrecognized and not distinguished from the morphologically similar Xyleborus ferrugineus (F.). Like other members of the tribe Xyleborini, X. ferrugineus (and possibly X....

  6. Sex Pheromone of Conophthorus ponderosae (Coleoptera: Scolytidae) in a Coastal Stand of Western White Pine (Pinaceae)

    Science.gov (United States)

    Daniel R. Miller; Harold D. Pierce; Peter de Groot; Nicole Jeans-Williams; Robb Bennett; John H. Borden

    2000-01-01

    An isolated stand of western white pine, Pinus monticola Dougl. ex D. Don, on Texada Island (49°40'N, 124°10'W), British Columbia, is extremely valuable as a seed-production area for progeny resistant to white pine blister rust, Cronartium ribicola J.C. Fisch. (Cronartiaceae). During the past 5 years, cone beetles, ...

  7. Efficacy of “Verbenone Plus” for protecting ponderosa pine trees and stands from Dendroctonus brevicomis (Coleoptera: Curculionidae) attack in British Columbia and California

    Science.gov (United States)

    Christopher J. Fettig; Stephen R. McKelvey; Christopher P. Dabney; Dezene P.W. Huber; Cameron C. Lait; Donald L Fowler; John H. Borden

    2012-01-01

    The western pine beetle, Dendroctonus brevicomis LeConte (Coleoptera: Curculionidae, Scolytinae), is a major cause of ponderosa pine, Pinus ponderosa Douglas ex Lawson, mortality in much of western North America. We review several years of research that led to the identification of Verbenone Plus, a novel four-component...

  8. Descrição da larva de último instar e pupa de Epacroplon cruciatum (Aurivillius (Coleoptera, Cerambycidae, Cerambycinae e notas biológica

    Directory of Open Access Journals (Sweden)

    Juares Fuhrmann

    2012-03-01

    Full Text Available Descrição da larva de último instar e pupa de Epacroplon cruciatum (Aurivillius (Coleoptera, Cerambycidae, Cerambycinae e notas biológicas. Último instar larval e pupa do Hexoplonini sul-americano Epacroplon cruciatum (Aurivillius, 1899 são descritos, ilustrados e disponibilizadas notas biológicas.

  9. Using Landsat satellite imagery to detect small-size forest stands of Pinus nigra Arn. and Pinus sylvestris L. affected by Scolytidae; Uso de imagenes satelite Landsat para la deteccion de rodales de Pinus nigra Arn. y Pinus sylvestris L. afectados por escolitidos

    Energy Technology Data Exchange (ETDEWEB)

    Blanco, E.; Bonet, J. A.; Eizaguirre, M.

    2009-07-01

    Medium resolution images from multispectral sensors like Landsat TM have been extensively used for decades in order to identify decline and defoliation generated by insects and other forest pests. The present work analyses the usefulness of these kinds of images to detect small-size stands of Pinus nigra Arn. and Pinus sylvestris L. affected by Scolytidae attacks. The study area was located in the Solsones region (Eastern Pyrenees), selecting 34 training zones (17 damaged small-size stands and 17 healthy small-size stands). The exploratory analysis of the images was conducted with the ERDAS IMAGINE 8.x. program.The results of the study showed significant differences between the affected and non-affected stands in 5 of the 7 spectral bands analysed. TM5 and TM7 bands were identified as those having the highest power to detect damaged stands. The digital levels obtained and the spaces of characteristics created, both showed trends to group small-size affected stands versus healthy, achieving improvements in the methodological procedure employed. (Author) 31 refs.

  10. A cure for the blues: opsin duplication and subfunctionalization for short-wavelength sensitivity in jewel beetles (Coleoptera: Buprestidae).

    Science.gov (United States)

    Lord, Nathan P; Plimpton, Rebecca L; Sharkey, Camilla R; Suvorov, Anton; Lelito, Jonathan P; Willardson, Barry M; Bybee, Seth M

    2016-05-18

    Arthropods have received much attention as a model for studying opsin evolution in invertebrates. Yet, relatively few studies have investigated the diversity of opsin proteins that underlie spectral sensitivity of the visual pigments within the diverse beetles (Insecta: Coleoptera). Previous work has demonstrated that beetles appear to lack the short-wavelength-sensitive (SWS) opsin class that typically confers sensitivity to the "blue" region of the light spectrum. However, this is contrary to established physiological data in a number of Coleoptera. To explore potential adaptations at the molecular level that may compensate for the loss of the SWS opsin, we carried out an exploration of the opsin proteins within a group of beetles (Buprestidae) where short-wave sensitivity has been demonstrated. RNA-seq data were generated to identify opsin proteins from nine taxa comprising six buprestid species (including three male/female pairs) across four subfamilies. Structural analyses of recovered opsins were conducted and compared to opsin sequences in other insects across the main opsin classes-ultraviolet, short-wavelength, and long-wavelength. All nine buprestids were found to express two opsin copies in each of the ultraviolet and long-wavelength classes, contrary to the single copies recovered in all other molecular studies of adult beetle opsin expression. No SWS opsin class was recovered. Furthermore, the male Agrilus planipennis (emerald ash borer-EAB) expressed a third LWS opsin at low levels that is presumed to be a larval copy. Subsequent homology and structural analyses identified multiple amino acid substitutions in the UVS and LWS copies that could confer short-wavelength sensitivity. This work is the first to compare expressed opsin genes against known electrophysiological data that demonstrate multiple peak sensitivities in Coleoptera. We report the first instance of opsin duplication in adult beetles, which occurs in both the UVS and LWS opsin classes

  11. New records of water beetles (Coleoptera: Haliplidae, Dytiscidae, Gyrinidae from Montenegro (SE Europe

    Directory of Open Access Journals (Sweden)

    Pešić Vladimir M.

    2005-01-01

    Full Text Available The water beetle fauna of Montenegro is still poorly known. In the catalog dealing with water beetles (Hydrochantares and Palpicornia in Yugoslavia Gueorguiev (1971 gives a list of 116 water beetle species from Montenegro. Mikšić (1977 reported the presence of six water beetles species from the Ulcinj area. In the present paper, 19 water beetle species (Coleoptera Hydradephaga are reported, five of which are new for the fauna of Montenegro. All specimens have been deposited in the zoological collection of the department of Biology (Podgorica. In list of the species, we give the locality, the date of sampling, the total number of individuals and the names of collectors.

  12. Attraction of the southern pine beetle, Dendroctonus frontalis, to pheromone components of the western pine beetle, Dendroctonus brevicomis (Coleoptera: Curculionidae: Scolytinae), in an allopatric zone

    Science.gov (United States)

    Deepa S. Pureswaran; Richard W. Hofstetter; Brian T. Sullivan

    2008-01-01

    Subtle differences in pheromone components of sympatric species should be attractive only to the producing species and unattractive or repellent to the nonproducing species, and thereby maintain reproductive isolation and reduce competition between species. Bark beetles Dendroctonus brevicomis and D. frontalis (Coleoptera: Curculionidae) are known to...

  13. Bioactivity of Indonesian mahogany, Toona sureni (Blume (Meliaceae, against the red flour beetle, Tribolium castaneum (Coleoptera, Tenebrionidae Bioatividade do mogno da Indonésia, Toona sureni (Blume (Meliaceae, contra o besouro-das-farinhas, Tribolium castaneum (Coleoptera, Tenebrionidae

    Directory of Open Access Journals (Sweden)

    Sahana Parvin

    2012-09-01

    Full Text Available Bioactivity of Indonesian mahogany, Toona sureni (Blume (Meliaceae, against the red flour beetle, Tribolium castaneum (Coleoptera, Tenebrionidae. The insecticidal activity of Toona sureni (Blume Merr. was evaluated considering repellency, mortality and progeny production of F1 adults of Tribolium castaneum (Herbst, 1797 (Coleoptera, Tenebrionidae. Dried extract of seeds of T. sureni was dissolved in acetone to prepare solution of various concentrations (0.5, 1.0, 2.5 and 5.0%. To test for repellency, the insects were exposed to treated filter paper. Mortality of larvae, pupae and adults was evaluated by the treatment of spraying the insects with different concentrations of T. sureni extract. Residual effect of the extract was also evaluated considering the production of progeny of F1 adults. The highest repellency (93.30% of T. castaneum occurred at the highest concentration (5.0% suspension of T. sureni; while the lowest (0.0% repellency occurred at 0.5% suspension after 1 day of treatment. The highest mortality against adults (86.71%, larvae (88.32% and pupae (85% occurred at 5% suspension at 8 days after application. There was a negative correlation between the concentrations of T. sureni and the production of F1 adult's progeny of T. castaneum. The highest number of progeny (147 of T. castaneum occurred in the control at 7 days after treatment; and the lowest number of progeny (43 occurred at 5.0% concentration in 1 day after treatment. The results show that T. sureni is toxic to T. castaneum and has the potential to control all stages of this insect in stored wheat.Bioatividade do mogno da Indonésia, Toona sureni (Blume (Meliaceae, contra o besouro-das-farinhas, Tribolium castaneum (Coleoptera, Tenebrionidae. A atividade inseticida de Toona sureni (Blume Merr. foi avaliada considerando repelência, mortalidade e a produção de progênie de adultos F1 de Tribolium castaneum (Herbst, 1797 (Coleoptera, Tenebrionidae. Extrato seco de sementes

  14. Preharvest quarantine treatments of Chlorantraniliprole,Clothianidin, & Imidacloprid-based insecticides for control of Japanese beetle Coleoptera:Scarabaeidae)& other scarab larvae in the root zone of field-grown nurserytrees

    Science.gov (United States)

    Japanese beetle, Popillia japonica Newman (Coleoptera: Scarabaeidae), is an important quarantine pest of nurseries. Nursery plant movement from P. japonica-infested regions is regulated by the U.S. Domestic Japanese Beetle Harmonization Plan (DJHP), which classifies states by risk categories. Treatm...

  15. White grubs (Coleoptera, Melolonthidae in the "Planalto Region", Rio Grande do Sul state, Brazil: Key for identification, species richness and distribution

    Directory of Open Access Journals (Sweden)

    Mariana A. Cherman

    2013-09-01

    Full Text Available White grubs (Coleoptera, Melolonthidae in the "Planalto Region", Rio Grande do Sul state, Brazil: Key for identification, species richness and distribution. The objective of this study was to survey the occurrence and geographic distribution of white grub species (Coleoptera, Melolonthidae in cultivated and non-cultivated fields of the "Planalto Region", Rio Grande do Sul state, Brazil and develop a key at genus-level. Twenty-eight species from 15 genera and three subfamilies were recorded: Dynastinae, Melolonthinae and Rutelinae. The species or genera recorded for the first time in the state are: Cyclocephala metrica, C. tucumana, Isonychus albicinctus, Liogenys bidenticeps, L. fusca, L. obesa and L. sinuaticeps, Paranomala violacea, as well as unidentified species of Amononyx, Dicrania, Leucothyreus, Macrodactylus, Plectris and Rhizogeniates. Among the species recorded, 23 were associated with winter crops. Only Cyclocephala metrica, Dyscinetus rugifrons, two species of Leucothyreus and one species of the tribe Sericini were not present in cultivated crop fields. Cyclocephala flavipennis and Diloboderus abderus occurred in most of the municipalities sampled, often associated with Plectris sp., C. modesta and C. putrida. The highest richness of melolonthids was concentrated in the northeast of the Planalto region.

  16. Influence of 60Co gamma radiation on Zabrotes subfasciatus (Bohemann, 1833) (Coleoptera, Curculionidae) and beams Phaseolus vulgaris

    International Nuclear Information System (INIS)

    Moraes Rego, A.F. de; Rodrigues, Z.A.; Oliveira, M.L. de; Santana, M.D.

    1986-01-01

    Influence of gamma radiation on Zabrotes subfasciatus (Boh, 1833) (Coleoptera Bruchidae) and the beans Phaseolus vulgaris (L.). The effects of 60 CO gamma radiation, 50 Gy, on both Phaseolus vulgaris (L.) seedbeans and adults of Zabrotes subfasciatus were studied using the no free choise method. Radiation decreased insect fertility hence insect population and it damage loss of weight and germination of seedbeans. However, radiation resulted in abnamal seedlings, showing various degrees of morphological malformation, although there was no effect on germination rates or seedling vigor. (Author) [pt

  17. An annotated catalogue of the type material of Elateroidea Leach, 1815 (Coleoptera) deposited in the Coleoptera collection of the Museum of Zoology of the University of São Paulo, Brazil.

    Science.gov (United States)

    Ferreira, Vinicius De Souza

    2015-03-25

    The Museum of Zoology of the University of São Paulo (MZSP) houses one of the most important Coleoptera collections of Brazil and Neotropical Region with nearly 900,000 adult mounted material and about 1,500,000 specimens to be mounted. The superfamily Elateroidea Leach, 1815 (including Cantharoidea) comprises about 24,077 described species in 17 families. The MZSP owns type material of Brachypsectridae LeConte & Horn, 1883, Cantharidae, 1856 (1815), Cerophytidae Latreille, 1834, Elateridae Leach 1815, Eucnemidae Eschscholtz, 1829, Lampyridae Rafinesque, 1815, Lycidae Laporte, 1836, Phengodidae LeConte, 1861 and Rhinorhipidae Lawrence, 1988. This catalogue includes type material of 166 species distributed in 69 genera. Among 1,223 type specimens, are 86 holotypes, 1,133 paratypes, 2 allotypes, 1 lectotype and 1 paralectotype.

  18. Los Escarabeidos y Geotrúpidos de la Comunidad de Madrid: lista de especies, distribución geográfica y patrones de diversidad (Coleoptera, Scarabaeoidea, Scarabaeidae y Geotrupidae

    Directory of Open Access Journals (Sweden)

    Lobo, J. M.

    2006-05-01

    Full Text Available In this work we summarize the main characteristics of Geotrupidae and Scarabaeidae (Coleoptera, Scarabaeoidea fauna inhabiting Comunidad de Madrid, including an updated checklist of species as well as maps representing the observed and potential distributions of all species. Geographical variation in species richness, rarity or endemicity was also estimated, with a brief discussion on the geographical pattern obtained.

    En este trabajo se resumen las características fundamentales de la fauna de Geotrupidae y Scarabaeidae (Coleoptera, Scarabaeoidea que habita la Comunidad de Madrid, presentándose un inventario actualizado así como mapas que representan la distribución observada y potencial de todas las especies. Finalmente, se estima la variación geográfica de la riqueza de especies, la rareza o la endemicidad, discutiendo brevemente el patrón geográfico encontrado.

  19. DNA barcoding of Japanese click beetles (Coleoptera, Elateridae).

    Science.gov (United States)

    Oba, Yuichi; Ôhira, Hitoo; Murase, Yukio; Moriyama, Akihiko; Kumazawa, Yoshinori

    2015-01-01

    Click beetles (Coleoptera: Elateridae) represent one of the largest groups of beetle insects. Some click beetles in larval form, known as wireworms, are destructive agricultural pests. Morphological identification of click beetles is generally difficult and requires taxonomic expertise. This study reports on the DNA barcoding of Japanese click beetles to enable their rapid and accurate identification. We collected and assembled 762 cytochrome oxidase subunit I barcode sequences from 275 species, which cover approximately 75% of the common species found on the Japanese main island, Honshu. This barcode library also contains 20 out of the 21 potential pest species recorded in Japan. Our analysis shows that most morphologically identified species form distinct phylogenetic clusters separated from each other by large molecular distances. This supports the general usefulness of the DNA barcoding approach for quick and reliable identification of Japanese elaterid species for environmental impact assessment, agricultural pest control, and biodiversity analysis. On the other hand, the taxonomic boundary in dozens of species did not agree with the boundary of barcode index numbers (a criterion for sequence-based species delimitation). These findings urge taxonomic reinvestigation of these mismatched taxa.

  20. DNA barcoding of Japanese click beetles (Coleoptera, Elateridae.

    Directory of Open Access Journals (Sweden)

    Yuichi Oba

    Full Text Available Click beetles (Coleoptera: Elateridae represent one of the largest groups of beetle insects. Some click beetles in larval form, known as wireworms, are destructive agricultural pests. Morphological identification of click beetles is generally difficult and requires taxonomic expertise. This study reports on the DNA barcoding of Japanese click beetles to enable their rapid and accurate identification. We collected and assembled 762 cytochrome oxidase subunit I barcode sequences from 275 species, which cover approximately 75% of the common species found on the Japanese main island, Honshu. This barcode library also contains 20 out of the 21 potential pest species recorded in Japan. Our analysis shows that most morphologically identified species form distinct phylogenetic clusters separated from each other by large molecular distances. This supports the general usefulness of the DNA barcoding approach for quick and reliable identification of Japanese elaterid species for environmental impact assessment, agricultural pest control, and biodiversity analysis. On the other hand, the taxonomic boundary in dozens of species did not agree with the boundary of barcode index numbers (a criterion for sequence-based species delimitation. These findings urge taxonomic reinvestigation of these mismatched taxa.

  1. Levantamento da fauna de Coleoptera que habita a carcaça de Sus scrofa L., em Curitiba, Paraná A study of the Coleoptera (Insecta fauna that inhabits Sus scrofa L. carcass in Curitiba, Paraná

    Directory of Open Access Journals (Sweden)

    Kleber Makoto Mise

    2007-09-01

    Full Text Available Este trabalho visou levantar a fauna de Coleoptera associada à carcaça de Sus scrofa L.,1758, espécie utilizada como modelo em Entomologia Forense. O acréscimo ou a substituição seqüencial das espécies de insetos pode ser utilizado para estimar o intervalo post mortem (IPM. O experimento foi realizado no Centro Politécnico (UFPR, de setembro de 2005 a setembro de 2006. A cada estação foi sacrificado um suíno de 15 kg no local, colocado em gaiola. A captura dos insetos foi realizada diariamente em bandeja posicionada abaixo da carcaça e em armadilha tipo Shannon modificada, e a cada 14 dias em cinco armadilhas do tipo pit-fall. Foram coletados 4.360 Coleoptera, pertencentes a 112 espécies de 26 famílias, 12 consideradas de importância forense. A coleta ativa realizada na bandeja foi responsável pela maior captura (2.023 espécimes, seguida pela armadilha Shannon modificada (2.016 espécimes e por último pelas do tipo pit-fall (324 espécimes. Staphylinidae foi mais coletada na bandeja e Shannon modificada, e Silphidae na armadilha pit-fall. Os principais hábitos encontrados foram predador/parasita (55%e onívoro (38,05%, com poucas espécies consideradas necrófagas (1,31%.This paper sought to assess the Coleoptera fauna associated with carcasses of Sus scrofa L., 1758, which is usually used as model in Forensic Entomology. The addition and sequential substitution of insect species could be used to estimate the post mortem interval (PMI. The present study took place in Centro Politécnico (UFPR, between september 2005 to september 2006. A pig weighting 15 kg was sacrificed each season and put inside a cage. Sampling is made daily in a tray placed below the carcass and in a Shannon modified trap, and each 14 days in five pit-fall traps. 4,360 beetles were collected, belonging to 112 species of 26 families, 12 were considered of forensic potential. The active collecting made in the tray was responsible for the largest number of

  2. A review of the natural history of adult Cetoniinae (Coleoptera: Scarabaeidae) from Argentina and adjacent countries.

    Science.gov (United States)

    Di Iorio, Osvaldo

    2014-04-17

    A compilation of the known natural history of adult Cetoniinae (Coleoptera: Scarabaeidae) from Argentina and adjacent countries is provided. Food items of adult Cetoniinae include pollen and/or nectar (flower visitors), sap and/or slime flux, ripened fruits on plants, green tissues and leaves, and honey. Of the 36 species of Cetoniinae from Argentina, food items are known only for 11 species (30.5%). Attraction to light and bait-traps, adult activity periods, vertebrate predators, and the occurrence in bird nests are presented and discussed. Other insects that share the same food sources and bait-traps with Cetoniinae are mentioned.

  3. Invertebrate fauna (Coleoptera, Collembola, Diplopoda, Isopoda collected in the karst areas of the Aninei - Locvei Mountains

    Directory of Open Access Journals (Sweden)

    Andrei Giurginca

    2011-08-01

    Full Text Available The authors identified 132 species of invertebrates (14 Oniscidea, 25 Diplopoda,31 Collembola and 62 Coleoptera recently sampled (2001–2006 from the soil and subterranean (MSS and caves environments from the Banat Mountains. Some new,rare and endemic species are discussed. The seasonal changes of the species diversity in the superficial subterranean environments at 0.5 to 1 m in depth are for the first time presented for the Reşiţa – Moldova Nouă synclinorium. The characteristic and preferential species for the mesovoid shallow substratum (MSS, belonging to the analyzed taxa, are identified.

  4. Effectiveness of bifenthrin (Onyx) and carbaryl (Sevin SL) for protecting individual, high-value conifers from bark beetle attack (Coleoptera: Curculionidae: Scolytinae) in the Western United States

    Science.gov (United States)

    Christopher J. Fettig; Kurt K. Allen; Robert R. Borys; John Christopherson; Christopher P. Dabney; Thomas J. Eager; Kenneth E. Gibson; Elizabeth G. Hebertson; Daniel F. Long; A. Steven Munson; Patrick J. Shea; Sheri L. Smith; Michael I. Haverty

    2006-01-01

    High-value trees, such as those located in residential, recreational, or administrative sites, are particularly susceptible to bark beetle (Coleoptera: Curculionidae: Scolytinae) attack as a result of increased amounts of stress associated with drought, soil compaction, mechanical injury, or vandalism. Tree losses in these unique environments generally have a...

  5. Development and survival of the spruce bark beetle, Ips typographus (Coleoptera: Curculionidae: Scolytinae) at low temperatures in the laboratory and the field

    Czech Academy of Sciences Publication Activity Database

    Štefková, Kristýna; Okrouhlík, Jan; Doležal, Petr

    2017-01-01

    Roč. 114, JAN 11 (2017), s. 1-6 E-ISSN 1802-8829 Grant - others:MSM ČR(CZ) LH12098; Lesy ČR(CZ) 08/2009 Institutional support: RVO:60077344 Keywords : Coleoptera * Curculionidae * Scolytinae Subject RIV: ED - Physiology OBOR OECD: Biology (theoretical, mathematical, thermal, cryobiology, biological rhythm), Evolutionary biology Impact factor: 1.167, year: 2016 http://www.eje.cz/pdfs/eje/2017/01/01.pdf

  6. Comparison of male and female emerald ash borer (Coleoptera: Buprestidae) responses to phoebe oil and (Z)-3-hexanol lures in light green prism traps

    Science.gov (United States)

    Gary G. Grant; Therese M. Poland; Tina Ciaramitaro; D. Barry Lyons; Gene C. Jones

    2011-01-01

    We conducted trapping experiments for the emerald ash borer, Agrilus planipennis Fairmaire (Coleoptera: Buprestidae) in Michigan, USA, and Ontario, Canada, to compare unbaited light green sticky prism traps with traps baited with phoebe oil, (Z)-3-hexenol (Z3-6:OH), or blends of other green leaf volatiles (GLVs) with Z3-6:OH. Traps were placed in the...

  7. New records of Paracrias Ashmead (Hymenoptera, Eulophidae as parasitoids on weevil larvae (Coleoptera, Curculionidae in Brazil, with the description of a new species

    Directory of Open Access Journals (Sweden)

    Luciano Palmieri

    2013-09-01

    Full Text Available Paracrias strii Schauff, 1985 and P. ceratophaga Palmieri & Hansson sp. nov. are first record in Brazil and both are associated with Ceratopus Schoenherr larvae (Coleoptera, Curculionidae reared from syconia of two species of fig-trees. Both Paracrias species are diagnosed and illustrated. Males of P. ceratophaga sp. nov. are described. The association of Paracrias with weevil larvae is briefly discussed.

  8. Incorporating a Sorghum Habitat for Enhancing Lady Beetles (Coleoptera: Coccinellidae in Cotton

    Directory of Open Access Journals (Sweden)

    P. G. Tillman

    2012-01-01

    Full Text Available Lady beetles (Coleoptera: Coccinellidae prey on insect pests in cotton. The objective of this 2 yr on-farm study was to document the impact of a grain sorghum trap crop on the density of Coccinellidae on nearby cotton. Scymnus spp., Coccinella septempunctata (L., Hippodamia convergens Guérin-Méneville, Harmonia axyridis (Pallas, Coleomegilla maculata (De Geer, Cycloneda munda (Say, and Olla v-nigrum (Mulsant were found in sorghum over both years. Lady beetle compositions in sorghum and cotton and in yellow pyramidal traps were similar. For both years, density of lady beetles generally was higher on cotton with sorghum than on control cotton. Our results indicate that sorghum was a source of lady beetles in cotton, and thus incorporation of a sorghum habitat in farmscapes with cotton has great potential to enhance biocontrol of insect pests in cotton.

  9. Flutuação Populacional de Rhynchophorus palmarum L. (Coleoptera: Curculionidae em Plantios de Palma de Óleo em Roraima

    Directory of Open Access Journals (Sweden)

    2015-08-01

    Full Text Available Esta pesquisa teve como objetivo avaliar a flutuação populacional de Rhynchophorus palmarum L. (Coleoptera: Curculionidae em plantios de Elaeis guineensis Jacq, em ecossistemas de savana e floresta no estado de Roraima. A pesquisa foi desenvolvida durante o período de janeiro de 2011 a fevereiro de 2012 nos campos experimentais da Embrapa Roraima: Monte Cristo e Caroebe, numa área de 2 hectares com a cultura da Palma de Óleo, em cada campo. Foram distribuídas armadilhas iscadas com roletes de cana-de-açúcar e feromônio de agregação para captura dos insetos no entorno dos plantios. Ocorreu flutuação de R. palmarum com picos populacionais nos meses de julho e agosto no ecossistema de savana e de abril a setembro no ambiente de floresta. A população de R. palmarum foi menor em meses de baixa precipitação pluviométrica nos dois ambientes avaliados com a Palma de Óleo em Roraima Population Fluctuation of Rhynchophorus palmarum L. (Coleoptera: Curculionidae in Plantations of Oil Palm in Roraima Abstract. This research aimed to evaluate the population fluctuation Rhynchophorus palmarum L. (Coleoptera: Curculionidae in Elaeis guineensis Jacq plantations in forest and savanna ecosystems in the state of Roraima. The research was conducted during the period from January 2011 to February 2012 in the experimental field of Embrapa Roraima: Monte Cristo and Caroebe in an area of 2 hectares with culture Oil Palm in each field. Traps baited with rollers cane sugar and aggregation pheromone for capturing insects in the vicinity of the plantations were distributed. Fluctuation occurred R. palmarum with population peaks in the months of July and August in the savanna ecosystem and from April to September in the forest environment. The population of R. palmarum was lower in months of low rainfall in the two environments assessed with a palm-oil-in Roraima.

  10. A new species of myrmecophilous lady beetle in the genus Diomus (Coleoptera: Coccinellidae: Diomini) from Chiapas, Mexico that feeds on green coffee scale, Coccus viridis (Green) (Hemiptera: Coccidae)

    Science.gov (United States)

    A new species of myrmecophilous lady beetle in the genus Diomus (Coleoptera: Coccinellidae: Diomini) is described from a coffee agroecosystem in Chiapas, Mexico. The new species was found preying on the green coffee scale pest, Coccus viridis (Green), tended primarily by Azteca sericeasur Longino an...

  11. Long-term monitoring of the introduced emerald ash borer (Coleoptera: Buprestidae) egg parasitoid, oobius agrili (Hymenoptera: Encyridae), in Michigan, USA and evaluation of a newly developed monitoring technique

    Science.gov (United States)

    Emerald ash borer (EAB), Agrilus planipennis Fairmaire (Coleoptera: Buprestidae), is a serious invasive pest of ash trees (Fraxinus spp.) in North America. The egg parasitoid Oobius agrili Zhang and Huang (Hymenoptera: Encyrtidae) was introduced as a biological control agent of this pest in Michiga...

  12. Catalogue of Geadephaga (Coleoptera: Adephaga of America, north of Mexico

    Directory of Open Access Journals (Sweden)

    Yves Bousquet

    2012-11-01

    Full Text Available All scientific names of Trachypachidae, Rhysodidae, and Carabidae (including cicindelines recorded from America north of Mexico are catalogued. Available species-group names are listed in their original combinations with the author(s, year of publication, page citation, type locality, location of the name-bearing type, and etymology for many patronymic names. In addition, the reference in which a given species-group name is first synonymized is recorded for invalid taxa. Genus-group names are listed with the author(s, year of publication, page citation, type species with way of fixation, and etymology for most. The reference in which a given genus-group name is first synonymized is recorded for many invalid taxa. Family-group names are listed with the author(s, year of publication, page citation, and type genus. The geographical distribution of all species-group taxa is briefly summarized and their state and province records are indicated.One new genus-group taxon, Randallius new subgenus (type species: Chlaenius purpuricollis Randall, 1838, one new replacement name, Pterostichus amadeus new name for Pterostichus vexatus Bousquet, 1985, and three changes in precedence, Ellipsoptera rubicunda (Harris, 1911 for Ellipsoptera marutha (Dow, 1911, Badister micans LeConte, 1844 for Badister ocularis Casey, 1920, and Agonum deplanatum Ménétriés, 1843 for Agonum fallianum (Leng, 1919, are proposed. Five new genus-group synonymies and 65 new species-group synonymies, one new species-group status, and 12 new combinations (see Appendix 5 are established.The work also includes a discussion of the notable private North American carabid collections, a synopsis of all extant world geadephagan tribes and subfamilies, a brief faunistic assessment of the fauna, a list of valid species-group taxa, a list of North American fossil Geadephaga (Appendix 1, a list of North American Geadephaga larvae described or illustrated (Appendix 2, a list of Geadephaga species

  13. Bioactivity of Indonesian mahogany, Toona sureni (Blume (Meliaceae, against the red flour beetle, Tribolium castaneum (Coleoptera, Tenebrionidae

    Directory of Open Access Journals (Sweden)

    Sahana Parvin

    2012-09-01

    Full Text Available Bioactivity of Indonesian mahogany, Toona sureni (Blume (Meliaceae, against the red flour beetle, Tribolium castaneum (Coleoptera, Tenebrionidae. The insecticidal activity of Toona sureni (Blume Merr. was evaluated considering repellency, mortality and progeny production of F1 adults of Tribolium castaneum (Herbst, 1797 (Coleoptera, Tenebrionidae. Dried extract of seeds of T. sureni was dissolved in acetone to prepare solution of various concentrations (0.5, 1.0, 2.5 and 5.0%. To test for repellency, the insects were exposed to treated filter paper. Mortality of larvae, pupae and adults was evaluated by the treatment of spraying the insects with different concentrations of T. sureni extract. Residual effect of the extract was also evaluated considering the production of progeny of F1 adults. The highest repellency (93.30% of T. castaneum occurred at the highest concentration (5.0% suspension of T. sureni; while the lowest (0.0% repellency occurred at 0.5% suspension after 1 day of treatment. The highest mortality against adults (86.71%, larvae (88.32% and pupae (85% occurred at 5% suspension at 8 days after application. There was a negative correlation between the concentrations of T. sureni and the production of F1 adult's progeny of T. castaneum. The highest number of progeny (147 of T. castaneum occurred in the control at 7 days after treatment; and the lowest number of progeny (43 occurred at 5.0% concentration in 1 day after treatment. The results show that T. sureni is toxic to T. castaneum and has the potential to control all stages of this insect in stored wheat.

  14. Effectiveness of bifenthrin (Onyx™) and carbaryl (Sevin® SL) for protecting individual, high-value trees from bark beetle attack (Coleoptera: Curculionidae: Scolytinae) in the western United States

    Science.gov (United States)

    Christopher J. Fettig; Kurt K. Allen; Robert R. Borys; John Christopherson; Christopher P. Dabney; Thomas J. Eager; Kenneth E. Gibson; Elizabeth G. Hebertson; Daniel F. Long; A. Steven Munson; Patrick J. Shea; Sheri L. Smith; Michael I. Haverty

    2006-01-01

    High-value trees, such as those located in residential, recreational, or administrative sites, are particularly susceptible to bark beetle (Coleoptera: Curculionidae: Scolytinae) attack as a result of increased amounts of stress associated with drought, soil compaction, mechanical injury, or vandalism. Tree losses in these unique environments generally have a...

  15. Cellulose digestion in Monochamus marmorator Kby. (coleoptera: Cerambycidae): role of acquired fungal enzymes

    Energy Technology Data Exchange (ETDEWEB)

    Kukol, J.J.; Martin, M.M.

    1986-05-01

    Larvae of the balsam fir sawyer, Monochamus marmorator Kby. (Coleoptera, Cerambycidae), contain midgut digestive enzymes active against hemicellulose and cellulose. Cellulases from larvae fed on balsam fir wood infected with the fungus, Trichoderma harzianum Rifai (Deuteromycetes, Moniliales, Moniliaceae), were found to be identical to those of the cellulase complex produced by this fungus when compared using chromatography, electrophoresis, and isofocusing. When larvae are maintained on a fungusfree diet, their midgut fluids lack cellulolytic activity, and they are unable to digest cellulose. Cellulolytic capacity can be restored by feeding the larvae wood permeated by fungi. We conclude that the enzymes which enable M. marmorator larvae to digest cellulose are not produced by the larvae. Instead, the larvae acquire the capacity to digest cellulose by ingesting active fungal cellulases while feeding in fungus-infected wood.

  16. Cellulose digestion in Monochamus marmorator Kby. (coleoptera: Cerambycidae): role of acquired fungal enzymes

    International Nuclear Information System (INIS)

    Kukol, J.J.; Martin, M.M.

    1986-01-01

    Larvae of the balsam fir sawyer, Monochamus marmorator Kby. (Coleoptera, Cerambycidae), contain midgut digestive enzymes active against hemicellulose and cellulose. Cellulases from larvae fed on balsam fir wood infected with the fungus, Trichoderma harzianum Rifai (Deuteromycetes, Moniliales, Moniliaceae), were found to be identical to those of the cellulase complex produced by this fungus when compared using chromatography, electrophoresis, and isofocusing. When larvae are maintained on a fungusfree diet, their midgut fluids lack cellulolytic activity, and they are unable to digest cellulose. Cellulolytic capacity can be restored by feeding the larvae wood permeated by fungi. We conclude that the enzymes which enable M. marmorator larvae to digest cellulose are not produced by the larvae. Instead, the larvae acquire the capacity to digest cellulose by ingesting active fungal cellulases while feeding in fungus-infected wood

  17. The mortality of Oryzaephilus surinamensis Linnaeus, 1758 (Coleoptera: Silvanidae induced by powdered plants

    Directory of Open Access Journals (Sweden)

    Kłyś Małgorzata

    2015-01-01

    Full Text Available The aim of this study was to investigate whether powdered plants of different species namely: peppermint Mentha piperita (L. (Lamiaceae, wormwood Artemisia absinthium (L. (Asteraceae, common sage Salvia officinalis (L. (Lamiaceae, allspice Pimenta dioica (Linnaeus et Merrill (Myrtaceae and common garlic Allium sativum (L. (Amaryllidaceae, added to semolina using concentrations of 1.23, 3.61, and 5.88%, influence the mortality rate in the saw-toothed grain beetle Oryzaephilus surinamensis Linnaeus, 1758 (Coleoptera: Silvanidae. Experiments were conducted in a laboratory at 28°C and relative humidity 60±5%. At the concentration of 1.23%, allspice seeds caused the highest mortality amongst the saw-toothed grain beetle. When concentrations of 3.61 and 5.88% were used, sage, peppermint and wormwood caused the highest statistically significant mortality of O. surinamensis

  18. NEW CONTRIBUTION CONCERNING THE MASS REARING OF TANYMECUS DILATICOLLIS GYLL (COLEOPTERA: CURCULIONIDAE UNDER CONTROLLED CONDITIONS

    Directory of Open Access Journals (Sweden)

    Traian MANOLE

    2013-12-01

    Full Text Available Controlled growth in the laboratory of some species of insect’s are justified both scientifically and practically. Due to the economic importance that the corn crop pest Tanymecus dilaticollis Gyll. (Coleoptera: Curculionidae had in Romania like the main pest of maize crops we tried to obtain successive generations under environment controlled of the insect mentioned. In this paper we aim to improve the efficiency of the multiplication of the species with respect to two aspects: attending larval and multiplication high efficiency. The coefficient value of 20, 90 obtained by us indicate a considerable increase in performance compared to previous attempts multiplication thus increasing your chances of recovery of this method of mass multiplication.

  19. Desenvolvimento de Podisus nigrispinus (Dallas (Heteroptera, Pentatomidae com Zophobas confusa Gebien (Coleoptera, Tenebrionidae comparado à duas outras presas alternativas Development of Podisus nigrispinus (Dallas (Heteroptera, Pentatomidae fed with Zophobas confusa Gebien (Coleoptera, Tenebrionidae compared with two another alternative preys

    Directory of Open Access Journals (Sweden)

    Teresinha V Zanuncio

    1996-01-01

    Full Text Available Nymphs of Podisus nigrispinus (Dallas, 1851 were fed with Zophobas confusa Gebien, 1906, Tenebrio molitor Linnaeus, 1758 (Coleoptera, Tenebrionidae and Musca domestica Linnaeus, 1758 (Diptera, Muscidae under 25±0.5ºC, 60±10% of RH and photophase of 12h. Nymphal viability of P. nigrispinus were 64.0%, 80.0% and 92.0% with Z. confusa, M. domestica and T. molitor, respectively. No differences were found for pre-oviposition period, number of egg masses, number of eggs, egg viability, and longevity for females of this predator fed with any of these preys.

  20. A new species of Bruchidius (Coleoptera: Chrysomelidae: Bruchinae) from Albizia in Northern Thailand and a review of Bruchidius group 5.

    Science.gov (United States)

    Tuda, Midori

    2008-04-01

    A new species, Bruchidius paicus (Insecta, Coleoptera) reared from the seeds of a leguminous tree, Albizia lebbeck (Fabaceae: Mimosoideae: Ingeae), is described from Northern Thailand. Inspection of genital and external morphological traits of B. paicus revealed that the new species belongs to Bruchidius Group 5 (sensu ). The definition of Group 5 is reviewed based on both external and genital morphology. Further comparison of the group to molecular Clade I of Bruchidius (sensu ) indicates the two groups correspond to each other.

  1. Key to higher taxa of South American weevils based on adult characters (Coleoptera, Curculionoidea Clave de taxones superiores de gorgojos sudamericanos basada en caracteres de los adultos (Coleoptera, Curculionoidea

    Directory of Open Access Journals (Sweden)

    ADRIANA E. MARVALDI

    2005-03-01

    Full Text Available The weevils (Coleoptera: Curculionoidea from South America are currently classified in the following families and subfamilies: Nemonychidae (Rhinorhynchinae, Anthribidae (Anthribinae, Belidae (Belinae and Oxycoryninae, Attelabidae (Attelabinae and Rhynchitinae, Brentidae (Apioninae and Brentinae, Caridae (Carinae and Curculionidae (Erirhininae, Dryophthorinae, Entiminae, Aterpinae, Gonipterinae, Rhythirrininae, Thecesterninae, Eugnominae, Hyperinae, Curculioninae, Cryptorhynchinae, Mesoptiliinae (= Magdalidinae, Molytinae, Baridinae, Lixinae, Conoderinae (= Zygopinae, Cossoninae, Scolytinae and Platypodinae. In the present contribution we bring a dichotomous key for the identification of seven families and 28 subfamilies of Curculionoidea from South America, and for 21 tribes of the highly heterogeneous subfamilies Curculioninae and Molytinae. These tribes are Curculionini Anthonomini, Ceutorhynchini, Derelomini, Otidocephalini, Erodiscini, Camarotini, Piazorhinini, Prionobrachiini, Smicronychini, Rhamphini and Tychiini, within Curculioninae; and Hylobiini, Pissodini, Conotrachelini, Cleogonini, Sternechini, Pacholenini, Cholini, Petalochilini and Amalactini, within Molytinae. Most of them have been classified as subfamilies in traditional schemes. The key is mainly based on external morphological characters, but also includes data on genitalia, mouth parts and other biological features. Definitions and illustrations of diagnostic characters used in the key are providedLos gorgojos (Coleoptera: Curculionoidea de América del Sur se clasifican actualmente en las siguientes familias y subfamilias: Nemonychidae (Rhinorhynchinae, Anthribidae (Anthribinae, Belidae (Belinae y Oxycoryninae, Attelabidae (Attelabinae y Rhynchitinae, Brentidae (Apioninae y Brentinae, Caridae (Carinae y Curculionidae (Erirhininae, Dryophthorinae, Entiminae, Aterpinae, Gonipterinae, Rhythirrininae, Thecesterninae, Eugnominae, Hyperinae, Curculioninae, Cryptorhynchinae

  2. Morphological Diversity of Coleoptera (Arthropoda: Insecta in Agriculture and Forest Systems

    Directory of Open Access Journals (Sweden)

    Pâmela Niederauer Pompeo

    2017-11-01

    Full Text Available ABSTRACT Coleopterans (Coleoptera are major ecosystem service providers. However ecomorphological features that are comparable in a wide range of invertebrates within this group and in various environments must be found, to be able to study regions with different species, contributing to overcome difficulties of the taxonomic approach and understand the functioning of ecosystems. This research addressed the diversity of Coleoptera, using a methodology of ecomorphological traits, as well as their relation with the land use systems (LUS and the soil properties. The following LUS were evaluated: no-tillage (NT, crop-livestock integration (CLI, pasture (PA, Eucalyptus stands (EST, and native forest (NF. Samples were collected using a 3 × 3 point grid (sampling points at a distance of 30 m, in winter and summer, in three municipalities on the Southern Santa Catarina Plateau, Brazil. Coleopterans were collected using the methodology recommended by the Tropical Soil Biology and Fertility Program, based on the excavation of soil monoliths, and on pitfall traps. To evaluate the biological forms (morphotypes and ecomorphological groups, the ecomorphological index (EMI methodology was adopted and the modified soil biological quality (SBQ index was determined. At the same points, samples were collected to evaluate environmental variables (soil physical, chemical, and microbiological properties. Density data underwent nonparametric univariate statistical analysis and multivariate abundance to verify the distribution of coleopterans in the LUS, and the environmental variables were considered as explanatory. Regardless of the LUS, 14 morphotypes were identified, and adult coleopterans with epigean morphologic adaptations were more abundant than hemi-edaphic and edaphic coleopterans, respectively. Morphotype diversity was higher in the systems NF, EST, and PA in summer and in NT in winter. The reductions in SBQ index were not associated with a gradient of land

  3. Response to host volatiles by native and introduced populations of Dendroctonus valens (Coleoptera: Curculionidae, Scolytinae) in North America and China.  Journal of Chemical Ecology 33: 131-146.

    Science.gov (United States)

    N. Erbilgin; S.R. Mori; J.H. Sun; J.D. Stein; D.R. Owen; L.D. Merrill; R. Campos Bolande; os; K.F. Raffa; T. Mendez Montiel; D.L. Wood; N.E.  Gillette

    2007-01-01

    Bark beetles (Coleoptera: Curculionidae, Scolytinae) have specialized feeding habits, and commonly colonize only one or a few closely related host genera in their geographical ranges. The red turpentine beetle, Dendroctonus valens LeConte, has a broad geographic distribution in North America and exploits volatile cues from a wide variety of pines...

  4. Interaction of Insecticide and Media Moisture on Ambrosia Beetle (Coleoptera: Curculionidae) Attacks on Selected Ornamental Trees.

    Science.gov (United States)

    Frank, Steven D; Anderson, Amanda L; Ranger, Christopher M

    2017-12-08

    Exotic ambrosia beetles, particularly Xylosandrus crassiusculus (Motschulsky) (Coleoptera: Curculionidae: Scolytinae) and Xylosandrus germanus (Blandford) (Coleoptera: Curculionidae: Scolytinae), are among the most damaging pests of ornamental trees in nurseries. Growers have had few tactics besides insecticide applications to reduce ambrosia beetle attacks but recent research has shown that attacks may be reduced by maintaining media moisture below a 50% threshold thereby reducing flood stress. We compared the efficacy of managing media moisture and insecticide applications for reducing ambrosia beetle attacks on three ornamental tree species in North Carolina. During trials in spring 2013 and 2015, flooded Cornus florida and Cornus kousa were heavily attacked despite sprays with permethrin, but nonflooded C. kousa or C. florida were not attacked. In spring 2015 trials, both nonflooded and flooded Styrax japonicus were heavily attacked regardless of permethrin applications. Although ethanol emissions were not measured, the apparently healthy nonflooded S. japonicus trees may have been exposed to an unknown physiological stress, such as low temperature injury, the previous winter, which predisposed them to beetle attack. However, ethanol levels within host tissues were not measured as part of the current study. X. crassiusculus (75%), Xyloborinus saxesenii Ratzburg (13%), and X. germanus (9%) were the most abundant species collected in ethanol baited traps deployed in 2015, while X. crassiusculus (63%) and X. germanus (36%) were the predominant species reared from attacked trees. Results indicate that managing media moisture levels at or below 50%, and maximizing tree health overall, may provide significant protection against Xylosandrus spp. attacks in flood intolerant tree species. © The Authors 2017. Published by Oxford University Press on behalf of Entomological Society of America. All rights reserved. For permissions, please e-mail: journals.permissions@oup.com.

  5. Family-group names in Coleoptera (Insecta)

    Science.gov (United States)

    Bouchard, Patrice; Bousquet, Yves; Davies, Anthony E.; Alonso-Zarazaga, Miguel A.; Lawrence, John F.; Lyal, Chris H. C.; Newton, Alfred F.; Reid, Chris A. M.; Schmitt, Michael; Ślipiński, S. Adam; Smith, Andrew B. T.

    2011-01-01

    Abstract We synthesize data on all known extant and fossil Coleoptera family-group names for the first time. A catalogue of 4887 family-group names (124 fossil, 4763 extant) based on 4707 distinct genera in Coleoptera is given. A total of 4492 names are available, 183 of which are permanently invalid because they are based on a preoccupied or a suppressed type genus. Names are listed in a classification framework. We recognize as valid 24 superfamilies, 211 families, 541 subfamilies, 1663 tribes and 740 subtribes. For each name, the original spelling, author, year of publication, page number, correct stem and type genus are included. The original spelling and availability of each name were checked from primary literature. A list of necessary changes due to Priority and Homonymy problems, and actions taken, is given. Current usage of names was conserved, whenever possible, to promote stability of the classification. New synonymies (family-group names followed by genus-group names): Agronomina Gistel, 1848 syn. nov. of Amarina Zimmermann, 1832 (Carabidae), Hylepnigalioini Gistel, 1856 syn. nov. of Melandryini Leach, 1815 (Melandryidae), Polycystophoridae Gistel, 1856 syn. nov. of Malachiinae Fleming, 1821 (Melyridae), Sclerasteinae Gistel, 1856 syn. nov. of Ptilininae Shuckard, 1839 (Ptinidae), Phloeonomini Ádám, 2001 syn. nov. of Omaliini MacLeay, 1825 (Staphylinidae), Sepedophilini Ádám, 2001 syn. nov. of Tachyporini MacLeay, 1825 (Staphylinidae), Phibalini Gistel, 1856 syn. nov. of Cteniopodini Solier, 1835 (Tenebrionidae); Agronoma Gistel 1848 (type species Carabus familiaris Duftschmid, 1812, designated herein) syn. nov. of Amara Bonelli, 1810 (Carabidae), Hylepnigalio Gistel, 1856 (type species Chrysomela caraboides Linnaeus, 1760, by monotypy) syn. nov. of Melandrya Fabricius, 1801 (Melandryidae), Polycystophorus Gistel, 1856 (type species Cantharis aeneus Linnaeus, 1758, designated herein) syn. nov. of Malachius Fabricius, 1775 (Melyridae), Sclerastes

  6. Family-Group Names In Coleoptera (Insecta

    Directory of Open Access Journals (Sweden)

    Patrice Bouchard

    2011-04-01

    Full Text Available We synthesize data on all known extant and fossil Coleoptera family-group names for the first time. A catalogue of 4887 family-group names (124 fossil, 4763 extant based on 4707 distinct genera in Coleoptera is given. A total of 4492 names are available, 183 of which are permanently invalid because they are based on a preoccupied or a suppressed type genus. Names are listed in a classification framework. We recognize as valid 24 superfamilies, 211 families, 541 subfamilies, 1663 tribes and 740 subtribes. For each name, the original spelling, author, year of publication, page number, correct stem and type genus are included. The original spelling and availability of each name were checked from primary literature. A list of necessary changes due to Priority and Homonymy problems, and actions taken, is given. Current usage of names was conserved, whenever possible, to promote stability of the classification. New synonymies (family-group names followed by genus-group names: Agronomina Gistel, 1848 syn. n. of Amarina Zimmermann, 1832 (Carabidae, Hylepnigalioini Gistel, 1856 syn. n. of Melandryini Leach, 1815 (Melandryidae, Polycystophoridae Gistel, 1856 syn. n. of Malachiinae Fleming, 1821 (Melyridae, Sclerasteinae Gistel, 1856 syn. n. of Ptilininae Shuckard, 1839 (Ptinidae, Phloeonomini Ádám, 2001 syn. n. of Omaliini MacLeay, 1825 (Staphylinidae, Sepedophilini Ádám, 2001 syn. n. of Tachyporini MacLeay, 1825 (Staphylinidae, Phibalini Gistel, 1856 syn. n. of Cteniopodini Solier, 1835 (Tenebrionidae; Agronoma Gistel 1848 (type species Carabus familiaris Duftschmid, 1812, designated herein syn. n. of Amara Bonelli, 1810 (Carabidae, Hylepnigalio Gistel, 1856 (type species Chrysomela caraboides Linnaeus, 1760, by monotypy syn. n. of Melandrya Fabricius, 1801 (Melandryidae, Polycystophorus Gistel, 1856 (type species Cantharis aeneus Linnaeus, 1758, designated herein syn. n. of Malachius Fabricius, 1775 (Melyridae, Sclerastes Gistel, 1856 (type species

  7. Notas e novas espécies de Onciderini (Coleoptera, Cerambycidae, Lamiinae

    Directory of Open Access Journals (Sweden)

    Ubirajara R. Martins

    2007-01-01

    Full Text Available Novas espécies descritas do Brasil: Hypsioma carioca sp. nov. (Rio de Janeiro e Hesychotypa maraba sp. nov. (Pará; do Equador: Sternycha ecuatoriana sp. nov. (Pichincha; da Bolívia (Santa Cruz: Hesychotypa magnifica sp. nov., Tibiosioma maculosa sp. nov. e Alexera secunda sp. nov. Transfere-se Hesycha strandi (Breuning, 1943 para o gênero Cacostola Fairmaire & Germain, 1859. Hesychotypa archippa Dillon & Dillon, 1946 é considerada sinônima de H. miniata Thomson, 1868. Novo registro (Trinidad e figura são dados para Trachysomus surdus.Notes and new species of Onciderini (Coleoptera, Cerambycidae, Lamiinae. New species described from Brazil: Hypsioma carioca sp. nov. (Rio de Janeiro and Hesychotypa maraba sp. nov. (Pará; from Ecuador: Sternycha ecuatoriana sp. nov. (Pichincha; from Bolivia (Santa Cruz: Hesychotypa magnifica sp. nov., Tibiosioma maculosa sp. nov. and Alexera secunda sp. nov. Hesycha strandi (Breuning, 1943 is transferred to the genus Cacostola Fairmaire & Germain, 1859. Hesychotypa archippa Dillon & Dillon, 1946 is considered a synonym of H. miniata Thomson, 1868. New record (Trinidad and figure for Trachysomus surdus Dillon & Dillon, 1946 are given.

  8. Minimal effective dose of phosphine to control the cashew root borer, Marshallius bondari Rosado-Neto (Coleoptera: Curculionidae Dose mínima efetiva de fosfina no controle da broca-da-raiz do cajueiro, Marshallius bondari Rosado-Neto (Coleoptera: Curculionidae

    Directory of Open Access Journals (Sweden)

    Ervino Bleicher

    2010-06-01

    Full Text Available The objective of this research was to determine, in field conditions, the minimal of phosphine effective dose for the cashew root borer control. Three experiments were set up at three different periods: August, October and November, 1994, to control the cashew root borer, Marshallius bondari Rosado-Neto (Coleoptera: Curculionidae, in Piaui State, Brazil. One, two, three and six phosphine tablets of three gram each, per plant were tested. In the August essay, phosphine was inefficient to control the borer. In the October essay, control was achieved using as little as 2 tablets per plant and in November with one tablet per plant to control the adult borers in the soil. Higher efficiency was achieved when treatment was applied far away from the last rain, in other words, as soil dries out.Objetivou-se determinar, em condições de campo, a dose mínima de fosfina para o controle da broca da raiz do cajueiro. Foram instalados 3 experimentos em épocas distintas, sendo o primeiro em agosto, o segundo em outubro e o terceiro em novembro de 1994 para o controle de Marshallius bondari Rosado-Neto (Coleoptera: Curculionidae em cajueiro, Anacardium occidentale L. no município de Pio IX, Estado do Piauí. Foram testadas 1; 2; 3 e 6 pastilhas de fosfina na forma de fosfeto de alumínio, de 3 gramas cada, por planta. No ensaio conduzido em agosto nenhum tratamento foi eficiente para o controle de brocas adultas no solo. No ensaio instalado em outubro, a fosfina foi eficiente a partir de duas pastilhas por planta e no ensaio de novembro a partir de uma pastilha por planta para o controle de adultos no solo. A eficiência foi tanto maior quanto maior foi o tempo decorrido após a última chuva, estando, portanto, o solo mais seco.

  9. Response of Lutz, Sitka, and white spruce to attack by Dendroctonus rufipennis (Coleoptera: Scolytidae) and blue stain fungi

    Science.gov (United States)

    Richard A. Werner; Barbara L. Illman

    1994-01-01

    Mechanical wounding and wounding plus inoculation with a blue-stain fungus, Leptographium abietinum (Peck), associated with the spruce beetle, Dendroctonus rufipennis (Kirby), caused an induced reaction zone or lesion around the wound sites in Lutz spruce, Picea lutzii Little, Sitka spruce, P. sitchensis (Bong.) Carr., and white spruce, P. glauca (Moench) Voss, in...

  10. Verbenone: Dose-Dependent Interruption of Pheromone-Based Attraction of Three Sympatric Species of Pine Bark Beetles (Coleoptera: Scolytidae)

    Science.gov (United States)

    Daniel R. Miller; John H. Borden; B. Staffan Lindgren

    1995-01-01

    Verbenone significantly reduced catches of Ips latidens (LeConte), I. pini (Say), and Dendroctonus ponderosae Hopkins in multiple-funnel traps, baited with aggregation pheromones, in stands of lodgepole pine in southern British Columbia. Interruption of attraction was dose dependent for all three species. There...

  11. Effectiveness of polyethylene sheeting in controlling spruce beetles (Coleoptera: Scolytidae) in infested stacks of spruce firewood in Alaska.

    Science.gov (United States)

    Edward H. Holsten; Richard A. Werner

    1993-01-01

    Covering stacks of spruce firewood with either clear or black polyethylene sheeting does not raise log temperatures high enough to kill spruce beetle brood in the logs. Based on the results of this study, we do not recommend the use of polyethylene sheeting as a remedial measure for the reduction of spruce beetle brood in infested firewood or log decks in south-central...

  12. Semiochemical -Based Communication in interspecific interactions between IPS PINI and Pityogenes Knecteli (Swaine) (Coleoptera: Scolytidae) in Lodgepole Pine

    Science.gov (United States)

    Therese M. Poland; John H. Borden

    1994-01-01

    The pine engraver, Ips pini Say, and Pityogenes knechteli Swaine often co-exist in lodgepole pine, Pinus contorta var. latifolia Engelmann. We tested the hypotheses that P. knechteli produces an attractive pheromone and that the attraction of P. knechteli...

  13. Inter- and Intrapopulation Variation of the Pheromone, Ipsdienol Produced by Male Pine Engravers Ips pini (Say) (Coleoptera: Scolytidae)

    Science.gov (United States)

    D.R. Miller; J.H. Borden; K.N. Slessor

    1989-01-01

    We determined the chirality of ipsdienol in individual male pine engravers, Ips pini (Say), from New York, California, and two localities in British Columbia (BC). Both quantity and chirality of ipsdienol varied significantly between and within populations of I. pini . Beetles from California and southeastern BC produced...

  14. Hematology, micronuclei and nuclear abnormalities in fishes from São Francisco river, Minas Gerais state, Brazil = Hematologia, micronúcleos e anomalias nucleares em peixes do rio São Francisco, Estado de Minas Gerais, Brasil

    Directory of Open Access Journals (Sweden)

    Robson Seriani

    2011-01-01

    Full Text Available This study aimed to determine the variables leukocytary, erythrocytary, frequency of micronuclei and nuclear abnormalities in peripheral erythrocytes of Prochilodus argenteus, Pimelodus maculatus and Myleus micans from São Francisco river basin, Minas Gerais State, during the summer and winter. Thrombocytes, hematocrit and leukocyte of P.argenteus series, was influenced by climatic conditions. In P. maculatus, not were significant differences for all leukocytes and thrombocytes. In M. micans, values are unprecedented in the literature, with MCV and absolute number of leukocytes found superior to other species of the family Characidae. The frequency of micronuclei and nuclear abnormalities in erythrocytes, the three species not showed seasonal differences between the sites. However, the highest values were found in summer. Furthermore, we observed a positive correlation between the increase in the percentage of micronuclei with nuclear abnormalities.O presente estudo teve como objetivo, determinar as variáveis leucocitárias, eritrocíticas, freqüência de micronúcleos e anomaliasnucleares nos eritrócitos do sangue periférico de Prochilodus argenteus, Pimelodus maculatus e Myleus micans de um trecho da bacia do rio São Francisco, Minas Gerais, no verão e inverno. Trombóctios, hematócrito e a serie leucocítária de P.argenteus, foi influenciado pela sazonalidade. Em P. maculatus, não ocorreram diferenças significativas para todos os leucócitos e trombócitos. Em M. micans, os valores são inéditos na literatura, apresentando VCM e número absoluto de leucócitos superior ao encontrados para outras espécies dafamília Characidae. A freqüência de micronúcleos e de anomalias nucleares nos eritrócitos, nas três espécies não apresentou diferenças sazonais e entre os pontos amostrais. No entanto, os valores mais altos foram encontrados no verão. Além disso, foi possível observar correlação positiva entre o aumento da

  15. Diagnosis and key of the main families and species of South American Coleoptera of forensic importance Diagnose e chave de identificação para as principais famílias e espécies de Coleoptera de importância forense da América do Sul

    Directory of Open Access Journals (Sweden)

    Lúcia M. Almeida

    2009-06-01

    Full Text Available The objective of this paper is to provide diagnosis and keys of the families and species, with illustrations of the main groups. A table of all related species recorded from South America is presented, including the substrate in which they were collected and their geographical distribution. The list comprises 221 species included in 15 families, of which 70% of the species are from Brazil. Scarabaeidae is the most diverse family with 121 species, followed by Staphylinidae with 68. Also we provide one database of Coleoptera species associated with carcasses in South America.O objetivo deste trabalho é apresentar diagnoses e chaves de identificação das principais famílias e espécies de importância forense, com ilustrações dos principais grupos. É apresentada uma tabela de todas as espécies de ocorrência na América do Sul, incluindo o substrato nas quais foram coletadas e sua distribuição geográfica. A lista compreende 221 espécies incluídas em 15 famílias, das quais pelo menos 70% das espécies são distribuídas no Brasil. Scarabaeidae é a família com maior diversidade com 121 espécies, seguida por Staphylinidae com 68. Também é fornecida uma base de dados para as espécies de Coleoptera associadas a carcaças na América do Sul.

  16. Identification of candidate chemosensory genes in the antennal transcriptome of Tenebrio molitor (Coleoptera: Tenebrionidae).

    Science.gov (United States)

    Liu, Su; Rao, Xiang-Jun; Li, Mao-Ye; Feng, Ming-Feng; He, Meng-Zhu; Li, Shi-Guang

    2015-03-01

    We present the first antennal transcriptome sequencing information for the yellow mealworm beetle, Tenebrio molitor (Coleoptera: Tenebrionidae). Analysis of the transcriptome dataset obtained 52,216,616 clean reads, from which 35,363 unigenes were assembled. Of these, 18,820 unigenes showed significant similarity (E-value molitor OBPs and CSPs are closely related to those of T. castaneum. Real-time quantitative PCR assays showed that eight TmolOBP genes were antennae-specific. Of these, TmolOBP5, TmolOBP7 and TmolOBP16 were found to be predominantly expressed in male antennae, while TmolOBP17 was expressed mainly in the legs of males. Several other genes were identified that were neither tissue-specific nor sex-specific. These results establish a firm foundation for future studies of the chemosensory genes in T. molitor. Copyright © 2015 Elsevier Inc. All rights reserved.

  17. Colepotera:Scolytidae

    African Journals Online (AJOL)

    DOGAN ISIK

    2012-03-01

    Mar 1, 2012 ... Bark (Anisandrus dispar) and ambrosia beetles (Xyleborinus saxesenii) ... physiologically stressed trees for colonization but some species also attack healthy trees. Bark and ... Curculionidae), causing considerable damage in hazelnut (Corylus ... control techniques and removal of infested plant material.

  18. Review of the genus Fontidessus Miller & Spangler, 2008 (Coleoptera, Dytiscidae, Hydroporinae, Bidessini with description of four new species

    Directory of Open Access Journals (Sweden)

    Kelly Miller

    2014-07-01

    Full Text Available The genus Fontidessus Miller & Spangler, 2008 (Coleoptera: Dytiscidae: Hydroporinae: Bidessini is reviewed. The genus now includes seven species with three previously described, and four new species described here: F. microphthalmus Miller & Montano, sp. n.; F. bettae Miller & Montano, sp. n.; F. christineae Miller & Montano, sp. n., and F. aquarupe Miller & Montano, sp. n. Each species is diagnosed and described, including the previously known species, based on new specimens and new information. Habitus, male genitalia and other diagnostic features are illustrated for each species. A key to the seven species is provided. Fontidessus species are unique to hygropetric habitats in the Guiana Shield craton of northern South American.

  19. Diversidade de Carabidae (Coleoptera Amostrados em Áreas de Reflorestamento de Mata Ciliar e Fragmento Florestal, no Estado do Paraná

    Directory of Open Access Journals (Sweden)

    Tamara Quinteiro

    2012-12-01

    Abstract. Carabidae are Coleoptera whose most species have a predatory eating habit. The purpose of this paper was to study the diversity and abundance of Carabidae (Coleoptera family in forest fragment areas and in reforestation areas of riparian vegetation, evidencing the importance of this group as a biodiversity indicator regarding the reforestation success. Beetles were sampled using soil pitfall traps in forest fragments and reforestation of riparian vegetation in three municipalities the state of Parana. The abundance of Carabidae was higher in riparian reforestation. The species Odontochila nodicornis (Dejean was the most significantly abundant and found in all studied areas. There was a similarity in richness of Carabidae found in the remaining forest fragment, being the wealth found in reforestation, even where samples were collected 3km away from the fragment or in reforestation areas that did not have any connection with the remaining fragment. Tetracha brasiliensis (Kirby was almost exclusively collected in reforestation unrelated to the fragment. Using the Kruskal-Wallis test, it was not noted any attraction of different baits, but there was a significant difference between the collection number in baited traps compared with the control. The highest concentration of Carabidae was collected from December to February, period corresponding to the summer season for the studied region. The similarity on the richness of Carabidae found between forest fragments and reforestation of riparian vegetation may suggest the reforestation method success, being able to advance to the primary characteristic.

  20. A new brachypterous scarab species, Orphnus longicornis (Coleoptera: Scarabaeidae: Orphninae), from the East African Rift.

    Science.gov (United States)

    Frolov, Andrey; Akhmetova, Lilia

    2015-11-05

    The Afrotropical Region is the center of the diversity of the scarab beetle genus Orphnus MacLeay, 1819 (Coleoptera: Scarabaeidae: Orphninae), with 94 species occurring from Sahel in the north to Little Karoo in the south (Paulian, 1948; Petrovitz, 1971; Frolov, 2008). The East African Rift is one of the richest regions of the Afrotropics housing more than 20 species of Orphnus (Paulian, 1948; Frolov, 2013), most of which are endemic to this region. Yet the scarab beetle fauna of the East African Rift, and especially the Eastern Arc Mountains, is still inadequately studied. Examination of the material housed in the Museum of Natural History of Humboldt-Universität, Berlin, Germany (ZMHUB), revealed a series of brachypterous Orphnus beetles belonging to an undescribed species. The new species is described and illustrated below.

  1. The tiger beetles (Coleoptera: Carabidae, Cicindelinae) of Angola: a descriptive catalogue and designation of neotypes.

    Science.gov (United States)

    Serrano, Artur R M; Capela, Rúben A

    2013-11-01

    An annotated catalogue of the species and subspecies of tiger beetles (Coleoptera: Carabidae, Cicindelinae) hitherto known from Angola is given. A total of 89 forms (74 species and 15 subspecies) is recorded from this southwestern country of Africa. Within this assemblage there are 31 endemic forms (33.3%). Some species are represented by only the holotype specimen (some without locality) or the type series. Others were recorded based on a single specimen. Records for six species previously unknow from Angola are given: Foveodromica sp. n. 1, Foveodromica sp. n. 2, Ophryodera rufomarginata bradshawi Péringuey, 1888, Elliptica muata parallelestriata (W. Horn, 1923), Lophyra differens (W. Horn, 1892) and Myriochila jucunda (Péringuey, 1892). A historical review, as well as some considerations on the distribution and conservation status of these beetles in Angola are also presented.

  2. Application of rotifer Brachionus plicatilis in detecting the toxicity of harmful algae

    Science.gov (United States)

    Yan, Tian; Wang, Yunfeng; Wang, Liping; Chen, Yang; Han, Gang; Zhou, Mingjiang

    2009-05-01

    The toxicity of seven major HAB (harmful algal bloom) species/strains, Prorocentrum donghaiense, Phaeocystis globosa, Prorocentrum micans, Alexandrium tamarense (AT-6, non-PSP producer), Alexandrium lusitanicum, Alexandrum tamarense (ATHK) and Heterosigma akashiwo were studied against rotifer Brachionus plicatilis under laboratory conditions. The results show that P. donghaiense, P. globosa, P. micans, A. tamarense (AT-6), or A. lusitanicum could maintain the individual survival and reproduction, as well as the population increase of the rotifer, but the individual reproduction would decrease when exposed to these five algae at higher densities for nine days; H. akashiwo could decrease the individual survival and reproduction, as well as population increase of the rotifer, which is similar to that of the starvation group, indicating that starvation might be its one lethal factor except for the algal toxins; A. tamarense (ATHK) has strong lethal effect on the rotifer with 48h LC50 at 800 cells/mL. The experiment on ingestion ability indicated by gut pigment change shows that P. donghaiense, P. globosa, P. micans, A. tamarense (AT-6) and A. lusitanicum can be taken by the rotifers as food, but A. tamarense (ATHK) or H. akashiwo can be ingested by the rotifers. The results indicate that all the indexes of individual survival and reproduction, population increase, gut pigment change of the rotifers are good and convenient to be used to reflect the toxicities of HAB species. Therefore, rotifer is suggested as one of the toxicity testing organisms in detecting the toxicity of harmful algae.

  3. What do we know about winter active ground beetles (Coleoptera, Carabidae) in Central and Northern Europe?

    Science.gov (United States)

    Jaskuła, Radomir; Soszyńska-Maj, Agnieszka

    2011-01-01

    This paper summarizes the current knowledge on winter active Carabidae in Central and Northern Europe. In total 73 winter active species are listed, based on literature and own observations. Ground beetles are among the three most numerous Coleoptera families active during the autumn to spring period. The winter community of Carabidae is composed both of larvae (mainly autumn breeding species) and adults, as well as of epigeic species and those inhabiting tree trunks. Supranivean fauna is characterized by lower species diversity than the subnivean fauna. The activity of ground beetles decreases in late autumn, is lowest during mid-winter and increases in early spring. Carabidae are noted as an important food source in the diet of insectivorous mammals. They are also predators, hunting small winter active invertebrates.

  4. UVR-induced photosynthetic inhibition dominates over DNA damage in marine dinoflagellates exposed to fluctuating solar radiation regimes

    NARCIS (Netherlands)

    Helbling, E. Walter; Buma, Anita G. J.; van de Poll, Willem; Fernandez Zenoff, M. Veronica; Villafane, Virginia E.

    2008-01-01

    The combined effect of solar radiation (UV-B (280-315 nm), UWA (315-400 nm) and PAR (400-700 nm)) and vertical mixing (i.e., fluctuating radiation regimes) on the marine dinoflagellates Gymnodinium chlorophorum, Heterocapsa triquetra and Prorocentrum micans was investigated during the austral spring

  5. Preliminary Diversity Of Dung Beetles (Coleoptera: Scarabaeinae Attracting By Human Dung (Calvario, Meta

    Directory of Open Access Journals (Sweden)

    Ruth Mariela Castillo Morales

    2011-12-01

    Full Text Available In the Private Reserve, Refugio del Oso de Anteojos (El Calvario-Meta, the diversity of dung beetles was studied (Coleoptera: Scarabaeinae, grouped around different types of vegetation (Montane Rain Forest, Rainforest Premontane, Lower Montane Rain Forest, by using pitfall traps baited with human dung. During the samplings carried out in the rainy station on 2008, were captured a total of 177 individuals belonging to 9 species. The tribe Canthonini was the most representative with 87.5%, of the described species, followed by Aechini 10.8%, and Onthophagini 1.7%. The dominant species was Canthon lituratus in the three vegetation units: Lower montane rain forest was the richest (9 species and abundance (86 individuals, compared with other environments sampled. By calculating the complementarity index, shows a similar species composition in the three habitats sampled, possibly, related to the floristic composition presented in each one of them.

  6. First record of Sinoxylon anale and S. unidentatum in Greece, with an updated account on their global distribution and host plants (Coleoptera: Bostrichidae

    Directory of Open Access Journals (Sweden)

    Charalampos T. Lykidis

    2016-12-01

    Full Text Available Sinoxylon anale Lesne, 1897 and S. unidentatum (Fabricius, 1801 (Coleoptera, Bostrichidae, two almost cosmopolitan species most likely native of the Oriental Region, are recorded for the first time from Greece on the basis of several specimens intercepted in a consignment at the Piraeus harbor (Attica, Athens in wood packaging material originating from China. The establishment of these species in Greece is briefly discussed, moreover, an updated list of their interceptions, countries of establishment and host plants, is provided.

  7. Identification of Sex Pheromones and Sex Pheromone Mimics for Two North American Click Beetle Species (Coleoptera: Elateridae) in the Genus Cardiophorus Esch.

    Science.gov (United States)

    Serrano, Jacqueline M; Collignon, R Maxwell; Zou, Yunfan; Millar, Jocelyn G

    2018-04-01

    To date, all known or suspected pheromones of click beetles (Coleoptera: Elateridae) have been identified solely from species native to Europe and Asia; reports of identifications from North American species dating from the 1970s have since proven to be incorrect. While conducting bioassays of pheromones of a longhorned beetle (Coleoptera: Cerambycidae), we serendipitously discovered that males of Cardiophorus tenebrosus L. and Cardiophorus edwardsi Horn were specifically attracted to the cerambycid pheromone fuscumol acetate, (E)-6,10-dimethylundeca-5,9-dien-2-yl acetate, suggesting that this compound might also be a sex pheromone for the two Cardiophorus species. Further field bioassays and electrophysiological assays with the enantiomers of fuscumol acetate determined that males were specifically attracted by the (R)-enantiomer. However, subsequent analyses of extracts of volatiles from female C. tenebrosus and C. edwardsi showed that the females actually produced a different compound, which was identified as (3R,6E)-3,7,11-trimethyl-6,10-dodecadienoic acid methyl ester (methyl (3R,6E)-2,3-dihydrofarnesoate). In field trials, both the racemate and the (R)-enantiomer of the pheromone attracted similar numbers of male beetles, suggesting that the (S)-enantiomer was not interfering with responses to the insect-produced (R)-enantiomer. This report constitutes the first conclusive identification of sex pheromones for any North American click beetle species. Possible reasons for the strong and specific attraction of males to fuscumol acetate, which is markedly different in structure to the actual pheromone, are discussed.

  8. Erotylidae (Insecta, Coleoptera) of Poland - problematic taxa, updated keys and new records.

    Science.gov (United States)

    Ruta, Rafał; Jałoszyński, Paweł; Sienkiewicz, Paweł; Konwerski, Szymon

    2011-01-01

    New data concerning the occurrence of pleasing fungus beetles (Coleoptera: Erotylidae) in Poland are given, with a focus on rare and difficult to identify Central European taxa. Cryptophilus cf. integer (Heer) (Cryptophilinae) is reported from the Polish territory for the first time based on adult and larval specimens collected in the Wielkopolska-Kujawy Lowland. Identification problems concerning species of Cryptophilus introduced to Europe are discussed. Triplax carpathica Reitter (Erotylinae) is recorded from the Białowieża Primeval Forest, which is the first known non-Carpathian finding of this species, located in the close proximity of the Polish-Belarussian UNESCO World Heritage Site "Białowieża Forest". Discussion of Triplax carpathica being conspecific with Siberian Triplax rufiventris Gebler is provided. New Polish localities of several other Erotylidae are reported, and an updated key to Central European species of Triplax is given. The Triplax key is supplemented with dorsal and ventral habitus images of all treated Triplax species. One of the rarest Central European erotyline species Combocerus glaber (Schaller) is recorded from xerothermic grasslands in North-West Poland.

  9. Analýza vzťahu medzi náletom kambiofágneho hmyzu a fyziologickým oslabením smerkových ekosystémov

    Czech Academy of Sciences Publication Activity Database

    Kmeť, J.; Kulla, L.; Jakuš, R.; Cudlín, Pavel; Lieutier, F.

    -, č. 18 (2005), s. 151-159. ISBN 80-7157-297-7 R&D Projects: GA MŠk(CZ) OK 389 Institutional research plan: CEZ:AV0Z6087904 Keywords : Picea abies, ecophysiology, stress , Scolytidae, forest protection Subject RIV: GK - Forest ry

  10. External and internal structure of weevils (Insecta: Coleoptera) investigated with phase-contrast X-ray imaging

    International Nuclear Information System (INIS)

    Hoennicke, M.G.; Cusatis, C.; Rigon, L.; Menk, R.-H.; Arfelli, F.; Foerster, L.A.; Rosado-Neto, G.H.

    2010-01-01

    Weevils (Coleoptera: Curculionidae) are identified by the external structure (dorsal, ventral and lateral features) and also by internal structure. The genitalia can be used to distinguish the sex and to identify the insects when the external structure appears identical. For this purpose, a destructive dissecting microscopy procedure is usually employed. In this paper, phase contrast X-ray imaging (radiography and tomography) is employed to investigate the internal structure (genitalia) of two entire species of weevils that presents very similar external structures (Sitophilus oryzae and Sitophilus zeamais). The detection of features, which looks like the genital structure, shows that such non-destructive technique could be used as an alternative method for identification of insects. This method is especially useful in examining the internal features of precious species from museum collections, as already described in the recent literature.

  11. Feeding habits of Carabidae (Coleoptera associated with herbaceous plants and the phenology of coloured cotton

    Directory of Open Access Journals (Sweden)

    Danilo Henrique da Matta

    2017-04-01

    Full Text Available The carabids (Coleoptera: Carabidae are recognized as polyphagous predators and important natural enemies of insect pests. However, little is known about the feeding habits of these beetles. In this work, we determine the types of food content in the digestive tracts of nine species of Carabidae associated with herbaceous plants and different growth stages of coloured cotton. The food contents were evaluated for beetles associated with the coloured cotton cv. BRS verde, Gossypium hirsutum L. latifolium Hutch., adjacent to weed plants and the flowering herbaceous plants (FHPs Lobularia maritima (L., Tagetes erecta L., and Fagopyrum esculentum Moench. The digestive tract analysis indicated various types of diets and related arthropods for Abaris basistriata, Galerita brasiliensis, Scarites sp., Selenophorus alternans, Selenophorus discopunctatus and Tetracha brasiliensis. The carabids were considered to be polyphagous predators, feeding on different types of prey.

  12. Plant compounds insecticide activity against Coleoptera pests of stored products

    Energy Technology Data Exchange (ETDEWEB)

    Moreira, Marcio Dionizio; Picanco, Marcelo Coutinho; Guedes, Raul Narciso Carvalho; Campos, Mateus Ribeiro de; Silva, Gerson Adriano; Martins, Julio Claudio [Universidade Federal de Vicosa (UFV), MG (Brazil). Dept. de Biologia Animal; br, picanco@ufv; br, guedes@ufv; br, mateusc3@yahoo com; br, agronomiasilva@yahoo com

    2007-07-15

    The objective of this work was to screen plants with insecticide activity, in order to isolate, identify and assess the bioactivity of insecticide compounds present in these plants, against Coleoptera pests of stored products: Oryzaephilus surinamensis L. (Silvanidae), Rhyzopertha dominica F. (Bostrichidae) and Sitophilus zeamais Mots. (Curculionidae). The plant species used were: basil (Ocimum selloi Benth.), rue (Ruta graveolens L.), lion's ear (Leonotis nepetifolia (L.) R.Br.), jimson weed (Datura stramonium L.), baleeira herb (Cordia verbenacea L.), mint (Mentha piperita L.), wild balsam apple (Mormodica charantia L.), and billy goat weed or mentrasto (Ageratum conyzoides L.). The insecticide activity of hexane and ethanol extracts from those plants on R. dominica was evaluated. Among them, only hexane extract of A. conyzoides showed insecticide activity; the hexane extract of this species was successively fractionated by silica gel column chromatography, for isolation and purification of the active compounds. Compounds 5,6,7,8,3',4',5'-heptamethoxyflavone; 5,6,7,8,3'-pentamethoxy-4',5'-methilenedioxyflavone and coumarin were identified. However, only coumarin showed insecticide activity against three insect pests (LD{sub 50} from 2.72 to 39.71 mg g{sup -1} a.i.). The increasing order of insects susceptibility to coumarin was R. dominica, S. zeamais and O. surinamensis. (author)

  13. Plant compounds insecticide activity against Coleoptera pests of stored products

    International Nuclear Information System (INIS)

    Moreira, Marcio Dionizio; Picanco, Marcelo Coutinho; Guedes, Raul Narciso Carvalho; Campos, Mateus Ribeiro de; Silva, Gerson Adriano; Martins, Julio Claudio; julioufv@yahoo.com.br

    2007-01-01

    The objective of this work was to screen plants with insecticide activity, in order to isolate, identify and assess the bioactivity of insecticide compounds present in these plants, against Coleoptera pests of stored products: Oryzaephilus surinamensis L. (Silvanidae), Rhyzopertha dominica F. (Bostrichidae) and Sitophilus zeamais Mots. (Curculionidae). The plant species used were: basil (Ocimum selloi Benth.), rue (Ruta graveolens L.), lion's ear (Leonotis nepetifolia (L.) R.Br.), jimson weed (Datura stramonium L.), baleeira herb (Cordia verbenacea L.), mint (Mentha piperita L.), wild balsam apple (Mormodica charantia L.), and billy goat weed or mentrasto (Ageratum conyzoides L.). The insecticide activity of hexane and ethanol extracts from those plants on R. dominica was evaluated. Among them, only hexane extract of A. conyzoides showed insecticide activity; the hexane extract of this species was successively fractionated by silica gel column chromatography, for isolation and purification of the active compounds. Compounds 5,6,7,8,3',4',5'-heptamethoxyflavone; 5,6,7,8,3'-pentamethoxy-4',5'-methilenedioxyflavone and coumarin were identified. However, only coumarin showed insecticide activity against three insect pests (LD 50 from 2.72 to 39.71 mg g -1 a.i.). The increasing order of insects susceptibility to coumarin was R. dominica, S. zeamais and O. surinamensis. (author)

  14. Plastic pellets as oviposition site and means of dispersal for the ocean-skater insect Halobates.

    Science.gov (United States)

    Majer, A P; Vedolin, M C; Turra, A

    2012-06-01

    Microplastics are omnipresent in the oceans and generally have negative impacts on the biota. However, flotsam may increase the availability of hard substrates, which are considered a limiting resource for some oceanic species, e.g. as oviposition sites for the ocean insect Halobates. This study describes the use of plastic pellets as an oviposition site for Halobates micans and discusses possible effects on its abundance and dispersion. Inspection of egg masses on stranded particles on beaches revealed that a mean of 24% (from 0% to 62%) of the pellets bore eggs (mean of 5 and max. of 48 eggs per pellet). Most eggs (63%) contained embryos, while 37% were empty egg shells. This shows that even small plastic particles are used as oviposition site by H. micans, and that marine litter may have a positive effect over the abundance and dispersion of this species. Copyright © 2012 Elsevier Ltd. All rights reserved.

  15. Caracterização Morfológica de Três Espécies de Broca-da-Haste em Chuchuzeiro (Coleoptera: Cerambycidae, Lamiinae)

    OpenAIRE

    SOUZA FILHO, MIGUEL F. DE; GABRIEL, DALVA; AZEVEDO FILHO, JOAQUIM A. DE

    2001-01-01

    A ocorrência simultânea de Adetus analis (Haldeman), Adetus fuscoapicalis Breuning e Plerodia syrinx (Bates) (Coleoptera: Cerambycidae, Lamiinae), broqueando ramos de chuchuzeiro Sechium edule (Jaqc.) Sw., é relatada. A. analis é sinônima de A. muticus (Thomson), que foi referida por diversos autores no Brasil. A. analis e A. fuscoapicalis são muito semelhantes quanto aos aspectos morfológicos e etológicos. Assim foi realizada uma descrição detalhada e ilustrações de ambas espécies a fim de p...

  16. What do we know about winter active ground beetles (Coleoptera, Carabidae in Central and Northern Europe?

    Directory of Open Access Journals (Sweden)

    Radomir Jaskula

    2011-05-01

    Full Text Available This paper summarizes the current knowledge on winter active Carabidae in Central and Northern Europe. In total 73 winter active species are listed, based on literature and own observations. Ground beetles are among the three most numerous Coleoptera families active during the autumn to spring period. The winter community of Carabidae is composed both of larvae (mainly autumn breeding species and adults, as well as of epigeic species and those inhabiting tree trunks. Supranivean fauna is characterized by lower species diversity than the subnivean fauna. The activity of ground beetles decreases in late autumn, is lowest during mid-winter and increases in early spring. Carabidae are noted as an important food source in the diet of insectivorous mammals. They are also predators, hunting small winter active invertebrates.

  17. Two new species of the megadiverse lentic diving-beetle genus Hydrovatus (Coleoptera, Dytiscidae described from NE Thailand

    Directory of Open Access Journals (Sweden)

    Olof Bistrom

    2016-11-01

    Full Text Available Here we describe two new Hydrovatus species (Coleoptera: Dytiscidae: Hydroporinae: Hydrovatini from the province of Khon Kaen, Isan region in NE Thailand. Hydrovatus is the third most species rich genus of diving beetles (Dytiscidae. It occurs on all continents except Antarctica and now numbers 210 currently recognized species. Both new species, H. diversipunctatus sp. n. and H. globosus sp. n., were collected at lights and are only known from the type locality “Khon Kaen” (a city and province. Diagnoses based on morphology for the separation from closely related species are given together with illustrations of male genitalia and habitus photos. We provide a determination key to Old World species of the pustulatus species group and to Oriental species of the oblongipennis species group.

  18. Dispersal of individuals of the flightless grassland ground beetle, Carabus hungaricus (Coleoptera: Carabidae), in three populations and what they tell us about mobility estimates based on mark-recapture

    Czech Academy of Sciences Publication Activity Database

    Elek, Z.; Drag, Lukáš; Pokluda, Pavel; Čížek, Lukáš; Bérces, S.

    2014-01-01

    Roč. 111, č. 5 (2014), s. 663-668 ISSN 1210-5759 Grant - others:Hungarian Academy of Sciences(HU) BO/00045/11/8; European Social Fund(CZ) CZ.1.07/2.3.00/20.0064 Institutional support: RVO:60077344 Keywords : Coleoptera * Carabidae * Carabus hungaricus Subject RIV: EH - Ecology, Behaviour Impact factor: 0.975, year: 2014 http://www.eje.cz/pdfs/eje/2014/05/10.pdf

  19. CEPF Western Ghats Special Series : Parasitoids (Hymenoptera of xylophagous beetles (Coleoptera attacking dead wood in southern Western Ghats, Kerala, India, with descriptions of two new species

    Directory of Open Access Journals (Sweden)

    P.M. Sureshan

    2013-05-01

    Full Text Available An account is given of four species of Hymenoptera parasitoids probably of the wood boring beetle Clytocera chinospila Gahan (Coleoptera: Cerambycidae from Chinnar Wildlife Sanctuary, southern Western Ghats, Kerala. Two new hymenopteran species, Eurytoma chinnarensis (Eurytomidae and Foenatopus idukkiensis (Stephanidae are described. Solenura ania Walker (Pteromalidae is reported for the first time from Kerala and Western Ghats with a new host record, and Doryctus sp. (Braconidae is reported here.

  20. Riqueza del complejo chisa (Coleoptera: Melolonthidae en cuatro agroecosistemas del Cauca, Colombia

    Directory of Open Access Journals (Sweden)

    Morón R. Miguel A.

    2005-12-01

    Full Text Available La composición y variación de la riqueza del complejo de larvas Melolonthidae se examinó en cuatro circunstancias agroecológicas en los municipios de Caldono y Buenos Aires, Cauca (1400 a 1500 m.s.n.m, 21,5ºC. y 2000 mm/año de precipitación promedio. Quincenalmente, durante un año, se visitaron parcelas de media hectárea de yuca, pastizal, cafetal y bosque, en cada parcela y ocasión se realizaron 10 muestreos ( 1m2 por 15 cm de profundidad. Se colectaron 10.261 larvas pertenecientes a 32 especies y 12 géneros de Melolonthidae, así: Phyllophaga, Plectris, Astaena, Macrodactylus, Ceraspis, Barybas, Isonychus, Anomala Callistethus, Strigoderma, Leucothyreus, Cyclocephala. La riqueza de especies presentó variaciones estadísticamente significativas entre localidades (F=87.24 p =2.72-18, muestreos (F=22.29 p =5.18-13, parcelas (F= 23.39 p=1.40-13 así como entre la mayoría de interacciones. Los promedios de riqueza fueron: yuca (4.5 , pastizal (3.6, café (2.1 y bosque (2.2, cada uno con grandes fluctuaciones que hicieron la diferencia. Se discuten las curvas de isodensidades de cada parcela y sus implicaciones en el programa de manejo. Abstract Richness of the white-grub complex (Coleoptera: Melolonthidae in agroecosystems of the Cauca province, Colombia. The composition and variation in the richness of the complex of rhizophagous Melolonthidae larvae was examinated in four agroecological zones in the Municipality of Caldono (1400-1500 m, 21.5ºC, average rainfall 2000 mm/yr with complementary surveys in the neighbouring site of Buenos Aires, Cauca. Half-hectare plots (cassava, pastures, coffee and wooded areas were selected and visited every 15 days (total of 15 visits per plot, and a total of 10 samples were taken (1 m2 by 15 cm deep. In total, 10,261 larvae of 32 species were collected: Phyllophaga, Plectris, Astaena, Macrodactylus, Ceraspis, Barybas, Isonychus, Anomala Callistethus, Strigoderma, Leucothyreus, Cyclocephala

  1. Caracteres preimaginales y aspectos bionómicos de Gyriosomus luczotii Laporte, 1840 (Coleoptera, Tenebrionidae

    Directory of Open Access Journals (Sweden)

    Jerez, V.

    2011-12-01

    Full Text Available We describe the morphology and microstructure of the egg chorion, and the morphology of the first instar larva of Gyriosomus luczotii Laporte, 1840 (Coleoptera, Tenebrionidae, Nycteliini. Bionomical and distributional data on this species are also provided. To obtain eggs and larvae, couples were collected in the field and kept in rearing cages until oviposture and ecclosion. The structure and adornment of the egg exochorion, and the exterior morphological features of larvae were examined with electron scanning microscopy. The eggs of G. luczotii showed a rounded micropyle and a smooth exochorion, composed of hexagonal cells without aeropyles. The larvae of G. luczotii showed morphological characteristics suited for an edaphic life similar to that of Pedobionta: digging prothoracic legs, cephalic capsule with abundant sensilla, and well–developed pygopodium. We analysed the importance of larval morphology as an element for specific diagnosis and found that interspecific differences regarding frontal sensilla, clypeus shape, and anterior part of labrum, had a taxonomic value and possibly a phylogenetic value.

  2. Design and deployment of semiochemical traps for capturing Anthonomus rubi Herbst (Coleoptera: Curculionidae) and Lygus rugulipennis Poppius (Hetereoptera: Miridae) in soft fruit crops

    DEFF Research Database (Denmark)

    Fountain, Michelle T.; Baroffio, Catherine; Borg-Karlson, Anna-Karin

    2017-01-01

    Strawberry blossom weevil (SBW), Anthonomus rubi Herbst (Coleoptera: Curculionidae) and European tarnished plant bug (ETB), Lygus rugulipennis Poppius (Hetereoptera: Miridae), cause significant damage to strawberry and raspberry crops. Using the SBW aggregation pheromone and ETB sex pheromone we...... if deployed at ground level and although a cross vane was not important for catches of ETB it was needed for significant captures of SBW. The potential for mass trapping SBW and ETB simultaneously in soft fruit crops is discussed including potential improvements to make this more effective and economic...

  3. Uji Aktivitas Ekstrak Daun Seledri ( Apium graveolens L. terhadap Kumbang Kacang Callosobruchus chinensis L. (Coleoptera:Bruchidae

    Directory of Open Access Journals (Sweden)

    NI NENGAH DARMIATI

    2015-09-01

    Full Text Available The Activity Test of Celery Leaf Extract (Apium graveolens L. Against Bean Weevil, Callosobruchus cinensis L. (Coleoptera:Bruchidae The experiment was conducted at the Laboratory of Plant Pest and Disease Management,Department of Agroecotechnology, Faculty of Agriculture, Udayana University. The purpose of this experiment was to examine the activity of celery leaf extract against bean weevil, Callosobruchus chinensis L. The experiment was Randomized Complete Design, with five treatments of formulation concentration. The activities of celery leaf extract was indicated through i.e. contact poison test, repellent test, and the placement of eggs (oviposition test. The results showed that the celery leaf extract has activity as a contact poison with concentration 75% formulations caused over 50% death of the total insect. The extract with 100% concentration acted as a repellent and anti oviposition as well.

  4. Toxicities of azadirachtin and polychlorinated petroleum Hydrocarbon against resist and susceptible strains of tribolium castaneum (coleoptera: tenebrionidae) adults

    International Nuclear Information System (INIS)

    Hussain, R.; Riaz, M.; Riaz, M.

    2014-01-01

    The LC/sub 50/ values for malathion-resistant (PAK) and organo-50 phosphate-susceptible (FSS-II) strains of red flour beetle, Tribolium castaneum (Herbst) (Coleoptera: Tenebrionidae) adult beetles were determined through filter paper impregnated method against azadirachtin (Nimbokil 60 EC) and polychlorinated petroleum hydrocarbon (Tenekil 100 EC). The LC values of these insecticides were worked out as 12830 and 50 9331 ppm for azadirachtin and 5148 and 4047 ppm for Tenekil 100 EC against PAK and FSS-II strains, respectively. The results revealed that polychlorinated petroleum hydrocarbon was more toxic than the azadirachtin. Furthermore, both the insecticides were equally toxic to the adult beetles of T. castaneum as the difference was non-significant because of overlapping 95% FLs to LC./sub 50/. (author)

  5. Comparison of leaf beetle assemblages of deciduous trees canopies in Hungary (Coleoptera: Chrysomelidae).

    Science.gov (United States)

    Vig, K; Markó, V

    2005-01-01

    The species richness and species composition of Coleoptera assemblages were investigated in deciduous tree canopies in Hungary. Apple and pear orchards were investigated in Nagykovácsi, Kecskemét and Sárospatak in 1990-94, and limes and maples in Keszthely in 1999-2002. Faunistic results and conclusions of these investigations were published elsewhere. Examination of the fauna of parks, avenues and other planted urban plant stocks has only begun to occupy researchers in the last decade in Hungary. The proportion of leaf-beetle species in the material gathered on maples and limes ranged between 17.0 and 21.3 per cent. The commonest leaf-beetle specimens collected in the lime canopy were Aphthona euphorbiae, Chaetocnema tibialis, Longitarsus lycopi, L. pellucidus, L. pratensis and L. succineus. The commonest on maple were Aphthona euphorbiae, Chaetocnema concinna, C. tibialis, Longitarsus lycopi, L. pellucidus, L. succineus, Phyllotreta cruciferae and P. vittula. This study presents the details on the composition of the chrysomelid communities that was compared by metric ordination using the Syntax 5.1 program.

  6. The infestation by an exotic ambrosia beetle, Euplatypus parallelus (F. (Coleoptera: Curculionidae: Platypodinae of Angsana trees (Pterocarpus indicus Willd. in southern Thailand

    Directory of Open Access Journals (Sweden)

    Sara Bumrungsri

    2008-07-01

    Full Text Available An exotic ambrosia beetle, Euplatypus parallelus (F. was collected from infested Pterocarpus indicus Willd. trees in Prince of Songkla University. Larvae and eggs were found in simple galleries with a single branch. Either a single male or a male and a female were found in each gallery. Half of these infested trees were previously attacked by long-horned beetles probably Aristobia horridula (Hope (Coleoptera: Cerambycidae, while some of them appeared to be healthy. Fusarium oxysporum Schlecht.:Fr. was isolated from frass, sapwood samples and insect larvae, and might be a cause of death of P.indicus.

  7. Plant compounds insecticide activity against Coleoptera pests of stored products

    Energy Technology Data Exchange (ETDEWEB)

    Moreira, Marcio Dionizio; Picanco, Marcelo Coutinho; Guedes, Raul Narciso Carvalho; Campos, Mateus Ribeiro de; Silva, Gerson Adriano; Martins, Julio Claudio [Universidade Federal de Vicosa (UFV), MG (Brazil). Dept. de Biologia Animal]. E-mail: marcio.dionizio@gmail.com; picanco@ufv.br; guedes@ufv.br; mateusc3@yahoo.com.br; agronomiasilva@yahoo.com.br

    2007-07-15

    The objective of this work was to screen plants with insecticide activity, in order to isolate, identify and assess the bioactivity of insecticide compounds present in these plants, against Coleoptera pests of stored products: Oryzaephilus surinamensis L. (Silvanidae), Rhyzopertha dominica F. (Bostrichidae) and Sitophilus zeamais Mots. (Curculionidae). The plant species used were: basil (Ocimum selloi Benth.), rue (Ruta graveolens L.), lion's ear (Leonotis nepetifolia (L.) R.Br.), jimson weed (Datura stramonium L.), baleeira herb (Cordia verbenacea L.), mint (Mentha piperita L.), wild balsam apple (Mormodica charantia L.), and billy goat weed or mentrasto (Ageratum conyzoides L.). The insecticide activity of hexane and ethanol extracts from those plants on R. dominica was evaluated. Among them, only hexane extract of A. conyzoides showed insecticide activity; the hexane extract of this species was successively fractionated by silica gel column chromatography, for isolation and purification of the active compounds. Compounds 5,6,7,8,3',4',5'-heptamethoxyflavone; 5,6,7,8,3'-pentamethoxy-4',5'-methilenedioxyflavone and coumarin were identified. However, only coumarin showed insecticide activity against three insect pests (LD{sub 50} from 2.72 to 39.71 mg g{sup -1} a.i.). The increasing order of insects susceptibility to coumarin was R. dominica, S. zeamais and O. surinamensis. (author)

  8. NEW DATA ABOUT COMPOSITION, GEOGRAPHIC DISTRIBUTION AND POSSIBLE WAYS OF FORMING OF DARKLING BEETLES FAUNA (COLEOPTERA: TENEBRIONIDAE IN PERI-CASPIAN AND ISLAND CASPIAN ECOSYSTEMS. PART 1

    Directory of Open Access Journals (Sweden)

    G. M. Abdurakhmanov

    2014-01-01

    Full Text Available Abstract. Aim is study of biological diversity of the Caspian coasts and islands ecosystems, the composition, especially geographical distribution and possible ways of forming of darkling beetles fauna (Coleoptera: Tenebrionidae.Methods. We used the traditional methods of collecting (hand collecting, soil traps, light traps, processing and material definition. List discussed tenebrionid fauna is composed using Abdurakhmanov and Medvedev (1994, Abdurakhmanov and Nabozhenko (2011.Results. The paper includes a comparative analysis of darkling beetles (341 species of 17 regions of 5 Caspian countries. Diversity of Tenebrionidae of the Caspian islands Chechen (32 species, Tyuleniy (29 species, Nordovyi (24 species, Kulaly (16 species is discussed for the first time. Faunistic base of discussed ecosystems includes species with turanian (sensu lato, 204 species, steppe (42 species, caucasian (30 species, including subendemics of the Caucasus, mediterranean (19 species, western asian (17 species biogeographic complexes with background of widespread euro-siberian, transpalearctic, paleotropical species. Сonnections and relations of regional and island faunas are discussed.Main conclusions. Results of the study will be a step in the determination of age of the islands through the biological diversity and the coastal level regime of the Caspian Sea, as well as possible changes in the population structure of darkling beetles (Coleoptera: Tenebrionidae on island ecosystems.

  9. Observations on the Cave-Associated Beetles (Coleoptera of Nova Scotia, Canada

    Directory of Open Access Journals (Sweden)

    Moseley M.

    2009-07-01

    Full Text Available The cave-associated invertebrates of Nova Scotia constitute a fauna at a very early stage of post-glacial recolonization. TheColeoptera are characterized by low species diversity. A staphylinid Quedius spelaeus spelaeus, a predator, is the only regularlyencountered beetle. Ten other terrestrial species registered from cave environments in the province are collected infrequently. Theyinclude three other rove-beetles: Brathinus nitidus, Gennadota canadensis and Atheta annexa. The latter two together with Catopsgratiosus (Leiodidae constitute a small group of cave-associated beetles found in decompositional situations. Quedius s. spelaeusand a small suite of other guanophiles live in accumulations of porcupine dung: Agolinus leopardus (Scarabaeidae, Corticariaserrata (Latrididae, and Acrotrichis castanea (Ptilidae. Two adventive weevils Otiorhynchus ligneus and Barypeithes pellucidus(Curculionidae collected in shallow cave passages are seasonal transients; Dermestes lardarius (Dermestidae, recorded fromone cave, was probably an accidental (stray. Five of the terrestrial beetles are adventive Palaearctic species. Aquatic beetles arecollected infrequently. Four taxa have been recorded: Agabus larsoni (Dytiscidae may be habitual in regional caves; another Agabussp. (probably semivittatus, Dytiscus sp. (Dytiscidae, and Crenitis digesta (Hydrophilidae are accidentals. The distribution andecology of recorded species are discussed, and attention is drawn to the association of beetles found in a Nova Scotia “ice cave”.

  10. A new species of endogean, anophthalmous Parazuphium Jeannel from Northern Morocco (Coleoptera: Carabidae, with new molecular data for the tribe Zuphiini

    Directory of Open Access Journals (Sweden)

    Carmelo Andújar

    2011-06-01

    Full Text Available A new species of the genus Parazuphium (Coleoptera, Carabidae, Zuphiini, Parazuphium aguilerai sp.n., is described from the Tingitan peninsula in North Morocco. The single known specimen was found below a large stone deeply inserted in the substratum, and it is anophthalmous, depigmented and flattened. This is the second species of blind Parazuphium, the other being P. feloi Machado 1998 from a lave tube in the Canary Islands. Molecular data of the unique known P. aguilerai sp.n. specimen is provided, and a molecular phylogeny confirm its inclusion inside Zuphiini within Harpalinae. Identification keys to the Mediterranean and Macaronesian species of Parazuphium are provided.

  11. Vector Affinity and Diversity of Geosmithia Fungi Living on Subcortical Insects Inhabiting Pinaceae Species in Central and Northeastern Europe

    Czech Academy of Sciences Publication Activity Database

    Kolařík, Miroslav; Jankowiak, R.

    2013-01-01

    Roč. 66, č. 3 (2013), s. 682-700 ISSN 0095-3628 R&D Projects: GA ČR(CZ) GAP506/11/2302 Institutional support: RVO:61388971 Keywords : SCOLYTIDAE COLONIZING BRANCHES * PINUS-SYLVESTRIS L * BARK BEETLES Subject RIV: EE - Microbiology, Virology Impact factor: 3.118, year: 2013

  12. The new record for Turkish invasive alien insect fauna Anoplophora chinensis (Forster, 1771 (Coleoptera: Cerambycidae

    Directory of Open Access Journals (Sweden)

    Erdem Hızal

    2015-01-01

    Full Text Available International trade is increasing rapidly with developing transportation routes. As a result of this, it became easier for many animal species to move from their natural habitats with the break down of the natural barriers between countries and continents. Insects take an important place among these animals. Insect populations are controlled by several factors in their natural habitats, but they causes important problems as they move by living plants and wood materials to another area. They are so called invasive alien insect species in their new location. These species’ common characteristics are fast growth and reproduction, high dispersal ability, tolerance of wide range of enviromental conditions and ability to feed with various food types. The increase in importing of the plants and wood material in the recent years has been causing the prensence of these species in Turkey. In this research Anoplophora chinensis (Forster, 1771 (Coleoptera; Cerambycidae is given as a new record to Turkish invasive alien insect species fauna.

  13. Comunidade de Carabidae (Coleoptera em manchas florestais no Pantanal, Mato Grosso do Sul, Brasil Carabid community (Coleoptera in forest patches in Pantanal, State of Mato Grosso do Sul, Brazil

    Directory of Open Access Journals (Sweden)

    Letícia Vieira

    2008-09-01

    Full Text Available Neste trabalho foi estudado o efeito do tamanho, susceptibilidade à inundação e complexidade vegetacional na estrutura de comunidade de Carabidae (Coleoptera em ilhas de vegetação arbórea (capões de mata no Pantanal sul-mato-grossense, sub-regiões Miranda e Abobral. Os dados foram obtidos no período de outubro de 1998 a outubro de 1999 em seis capões de mata, através de 30 armadilhas de queda ("pitfall traps" instaladas por seis dias, mensalmente, no interior dos capões. Foram capturados 2.071 indivíduos, distribuídos em 64 espécies. Negrea scutellaris (Dejean, 1831 e uma espécie não-identificada de Lebiini foram as espécies mais abundantes (com 472 e 464 indivíduos, respectivamente. A distribuição gregária e o elevado número de espécies pouco abundantes encontrados pode refletir o padrão de disponibilidade de recursos das regiões tropicais. Entre as variáveis estudadas, apenas a complexidade vegetacional explicou a variação da riqueza de espécies nos capões de mata. A composição das espécies não foi explicada por nenhuma das variáveis avaliadas. Possivelmente a variação em tamanho e em complexidade vegetacional dos capões não seja tão evidente para demonstrar estas relações e a composição das espécies esteja variando mais em escala regional do que em escala local.This work addresses the effects of the size, flooding susceptibility and vegetation complexity on ground beetles community structure (Coleoptera, Carabidae in forest patches (capões in the sub-regions Miranda and Abobral of the Pantanal, State of Mato Grosso do Sul. Thirty pitfall traps were run for six days per month, in six forest patches between October 1998 and October 1999. A total of 2,071 individuals of 64 species were captured. Negrea scutellaris (Dejean, 1831 and an unidentified Lebiini were the most abundant species (472 and 464 individuals respectively. Gregarious distribution and great number of species of low abundance could

  14. Bioatividade da azadiractina e de inseticidas sintéticos sobre a broca-do-café, Hypothenemus hampei (FERRARI, 1867) (COLEOPTERA: CURCULIONIDAE), em laboratório

    OpenAIRE

    Tatiane Lobak

    2016-01-01

    A broca-do-café, Hypothenemus hampei (Ferrari, 1867) (Coleoptera: Curculionidae), é praga limitante à produtividade e a qualidade dos grãos. Com a proibição do uso do endossulfam, para seu controle, em 2013, novas alternativas devem ser pesquisadas, visto que atualmente tem se seis princípios ativos registrados no Brasil, incluindo a azadiractina. Assim, o objetivo deste trabalho foi avaliar a bioatividade da azadiractina e de inseticidas sintéticos sobre a broca-do-café, em condições de labo...

  15. Necrophagous species of Diptera and Coleoptera in northeastern Brazil: state of the art and challenges for the Forensic Entomologist Espécies necrófagas de Diptera e Coleoptera na Região Nordeste do Brasil: estado da arte e desafios para o Entomologista Forense

    Directory of Open Access Journals (Sweden)

    Simão D. Vasconcelos

    2012-03-01

    Full Text Available Inventories on necrophagous insects carried out in Brazil encompass mostly species from the southeastern and central-western regions of the country. This review aims to produce the first checklist of necrophagous Diptera and Coleoptera species of forensic relevance in northeastern Brazil, an area that concentrates high rates of homicides. We performed a literature survey on scientific articles, theses and dissertations regarding necrophagous insect species in the region, and contacted scientists who develop research on forensic entomology. Fifty-two species of Diptera belonging to eight families with previous record of necrophagy were reported in the region: Sarcophagidae, Calliphoridae, Muscidae, Fanniidae, Piophilidae, Phoridae, Anthomyiidae and Stratiomyidae. Coleopteran species from six families of forensic relevance were registered, although taxonomical identification remained superficial. Bait traps were the most frequent methodology used, followed by collection on animal carcasses. Seven Dipteran species from two families were registered on human cadavers. All species had been previously reported in other Brazilian states and/or other countries, although none has been effectively used in legal procedures in the region. The status of research on forensic entomology in northeastern Brazil is incipient, and the checklist produced here contributes to the knowledge on the local diversity of necrophagous insects.Inventários de insetos necrófagos no Brasil abordam em sua maioria espécies das regiões Sudeste e Centro-Oeste do país. Esta revisão visa apresentar um checklist de espécies necrófagas de Diptera e Coleoptera de importância forense no Nordeste brasileiro, uma área que concentra elevadas taxas de homicídio. Nós conduzimos uma revisão bibliográfica consultando artigos, teses e dissertações sobre espécies necrófagas na região, e contatamos cientistas que desenvolvem pesquisa em entomologia forense. Cinquenta e duas esp

  16. Susceptibility of Dalotia coriaria (Kraatz (Coleoptera: Staphylinidae to Entomopathogenic Nematodes (Rhabditida: Heterorhabditidae and Steinernematidae

    Directory of Open Access Journals (Sweden)

    Joseph Tourtois

    2015-03-01

    Full Text Available Dalotia coriaria (Kraatz (Coleoptera: Staphylinidae and entomopathogenic nematodes (Rhabditida: Heterorhabditidae and Steinernematidae are two soil-dwelling biological control agents used to manage western flower thrips, Frankliniella occidentalis (Pergande (Thysanoptera: Thripidae and fungus gnats Bradysis spp. (Diptera: Sciaridae in glasshouses. Growers often use multiple natural enemies to achieve economic control, but knowledge of interactions among natural enemies is lacking. We conducted a laboratory bioassay to test the pathogenicity of four commercially available nematode species—Heterorhabditis bacteriophora Poinar (Rhabditida: Heterorhbditidae, Steinernema carpocapsae (Weiser (Rhabditida: Steinernematidae, S. feltiae (Filipjev, and S. riobrave Cabanillas et al.—to third instar and adult D. coriaria. Third instars were three times more susceptible than the adults to the entomopathogenic nematodes. Mortality for D. coriaria adults and third instars treated with S. feltiae and H. bacteriophora was lower than the mortality for D. coriaria adults and third instars treated with S. carpocapsae and S. riobrave. Neither infective juvenile foraging behavior nor size correlates with D. coriaria mortality. Dalotia coriaria appears to be most likely compatible with applications of S. feltiae and H. bacteriophora.

  17. Ground beetles (Coleoptera, Carabidae of the Hanford Nuclear Site in south-central Washington State

    Directory of Open Access Journals (Sweden)

    Chris Looney

    2014-04-01

    Full Text Available In this paper we report on ground beetles (Coleoptera: Carabidae collected from the Hanford Nuclear Reservation and Hanford National Monument (together the Hanford Site, which is located in south-central Washington State. The Site is a relatively undisturbed relict of the shrub-steppe habitat present throughout much of the western Columbia Basin before the westward expansion of the United States. Species, localities, months of capture, and capture method are reported for field work conducted between 1994 and 2002. Most species were collected using pitfall traps, although other capture methods were employed. Trapping results indicate the Hanford Site supports a diverse ground beetle community, with over 90% of the 92 species captured native to North America. Four species collected during the study period are newly recorded for Washington State: Bembidion diligens Casey, Calosoma obsoletum Say, Pseudaptinus rufulus (LeConte, and Stenolophus lineola (Fabricius. Based on these data, the Site maintains a diverse ground beetle fauna and, due to its size and diversity of habitats, is an important repository of shrub-steppe biodiversity.

  18. Seed Detection and Discrimination by Ground Beetles (Coleoptera: Carabidae) Are Associated with Olfactory Cues.

    Science.gov (United States)

    Kulkarni, Sharavari S; Dosdall, Lloyd M; Spence, John R; Willenborg, Christian J

    2017-01-01

    Olfactory ability is an element of fitness in many animals, guiding choices among alternatives such as mating partners or food. Ground beetles (Coleoptera; Carabidae), exhibit preferences for prey, and some species are well-known weed seed predators. We used olfactometer-based bioassays to determine if olfactory stimuli are associated with detection of Brassica napus L., Sinapis arvensis L., and Thlaspi arvense L. seeds by ground beetles characteristic of agroecosystems, and whether behavioural responses to seed odors depended on seed physiological state (imbibed or unimbibed). Imbibed B.napus seeds were preferred over other weed species by two of the three carabid species tested. Only A. littoralis responded significantly to unimbibed seeds of B. napus. Sensitivity to olfactory cues appeared to be highly specific as all carabid species discriminated between the olfactory cues of imbibed brassicaceous weed seeds, but did not discriminate between weed seeds that were unimbibed. Overall, our data suggest that depending on seed physiological state, odours can play an important role in the ability of carabids to find and recognize seeds of particular weed species.

  19. Locomotor activity of Phalerisida maculata Kulzer (Coleoptera, Tenebrionidae on Chilean sandy beaches Actividad locomotora de Phalerisida maculata Kulzer (Coleoptera, enebrionidae en playas arenosas chilenas

    Directory of Open Access Journals (Sweden)

    EDUARDO JARAMILLO

    2000-03-01

    Full Text Available The locomotor activity of the beetle Phalerisida maculata Kulzer (Coleoptera Tenebrionidae was studied on the surface of the substrate in two sandy beaches of the Chilean coast: one in north central (ca. 29ºS and the other in south central Chile (ca.39ºS. During the summer period of 1991 the circadian locomotor activity was studied in the southern beach, while during that of 1997 in both beaches. To analyze the activity, pitfall traps were used which were ordered along two transects extended between the upper beach and the resurgence zone. The traps were checked (i.e. collection of captured insects every two hours for a total period of 26 hours. The results showed that the adults of P. maculata were mostly active during the night hours, whereas the larvae were active during both, the day and night. Studies carried out in the beach located in south central Chile show that differences in the tidal range (neap vs. spring tides do not affect the activity patterns. During the locomotor activity, adult and larvae move to lower intertidal levels than those usually occupied while buried. Results of laboratory experiments using actographs under conditions of darkness and constant temperature, suggest that adults and larvae of P. maculata presented a circadian rhythm similar to that observed in the field experiments. It is concluded that P. maculata presents a behaviour that appear to be under control of an endogenous rhythm, without showing differences in the circadian rhythm of activity when beaches located at different latitudes are comparedSe estudió la actividad locomotriz del escarabajo Phalerisida maculata Kulzer (Coleoptera, Tenebrionidae sobre la superficie del sustrato de dos playas arenosas de la costa de Chile: una en el centro norte (ca. 29ºS y otra en el centro sur (ca. 39ºS. Durante el período estival de 1991 se estudió la actividad locomotriz circadiana en la playa del centro sur y durante el de 1997 en ambas playas. Para analizar

  20. Economic analysis of emerald ash borer (Coleoptera: Buprestidae) management options.

    Science.gov (United States)

    Vannatta, A R; Hauer, R H; Schuettpelz, N M

    2012-02-01

    Emerald ash borer, Agrilus planipennis (Fairmaire) (Coleoptera: Buprestidae), plays a significant role in the health and extent of management of native North American ash species in urban forests. An economic analysis of management options was performed to aid decision makers in preparing for likely future infestations. Separate ash tree population valuations were derived from the i-Tree Streets program and the Council of Tree and Landscape Appraisers (CTLA) methodology. A relative economic analysis was used to compare a control option (do-nothing approach, only removing ash trees as they die) to three distinct management options: 1) preemptive removal of all ash trees over a 5 yr period, 2) preemptive removal of all ash trees and replacement with comparable nonash trees, or 3) treating the entire population of ash trees with insecticides to minimize mortality. For each valuation and management option, an annual analysis was performed for both the remaining ash tree population and those lost to emerald ash borer. Retention of ash trees using insecticide treatments typically retained greater urban forest value, followed by doing nothing (control), which was better than preemptive removal and replacement. Preemptive removal without tree replacement, which was the least expensive management option, also provided the lowest net urban forest value over the 20-yr simulation. A "no emerald ash borer" scenario was modeled to further serve as a benchmark for each management option and provide a level of economic justification for regulatory programs aimed at slowing the movement of emerald ash borer.

  1. Diversity of Scydmaeninae (Coleoptera: Staphylinidae) in Upper Eocene Rovno amber.

    Science.gov (United States)

    Jałoszyński, Paweł; Perkovsky, Evgeny

    2016-08-25

    Among nearly 1270 inclusions of Coleoptera found in Upper Eocene Rovno amber, 69 were identified as ant-like stone beetles (Scydmaeninae); 34 were possible to unambiguously determine to the tribal level and were studied in detail. Rovnoleptochromus ableptonoides gen. & sp. n. (Mastigitae: Clidicini), Vertheia quadrisetosa gen. & sp. n. (Cephenniitae: Eutheiini), Cephennomicrus giganteus sp. n. (Cephenniitae: Cephenniini), Glaesoconnus unicus gen. & sp. n. (Scydmaenitae: Glandulariini), Rovnoscydmus frontalis gen. & sp. n. (Scydmaenitae: Glandulariini; type species of Rovnoscydmus), Rovnoscydmus microscopicus sp. n., Euconnus (incertae sedis, near Cladoconnus) palaeogenus sp. n. (Scydmaenitae: Glandulariini), and Stenichnus (s. str.) proavus sp. n. (Scydmaenitae: Glandulariini) are described. Additionally, specimens representing one undescribed species of Vertheia, one of Cephennodes, five of Cephennomicrus, one of Euconnus, one of Microscydmus are recorded, and nine specimens representing an unknown number of species of Rovnoscydmus (and two putative Rovnoscydmus), one Euconnus (and one putative Euconnus), two putative Microscydmus and one putative Scydmoraphes were found in the studied material. The composition of Scydmaeninae fauna in Rovno amber is discussed in the context of ecological preferences and distribution of extant taxa. It is concluded that subtropical and tropical taxa were present in the region where Rovno amber has formed, most notably the second genus and species of the extant tribe Clidicini known from the Eocene of Europe, and six species of the extant genus Cephennomicrus, for the first time found in the fossil record. An annotated catalog of nominal species of Scydmaeninae known in the fossil record is given.

  2. Debaryomyces hansenii: A Model System for Marine Molecular Biology

    Science.gov (United States)

    1991-12-31

    bisexualts and Ochromonas danica (Gunderson et al. 1987), Prorocerarum micans (Herzog and Maroteaux, 1986), Crypthecodinium cohnii and Saccocystis muris ...Dicdyostelium discoideum(McCaroll et al. 1983), Physarum polycephatun (Johansen et al. 1988), Giardia lamblia (Sogin et al. 1989), Suijflobus...Physanum polycephalum , Giardia lamblia , and .ulfolobu soljbnicus used as outgroups). The relationships of the ciliates, the apicomplexans, and the

  3. Erotylidae (Insecta, Coleoptera of Poland – problematic taxa, updated keys and new records

    Directory of Open Access Journals (Sweden)

    Rafal Ruta

    2011-10-01

    Full Text Available New data concerning the occurrence of pleasing fungus beetles (Coleoptera: Erotylidae in Poland are given, with a focus on rare and difficult to identify Central European taxa. Cryptophilus cf. integer (Heer (Cryptophilinae is reported from the Polish territory for the first time based on adult and larval specimens collected in the Wielkopolska-Kujawy Lowland. Identification problems concerning species of Cryptophilus introduced to Europe are discussed. Triplax carpathica Reitter (Erotylinae is recorded from the Białowieża Primeval Forest, which is the first known non-Carpathian finding of this species, located in the close proximity of the Polish-Belarussian UNESCO World Heritage Site “Białowieża Forest”. Discussion of T. carpathica being conspecific with Siberian T. rufiventris Gebler is provided. New Polish localities of several other Erotylidae are reported, and an updated key to Central European species of Triplax is given. The Triplax key is supplemented with dorsal and ventral habitus images of all treated Triplax species. One of the rarest Central European erotyline species Combocerus glaber (Schaller is recorded from xerothermic grasslands in North-West Poland.

  4. Erotylidae (Insecta, Coleoptera) of Poland – problematic taxa, updated keys and new records

    Science.gov (United States)

    Ruta, Rafał; Jałoszyński, Paweł; Sienkiewicz, Paweł; Konwerski, Szymon

    2011-01-01

    Abstract New data concerning the occurrence of pleasing fungus beetles (Coleoptera: Erotylidae) in Poland are given, with a focus on rare and difficult to identify Central European taxa. Cryptophilus cf. integer (Heer) (Cryptophilinae) is reported from the Polish territory for the first time based on adult and larval specimens collected in the Wielkopolska-Kujawy Lowland. Identification problems concerning species of Cryptophilus introduced to Europe are discussed. Triplax carpathica Reitter (Erotylinae) is recorded from the Białowieża Primeval Forest, which is the first known non-Carpathian finding of this species, located in the close proximity of the Polish-Belarussian UNESCO World Heritage Site “Białowieża Forest”. Discussion of Triplax carpathica being conspecific with Siberian Triplax rufiventris Gebler is provided. New Polish localities of several other Erotylidae are reported, and an updated key to Central European species of Triplax is given. The Triplax key is supplemented with dorsal and ventral habitus images of all treated Triplax species. One of the rarest Central European erotyline species Combocerus glaber (Schaller) is recorded from xerothermic grasslands in North-West Poland. PMID:22140339

  5. BIOECOLOGY AND MANAGEMENT OF ERVA-MATE BORER, Hedypathes betulinus (KLUG, 1825 (COLEOPTERA: CERAMBYCIDAE

    Directory of Open Access Journals (Sweden)

    Márcia d´Avila

    2010-08-01

    Full Text Available The erva-mate (Ilex paraguariensis A.St.-Hil. has a social, cultural and economic importance in  the southern states of Brazil. The  pure stands of  this culture was responsible for the increase  of many species of insects. Hedypathes betulinus (Klug, 1825 (Coleoptera: Cerambycidae is considered the main pest from an economic viewpoint because of its difficult control and potential for damage. The larval phase occurs inside the twings and trunks, what makes more difficult to deal with its detention and management. Cultural and mechanical management are the most indicated, such as collection of adults, prunning and burning of plant parts damaged by the insect, balanced nutrition, adequate plant density and maintenance of areas with native vegetation or also the introduction of policulture. These strategies  may increase  the  agroecossystem  balance  and  thus  a  reduction  of  the  insect-pest  to  an aceptable level. Therefore, the objective of this study was to assemble and the discuss the information on the bioecology and management of erva-mate borer.

  6. The European lesser glow worm, Phosphaenus hemipterus (Goeze, in North America (Coleoptera, Lampyridae

    Directory of Open Access Journals (Sweden)

    Christopher Majka

    2009-12-01

    Full Text Available Phosphaenus hemipterus (Goeze is a Palaearctic glow worm (Coleoptera: Lampyridae, previously been reported in North America on the basis of two specimens; one collected in 1947 in Yarmouth, Nova Scotia; the other in 1989 in Montreal, Quebec. The present study newly records it from three sites in Halifax, Nova Scotia. One hundred and twenty six adult males and larvae were collected in 2009 in disturbed urban grassland areas, similar to habitats in England and Belgium where the species has been investigated. Experiments confirm that larvae feed on earthworms (Lumbricus terrestris, consistent with observations in Europe. The habitat is described, including vegetation, potential predators, and prey. Although ballast-shipments have previously been proposed as a vector for the species’ introduction to North America, the present study suggests that the importation of agricultural and horticultural products, which has lead to the introduction of many earthworms to the continent, could also serve as a conduit for the introduction of obligate earthworm predators such as the larvae of P. hemipterus. Although an adventive species, possible conservation concerns are discussed for a species that is considered endangered in parts of its native range.

  7. ATIVIDADE INSETICIDA DE PLANTAS MEDICINAIS SOBRE O Callosobruchus maculatus (COLEOPTERA: BRUCHIDAE

    Directory of Open Access Journals (Sweden)

    Antonia Mirian Nogueira de Moura Guerra

    2009-01-01

    Full Text Available This study aimed to evaluate the insecticidal activity of eight medicinal plants on Callosobruchus maculatus (F. (Coleoptera: Bruchidae. Plant powder from Rosmarinus officinalis (L. leaves, Peumus boldus (Mol leaves, Matricaria chamomilla (L. flowers, Baccharis trimera (Less. leaves, Camellia sinensis (L. leaves, Thea sinensis (L. leaves, Ilex paraguariensis (St. Hil. leaves, and fruits of Pimpinella anisum (L. were used in the experiment. Bioassays were carried out under constant conditions of temperature (28±2 °C, relative humidity (70±5% and scotophase of 24 hours. Experimental units consisted of 20 grams of cowpea (Vigna unguiculata (L. Walp. grains with 13% wet basis moisture content, 2 g plant powder and ten adult insects, both placed in plastic containers (60 mm in diameter x 60 mm high. The analyzed variables included: insect mortality, oviposition (egg number and instantaneous rate of population growth (ri. The number of dead insects was recorded 5 days after bioassays were started, the egg number was recorded after 12 days, and ri was estimated on the 60th day. All the tested plants had toxicity to C. maculatus. The highest mortality was found in insects treated with P. boldus and I. paraguariensis. Number of eggs and ri also varied significantly among the powders. The lowest mean values for these parameters were recorded in the plots treated with P. boldus, P. anisum and R. officinalis.

  8. Olfaction in the boll weevil,Anthonomus grandis Boh. (Coleoptera: Curculionidae): Electroantennogram studies.

    Science.gov (United States)

    Dickens, J C

    1984-12-01

    Electroantennogram (EAG) techniques were utilized to measure the antennal olfactory responsiveness of adult boll weevils,Anthonomus grandis Boh. (Coleoptera: Curculionidae), to 38 odorants, including both insect and host plant (Gossypium hirsutum L.) volatiles. EAGs of both sexes were indicative of at least two receptor populations: one receptor population primarily responsive to pheromone components and related compounds, the other receptor population primarily responsive to plant odors. Similar responses to male aggregation pheromone components (i.e., compounds I, II, and III + IV) were obtained from both sexes, but females were slightly more sensitive to I. Both sexes were highly responsive to components of the "green leaf volatile complex," especially the six-carbon saturated and monounsaturated primary alcohols. Heptanal was the most active aldehyde tested. More acceptors responded to oxygenated monoterpenes than to monoterpene hydrocarbons. β-Bisabolol, the major volatile of cotton, was the most active sesquiterpene. In general, males, which are responsible for host selection and pheromone production, were more sensitive to plant odors than were females. In fact, males were as sensitive to β-bisabolol and heptanal as to aggregation pheromone components. Electrophysiological data are discussed with regard to the role of insect and host plant volatiles in host selection and aggregation behavior of the boll weevil.

  9. Development and Life History of Sitophilus zeamais (Coleoptera: Curculionidae on Cereal Crops

    Directory of Open Access Journals (Sweden)

    James Adebayo Ojo

    2016-01-01

    Full Text Available The maize weevil, Sitophilus zeamais Motschulsky (Coleoptera: Curculionidae, is one of the most destructive pests of stored cereals. Knowledge of the life history and biology is important to the development of an integrated pest management program. Investigation was carried out on developmental biology of S. zeamais on four main cereal crops, maize, rice, sorghum, and millet, under laboratory conditions. Egg incubation, oviposition periods, and larval instar development were not different significantly among the food hosts. Number of eggs laid varied significantly among the cereal grains; mean fecundity was highest on maize (67.2±3.16 and lowest on millet (53.8±0.17. Number of immature (larva and pupa and adult stages varied significantly among the cereal grains. There exist four larval instars with a varied mean head capsule width, with a mean total instar larval developmental period of 23.1, 22.2, 22.2, and 21.6 d on maize, rice, sorghum, and millet, respectively. There was linear relationship and significant correlation between the stages of larval development and head capsule width. The mean developmental period from egg to adult varied, being highest on maize (34.7 d and lowest on sorghum (33.5 d.

  10. Heterochromatin and molecular characterization of DsmarMITE transposable element in the beetle Dichotomius schiffleri (Coleoptera: Scarabaeidae).

    Science.gov (United States)

    Xavier, Crislaine; Cabral-de-Mello, Diogo Cavalcanti; de Moura, Rita Cássia

    2014-12-01

    Cytogenetic studies of the Neotropical beetle genus Dichotomius (Scarabaeinae, Coleoptera) have shown dynamism for centromeric constitutive heterochromatin sequences. In the present work we studied the chromosomes and isolated repetitive sequences of Dichotomius schiffleri aiming to contribute to the understanding of coleopteran genome/chromosomal organization. Dichotomius schiffleri presented a conserved karyotype and heterochromatin distribution in comparison to other species of the genus with 2n = 18, biarmed chromosomes, and pericentromeric C-positive blocks. Similarly to heterochromatin distributional patterns, the highly and moderately repetitive DNA fraction (C 0 t-1 DNA) was detected in pericentromeric areas, contrasting with the euchromatic mapping of an isolated TE (named DsmarMITE). After structural analyses, the DsmarMITE was classified as a non-autonomous element of the type miniature inverted-repeat transposable element (MITE) with terminal inverted repeats similar to Mariner elements of insects from different orders. The euchromatic distribution for DsmarMITE indicates that it does not play a part in the dynamics of constitutive heterochromatin sequences.

  11. Impact of the newly arrived seed-predating beetle Specularius impressithorax (Coleoptera: Chrysomelidae: Bruchinae) in Hawai'i

    Science.gov (United States)

    Medeiros, A.C.; Von Allmen, E.; Fukada, M.; Samuelson, A.; Lau, T.

    2008-01-01

    Prior to 2001, seed predation was virtually absent in the endemic Wiliwili Erythrina sandwicensis (Fabaceae: Degener), dominant tree species of lower-elevation Hawaiian dryland forests. The African bruchine chrysomelid Specularius impressithorax (Pic) (Coleoptera: Chrysomelidae: Bruchinae) was first detected in Hawai'i in 2001 and became established on all main islands within the next two years. The mode of entry for this invasive Erythrina seed predator into Hawai'i is unknown, but likely occurred with the importation of trinket jewelry from Africa containing characteristically brightly-colored Erythrina seeds. The initial establishment of this insect likely occurred on a non-native host, the widely cultivated coral tree E. variegata. Within three years of its first record, S. impressithorax accounted for 77.4% mean seed crop loss in 12 populations of Wiliwili on six main Hawaiian islands. Specularius impressithorax, dispersed through international commerce and established via E. variegata, has become a threat to a unique Hawaiian forest type and may threaten other Erythrina, especially New World representatives.

  12. Taxonomic notes on the ground beetles in the genus Trephionus Bates, 1883 from central Honshu, Japan (Coleoptera, Carabidae, Sphodrini, Synuchina).

    Science.gov (United States)

    Sasakawa, Kôji; Itô, Hirotarô

    2018-01-01

    Trephionus Bates, 1883, a Japanese endemic genus in the subtribe Synuchina (Coleoptera, Carabidae, Sphodrini), is revised taxonomically based mainly on the shape of the endophallus, a membranous inner sac everted from the aedeagus of the male genitalia. Three known species from central Honshu, T. kinoshitai Habu, 1954; T. shibataianus Habu, 1978; and T. babai Habu, 1978, are re-defined based on this genital character, and five new species are described from the region: T. cylindriphallus Sasakawa, sp . n ., T. niumontanus Sasakawa, sp . n ., T. inexpectatus Sasakawa & Itô, sp . n ., T. abiba Sasakawa & Itô, sp . n ., and T. bifidilobatus Sasakawa & Itô, sp . n . The observed interspecies differences in endophallus morphology are discussed in terms of the species-level phylogeny and genus-level taxonomy of Trephionus .

  13. Using malaise traps to sample ground beetles (Coleoptera: Carabidae).

    Energy Technology Data Exchange (ETDEWEB)

    Ulyshen, Michael D., James L. Hanula, and Scott Horn

    2005-01-01

    Pitfall traps provide an easy and inexpensive way to sample ground-dwelling arthropods (Spence and Niemela 1994; Spence et al. 1997; Abildsnes and Tommeras 2000) and have been used exclusively in many studies of the abundance and diversity of ground beetles (Coleoptera: Carabidae). Despite the popularity of this trapping technique, pitfall traps have many disadvantages. For example, they often fail to collect both small (Spence and Niemela 1994) and trap-shy species (Benest 1989), eventually deplete the local carabid population (Digweed et al. 1995), require a species to be ground-dwelling in order to be captured (Liebherr and Mahar 1979), and produce different results depending on trap diameter and material, type of preservative used, and trap placement (Greenslade 1964; Luff 1975; Work et al. 2002). Further complications arise from seasonal patterns of movement among the beetles themselves (Maelfait and Desender 1990), as well as numerous climatic factors, differences in plant cover, and variable surface conditions (Adis 1979). Because of these limitations, pitfall trap data give an incomplete picture of the carabid community and should be interpreted carefully. Additional methods, such as use of Berlese funnels and litter washing (Spence and Niemela 1994), collection from lights (Usis and MacLean 1998), and deployment of flight intercept devices (Liebherr and Mahar 1979; Paarmann and Stork 1987), should be incorporated in surveys to better ascertain the species composition and relative numbers of ground beetles. Flight intercept devices, like pitfall traps, have the advantage of being easy to use and replicate, but their value to carabid surveys is largely unknown. Here we demonstrate the effectiveness of Malaise traps for sampling ground beetles in a bottomland hardwood forest.

  14. Using malaise traps to sample ground beetles (Coleoptera. Carabidae)

    Energy Technology Data Exchange (ETDEWEB)

    Ulyshen, Michael D. [USDA Forest Service, Savannah River, New Ellenton, SC (United States); Hanula, James L. [USDA Forest Service, Savannah River, New Ellenton, SC (United States); Horn, Scott [USDA Forest Service, Savannah River, New Ellenton, SC (United States)

    2012-04-02

    Pitfall traps provide an easy and inexpensive way to sample ground-dwelling arthropods (Spence and Niemela 1994; Spence et al. 1997; Abildsnes and Tommeras 2000) and have been used exclusively in many studies of the abundance and diversity of ground beetles (Coleoptera: Carabidae). Despite the popularity of this trapping technique, pitfall traps have many disadvantages. For example, they often fail to collect both small (Spence and Niemela 1994) and trap-shy species (Benest 1989), eventually deplete the local carabid population (Digweed et al. 1995), require a species to be ground-dwelling in order to be captured (Liebherr and Mahar 1979), and produce different results depending on trap diameter and material, type of preservative used, and trap placement (Greenslade 1964; Luff 1975; Work et al. 2002). Further complications arise from seasonal patterns of movement among the beetles themselves (Maelfait and Desender 1990), as well as numerous climatic factors, differences in plant cover, and variable surface conditions (Adis 1979). Because of these limitations, pitfall trap data give an incomplete picture of the carabid community and should be interpreted carefully. Additional methods, such as use of Berlese funnels and litter washing (Spence and Niemela 1994), collection from lights (Usis and MacLean 1998), and deployment of flight intercept devices (Liebherr and Mahar 1979; Paarmann and Stork 1987), should be incorporated in surveys to better ascertain the species composition and relative numbers of ground beetles. Flight intercept devices, like pitfall traps, have the advantage of being easy to use and replicate, but their value to carabid surveys is largely unknown. Here we demonstrate the effectiveness of Malaise traps for sampling ground beetles in a bottomland hardwood forest.

  15. Biological aspects of Leucothyreus ambrosius Blanchard (Coleoptera, Melolonthidae, Rutelinae

    Directory of Open Access Journals (Sweden)

    Elias Soares Gomes

    2014-06-01

    Full Text Available Biological aspects of Leucothyreus ambrosius Blanchard (Coleoptera, Melolonthidae, Rutelinae. Coleopterans of the family Melolonthidae comprise a large group of species that feed on different food sources, including plant roots, stems, and leaves, in addition to plant materials at different decomposition stages. Several species are found in the genus Leucothyreus, occurring in different regions of Brazil, including the various biomes in the country. Information on the biology of species of the genus Leucothyreus is scarce, therefore, we conducted studies on the biological aspects of Leucothyreus ambrosius Blanchard, 1850. The period of adult occurrence was determined with a light trap installed between a cropped and pasture area in the municipality of Aquidauana, Mato Grosso do Sul State, Brazil. Adults collected in the field were used to form insect pairs and the studies were initiated in the entomology laboratory as the adults began ovipositing. Adults were observed flying in the field from October to December. Eggs were obtained as pairs were formed and a colony was established, the embryonic period lasting 14.6 days on average. The larval period in the 1st instar lasted 21.6 days, in the 2nd instar 19.6 days, and in the 3rd instar, 85.6 days. The head capsule width was 1.48 mm in the 1st instar, 2.44 mm in the 2nd, and 3.83 mm in 3rd larval instar. The pupal stage had an average duration of 35.5 days. The egg to adult period lasted 173.3 days. Morphometric information for the larval and adult stages is presented in this study.

  16. Variação de Abundância, Diversidade Ecológica e Similaridade de Coleoptera (Insecta entre Restinga e Marisma do Estuário da Lagoa dos Patos, Rio Grande, RS

    Directory of Open Access Journals (Sweden)

    Katiele Dummel

    2011-07-01

    Abstract. Insecta is the most diverse, abundant and dominant group of arthropods, being used in diversity studies as biological indicators. Despite this, there are few studies regard to coleopterofauna and its relation to coastal environments. Salt marshes and sandbanks are characterized by their ecological importance of coastal regions of the southwest Atlantic. Therefore, this study aimed to compare the fauna of Coleoptera captured in a sandbank area with the fauna of a salt marsh in the estuary of the lagoon Lagoa dos Patos, RS. Samples were collected from August 2007 to July 2008 in sandbank area; and from September 2008 to August 2009 in the salt marsh area. A total of 826 beetles were collected, distributed in 26 families. The results suggest that both sandbank and salt marsh presented equally rich families, but with alternation of dominance between the areas. Coleoptera communities flutuactions in each area were different in the period; however, the peak abundance of both areas coincided with the warmer months. The diversity of families was higher in the area of sandbank, while families caught in sandbanks have greater similarity to those found in both areas. Groups classified as rare surpassed common. Families of varied habit appeared in both environments; nonetheless, the herbivorous dominated in the sandbank and carnivorous in the salt marsh.

  17. AcEST: BP912427 [AcEST

    Lifescience Database Archive (English)

    Full Text Available 2 tr|Q4R1A7|Q4R1A7_PEDDU Plastocyanin OS=Pediastrum duplex GN=Pcy ... 75 2e-12 tr|B0JHN7|B0JHN7_MICAN Plasto... V+ Sbjct: 86 KGLAFSAGESFESTFSEPGTYTYYCEPHRGAGMVGTITVQ 125 >tr|Q4R1A7|Q4R1A7_PEDDU Plastocyanin OS=Pediastrum duplex

  18. A new species of Pacholenus Schoenherr from southeastern Brazil (Coleoptera, Curculionidae, Molytinae, and new occurrences of species of the genus

    Directory of Open Access Journals (Sweden)

    Sergio Antonio Vanin

    2008-01-01

    Full Text Available A new species of Pacholenus Schoenherr from southeastern Brazil (Coleoptera, Curculionidae, Molytinae, and new occurrences of species of the genus. Pacholenus monteiroi sp. nov. (type-locality Brazil, Rio de Janeiro state, Carapebus, Parque Nacional da Restinga de Jurubatiba is described and illustrated. The weevil develops as a stem gall-former in Calyptranthes brasiliensis Spreng (Myrtaceae. The new species is easily distinguished from the other five known of the genus by the presence of a prominent supra-ocular ridge. An updated key for identification for all species of Pacholenus is provided. Three species of Pacholenus are presently recorded for the states of Rio de Janeiro and São Paulo; P. pelliceus and P. monteiroi occur in both states, while P. penicillus is only known from Rio de Janeiro; P. hispidus occurs in São Paulo, being the most widespread species of the genus, ranging from Minas Gerais south to Santa Catarina.Nova espécie de Pacholenus Schoenherr do sudeste do Brasil (Coleoptera, Curculionidae, Molytinae, e novas ocorrências de espécies do gênero. Pacholenus monteiroi sp. nov. (localidade-tipo Brasil, Estado do Rio de Janeiro, Carapebus, Parque Nacional da Restinga de Jurubatiba é descrita e ilustrada. Esse gorgulho se desenvolve em galhas caulinares de Calyptranthes brasiliensis Spreng (Myrtaceae. A nova espécie é facilmente distinta das outras cinco conhecidas do gênero devido à presença de uma crista supra-ocular proeminente. Uma chave atualizada para identificação das espécies de Pacholenus é fornecida. Três espécies de Pacholenus ocorrem nos estado do Rio de Janeiro e São Paulo; P. pelliceus e P. monteiroi ocorrem em ambos os estados, enquanto que P. penicillus apenas no Rio de Janeiro; P. hispidus ocorre em São Paulo, sendo a espécie do gênero com a distribuição mais ampla, sendo encontrada desde Minas Gerais até Santa Catarina.

  19. Description of the immature stages of the weevil Anthonomus vis Clark (Coleoptera, Curculionidae, inquiline into the gall of Leandra aurea (Melastomataceae

    Directory of Open Access Journals (Sweden)

    Daniela de Cassia Bená

    2013-12-01

    Full Text Available Description of the immature stages of the weevil Anthonomus vis Clark (Coleoptera, Curculionidae, inquiline into the gall of Leandra aurea (Melastomataceae. The third instar larva and the pupa of Anthonomus vis Clark, 1992 are described and illustrated, based upon specimens collected in the Serra de São José, Tiradentes, in Minas Gerais, southeastern Brazil. The species was previously known from the type series collected in the states of Amapá and Pará. Comparisons with the larva and pupa of A. grandis Boheman, 1843 and A. monostigma Champion, 1903 are included. The larvae of A. vis live as inquilines in the galls induced by a species of momphid moths (Lepidoptera, Momphidae in the stems of Leandra aurea (Cham. Cogn. (Melastomataceae.

  20. Novos gêneros, novas espécies e redescrição em Hemilophini (Coleoptera, Cerambycidae, Lamiinae das Américas

    Directory of Open Access Journals (Sweden)

    Maria Helena M. Galileo

    2013-03-01

    Full Text Available New genera, new species and redescription in Hemilophini (Coleoptera, Cerambycidae, Lamiinae from the Americas. New taxa described from El Salvador: Eranina sororcula sp. nov. (La Libertad. From Honduras: E. pallida sp. nov. (department not indicated. From Costa Rica: Mexicoscylus nigritarse sp. nov. (Guanacaste and Cotyabanycha gen. nov., type species, C. ocularis sp. nov. (Limón. From Colombia and Ecuador: Sybaguasu mirim sp. nov. (Meta and Napo. From Ecuador: Piampatara antennata sp. nov. (Napo, Adesmus simile sp. nov. (Manabi, A. alboniger sp. nov. (Napo, A. swifti sp. nov. (Loja. From Bolivia: Potiapunga gen. nov., type species P. lata sp. nov. (Santa Cruz. Phoebe spegazzinii Bruch, 1908 is recorded for Ecuador (Manabi and its chromatic variation is commented.

  1. Coexistence and Competition between Tomicus yunnanensis and T. minor (Coleoptera: Scolytinae in Yunnan Pine

    Directory of Open Access Journals (Sweden)

    Rong Chun Lu

    2012-01-01

    Full Text Available Competition and cooperation between bark beetles, Tomicus yunnanensis Kirkendall and Faccoli and Tomicus minor (Hartig (Coleoptera: Scolytinae were examined when they coexisted together in living Yunnan pine trees (Pinus yunnanensis Franchet in Yunnan province in Southwest China. T. yunnanensis bark beetles were observed to initiate dispersal from pine shoots to trunks in November, while the majority of T. minor begins to transfer in December. T. yunnanensis mainly attacks the top and middle parts of the trunk, whereas T. minor mainly resides in the lower and middle parts of the trunk. The patterns of attack densities of these two species were similar, but with T. yunnanensis colonizing the upper section of the trunk and T. minor the lower trunk. The highest attack density of T. Yunnanensis was 297 egg galleries/m2, and the highest attack density of T. minor was 305 egg galleries/m2. Although there was significant overlap for the same bark areas, the two species generally colonize different areas of the tree, which reduces the intensity of competition for the relatively thin layer of phloem-cambium tissues where the beetles feed and reside.

  2. A DNA barcode library of the beetle reference collection (Insecta: Coleoptera in the National Science Museum, Korea

    Directory of Open Access Journals (Sweden)

    Sang Woo Jung

    2016-06-01

    Full Text Available Coleoptera is a group of insects that are most diverse among insect resources. Although used as indicator species and applied in developing new drugs, it is difficult to identify them quickly. Since the development of a method using mitochondrial DNA information for identification, studies have been conducted in Korea to swiftly and accurately identify species. The National Science Museum of Korea (NSMK has been collecting and morphologically identifying domestic reference insects since 2013, and building a database of DNA barcodes with digital images. The NSMK completed construction of a database of digital images and DNA barcodes of 60 beetle species in the Korean National Research Information System. A total of 179 specimens and 60 species were used for the analysis, and the averages of intraspecific and interspecific variations were 0.70±0.45% and 26.34±6.01%, respectively, with variation rates ranging from 0% to 1.45% and 9.83% to 56.23%, respectively.

  3. Taxonomic notes on the ground beetles in the genus Trephionus Bates, 1883 from central Honshu, Japan (Coleoptera, Carabidae, Sphodrini, Synuchina

    Directory of Open Access Journals (Sweden)

    Kôji Sasakawa

    2018-03-01

    Full Text Available Trephionus Bates, 1883, a Japanese endemic genus in the subtribe Synuchina (Coleoptera, Carabidae, Sphodrini, is revised taxonomically based mainly on the shape of the endophallus, a membranous inner sac everted from the aedeagus of the male genitalia. Three known species from central Honshu, T. kinoshitai Habu, 1954; T. shibataianus Habu, 1978; and T. babai Habu, 1978, are re-defined based on this genital character, and five new species are described from the region: T. cylindriphallus Sasakawa, sp. n., T. niumontanus Sasakawa, sp. n., T. inexpectatus Sasakawa & Itô, sp. n., T. abiba Sasakawa & Itô, sp. n., and T. bifidilobatus Sasakawa & Itô, sp. n. The observed interspecies differences in endophallus morphology are discussed in terms of the species-level phylogeny and genus-level taxonomy of Trephionus.

  4. Seasonal shifts in accumulation of glycerol biosynthetic gene transcripts in mountain pine beetle, Dendroctonus ponderosae Hopkins (Coleoptera: Curculionidae, larvae

    Directory of Open Access Journals (Sweden)

    Jordie D. Fraser

    2017-06-01

    Full Text Available Winter mortality is a major factor regulating population size of the mountain pine beetle, Dendroctonus ponderosae Hopkins (Coleoptera: Curculionidae. Glycerol is the major cryoprotectant in this freeze intolerant insect. We report findings from a gene expression study on an overwintering mountain pine beetle population over the course of 35 weeks. mRNA transcript levels suggest glycerol production in the mountain pine beetle occurs through glycogenolytic, gluconeogenic and potentially glyceroneogenic pathways, but not from metabolism of lipids. A two-week lag period between fall glycogen phosphorylase transcript and phosphoenolpyruvate carboxykinase transcript up-regulation suggests that gluconeogenesis serves as a secondary glycerol-production process, subsequent to exhaustion of the primary glycogenolytic source. These results provide a first look at the details of seasonal gene expression related to the production of glycerol in the mountain pine beetle.

  5. Blueberry Cultivars Differ in Susceptibility to the Elephant Weevil, Orthorhinus cylindrirostris (Coleoptera: Curculionidae).

    Science.gov (United States)

    Murdoch, Gregory; Clift, Alan D; Mansfield, Sarah

    2017-10-01

    The accumulated damage from elephant weevil larvae, Orthorhinus cylindrirostris (F.) (Coleoptera: Curculionidae), reduces blueberry yield and shortens the productive lifespan of blueberry plants by several years. Selective breeding to develop pest-resistant blueberry cultivars is a possible control option, but the relationship between O. cylindrirostris populations, plant damage, and blueberry yield has not been described. A field survey of 17 blueberry cultivars was conducted on a commercial farm to measure O. cylindrirostris populations (emergence holes and adult numbers) and yield from plants of different ages (2-12 yr). Blueberry plants accumulated damage over time, that is, older plants tended to have more O. cylindrirostris emergence holes than younger plants. All cultivars received some level of O. cylindrirostris attack but this did not always lead to yield losses. Newer cultivars that have been in production since 2000 were less susceptible to O. cylindrirostris than older cultivars. Removal of highly susceptible cultivars from commercial blueberry farms may reduce O. cylindrirostris populations. There is potential for selective breeding to increase plant resistance to O. cylindrirostris if the specific resistance mechanisms can be identified in blueberry. © The Author 2017. Published by Oxford University Press on behalf of Entomological Society of America. All rights reserved. For Permissions, please email: journals.permissions@oup.com.

  6. Naturally-Occurring Entomopathogenic Fungi on Three Bark Beetle Species (Coleoptera: Curculionidae in Bulgaria

    Directory of Open Access Journals (Sweden)

    Slavimira A. Draganova

    2010-01-01

    Full Text Available Bark beetles (Coleoptera: Curculionidae: Scolytinae belong to one of the most damaging groups of forest insects and the activity of their natural enemies –pathogens, parasitoids,parasites or predators suppressing their population density,is of great importance. Biodiversity of entomopathogenic fungi on bark beetles in Bulgaria has been investigated sporadically. The aim of this preliminary study was to find, identify and study morphological characteristics of fungal entomopathogens naturally-occurring in populations of three curculionid species – Ips sexdentatus Boern, Ips typographus (L. and Dryocoetes autographus (Ratz.. Dead pest adults were found under the bark of Pinus sylvestris and Picea abies trees collectedfrom forests in the Maleshevska and Vitosha Mountains. Fungal pathogens were isolated into pure cultures on SDAY (Sabouraud dextrose agar with yeast extract and were identified based on morphological characteristics both on the host and in a culture.Morphological characteristics of the isolates were studied by phenotypic methods. The fungal isolates obtained from dead adults of Ips sexdentatus, Ips typographus and D. autographus were found to belong to the species Beauveria bassiana (Bals. – Criv. Vuillemin,Beauveria brongniartii (Saccardo Petch and Isaria farinosa (Holmsk. Fries (anamorph Ascomycota, Sordariomycetes: Hypocreales, Cordycipitaceae. Morphological traits of the isolates are described.

  7. Laboratory trials to infect insects and nematodes by some acaropathogenic Hirsutella strains (Mycota: Clavicipitaceous anamorphs).

    Science.gov (United States)

    Bałazy, Stanisław; Wrzosek, Marta; Sosnowska, Danuta; Tkaczuk, Cezary; Muszewska, Anna

    2008-02-01

    Laboratory assays have been carried out to artificially infect insect larvae of the birch bark-beetle (Scolytus ratzeburgi Jans.-Coleoptera, Scolytidae) and codling moth Cydia pomonella L. -Lepidoptera, Tortricidae) as well as the potato cyst nematode-Globodera rostochiensis Wollenweber, sugar beet nematode-Heterodera schachtii Schmidt and root-knot nematode-Meloidogyne hapla Chif (Nematoda, Heteroderidae), by the phialoconidia of some fungal species of the genus Hirsutella. From among four species tested on insects only H. nodulosa Petch infected about 20% of S. ratzeburgi larvae, whereas H. kirchneri (Rostrup) Minter, Brady et Hall, H. minnesotensis Chen, Liu et Chen, and H. rostrata Bałazy et Wiśniewski did not affect insect larvae. Only single eggs of the root-knot nematode were infected by H. minnesotensis in the laboratory trials, whereas its larvae remained unaffected. No infection cases of the potato cyst nematode (G. rostochiensis) and sugar beet nematode eggs were obtained. Comparisons of DNA-ITS-region sequences of the investigated strains with GenBank data showed no differences between H. minnesotensis isolates from the nematodes Heterodera glycines Ichinohe and from tarsonemid mites (authors' isolate). A fragment of ITS 2 with the sequence characteristic only for H. minnesotensis was selected. Two cluster analyses indicated close similarity of this species to H. thompsonii as sister clades, but the latter appeared more heterogenous. Insect and mite pathogenic species H. nodulosa localizes close to specialized aphid pathogen H. aphidis, whereas the phytophagous mite pathogens H. kirchneri and H. gregis form a separate sister clade. Hirsutella rostrata does not show remarkable relations to the establishment of aforementioned groups. Interrelated considerations on the morphology, biology and DNA sequencing of investigated Hirsutella species state their identification more precisely and facilitate the establishment of systematic positions.

  8. Pengaruh Jenis Mangsa dan Suhu pada Perkembangan Menochilus sexmaculatus Fabricius (Coleoptera: Coccinellidae dan Peranannya dalam Pengendalian Diaphorina citri Kuwayama (Hemiptera: Psyllidae

    Directory of Open Access Journals (Sweden)

    Tris Haris Ramadhan

    2008-07-01

    Full Text Available Diaphorina citri Kuwayama (Hemiptera: Psyllidae is the vector of citrus greening (Huanglongbing bacterium and the most serious impediment to citrus culture. Classical biological control of this psyllid vector should contribute to suppress their population. This research was conducted to determine the performance of Menochilus sexmaculatus Fabricius (Coleoptera: Coccinellidae when they were fed with D. citri. The larval performance index of M. sexmaculatus on D. citri compared with Aphis craccivora Koch (Hemiptera: Aphididae diet was 1.3.M. sexmaculatus fed with D. citri had lower fitness than those fed with A. craccivora as shown by longer larval stadium, lower adult dry weight, less number of egg produced and lower percentage of egg hatched. M. sexmaculatus grew best at the temperature of 27oC. Employing the exclusion procedure under field condition,M. sexmaculatus could reduce the population of D. citri up to 90%. These findings showed that theM. sexmaculatus could be a potential predator in reducing D. citri, particularly when the more preferred prey A. craccivora was not present.   Diaphorina citri Kuwayama (Hemiptera: Psyllidae merupakan kelompok Psyllid yang menularkan penyebab penyakit Huanglongbing yang sangat berbahaya pada tanaman jeruk. Pengendalian hayati klasik telah banyak memberikan kontribusi dalam pengendalian di lapangan. Penelitian ini dilakukan untuk melihat penampilan Menochilus sexmaculatus Fabricius (Coleoptera: Coccinellidae dengan pakan D. citri. Indeks penampilan larva M. sexmaculatus dengan pakan D. citri dibandingkan dengan Aphis craccivora Koch (Hemiptera: Aphididae adalah 1,3. M. sexmaculatus yang diberi pakan D. citri menunjukkan penurunan kebugaran dibandingkan jika diberi pakan A. craccivora seperti yang ditunjukkan dengan stadium larva lebih lama, penurunan berat kering serangga dewasa, telur yang dihasilkan lebih sedikit, dan penurunan jumlah telur yang menetas. Menggunakan metode eksklusi pada kondisi

  9. Impact of Cultivation and Subsequent Burial on Cydia pomonella (Lepidoptera: Tortricidae) and Conotrachelus nenuphar (Coleoptera: Curculionidae).

    Science.gov (United States)

    Baughman, William B; Nelson, Peter N; Grieshop, Matthew J

    2015-06-01

    We assessed the efficacy of cultivation as a potential management strategy for codling moth, Cydia pomonella L. (Lepidoptera: Tortricidae), and plum curculio, Conotrachelus nenuphar Herbst (Coleoptera: Curculionidae) in apple orchards. Cocooned codling moth pupae and thinning apples infested with plum curculio larvae were cultivated over in the field. Emergence, percent burial, damage to buried fruit, and depth of burial was recorded. In the laboratory, both insects were buried at variable depths in sand and potting soil and emergence was measured. A greater proportion of plum curculio larvae buried in infested fruit under laboratory conditions survived to adulthood compared with unburied infested fruit, down to 15 cm. No codling moth adults emerged from under 1 cm or more of sand. Buried codling moth larvae experienced drastically reduced survival to adulthood compared with unburied larvae. These results indicate that strip cultivation may negatively impact codling moth diapausing larvae and pupae on the ground, but not likely to negatively impact plum curculio in infested dropped apples. © The Authors 2015. Published by Oxford University Press on behalf of Entomological Society of America.

  10. Activités insecticides de Striga hermonthica (Del. Benth (Scrophulariaceae sur Callosobrichus maculatus (Fab. (Coleoptera : Bruchidae

    Directory of Open Access Journals (Sweden)

    Nacoulma OG.

    2006-01-01

    Full Text Available Insecticidal activities of Striga hermonthica (Del. Benth (Scrophulariacecae on Callobruchus maculatus (Fab. (Coleptera Bruchidae. This paper deals with insecticidal potentialities of Striga hermonthica (Del. (Scrophulariaceae in protection of cowpea Vigna unguculata (L. Walp against Callosobruchus maculatus (Fab. (Coleoptera: Bruchidae during storage. Crude acetone extract at 0,5% w/w (100 mg of extract for 20 g of grain exhibits 48% of ovicidal effect and then reduces by half emergence rate of adult beetles at the first generation. This extract shows a weak insecticide activity against adults of C. maculatus. Petroleum ether fraction (0,4% w/w of the crude extract reveals ovicidal (51% and larvicidal (72% effects which reduce the emergence rate of adults to only 9%. LD50 and LD90 are monitored during crude extract fractionation to follow ovicidal and larvicidal compounds and to evaluate their efficacy during the isolation procedure. One fraction, mainly composed of two triterpenoid compounds has been identified as responsible of the ovicidal activity of S. hermonthica while the origin of the larvicidal activity hasn’t been identified.

  11. Soil management system in hazelnut groves (Corylus sp. versus the presence of ground beetles (Coleoptera: Carabidae

    Directory of Open Access Journals (Sweden)

    Nietupski Mariusz

    2015-01-01

    Full Text Available Sustaining biodiversity as well as taking advantage of the natural environment’s resistance are the key elements which should be considered when designing integrated plans for the protection of hazelnut groves. An effort has been made in this study to analyse the impact of different soil cultivation methods in hazelnut groves, on the species composition and number of individuals in carabid assemblages (Coleoptera: Carabidae. Another aim was to determine which method of inter-row soil management had the least negative effect on assemblages of these beetles. Because of the type of habitat, the xerothermic species characteristic for southeastern Europe, i.e. Calathus ambiguus, Poecilus lepidus, Harpalus calceatus, and H. griseus, were the most numerous. The qualitative and quantitative analysis of the captured individuals implied that the optimal soil tillage system in young hazelnut groves is when soil is kept fallow with machines or chemicals, or when soil is covered with manure. The least favourable practice for the appearance of ground beetles of the Carabidae family is the use of polypropylene fabric, bark or sawdust, to cover soil

  12. Etude morphologique et biologique de la coccinelle Scymnus couturieri Chazeau (Coleoptera-Coccinellidae prédatrice de la cochenille farineuse du manioc Phenacoccus manihoti Matile-Ferrero

    Directory of Open Access Journals (Sweden)

    Obame Minko, D.

    1999-01-01

    Full Text Available Morphological and Biological Study of Scymnus couturieri Chazeau (Coleoptera-Coccinellidae, Predator of Cassava Mealybug Phenacoccus manihoti Matile-Ferrero (Homoptera-Pseudococcidae in Ivory Coast. Scymnus couturieri is a coccinellidae which was first described from Ivory Coast (2. But that morphological description was just based on the adult. The trophic action developed by Scymnus couturieri in the regulation of the abundance of the cassava mealybug led us to precise that description and to extend our knowledge of the coccinellidae by studying the morphological aspects and the biological parameters. The study brings to the fore the holometaboly development, the low fecondity and the long-lasting biological cycle of the predator.

  13. Description of the male of Eburella pinima Martins and notes on the geographical distribution of Eburodacrys aenigma Galileo & Martins and Eburodacrys lanei Zajciw (Coleoptera, Cerambycidae

    Directory of Open Access Journals (Sweden)

    Juan Pablo Botero

    2013-12-01

    Full Text Available Description of the male of Eburella pinima Martins and notes on the geographical distribution of Eburodacrys aenigma Galileo & Martins and Eburodacrys lanei Zajciw (Coleoptera, Cerambycidae. The male of Eburella pinima Martins, 1997 is described and illustrated for the first time. Information on Eburodacrys aenigma Galileo & Martins, 2006, previously known only from the female holotype, which lacked locality label, is herein complemented. This species is recorded from Brazil and the male is depicted for the first time. The geographical distribution of Eburodacrys lanei Zajciw, 1958 is further restricted here as some previous records are confirmed to result from misidentifications of E. aenigma.

  14. Ground beetles (Coleoptera: Carabidae) of rice field banks and restored habitats in an agricultural area of the Po Plain (Lombardy, Italy).

    Science.gov (United States)

    Pilon, Nicola; Cardarelli, Elisa; Bogliani, Giuseppe

    2013-01-01

    An entomological investigation was carried out in an agricultural area, mainly rice fields, of the Po river plain, located in the municipalities of Lacchiarella (MI) and Giussago (PV) (Lombardy, Italy). In 2009 and 2010, ground beetles (Coleoptera: Carabidae) were sampled along rice field banks and in restored habitats, by means of pitfall traps. The area appeared as species-rich, compared to other anthropogenic habitats in the Po river pain. Most of the collected Carabids were species with a wide distribution in the Paleartic region, eurytopic and common in European agroecosystems. The assemblages were dominated by small-medium, macropterous species, with summer larvae. No endemic species were found. Species with southern distribution, rarely found north of the Po river, were also sampled. Amaralittorea is recorded for the first time in Italy.

  15. Ground beetles (Coleoptera: Carabidae of rice field banks and restored habitats in an agricultural area of the Po Plain (Lombardy, Italy

    Directory of Open Access Journals (Sweden)

    Nicola Pilon

    2013-11-01

    Full Text Available An entomological investigation was carried out in an agricultural area, mainly rice fields, of the Po river plain, located in the municipalities of Lacchiarella (MI and Giussago (PV (Lombardy, Italy. In 2009 and 2010, ground beetles (Coleoptera: Carabidae were sampled along rice field banks and in restored habitats, by means of pitfall traps. The area appeared as species-rich, compared to other anthropogenic habitats in the Po river pain. Most of the collected Carabids were species with a wide distribution in the Paleartic region, eurytopic and common in European agroecosystems. The assemblages were dominated by small-medium, macropterous species, with summer larvae. No endemic species were found. Species with southern distribution, rarely found north of the Po river, were also sampled. Amara littorea is recorded for the first time in Italy.

  16. Variation in diel activity of ground beetles (Coleoptera: Carabidae) associated with a soybean field and coal mine remnant

    Science.gov (United States)

    Willand, J.E.; McCravy, K.W.

    2006-01-01

    Diel activities of carabids (Coleoptera: Carabidae) associated with a coal mine remnant and surrounding soybean field were studied in west-central Illinois from June through October 2002. A total of 1,402 carabids, representing 29 species and 17 genera, were collected using pitfall traps. Poecilus chalcites (Say) demonstrated roughly equal diurnal and nocturnal activity in June, but greater diurnal activity thereafter. Pterostichus permundus (Say), Cyclotrachelus seximpressus (LeConte), Amara obesa (Say), and Scarites quadriceps Chaudoir showed significant nocturnal activity. Associations between habitat and diel activity were found for three species: P. chalcites associated with the remnant and edge habitats showed greater diurnal activity than those associated with the soybean field; C. seximpressus was most active diurnally in the remnant, and Harpalus pensylvanicus (DeGeer) showed the greatest nocturnal activity in the remnant and edge habitats. We found significant temporal and habitat-related variation in diel activity among carabid species inhabiting agricultural areas in west-central Illinois.

  17. The collection of type specimens of the family Carabidae (Coleoptera deposited in the Natural History Museum of Barcelona, Spain

    Directory of Open Access Journals (Sweden)

    Viñolas, A.

    2014-05-01

    Full Text Available The type collection of the family Carabidae (Coleoptera deposited in the Natural History Museum of Barcelona, Spain, has been organised, revised and documented. It contains 430 type specimens belonging to 155 different taxa. Of note are the large number of hypogean species, the species of Cicindelidae from Asenci Codina’s collection, and the species of Harpalinae extracted from Jacques Nègre’s collection. In this paper we provide all the available information related to these type specimens. We therefore provide the following information for each taxon, species or subspecies: the original and current taxonomic status, original citation of type materials, exact transcription of original labels, and preservation condition of specimens. Moreover, the differences between original descriptions and labels are discussed. When a taxonomic change has occurred, the references that examine those changes are included at the end of the taxa description.

  18. Boll weevil (Coleoptera: Curculionidae) response to and volatilization rates of grandlure when combined with varying doses of eugenol in the extended-life pheromone lure.

    Science.gov (United States)

    Armstrong, J S

    2010-04-01

    Boll weevil, Anthonomus grandis grandis Boheman (Coleoptera: Curculionidae), trapping and pheromone quantitative analysis of extended-life pheromone lures manufactured with 0, 10, 20, and 30 mg of eugenol was conducted in the Rio Grande Valley of Texas under spring and summer conditions. Boll weevils responded positively to eugenol on one of 12 trapping weeks when densities were high, but when densities were low (30 degrees C, accumulative grandlure loss per week may be too high, leaving too little residual grandlure to effectively attract boll weevils at the end of 3 wk of trapping. Eugenol plays no role in reserving or encouraging the release of grandlure, or in increasing boll weevil captures when boll weevil densities are low.

  19. Aktivitas minyak dan serbuk enam spesies tumbuhan terhadap peneluran dan Mortalitas Callosobruchus sp. (Coleoptera: Bruchidae

    Directory of Open Access Journals (Sweden)

    Dadang Dadang

    2017-02-01

    Full Text Available Storage pests remain one of the main problems in storage. The pest attacks occur not only in the field, but also in storage. Control should be done to maintain the quality of storedproducts. The environmentally friendly measures should be implemented to avoid negative impacts to the environment and human being. The objective of this research was to study the mortality and oviposition deterrence caused by powder and oil of six plant species against Callosobruchus sp. (Coleoptera: Bruchidae. Flowers of Eugenia aromatica, roots of Vetiveria zizanioides, leaves of Pogostemon cablin, seeds of Ricinus communis, seeds of Foeniculum vulgare, and stems of Cymbopogon citratus were air-dried and milled to yield powder. Oil of six plant species were purchased from local market. Oviposition deterrent bioassay was conducted by no-choice method for both powder and oil, while mortality bioassay was conducted by topical application and residual methods for plant oil only. Several plant species showed high biological activity to Callosobruchus sp. Powder of E. aromatica and oil of V. zizanioides caused high oviposition deterrence, while oil of V. zizanioides and E. aromatica caused high mortality.

  20. Origin of Pest Lineages of the Colorado Potato Beetle (Coleoptera: Chrysomelidae).

    Science.gov (United States)

    Izzo, Victor M; Chen, Yolanda H; Schoville, Sean D; Wang, Cong; Hawthorne, David J

    2018-04-02

    Colorado potato beetle (Leptinotarsa decemlineata Say [Coleoptera: Chrysomelidae]) is a pest of potato throughout the Northern Hemisphere, but little is known about the beetle's origins as a pest. We sampled the beetle from uncultivated Solanum host plants in Mexico, and from pest and non-pest populations in the United States and used mitochondrial DNA and nuclear loci to examine three hypotheses on the origin of the pest lineages: 1) the pest beetles originated from Mexican populations, 2) they descended from hybridization between previously divergent populations, or 3) they descended from populations that are native to the Plains states in the United States. Mitochondrial haplotypes of non-pest populations from Mexico and Arizona differed substantially from beetles collected from the southern plains and potato fields in the United States, indicating that beetles from Mexico and Arizona did not contribute to founding the pest lineages. Similar results were observed for AFLP and microsatellite data . In contrast, non-pest populations from the states of Colorado, Kansas, Nebraska, New Mexico, and Texas were genetically similar to U.S. pest populations, indicating that they contributed to the founding of the pest lineages. Most of the pest populations do not show a significant reduction in genetic diversity compared to the plains populations in the United States. We conclude that genetically heterogeneous beetle populations expanded onto potato from native Solanum hosts. This mode of host range expansion may have contributed to the abundant genetic diversity of contemporary populations, perhaps contributing to the rapid evolution of climate tolerance, host range, and insecticide resistance.

  1. Scarab Beetle (Coleoptera: Scarabaeidae Fauna in Ardabil Province, North West Iran

    Directory of Open Access Journals (Sweden)

    G Mowlavi

    2008-12-01

    Full Text Available "nBackground: Dung beetles of Coleoptera associated to undisturbed cattle droppings in pastures present great diver¬sity and abundance. Dung beetles also play an important role for transmission of some helminthes to human and cat¬tle. This study was made to survey the biodiversity and abundance of these beetles in Ardebil Province, western Iran."nMethods: According to the field study all beetles attracted to fresh cow dung in five areas of Ardebil Province in¬cluding Namin, Ardabil, Meshkinshahr, Neer and Sarein were collected and identified. They were collected during summer 2007 from June to September, with general peaks appearing to be correlated with temperature mainly at 11 a.m to 15 p.m. The samples were identified using appropriate systematic key "nResults: A total of 231 specimens belonging to 9 beetle genera and at least 15 species were identified as Euoniticel¬lus fulvus, Sisyphus schaffaer, Euonthophagus taurus, Copris lunaris, Chironitis pamphilus, Gymnopleurus coriarus, Euonthophagus amyntas, Caccobius schreberi, Onthophagus speculifer, Onthophagus furcatus, Aphodius, lugens, Apho¬dius fimetarius, A. scrutator, Geotrupes spiniger and G. stercorarius"nThe most abundant and diverse subfamilies were Coprinae, Geotrupinae, and Aphodiinae. "nConclusion: We found 15 species of dung beetles occurred in the region. The prevalence of each species is varied depending on location. Some of them play an important role for helminths transmission of veterinary and public health importance. The finding will provide a clue for pasture management as well as public health monitoring and surveillance of the disease transmitted by dung beetles. 

  2. Radiobiology of Small Hive Beetle (Coleoptera: Nitidulidae) and Prospects for Management Using Sterile Insect

    International Nuclear Information System (INIS)

    Downey, Danielle; Chun, Stacey; Follett, Peter

    2016-01-01

    Small hive beetle, Aethina tumida Murray (Coleoptera: Nitidulidae), is considered a serious threat to beekeeping in the Western Hemisphere, Australia, and Europe mainly due to larval feeding on honey, pollen, and brood of the European honeybee, Apis mellifera L. Control methods are limited for this pest. Studies were conducted to provide information on the radiobiology of small hive beetle and determine the potential for sterile insect releases as a control strategy. Adult males and females were equally sensitive to a radiation dose of 80 Gy and died within 5–7 d after treatment. In reciprocal crossing studies, irradiation of females only lowered reproduction to a greater extent than irradiation of males only. For matings between unirradiated males and irradiated females, mean reproduction was reduced by >99% at 45 and 60 Gy compared with controls, and no larvae were produced at 75 Gy. Irradiation of prereproductive adults of both sexes at 45 Gy under low oxygen (1–4%) caused a high level of sterility (>99%) while maintaining moderate survivorship for several weeks, and should suffice for sterile insect releases. Sterile insect technique holds potential for suppressing small hive beetle populations in newly invaded areas and limiting its spread. (author)

  3. Revision of the genus Ptomaphagus Hellwig from eastern Asia (Coleoptera, Leiodidae, Cholevinae).

    Science.gov (United States)

    Wang, Cheng-Bin; Perreau, Michel; Růžička, Jan; Nishikawa, Masaaki

    2017-01-01

    The species belonging to the genus Ptomaphagus Hellwig, 1795 (Coleoptera, Leiodidae, Cholevinae, Ptomaphagini) from eastern Asia are assigned to three species groups. Group yasutoshii has a single species: P. (s. str.) yasutoshii Nishikawa, 1993 from Taiwan, China. Group nepalensis with three species: P. (s. str.) nepalensis Perreau, 1988 from Nepal and P. (s. str.) masumotoi Nishikawa, 2011 from Thailand are redescribed, and P. (s. str.) piccoloi Wang, Růžička, Nishikawa, Perreau & Hayashi, 2016 is recorded for the first time from China (Zhejiang). Group sibiricus with seven species, including two newly described Chinese ones P. (s. str.) funiu sp. n. from Henan, and P. (s. str.) haba sp. n. from Yunnan, and five known species: P. (s. str.) chenggongi Wang, Nishikawa, Perreau, Růžička & Hayashi, 2016, P. (s. str.) hayashii Wang, Růžička, Perreau, Nishikawa & Park, 2016, P. (s. str.) kuntzeni Sokolowski, 1957 (distribution records from Myanmar excluded), P. (s. str.) sibiricus Jeannel, 1934 and P. (s. str.) tingtingtae Wang, Nishikawa, Perreau, Růžička & Hayashi, 2016. Specimens of other undescribed species of the group sibiricus are also recorded, revealing a high diversity of this genus in eastern Asia, especially in central and north Sichuan, China, which essentially remains to be investigated. Relevant morphological characters of the examined species are illustrated with colour plates, and their known distributions are mapped. A key to species of Ptomaphagus from eastern Asia is provided.

  4. Odor-baited trap trees: a novel management tool for plum curculio (Coleoptera: Curculionidae).

    Science.gov (United States)

    Leskey, Tracy C; Piñero, Jaime C; Prokopy, Ronald J

    2008-08-01

    The plum curculio, Conotrachelus nenuphar (Herbst) (Coleoptera: Curculionidae), one of the most important pests of apple (Malus spp.) in eastern and central North America, historically has been managed in New England apple orchards by three full block insecticide applications. Efforts to reduce insecticide inputs against plum curculio include perimeter row sprays, particularly after petal fall, to control immigrating adults. The odor-baited trap tree approach represents a new reduced input strategy for managing plum curculio based on the application of insecticides to a few perimeter-row trap trees rather than the entire perimeter row or full orchard block. Here, we compared the efficacy of a trap tree approach with perimeter row treatments to manage populations after petal fall in commercial apple orchards in 2005 and 2006. Injury was significantly greater in trap trees compared with unbaited perimeter row treated trees in both years of the study. In 2005, heavy rains prevented growers from applying insecticide applications at regular intervals resulting in high injury in nearly all blocks regardless of type of management strategy. In 2006, both the trap-tree and perimeter-row treatments prevented penetration by immigrating populations and resulted in economically acceptable levels of injury. The trap tree management strategy resulted in a reduction of approximately 70% total trees being treated with insecticide compared with perimeter row sprays and 93% compared with standard full block sprays.

  5. ECOLOGICAL AND FAUNISTIC REVIEW OF COCCINELLIDAE (COLEOPTERA, COCCINELLIDAE IN THE REPUBLIC OF DAGESTAN

    Directory of Open Access Journals (Sweden)

    G. M. Mukhtarova

    2016-01-01

    Full Text Available Aim. The aim of the study is to conduct ecological and faunal studies of coccinellidae in Dagestan as well as to consider the chorologic, trophic and phenological aspects in connection with the peculiarities of the environment.Materials and methods. As the basis for the research we used the materials obtained by the authors from 1999 to 2016 in various parts of Dagestan. We also conducted expeditions, stationary and semi-stationary studies using traditional methods of entomological research.Results. Inventory of coccinellidae fauna in Dagestan allowed identifying 27 species from 18 genera. It also revealed multiple and rare species. We carried out an analysis on distribution of the species in the high altitude range; identified environmental groups by biotopic preferendum: xerophyllous, mesophyll meadow-steppe, mesophyll forest, and Hygrophila and polytopic species; according to trophic adaptation: Aphidophages, Coccidophages, Mycetophages, Entomophages and Phytophages; We held a zoogeographical analysis of coccinellidae of Dagestan and according to habitat type, 8 zoogeographic groups were identified; We conducted phenological observations of the study sites, stages and timing of winter and winter dormancy, the beginning of mating, egg-laying, the duration of certain stages, the number of generations and other features.Conclusion. This research represents the first comprehensive summary of ladybugs (Coleoptera, Coccinellidae of Dagestan and includes the findings of the composition study, ecological and zoogeographical aspects of coccinellidae fauna of the study area.

  6. Microstructure and nanoindentation of the rostrum of Curculio longinasus Chittenden, 1927 (Coleoptera: Curculionidae)

    Energy Technology Data Exchange (ETDEWEB)

    Singh, Sudhanshu S. [Materials Science and Engineering, Arizona State University, Tempe, AZ 85287-6106 (United States); Current address: Department of Materials Science and Engineering, Indian Institute of Technology Kanpur, Uttar Pradesh 208016 (India); Jansen, Michael A.; Franz, Nico M. [School of Life Sciences, Arizona State University, Tempe, AZ 85287-4501 (United States); Chawla, Nikhilesh, E-mail: nchawla@asu.edu [Materials Science and Engineering, Arizona State University, Tempe, AZ 85287-6106 (United States)

    2016-08-15

    The rostrum is an extension of the cuticle of the head of weevils (Coleoptera: Curculionidae) and is often used to bore holes for oviposition (the process of laying eggs) into host plant tissue where larval development occurs. In members of the genus Curculio Linnaeus, 1758, the rostrum is long, slender, and strongly curved, but is nevertheless used to excavate straight bore-holes in the fruit of various host plants, through significant deformation of this structure. In this study, scanning electron microscopy (SEM) was used to examine the rostrum of Curculio longinasus Chittenden, 1927, leading to a microstructural model that describes its deformation behavior. Specifically, we used the continuous stiffness measurement (CSM) technique in nanoindentation to measure the Young's modulus and hardness of rostrum. The values of Young's modulus and hardness for the endocuticle were measured to be 8.91 ± 0.93 GPa and 558 ± 60 MPa, respectively. These results are critical for generating accurate finite element models of the head's mechanical behavior while it undergoes deformation. - Highlights: •SEM was used to examine the rostrum of Curculio longinasus Chittenden, 1927. •Nanoindentation to measure the Young's modulus and hardness of rostrum. •Results are critical for finite element models of the head's mechanical behavior.

  7. Los ejemplares tipo de Dryopidae, Elmidae, Limnichidae y Psephenidae (Coleoptera: Byrrhoidea, depositados en la colección del Museo de La Plata The types of Dryopidae, Elmidae, Limnichidae and Psephenidae (Coleoptera: Byrrhoidea housed at the Museo de La Plata

    Directory of Open Access Journals (Sweden)

    Liliana A. Fernández

    2004-07-01

    Full Text Available Se examinaron los ejemplares tipo depositados en la colección de la División Entomología del Museo de La Plata, pertenecientes a diversas especies nominales de Byrrhoidea: Dryopidae (1 especie, 1 ejemplar tipo, Elmidae (4, 9, Limnichidae (29, 47 y Psephenidae (1, 2. El material tipo fue estudiado por los siguientes autores: Pic, Spangler, Spangler & Brown, Spangler & Perkins, Spangler & Santiago, Spilman y Wooldridge. Para cada taxón se indica la publicación original, datos de colección y condición del material.The types of species of Byrrhoidea (Coleoptera housed in the collection of the División Entomología of Museo de La Plata were examined and listed. They belong to 35 species distributed in the families Dryopidae (1 species, 1 type, Elmidae (4, 9, Limnichidae (29, 47 and Psephenidae (1, 2. The types were described by Pic, Spangler, Spangler & Brown, Spangler & Perkins, Spangler & Santiago, Spilman, and Wooldridge. For each taxon, complete information about categories of types, reference original descriptions, collection data and specimen condition are given.

  8. ABUNDÂNCIA RELATIVA DAS ESPÉCIES DE CERAMBYCIDAE (INSECTA-COLEOPTERA EM POMAR DE FRUTÍFERAS MISTO RELATIVE ABUNDANCE OF SPECIES OF THE CERAMBYCIDAE FAMILY (INSECTA-COLEOPTERA IN MIXED ORCHARD

    Directory of Open Access Journals (Sweden)

    Elisabeth Rose Pereira da Silva

    2007-09-01

    Full Text Available

    Estudou-se a abundância relativa das espécies da família Cerambycidae (Insecta-Coleoptera em um pomar de frutíferas misto composto por 28 diferentes espécies, no período de dezembro de 1997 a maio de 1999 em Ceres, Estado de Goiás, Brasil. Foram utilizadas armadilhas luminosas modelo “Luiz de Queiroz” com lâmpadas Bl-15 wats. Essas armadilhas foram ligadas por 12 horas em dois dias consectivos num total de 24 horas de coletas semanais. Coletaram-se 1.474 cerambicídeos, agrupados em 39 gêneros e 49 espécies. Acanthoderes jaspidea, Achryson surinamum, Chlorida festiva, Eurodacrys sexgutatta, Gnomibidion fulvipes, Lophopoeum timbouve, Megacyllene acuta, Rhopalophora collaris e Trichophorus distinctus foram as espécies classificadas como muito abundantes. Das espécies coletadas, 48,98 % foram classificadas como raras, 12,24 % como dispersas, 20,41 % como comuns e 18,37 % como muito abundantes. Dentre os 39 gêneros, Oreodera foi representado por três espécies (6,13 %, os gêneros Acanthoderes, Aerenica, Chrysoprasis, Colobothea, Eutrypanus, Megacylene, Myoxomorpha e Nyssodrysternum por duas espécies (4,08 %, e os demais gêneros por apenas uma espécie.

    PALAVRAS-CHAVE: Levantamento; riqueza de espécies; ecologia; comportamento.

    It was studied the relative abundance to the species of the family Cerambycidae (Insecta-Coleoptera in a mixed orchard composed by 28 diferent species in the period from decembre 1997 to may 1999 in Ceres, state of Goi

  9. A summary of eight traits of Coleoptera, Hemiptera, Orthoptera and Araneae, occurring in grasslands in Germany

    Science.gov (United States)

    Gossner, Martin M.; Simons, Nadja K.; Achtziger, Roland; Blick, Theo; Dorow, Wolfgang H. O.; Dziock, Frank; Köhler, Frank; Rabitsch, Wolfgang; Weisser, Wolfgang W.

    2015-03-01

    Analyses of species traits have increased our understanding of how environmental drivers such as disturbances affect the composition of arthropod communities and related processes. There are, however, few studies on which traits in the arthropod community are affected by environmental changes and which traits affect ecosystem functioning. The assembly of arthropod traits of several taxa is difficult because of the large number of species, limited availability of trait databases and differences in available traits. We sampled arthropod species data from a total of 150 managed grassland plots in three regions of Germany. These plots represent the spectrum from extensively used pastures to mown pastures to intensively managed and fertilized meadows. In this paper, we summarize information on body size, dispersal ability, feeding guild and specialization (within herbivores), feeding mode, feeding tissue (within herbivorous suckers), plant part (within herbivorous chewers), endophagous lifestyle (within herbivores), and vertical stratum use for 1,230 species of Coleoptera, Hemiptera (Heteroptera, Auchenorrhyncha), Orthoptera (Saltatoria: Ensifera, Caelifera), and Araneae, sampled by sweep-netting between 2008 and 2012. We compiled traits from various literature sources and complemented data from reliable internet sources and the authors’ experience.

  10. Volatiles released from Vaccinium corymbosum were attractive to Aegorhinus superciliosus (Coleoptera: Curculionidae) in an olfactometric bioassay.

    Science.gov (United States)

    Parra, Leonardo; Mutis, Ana; Ceballos, Ricardo; Lizama, Marcelo; Pardo, Fernando; Perich, Fernando; Quiroz, Andrés

    2009-06-01

    The objective of this study was to evaluate the role of host volatiles in the relationship between a blueberry plant Vaccinium corymbosum L. and the raspberry weevil Aegorhinus superciliosus (Guérin) (Coleoptera: Curculionidae), the principal pest of blueberry in the south of Chile. Volatiles from the aerial part of different phenological stages of the host were collected on Porapak Q and analyzed by coupled gas chromatography-mass spectrometry (GC-MS). Several chemical groups were identified including green leaf volatiles, aromatic compounds, and terpenes. The olfactometric responses of A. superciliosus toward different odor sources were studied in a four-arm olfactometer. Blueberry shoots at the phenological stages of fruit set, and blue-pink fruit color elicited the greatest behavioral responses from weevils. Five compounds (2-nonanone, eucalyptol, R- and S-limonene, and 4-ethyl benzaldehyde) elicited an attractant behavioral response from A. superciliosus. The results suggest the host location behavior of A. superciliosus could be mediated by volatiles derived from V. corymbosum. This work has identified a number of compounds with which it is possible to develop a lure for the principal pest of blueberry in southern Chile.

  11. Ecological, morphological, and histological studies on Blaps polycresta (Coleoptera: Tenebrionidae) as biomonitors of cadmium soil pollution.

    Science.gov (United States)

    Osman, Wafaa; El-Samad, Lamia M; Mokhamer, El-Hassan; El-Touhamy, Aya; Shonouda, Mourad

    2015-09-01

    Soil pollution in Egypt became far more serious than before due to either the heavy usage of different toxic pesticides or aerosol deposition of industrial pollutants. The present mentioned ground beetle, Blaps polycresta Tschinkel 1975 (Coleoptera: Tenebrionidae), showed ecological, morphological, and histological alterations in adult insects as biomonitors. Two cultivated sites (reference and polluted) were chosen for sampling the insects. The results indicated a significant increase in soil cadmium concentration of the polluted site leading to sex-specific difference in cadmium accumulation in gonads and alimentary canal of insects that being higher in males than females. The cadmium pollution leads significantly to a decrease in population density, a reduction in body weight, an increase in mortality rate, and an increase in sex ratio of the insects. The results also revealed a striking decrease in body length of the polluted insects with a marked increase in the percentage of deformed gonads and alimentary canal of both sexes. Some histopathological alterations were also recorded in testis, ovary, and midgut of the polluted insects. Our results confirmed that beetles are a good bioindicator for soil pollution, and the different studied parameters could be easily employed as sensitive monitors for cadmium soil pollution.

  12. Revision of the Neotropical diving beetle genus Hydrodessus J. Balfour-Browne, 1953 (Coleoptera, Dytiscidae, Hydroporinae, Bidessini).

    Science.gov (United States)

    Miller, Kelly B

    2016-01-01

    The Neotropical diving beetle genus Hydrodessus J. Balfour-Browne, 1953 (Coleoptera: Dytiscidae: Hydroporinae: Bidessini) is revised. Thirty species are recognized. The following new species are described: Hydrodessus bimaculatus sp. n. (Venezuela), Hydrodessus brevis sp. n. (Venezuela), Hydrodessus concolorans sp. n. (Venezuela), Hydrodessus continuus sp. n. (Venezuela), Hydrodessus disjunctus sp. n. (Suriname), Hydrodessus fasciatus sp. n. (Brazil), Hydrodessus imparilis sp. n. (Ecuador), Hydrodessus keithi sp. n. (Brazil, Colombia, Ecuador), Hydrodessus kurti sp. n. (Suriname), Hydrodessus kylei sp. n. (Suriname, Venezuela), Hydrodessus laetus sp. n. (Venezuela), Hydrodessus latotibialis sp. n. (Peru), Hydrodessus maculatus sp. n. (Guyana, Venezuela), Hydrodessus morsus sp. n. (Venezuela), Hydrodessus palus sp. n. (Venezuela), and Hydrodessus tenuatus sp. n. (Suriname). The following new synonyms are established: Hydrodessus fragrans Spangler, 1985 = Hydrodessus biguttatus (Guignot, 1957) syn. n. and Hydrodessus robinae Spangler, 1985 = Hydrodessus octospilus (Guignot, 1957), syn. n. One species is transferred from Hydrodessus to Amarodytes Régimbart, Amarodytes soekhnandanae (Makhan, 1994), comb. n. Habitus photographs (dorsal and lateral) and photos of the ventral surfaces are provided for most species. Line drawings of male and female genitalia and other diagnostic features are also provided along with distribution maps.

  13. Ecological aspects of a Cosmopolites sordidus (Germar (Coleoptera: Curculionidae population in São Miguel do Iguaçu, PR./ Aspectos ecológicos da população de Cosmopolites sordidus, (Germar (Coleoptera: Curculionidae em São Miguel do Iguaçu, PR

    Directory of Open Access Journals (Sweden)

    Cristiane Rohde

    2006-06-01

    Full Text Available The population dynamics of Cosmopolites sordidus (Germar was studied in banana crops (cultivar Nanicão at São Miguel do Iguaçu, PR, using roof-tile-like baits, between June/2003 and May/2004. Adults infected by entomopathogenic fungi were recorded, and predators were also found on the baits. A comparative bioassay was carried out between the Beauveria bassiana isolate obtained from the experiment area and from other regions in Brazil against C. sordidus adults. The population peaks of C. sordidus adults occurred in June and July, a period with mild temperatures and low precipitation. The population of C. sordidus larvae, however, was concentrated in December. The insect predators found in the area were insects of the following orders: Coleoptera (Carabidae, Dermaptera (Forficulidae, Hemiptera (Reduviidae, Hymenoptera (Formicidae, and spiders of the families Ctenidae, Clubionidae, and Lycosidae, with a population peak two months after the pest population peak. A low number of C. sordidus adults infected by B. bassiana was found, with an annual mean of 0.44%. In the laboratory, the B. bassiana isolates were pathogenic to the insects.Estudou-se a dinâmica populacional de Cosmopolites sordidus (Germar em cultivo de banana(cultivar Nanicão, em São Miguel do Iguaçu, PR, através de iscas do tipo telha, entre junho/2003 a maio/2004. Atribuiu-se conceito ao estado de conservação da isca, visando observar sua durabilidade e atratividade. Registraram-se adultos infectados por fungos entomopatogênicos, sendo também encontrados predadores nas iscas. Realizou-se um bioensaio com isolados de Beauveria bassiana da área experimental e de Centros de Pesquisa do Brasil, para avaliar a patogenicidade em C. sordidus. Verificou-se que os picos populacionais de adultos de C. sordidus ocorreram em junho e julho, período de temperaturas amenas e baixas precipitações, enquanto que as larvas foram mais abundantes em dezembro. Os insetos predadores

  14. Biocontrol of larval mosquitoes by Acilius sulcatus (Coleoptera: Dytiscidae

    Directory of Open Access Journals (Sweden)

    Banerjee Siddhartha S

    2008-10-01

    Full Text Available Abstract Background Problems associated with resistant mosquitoes and the effects on non-target species by chemicals, evoke a reason to find alternative methods to control mosquitoes, like the use of natural predators. In this regard, aquatic coleopterans have been explored less compared to other insect predators. In the present study, an evaluation of the role of the larvae of Acilius sulcatus Linnaeus 1758 (Coleoptera: Dytiscidae as predator of mosquito immatures was made in the laboratory. Its efficacy under field condition was also determined to emphasize its potential as bio-control agent of mosquitoes. Methods In the laboratory, the predation potential of the larvae of A. sulcatus was assessed using the larvae of Culex quinquefasciatus Say 1823 (Diptera: Culicidae as prey at varying predator and prey densities and available space. Under field conditions, the effectiveness of the larvae of A. sulcatus was evaluated through augmentative release in ten cemented tanks hosting immatures of different mosquito species at varying density. The dip density changes in the mosquito immatures were used as indicator for the effectiveness of A. sulcatus larvae. Results A single larva of A. sulcatus consumed on an average 34 IV instar larvae of Cx. quinquefasciatus in a 24 h period. It was observed that feeding rate of A. sulcatus did not differ between the light-on (6 a.m. – 6 p.m., and dark (6 p.m. – 6 a.m. phases, but decreased with the volume of water i.e., space availability. The prey consumption of the larvae of A. sulcatus differed significantly (P A. sulcatus larvae, while with the withdrawal, a significant increase (p A. sulcatus in regulating mosquito immatures. In the control tanks, mean larval density did not differ (p > 0.05 throughout the study period. Conclusion the larvae of the dytiscid beetle A. sulcatus proved to be an efficient predator of mosquito immatures and may be useful in biocontrol of medically important mosquitoes.

  15. Flea beetles (Coleoptera: Chrysomelidae: Alticinae collected by malaise trap method in Gölcük Natural Park (Isparta, Turkey, with a new record for Turkish fauna

    Directory of Open Access Journals (Sweden)

    Aslan Gül E.

    2012-01-01

    Full Text Available This study is based on Alticinae (Coleoptera: Chrysomelidae material collected by Malaise trapping which is different from other standardized collecting methods. A total of 19 flea beetle species belonging to 6 genera were collected from Gölcük Natural Park, Isparta (Turkey during 2009. The species are listed in a table together with distributional data in Turkey. Among them, Longitarsus curtus (Allard, 1860 is recorded for the first time in Turkey. L. monticola Kutschera, 1863 and L. curtus are recently separated synonyms and thus all data referring to the distribution of both species are currently important. Hence, the zoogeographical distribution of the new record is reviewed with some remarks; habitus and genitalia are illustrated.

  16. Catalogue of Tenebrionidae (Coleoptera of North America

    Directory of Open Access Journals (Sweden)

    Yves Bousquet

    2018-01-01

    Full Text Available This catalogue includes all valid family-group (8 subfamilies, 52 tribes, 14 subtribes, genus-group (349 genera, 86 subgenera, and species-group names (2825 species, 215 subspecies of darkling beetles (Coleoptera: Tenebrionidae known to occur in North America1 and their available synonyms. Data on extant, subfossil and fossil taxa are given. For each name the author and year and page number of the description are provided, with additional information (e.g., type species for genus-group names, author of synonymies for invalid taxa depending on the taxon rank. Several new nomenclatural acts are included. One new genus, Lepidocnemeplatia Bousquet and Bouchard, is described. Spelaebiosis Bousquet and Bouchard [for Ardoinia Özdikmen, 2004], Blapstinus marcuzzii Aalbu [for Blapstinus kulzeri Marcuzzi, 1977], and Hymenorus campbelli Bouchard [for Hymenorus oculatus Doyen and Poinar, 1994] are proposed as new replacement names. Supporting evidence is provided for the conservation of usage of Tarpela micans (Fabricius, 1798 nomen protectum over Tarpela vittata (Olivier, 1793 nomen oblitum. The generic names Psilomera Motschulsky, 1870 [= Stenomorpha Solier, 1836], Steneleodes Blaisdell, 1909 [= Xysta Eschscholtz, 1829], Ooconibius Casey, 1895 and Euconibius Casey, 1895 [= Conibius LeConte, 1851] are new synonyms (valid names in square brackets. The following 127 new synonymies of species-group names, listed in their original combination, are proposed (valid names, in their current combination, placed in square brackets: Bothrasida mucorea Wilke, 1922 [= Pelecyphorus guanajuatensis (Champion, 1884]; Parasida zacualpanicola Wilke, 1922 [= Pelecyphorus asidoides Solier, 1836]; Stenosides kulzeri Pallister, 1954, Stenosides bisinuatus Pallister, 1954, and Parasida trisinuata Pallister, 1954 [= Pelecyphorus dispar (Champion, 1892]; Asida favosa Champion, 1884 and Asida similata Champion, 1884 [= Pelecyphorus fallax (Champion, 1884]; Ologlyptus bicarinatus

  17. Temperature-dependent development and emergence pattern of Hypothenemus hampei (Coleoptera: Curculionidae: Scolytinae) from coffee berries.

    Science.gov (United States)

    Jaramillo, Juliana; Chabi-Olaye, Adenirin; Borgemeister, Christian

    2010-08-01

    The coffee berry borer, Hypothenemus hampei (Ferrari) (Coleoptera: Curculionidae: Scolytinae), is the most important constrain for coffee production throughout the world. Knowledge on the emergence pattern of H. hampei females to infest new berries is crucial to effectively plan control measures. In this laboratory study, we assessed the development of immature stages and the emergence pattern of H. hampei females from the berries by exposing them to temperatures that are typical for high-altitude plantations (> or = 1,700 m above sea level [masl] ) or when coffee is grown under shade trees (20-22 degrees C), and optimum altitude plantations (1,200-1,600 masl) or nonshaded coffee (25-30 degrees C). Fecundity and emergence pattern of H. hampei females from coffee berries varied with temperature. Temperature played a crucial role determining the rate of H. hampei development and therefore the emergence of the females to start a new infestation cycle. The emergence and colonization phases of new colonizing females in coffee plantations with mean temperatures of 20, 25, or 30 degrees C would take place at different moments in the development of the coffee berries, and in some cases more than once. The implications of our findings for an improved, site-specific timing of control interventions against H. hampei are discussed.

  18. Trapping Phyllophaga spp. (Coleoptera: Scarabaeidae: Melolonthinae) in the United States and Canada using sex attractants.

    Science.gov (United States)

    Robbins, Paul S.; Alm, Steven R.; Armstrong, Charles. D.; Averill, Anne L.; Baker, Thomas C.; Bauernfiend, Robert J.; Baxendale, Frederick P.; Braman, S. Kris; Brandenburg, Rick L.; Cash, Daniel B.; Couch, Gary J.; Cowles, Richard S.; Crocker, Robert L.; DeLamar, Zandra D.; Dittl, Timothy G.; Fitzpatrick, Sheila M.; Flanders, Kathy L.; Forgatsch, Tom; Gibb, Timothy J.; Gill, Bruce D.; Gilrein, Daniel O.; Gorsuch, Clyde S.; Hammond, Abner M.; Hastings, Patricia D.; Held, David W.; Heller, Paul R.; Hiskes, Rose T.; Holliman, James L.; Hudson, William G.; Klein, Michael G.; Krischik, Vera L.; Lee, David J.; Linn, Charles E.; Luce, Nancy J.; MacKenzie, Kenna E.; Mannion, Catherine M.; Polavarapu, Sridhar; Potter, Daniel A.; Roelofs, Wendell L.; Royals, Brian M.; Salsbury, Glenn A.; Schiff, Nathan M.; Shetlar, David J.; Skinner, Margaret; Sparks, Beverly L.; Sutschek, Jessica A.; Sutschek, Timothy P.; Swier, Stanley R.; Sylvia, Martha M.; Vickers, Neil J.; Vittum, Patricia J.; Weidman, Richard; Weber, Donald C.; Williamson, R. Chris; Villani, Michael G

    2006-01-01

    The sex pheromone of the scarab beetle, Phyllophaga anxia, is a blend of the methyl esters of two amino acids, L-valine and L-isoleucine. A field trapping study was conducted, deploying different blends of the two compounds at 59 locations in the United States and Canada. More than 57,000 males of 61 Phyllophaga species (Coleoptera: Scarabaeidae: Melolonthinae) were captured and identified. Three major findings included: (1) widespread use of the two compounds [of the 147 Phyllophaga (sensu stricto) species found in the United States and Canada, males of nearly 40% were captured]; (2) in most species intraspecific male response to the pheromone blends was stable between years and over geography; and (3) an unusual pheromone polymorphism was described from P. anxia. Populations at some locations were captured with L-valine methyl ester alone, whereas populations at other locations were captured with L-isoleucine methyl ester alone. At additional locations, the L-valine methyl ester-responding populations and the L-isoleucine methyl ester-responding populations were both present, producing a bimodal capture curve. In southeastern Massachusetts and in Rhode Island, in the United States, P. anxia males were captured with blends of L-valine methyl ester and L-isoleucine methyl ester. PMID:19537965

  19. Males of Hylamorpha elegans burmeister (Coleoptera: Scarabaeidae) are attracted to odors released from conspecific females.

    Science.gov (United States)

    Quiroz, Andrés; Palma, Ruben; Etcheverría, Paulina; Navarro, Vicente; Rebolledo, Ramón

    2007-04-01

    The behavioral responses of Hylamorpha elegans L. (Coleoptera: Scarabaeidae, Rutelinae) to the semiochemicals released from conspecific individual adults were studied, with particular attention paid to female attraction of males. Odors released from virgin females significantly attracted male conspecifics in both the field and laboratory olfactometer and wind tunnel bioassays. However, females did not attract other females, and males attracted no one. The response of male H. elegans to (1) compounds (1,4-hydroquinone and 1,4-benzoquinone) released only by unmated females; (2) the essential oil of the secondary host (Nothofagus obliqua); and (3) the blend of 1,4-hydroquinone and 1,4-benzoquinone with N. obliqua essential oil was studied. The blend of 1,4-benzoquinone mixed with essential oil at the trial concentration was attractive with males. The same response was found with 1,4-hydroquinone alone. The essential oil did not have the expected attractant effect on conspecific males. These results suggest that, when combined with essential oil, 1,4-benzoquinone may function in the sexual behavior of males and females. These findings are discussed in terms of the ecological role of this putative sexual pheromone and its potential use in a strategy of control of this pest.

  20. Larvae and pupae of two North American darkling beetles (Coleoptera, Tenebrionidae, Stenochiinae, Glyptotus cribratus LeConte and Cibdelis blaschkei Mannerheim, with notes on ecological and behavioural similarities

    Directory of Open Access Journals (Sweden)

    Warren Steiner

    2014-06-01

    Full Text Available This study describes and illustrates the larvae and pupae of two North American darkling beetles (Coleoptera: Tenebrionidae in the subfamily Stenochiinae, Glyptotus cribratus LeConte from the southeastern United States, and Cibdelis blaschkei Mannerheim from California. Both species inhabit forested regions where adults and larvae occur in soft rotten dry wood of dead branches on living trees or in sections recently fallen from them. Species identity was confirmed by rearing of adults and pupae and the discovery of both in pupal cells with associated exuvia. Specimen label data and notes on habitats are provided. Antipredator defense structures and behaviour are noted for larvae and pupae of both species.

  1. Parachordodes tegonotus n. sp. (Gordioidea: Nematomorpha), a hairworm parasite of ground beetles (Carabidae: Coleoptera), with a summary of gordiid parasites of carabids.

    Science.gov (United States)

    Poinar, George; Rykken, Jessica; LaBonte, Jim

    2004-06-01

    A new species of hairworm, Parachordodes tegonotus n. sp. (Gordioidea: Nematomorpha) is described from three species of ground beetles (Carabidae: Coleoptera) from the state of Oregon. This is the first record of Parachordodes Camerano parasitising carabid beetles in North America. Diagnostic characters for the new species include size, colour, the nature and arrangement of the areoles, and the character, shape and extant of ornamentation on the ventral surface of the male tail. Encysted hairworm larvae found in the internal tissues of mayfly and caddisfly larvae at the type-locality were presumed to be those of P. tegonotus, indicating an indirect life-cycle involving paratenic hosts. A worldwide host list shows that some 70 species of ground beetles have been documented as developmental hosts to hairworms belonging to at least five genera, namely Gordius, Parachordodes, Dacochordodes, Gordionus and Paragordionus.

  2. Effects of irradiated diet on longevity and prolificity of successive generations of Zabrotes subfasciatus (Boheman, 1833) (Coleoptera, Bruchidae)

    International Nuclear Information System (INIS)

    Domarco, R.E.

    1981-01-01

    The study was done in the laboratory of Entomology of the Centro de Energia Nuclear na Agricultura (CENA), University of Sao Paulo, in Piracicaba, State of Sao Paulo, Brazil. This research was carried out to observe the effect of irradiated beans (Phaseolus vulgaris, (L.), cultivar Rosinha) on the longevity and prolificity of Zabrotes subfasciatus (Boheman, 1833) (Coleoptera, Bruchidae). The first part of the study included the rearing of five generations of Zabrotes subfasciatus which were fed with irradiated beans (0, 10, 20, 100 e 200 krad, with a dose rate of approximately 70 krad/h). The second one consisted of growth of seven generations on irradiated beans (0, 100, 500, 1500 and 3000 krad, with a dose rate of approximately 70 krad/h). The data were obtained through daily countings of insect birth and death rates. It was concluded that irradiation modified the nutritional quality of beans, affecting the development of Zabrotes subfasciatus. This effect was studied through the longevity and prolificity, which were altered as compared with the control, once they were higher for the dosis of 1500 and 3000 krad. (author)

  3. Receptor chirality and behavioral specificity of the boll weevil,Anthonomus grandis Boh. (Coleoptera: Curculionidae), for its pheromone, (+)-grandisol.

    Science.gov (United States)

    Dickens, J C; Mori, K

    1989-02-01

    Electrophysiological recordings from antennal olfactory receptors and field behavioral experiments showed both male and female boll weevils,Anthonomus grandis Boh. (Coleoptera: Curculionidae), to respond specifically to (+)-grandisol, an enantiomer of compound I of the boll weevil aggregation pheromone. Single-cell recordings revealed antennal olfactory neurons in both male and female weevils keyed to (+)-grandisol. Electroantennograms in response to serial dilutions of the grandisol enaniiomers showed a threshold 100 to 1000 times lower for (+)-grandisol relative to its antipode. In field behavioral experiments, both sexes were significantly more attracted to (+)-grandisol in combination with the three other pheromone components than the combination with (-)-grandisol. When (-)-grandisol was placed with the (+)-enantiomer at equal dosages, a slight although statistically insignificant inhibition occurred. Subsequent field tests showed that the low level of attraction exhibited by (-)-grandisol in combination with the other three pheromone components could be attributed to the other three components alone. These results are in contrast with an earlier study, which found (-)-grandisol to be as attractive as the (+)-enantiomer.

  4. Trends in detoxification enzymes and heavy metal accumulation in ground beetles (Coleoptera: Carabidae) inhabiting a gradient of pollution.

    Science.gov (United States)

    Stone, David; Jepson, Paul; Laskowski, Ryszard

    2002-05-01

    Non-specfic carboxylesterase and glutathione S-transferase activity was measured in the ground beetle, Pterosthicus oblongopunctatus (Coleoptera: Carabidae), from five sites along a gradient of heavy metal pollution. A previous study determined that beetles from the two most polluted sites (site codes OLK2 and OLK3) were more susceptible to additional stressors compared with beetles from the reference site (Stone et al., Environ. Pollut. 113, 239-244 2001), suggesting the possibility of physiological impairment. Metal body burdens in ground beetles from five sites along the gradient ranged from 79 to 201 microg/g Zn, 0.174 to 8.66 microg/g Pb and 1.14 to 10.8 microg/g Cd, whereas Cu seemed to be efficiently regulated regardless of metal levels in the soil. Beetle mid- and hindguts were homogenized and the soluble fraction containing glutathione S-transferase (GST) and carboxylesterase (CaE) was assayed using kinetic analyses. Significantly higher levels of GST were found only in female beetles from the most polluted sites (OLK2 and OLK3; P=0.049, Pground beetles in association with metal body burdens.

  5. Effectiveness of corn rootworm (Coleoptera: Chrysomelidae) areawide pest management in South Dakota.

    Science.gov (United States)

    French, B Wade; Chandler, Laurence D; Riedell, Walter E

    2007-10-01

    Diabrotica barberi Smith & Lawrence and Diabrotica virgifera virgifera LeConte (Coleoptera: Chrysomelidae) are serious pests of maize, Zea mays L. To reduce the amount of toxicants released into the environment, the Agricultural Research Service implemented a 5-yr (1997-2001) areawide pest management program in five geographic locations, including one in South Dakota. The objective was to use integrated pest management tactics to suppress adult Diabrotica populations over a broad geographic area by using aerially applied semiochemical-baited insecticides. Suppressed populations theoretically should reduce oviposition, limit larval feeding damage to maize roots, and result in fewer beetles emerging in subsequent years. We used emergence cages, sticky traps, and CRW lure traps to monitor adult D. barberi and D. v. virgifera populations. We sampled for Diabrotica eggs, and we determined damage to maize roots. We sampled in several maize fields (control) located near the areawide site. The baited insecticides were effective in reducing adult populations 1 and 2 wk after application, and most remained low for the duration of the maize growing season. Fewer beetles were captured in both sticky and lure traps in the areawide site than in the control site. With a few exceptions, egg counts, adult emergence, and maize root damage were similar between the areawide and control sites; however, maize roots had greater fresh weight in the control site. Although not all goals were accomplished, when considering the amount of toxicant released into the environment, using semiochemical-baited insecticides to suppress adult pest Diabrotica populations seems to be an effective areawide management tool.

  6. Azadirachtin: an effective systemic insecticide for control of Agrilus planipennis (Coleoptera: Buprestidae).

    Science.gov (United States)

    McKenzie, Nicole; Helson, Blair; Thompson, Dean; Otis, Gard; McFarlane, John; Buscarini, Teresa; Meating, Joe

    2010-06-01

    The emerald ash borer, Agrilus planipennis Fairmaire (Coleoptera: Buprestidae), an invasive pest discovered in North America in 2002, is now well established and threatens ash (Fraxinus spp.) trees throughout the continent. Experiments were conducted to 1) examine the efficacy of an alternative natural pesticide, azadirachtin, to control emerald ash borer, and 2) determine foliar uptake and dissipation patterns after systemic injections of azadirachtin into trunks of small (2.2 cm diameter at breast height [dbh]), uninfested green ash trees. We found no evidence of mortality of adult beetles. In contrast, fewer larvae completed their development at dose levels > or = 1.7 mg (AI)/cm dbh and development ceased beyond the second instar at dose levels > or = 13.6 mg (AI)/cm dbh. Substantial concentrations (11.2 microg/g dry mass [SD = 7.55]) of azadirachtin were present in leaves within 7 d of treatment. After rapid initial uptake, concentrations in leaves declined logarithmically during the 55 d after injection. A similar pattern was observed in a separate experiment that examined the uptake and translocation of azadirachtin in larger green ash trees (22 cm dbh) treated with 250 mg (AI) /cm dbh with the EcoJect injection system. In another experiment, recently infested plantation green ash trees treated with doses > or = 40 mg (AI)/cm dbh had significant reductions in adult emergence approximately 1 yr postinjection. Given the inhibition of larval development, reduction of adult emergence, and the occurrence of foliar residues at biologically active concentrations, we conclude that azadirachtin is effective in protecting ash trees from emerald ash borer.

  7. Description of immatures and mating behavior of Liogenys bidenticeps Moser, 1919 (Coleoptera: Melolonthidae: Melolonthinae

    Directory of Open Access Journals (Sweden)

    Sérgio Roberto Rodrigues

    Full Text Available Abstract Description of immatures and mating behavior of Liogenys bidenticeps Moser, 1919 (Coleoptera: Melolonthidae: Melolonthinae. Some species of Melolonthinae are associated with several species of cropped plants, with larvae consuming roots and, in some cases, are considered as crop pests. In some agricultural regions of Brazil, larvae of L. bidenticeps are found associated with cultivated plants, and little information is available about this taxon. This study, aiming at expanding the knowledge about the morphology and behavior of this species, provides the description of immatures and mating behavior of adults. The studies were conducted at the experimental farm of the Universidade Estadual de Mato Grosso do Sul in Aquidauana, Mato Grosso do Sul state, Brazil, and the adults were collected with light trap and raised in the laboratory. Mating behavior was documented on video both in the field and under laboratory conditions. Descriptions and illustrations of the third instar larva and pupa are presented. Adults have crepuscular flight activity and their copulation lasts an average of 20.25 min, occurring from 19:00 to 22:00 h. On some occasions, females did not accept males for copulation, indicating an active selection of males by females. Field observations demonstrated that adults feed on Brazilian pepper leaves (Schinus terebinthifolius, Anacardiaceae and cashew flowers (Anacardium occidentale, Anacardiaceae, where male and female meet each other and copulation occurs.

  8. BIOECOLOGIA E MANEJO DA BROCA-DA-ERVA-MATE, Hedypathes betulinus (KLUG, 1825 (COLEOPTERA: CERAMBYCIDAE

    Directory of Open Access Journals (Sweden)

    Jerson V. Carús Guedes

    2006-07-01

    Full Text Available A cultura da erva-mate (Ilex paraguariensis A.St.-Hil. apresenta grande importância social, cultural e econômica no sul do Brasil. Com a formação de povoamentos puros e o aumento da área de plantio, observou-se um aumento populacional de muitas espécies de insetos. Dentre os insetos-praga, a broca-da-erva-mate, Hedypathes betulinus (Klug, 1825 (Coleoptera: Cerambycidae, é a de maior importância econômica, em razão dos danos que causa e seu difícil controle. A fase larval ocorre no interior dos galhos e troncos das plantas, dificultando sua detecção e manejo. O manejo cultural e o mecânico são os mais indicados, como a coleta de adultos, poda e queima de partes atacadas da planta, nutrição equilibrada, densidade adequada de plantas e manutenção de áreas com vegetação nativa ou ainda a introdução do policultivo. Com essas técnicas, espera-se um maior equilibrio do agroecossistema e, com isso, a diminuição dos insetos-praga a um nível aceitável. Portanto, o objetivo deste trabalho é reunir e discutir as informações da bioecologia e manejo da broca-da-erva-mate.

  9. Habitat Preferences of Boros schneideri (Coleoptera: Boridae) in the Natural Tree Stands of the Białowieża Forest

    Science.gov (United States)

    Gutowski, Jerzy M.; Sućko, Krzysztof; Zub, Karol; Bohdan, Adam

    2014-01-01

    Abstract We analyzed habitat requirements of Boros schneideri (Panzer, 1796) (Coleoptera: Boridae) in the natural forests of the continental biogeographical region, using data collected in the Białowieża Forest. This species has been found on the six host trees, but it preferred dead, standing pine trees, characterized by large diameter, moderately moist and moist phloem but avoided trees in sunny locations. It occurred mostly in mesic and wet coniferous forests. This species demonstrated preferences for old tree stands (over 140-yr old), and its occurrence in younger tree-stand age classes (minimum 31–40-yr old) was not significantly different from random distribution. B. schneideri occupied more frequently locations distant from the forest edge, which were less affected by logging. Considering habitat requirements, character of occurrence, and decreasing number of occupied locations in the whole range of distribution, this species can be treated as relict of primeval forests. PMID:25527586

  10. Fauna de Coleoptera Associada a Carcaças de Coelhos Expostas em uma Área Urbana no Sul do Brasil

    Directory of Open Access Journals (Sweden)

    Richard Silva

    2012-11-01

    Abstract. Study of Coleoptera fauna associated with rabbit carcasses, Oryctolagus cuniculus Linnaeus (Lagomorpha, Leporidae, during the summer of 2010 and winter of 2011, is present at an urban area of Northern Paraná State, Southern Brazil. To capture the beetles were used pan, pitfall and modified Shannon traps. We collected 236 beetles belonging to 12 families and at least 25 species. Staphylinidae (52.5% and Histeridae (26.7% were the most abundant families in both seasons represented mainly by Aleochara bonariensis Lynch and Euspilotus "group" azureus sp., respectively. Among the seasons, both the decomposition of the carcasses and the succession of coleopterofauna of forensic interest occurred differently due to significant variation of abiotic factors. During the winter, most individuals of Euspilotus "group" azureus sp. (96.8% was captured at the stage of Black Putrefaction, showing an association at this stage. Despite the environment seasonality, there wasn’t significant difference of the abundance among seasons by main beetles neither by coleopterofauna.

  11. Effet structurant de la plante hôte chez la bruche de l'arachide, Caryedon serratus (Olivier, 1790 (Coleoptera : Bruchidae

    Directory of Open Access Journals (Sweden)

    Sembène, M.

    2012-01-01

    Full Text Available Structuring effect of the host plant in the groundnut bruchid, Caryedon serratus (Olivier, 1790 (Coleoptera: Bruchidae. Twenty-six samples of the groundnut seed-beetle which were reared from pods of five different host plants (Arachis hypogaea L., Bauhinia rufescens Lam., Cassia sieberiana DC., Piliostigma reticulatum (DC. Hochst. and Tamarindus indica L. in four localities of Senegal were compared using electrophoresis based on six loci of four enzymatic systems. The population structure of Caryedon serratus Olivier was analysed using Weir and Cockerham's estimator of Wright's F-statistics. θ value (0.235 and the dendrogram of Rogers'genetic distances revealed a high degree of genetic differentiation between host plants. Genetic analysis without C. sieberiana samples indicated that populations form host races which are partially isolated according to their host plants (θ = 0.035. Geographical distances between localities are not decisive for genetic structuration of C. serratus populations from a given host plant.

  12. Riqueza de Famílias e Hábitos Alimentares em Coleoptera Capturados na Fazenda da EMPARN– Jiqui, Parnamirim / RN

    Directory of Open Access Journals (Sweden)

    Rodrigo Lucas de Lima

    2010-04-01

    Full Text Available Os Coleópteros podem ser encontrados nos mais variados habitats terrestres e até aquáticos, com isso se alimentam de toda a sorte de matéria vegetais e animais encontradas pelo mundo. Com tanta diversidade, para se compreender melhor sua biologia e seus hábitos alimentares eles foram categorizados em cinco grupos tróficos: carnívoros, detritívoros, herbívoros, fungívoros e algívoros. Visando identificar as famílias e os hábitos alimentares em Coleoptera adultos, foram realizadas coletas na fazenda da EMPARN–Jiqui (Empresa de Pesquisa Agropecuária do Rio Grande do Norte, em quatro áreas, sendo um Fragmento de Mata Atlântica e três monoculturas: cajueiro anão precoce, coqueiro anão verde e coqueiro híbrido gigante. O tempo foi de 26 semanas consecutivas de 1º de janeiro a 1º julho de 2005. Foi utilizada para a captura dos Coleoptera em cada área uma armadilha do tipo Malaise, na qual foram colecionados 1544 indivíduos de trinta famílias nas quatro áreas amostradas, assim distribuídos: fragmento de mata com maior número de insetos e famílias respectivamente, 692 indivíduos e 28 famílias, seguida pelo coqueiro híbrido gigante com 533 indivíduos e 20 famílias, cajueiro anão precoce com 184 indivíduos e 15 famílias e por último o coqueiro anão verde com apenas 135 indivíduos e 18 famílias. Enquanto que entre os cinco grupos tróficos, quatro foram encontrados: herbívoros, compreendendo 14 famílias; carnívoros, com 9 famílias; detritívoros, 5 famílias; e fungívoros, com apenas 4 famílias; onde as cinco famílias mais numerosas são herbívoras e juntas representam 64% de todos os coleópteros amostrados, e o remanescente de mata tem o maior numero de famílias herbívoras. Com isso o Fragmento de mata demonstra ter uma grande diversidade de entomofauna, sendo um mantenedor e distribuidor mesmo cercado por monoculturas.Wealth of Families and Alimentary Habits in Beetles Captured in the Farm of EMPARN

  13. Toxic effects of essential plant oils in adult Sitophilus oryzae (Linnaeus (Coleoptera, Curculionidae

    Directory of Open Access Journals (Sweden)

    Andréa Roveré Franz

    2011-03-01

    Full Text Available Toxic effects of essential plant oils in adult Sitophilus oryzae (Linnaeus (Coleoptera, Curculionidae. Stored grains are subject to losses in quality nutritional value and in sanitation from the time they are stored to the time they are consumed. Botanical insecticides may offer an alternative solution for pest control. The objective was to test the insecticidal properties of the essential oils of Cymbopogon citratus (leaf, Zingiber officinale (root and Mentha sp. (leaf. The efficacy of these oils was tested to control the rice weevil, S. oryzae, using hydrodistillation. Chemical analysis of the essential oils was carried out by gas chromatography. Major components of C. citratus were geranial (48% and neral (31%, of Z. officinale were α-zingibereno (13%, geranial (16%, neral (10% and α-farneseno (5% and of Mentha sp. was menthol (92%. Bioassays were carried out by fumigation and topical application. In topical application assays, the essential oil of C. citratus had greater toxicity (LC50 0.027 µL mL-1 and shorter exposure time than the oils of the other two plants. After 24 h and 48 h, 70% and 100% mortality of S. oryzae occurred, respectively. In fumigation assays, essential oil of Z. officinale had a lower LC50 (1.18 µL cm-2 and 70% mortality after 24 h exposure. Therefore, we recommend the use of essential oils of C. citratus and Z. officinale to control the rice weevil S. oryzae.

  14. The aquatic Coleoptera of Prince Edward Island, Canada: new records and faunal composition

    Directory of Open Access Journals (Sweden)

    Christopher Majka

    2008-09-01

    Full Text Available The aquatic Coleoptera (Gyrinidae, Haliplidae, Dytiscidae, Hydrophilidae, Elmidae, Dryopidae, Heteroceridae of Prince Edward Island, Canada is surveyed. Seventy-two species are now known to occur on Prince Edward Island, 26 of which are added to the island's faunal list. Three species, Gyrinus aquiris LeConte, Oulimnius latiusculus (LeConte, and Helichus striatus LeConte, are removed since there are no voucher specimens or published records to substantiate their presence. The name Dineutus horni is designated as an incorrect subsequent spelling of Dineutus hornii Roberts, 1895. The composition of the fauna is briefly discussed, both from regional and zoogeographic perspectives. There is only one introduced species, Helophorus grandis Illiger. Only one third of the aquatic fauna recorded on the neighbouring mainland has been found on Prince Edward Island, perhaps reflecting an island-associated diminution, the paucity of collecting, an area effect, or a combination of all these factors. The island faunas of Prince Edward Island, Cape Breton Island, and insular Newfoundland are compared. Prince Edward Island's is 36% smaller than the others, in contrast with the island's carabid fauna which is almost identical in magnitude with that of Cape Breton. This might reflect dispersal obstacles, the relative paucity of aquatic habitats on the island, or an insufficient collecting effort. Further research would be desirable, both to better discern the composition of the province's fauna, as well as to monitor the health of aquatic ecosystems in relation to anthropogenic activities.

  15. Visual cues are relevant in behavioral control measures for Cosmopolites sordidus (Coleoptera: Curculionidae).

    Science.gov (United States)

    Reddy, Gadi V P; Raman, A

    2011-04-01

    Trap designs for banana root borer, Cosmopolites sordidus (Germar) (Coleoptera: Curculionidae), have been done essentially on the understanding that C. sordidus rely primarily on chemical cues. Our present results indicate that these borers also rely on visual cues. Previous studies have demonstrated that among the eight differently colored traps tested in the field, brown traps were the most effective compared with the performances of yellow, red, gray, blue, black, white, and green traps; mahogany-brown was more effective than other shades of brown.In the current study, efficiency of ground traps with different colors was evaluated in the laboratory for the capture of C. sordidius. Response of C. sordidus to pheromone-baited ground traps of several different colors (used either individually or as 1:1 mixtures of two different colors) were compared with the standardized mahogany-brown traps. Traps with mahogany-brown mixed with different colors had no significant effect. In contrast, a laboratory color-choice tests indicated C. sordidus preferred black traps over other color traps, with no specific preferences for different shades of black. Here again, traps with black mixed with other colors (1:1) had no influence on the catches. Therefore, any other color that mixes with mahogany-brown or black does not cause color-specific dilution of attractiveness. By exploiting these results, it may be possible to produce efficacious trapping systems that could be used in a behavioral approach to banana root borer control.

  16. Aerial release of Rhinoncomimus latipes (Coleoptera: Curculionidae) to control Persicaria perfoliata (Polygonaceae) using an unmanned aerial system.

    Science.gov (United States)

    Park, Yong-Lak; Gururajan, Srikanth; Thistle, Harold; Chandran, Rakesh; Reardon, Richard

    2018-01-01

    Rhinoncomimus latipes (Coleoptera: Curculionidae) is a major biological control agent against the invasive plant Persicaria perfoliata. Release of R. latipes is challenging with the current visit-and-hand release approach because P. perfoliata shows a high degree of patchiness in the landscape, possesses recurved barbs on its stems, and often spreads into hard-to-access areas. This 3-year study developed and evaluated unmanned aerial systems (UAS) for precise aerial release of R. latipes to control P. perfoliata. We have developed two UAS (i.e. quad-rotor and tri-rotor) and an aerial release system to disseminate R. latipes. These include pods containing R. latipes and a dispenser to accommodate eight pods. Results of field tests to evaluate the systems showed no significant (P > 0.05) effects on survivorship and feeding ability of R. latipes after aerial release. Our study demonstrates the potential of UAS for precision aerial release of biological control agents to control invasive plants. The aerial deployment systems we have developed, including both pods and a dispenser, are low cost, logistically practical, and effective with no negative effects on aerially released R. latipes. © 2017 Society of Chemical Industry. © 2017 Society of Chemical Industry.

  17. Cretaceous origin of giant rhinoceros beetles (Dynastini; Coleoptera) and correlation of their evolution with the Pangean breakup.

    Science.gov (United States)

    Jin, Haofei; Yonezawa, Takahiro; Zhong, Yang; Kishino, Hirohisa; Hasegawa, Masami

    2017-03-17

    The giant rhinoceros beetles (Dynastini, Scarabaeidae, Coleoptera) are distributed in tropical and temperate regions in Asia, America and Africa. Recent molecular phylogenetic studies have revealed that the giant rhinoceros beetles can be divided into three clades representing Asia, America and Africa. Although a correlation between their evolution and the continental drift during the Pangean breakup was suggested, there is no accurate divergence time estimation among the three clades based on molecular data. Moreover, there is a long chronological gap between the timing of the Pangean breakup (Cretaceous: 110-148 Ma) and the emergence of the oldest fossil record (Oligocene: 33 Ma). In this study, we estimated their divergence times based on molecular data, using several combinations of fossil calibration sets, and obtained robust estimates. The inter-continental divergence events among the clades were estimated to have occurred about 99 Ma (Asian clade and others) and 78 Ma (American clade and African clade), both of which are after the Pangean breakup. These estimates suggest their inter-continental divergences occurred by overseas sweepstakes dispersal, rather than by vicariances of the population caused by the Pangean breakup.

  18. Evolutionary history of Calosomina ground beetles (Coleoptera, Carabidae, Carabinae) of the world as deduced from sequence comparisons of the mitochondrial ND 5 gene.

    Science.gov (United States)

    Su, Zhi-Hui; Imura, Yûki; Osawa, Syozo

    2005-11-07

    We deduced the phylogenetic relationships of 54 individuals representing 27 species of the Calosomina (Coleoptera, Carabidae) from various regions of the world from the mitochondrial NADH dehydrogenase subunit 5 (ND 5) gene sequences. The results suggest that these Calosomina radiated into 17 lineages within a short time about 30 million years ago (Mya). Most of the lineages are composed of a single genus containing only one or a few species. In some cases, several species classified into the same genus (e.g., Calosoma maximowiczi, Calos. inquisitor and Calos. frigidum) appear separately in independent lineages, while in others a series of species classified into different genera fall into one lineage (e.g., Chrysostigma calidum, Blaptosoma chihuahua, Microcallisthenes wilkesi and Callisthenes spp.). Based on this molecular phylogeny and morphological data, the probable evolutionary history and mode of morphological differentiation of the Calosomina are discussed.

  19. Evaluation of heat treatment schedules for emerald ash borer (Coleoptera: Buprestidae).

    Science.gov (United States)

    Myers, Scott W; Fraser, Ivich; Mastro, Victor C

    2009-12-01

    The thermotolerance of the emerald ash borer, Agrilus planipennis Fairmaire (Coleoptera: Buprestidae), was evaluated by subjecting larvae and prepupae to a number of time-temperature regimes. Three independent experiments were conducted during 2006 and 2007 by heating emerald ash borer infested firewood in laboratory ovens. Heat treatments were established based on the internal wood temperature. Treatments ranged from 45 to 65 degrees C for 30 and 60 min, and the ability of larvae to pupate and emerge as adults was used to evaluate the success of each treatment. A fourth experiment was conducted to examine heat treatments on exposed prepupae removed from logs and subjected to ambient temperatures of 50, 55, and 60 degrees C for 15, 30, 45, and 60 min. Results from the firewood experiments were consistent in the first experiment. Emergence data showed emerald ash borer larvae were capable of surviving a temperatures-time combination up to 60 degrees C for 30 min in wood. The 65 degrees C for 30 min treatment was, however, effective in preventing emerald ash borer emergence on both dates. Conversely, in the second experiment using saturated steam heat, complete mortality was achieved at 50 and 55 degrees C for both 30 and 60 min. Results from the prepupae experiment showed emerald ash borer survivorship in temperature-time combinations up to 55 degrees C for 30 min, and at 50 degrees C for 60 min; 60 degrees C for 15 min and longer was effective in preventing pupation in exposed prepupae. Overall results suggest that emerald ash borer survival is variable depending on heating conditions, and an internal wood temperature of 60 degrees C for 60 min should be considered the minimum for safe treatment for firewood.

  20. Sequential Sampling Plan of Anthonomus grandis (Coleoptera: Curculionidae) in Cotton Plants.

    Science.gov (United States)

    Grigolli, J F J; Souza, L A; Mota, T A; Fernandes, M G; Busoli, A C

    2017-04-01

    The boll weevil, Anthonomus grandis grandis Boheman (Coleoptera: Curculionidae), is one of the most important pests of cotton production worldwide. The objective of this work was to develop a sequential sampling plan for the boll weevil. The studies were conducted in Maracaju, MS, Brazil, in two seasons with cotton cultivar FM 993. A 10,000-m2 area of cotton was subdivided into 100 of 10- by 10-m plots, and five plants per plot were evaluated weekly, recording the number of squares with feeding + oviposition punctures of A. grandis in each plant. A sequential sampling plan by the maximum likelihood ratio test was developed, using a 10% threshold level of squares attacked. A 5% security level was adopted for the elaboration of the sequential sampling plan. The type I and type II error used was 0.05, recommended for studies with insects. The adjustment of the frequency distributions used were divided into two phases, so that the model that best fit to the data was the negative binomial distribution up to 85 DAE (Phase I), and from there the best fit was Poisson distribution (Phase II). The equations that define the decision-making for Phase I are S0 = -5.1743 + 0.5730N and S1 = 5.1743 + 0.5730N, and for the Phase II are S0 = -4.2479 + 0.5771N and S1 = 4.2479 + 0.5771N. The sequential sampling plan developed indicated the maximum number of sample units expected for decision-making is ∼39 and 31 samples for Phases I and II, respectively. © The Authors 2017. Published by Oxford University Press on behalf of Entomological Society of America. All rights reserved. For Permissions, please email: journals.permissions@oup.com.

  1. Distribución y caracterización morfológica de Hycleus duodecimmaculatus (Olivier, 1811 (Coleoptera, Meloidae, una especie poco conocida del oeste de Marruecos

    Directory of Open Access Journals (Sweden)

    Ruiz, José L.

    2014-06-01

    Full Text Available Hycleus duodecimmaculatus (Coleoptera, Meloidae, Mylabrini is a poorly known species endemic to Morocco. Its geographic range extends along the coastal-subcoastal fringe of the Atlantic Coast, between Larache and Tiznit region (Arbaa Ait Ahmed. In this paper we study more than a hundred specimens, mostly preserved in the collection of the Museo Nacional de Ciencias Naturales (MNCN-CSIC, Spain. We provide new geographic records, including the Western Rif and confirm its presence in Marrakech (northwestern slopes of the High Atlas. Because of the scarcity of information, disperse and sometimes erroneous, we synthesize information available on chorology and phenology, and characterize the typology of the species’ habitat. From a taxonomic point of view, we redefine the species’ diagnostic characters and illustrate various aspects of the intra- and interpopulational morphological variability.Hycleus duodecimmaculatus (Coleoptera, Meloidae, Mylabrini es un endemismo de Marruecos muy poco conocido, cuya distribución se extiende por la franja costera-subcostera del Marruecos atlántico, entre Larache y la región de Tiznit (Arbaa Ait Ahmed. En este trabajo, realizado principalmente a partir del estudio de más de un centenar de ejemplares conservados en su mayor parte en la colección del Museo Nacional de Ciencias Naturales (MNCN-CSIC, España, se aportan nuevas citas geográficas incluyendo el Rif occidental, y se confirma su presencia en Marrakech (falda noroccidental del Alto Atlas. A la vista de la escasez de información existente para esta especie, dispersa y a veces errónea, se sintetiza la información corológica disponible, y se ofrecen datos sobre fenología de los adultos y tipología general de los hábitats que ocupa. Desde el punto de vista taxonómico, se redefinen los caracteres diagnósticos de la especie y se ilustran diversos aspectos de la variabilidad morfológica intra e interpoblacional.

  2. Reproductive Plasticity of an Invasive Insect Pest, Rice Water Weevil (Coleoptera: Curculionidae).

    Science.gov (United States)

    Huang, Yunshang; Ao, Yan; Jiang, Mingxing

    2017-12-05

    Reproductive plasticity is a key determinant of species invasiveness. However, there are a limited number of studies addressing this issue in exotic insects. The rice water weevil Lissorhoptrus oryzophilus Kuschel (Coleoptera: Curculionidae), which is native to North America, is one of the most invasive insect pests in east Asia. In this study, we investigated the reproductive status of first-generation females (progeny of overwintered weevils) from five geographic regions in southern and northern China in the field, and reproductive status and ovipositional features of females provided with suitable host plants in the laboratory after collection. Under field conditions, a proportion of females oviposited, while the rest remained in diapause from all three southern regions investigated, but reproductive development did not take place in females from the two northern regions, where the weevil produces only one generation per year. However, when fed host plants in the laboratory, females from all regions laid eggs. They typically had a very short ovipositional period (3-6 d on average on rice at a temperature of 27°C), laid a low number of eggs, and did not die soon after oviposition; this was different from common reproductive females. We concluded that first-generation L. oryzophilus females, which largely enter diapause after emergence, are highly plastic in their reproductive performance and are ready to reproduce under favorable conditions. Our results indicate the significance of their reproductive plasticity for geographic spread and population development. © The Author(s) 2017. Published by Oxford University Press on behalf of Entomological Society of America. All rights reserved. For permissions, please e-mail: journals.permissions@oup.com.

  3. A new species of Megalommum Szépligeti (Hymenoptera, Braconidae, Braconinae); a parasitoid of the pistachio longhorn beetle (Calchaenesthes pistacivora Holzschuh; Coleoptera, Cerambycidae) in Iran

    Science.gov (United States)

    van Achterberg, C.; Mehrnejad, M.R.

    2011-01-01

    Abstract A new species of the genus Megalommum Szépligeti (Hymenoptera: Braconidae: Braconinae), reared from the pistachio longhorn beetle (Calchaenesthes pistacivora Holzschuh; Coleoptera: Cerambycidae), is described and illustrated. The genera Curreia Ashmead, 1900 and Endovipio Turner, 1922 are new synonyms of Megalommum Szépligeti, 1900. Notes on the biology of Megalommum pistacivorae sp. n. and a key to the West Palaearctic and Oriental species are added. The following new combinations are given: Megalommum xanthoceps (Fahringer, 1928), comb. n., Megalommum jacobsoni (Tobias, 1968), comb. n., Megalommum ayyari (Watanabe, 1950), comb. n., Megalommum philippinense (Baker, 1917), comb. n., Megalommum dodecanesi(Ferrière, 1922), comb. n., Megalommum ceresense (Turner, 1922), comb. n., Megalommum inareatum (Granger, 1949), comb. n., Megalommum antefurcale (Szépligeti, 1915) comb. n. and Megalommum tibiale (Ashmead, 1906), comb. n. PMID:21976987

  4. Radiobiology of Small Hive Beetle (Coleoptera: Nitidulidae) and Prospects for Management Using Sterile Insect Releases.

    Science.gov (United States)

    Downey, Danielle; Chun, Stacey; Follett, Peter

    2015-06-01

    Small hive beetle, Aethina tumida Murray (Coleoptera: Nitidulidae), is considered a serious threat to beekeeping in the Western Hemisphere, Australia, and Europe mainly due to larval feeding on honey, pollen, and brood of the European honeybee, Apis mellifera L. Control methods are limited for this pest. Studies were conducted to provide information on the radiobiology of small hive beetle and determine the potential for sterile insect releases as a control strategy. Adult males and females were equally sensitive to a radiation dose of 80 Gy and died within 5-7 d after treatment. In reciprocal crossing studies, irradiation of females only lowered reproduction to a greater extent than irradiation of males only. For matings between unirradiated males and irradiated females, mean reproduction was reduced by >99% at 45 and 60 Gy compared with controls, and no larvae were produced at 75 Gy. Irradiation of prereproductive adults of both sexes at 45 Gy under low oxygen (1-4%) caused a high level of sterility (>99%) while maintaining moderate survivorship for several weeks, and should suffice for sterile insect releases. Sterile insect technique holds potential for suppressing small hive beetle populations in newly invaded areas and limiting its spread. Published by Oxford University Press on behalf of Entomological Society of America 2015. This work is written by US Government employees and is in the public domain in the US.

  5. Population Development of Zabrotes subfasciatus (Coleoptera: Chrysomelidae) in Landrace Bean Varieties Occurring in Southwestern Amazonia.

    Science.gov (United States)

    Lopes, L M; Araújo, A E F; Santos, A C V; Santos, V B; Sousa, A H

    2016-02-01

    The common bean, Phaseolus vulgaris (L.), is one of the most important sources of protein worldwide, and Latin America is one of the recognized centers of diversity of this species. However, storage of this product after harvest is not feasible because of bruchid attacks. This study determined the accumulated normalized rate of emergence and the daily emergence rate of Zabrotes subfasciatus (Boheman) (Coleoptera: Chrysomelidae:Bruchinae) in five landrace varieties of common bean (BRL 01, SNA 01, RDR 01, RBC 01, and RBC 13) that occurin southwestern Amazonia. These varieties were selected for this study because they are well-distributed throughout the Amazonian communities. Beans of each variety were infested with 50 unsexed adults, and the insects were removed 13 d after beginning the bioassays. The adult progeny obtained from the feeding substrate were counted and removed every other day after the first emergence, until the end of the emergence period. Differences were observed in the calculated rates of development; however, the time required for development and emergence of the insects was independent. Of the five varieties of bean investigated, we observed that the RDR 01, BRL 01, and SNA 01 cultivars are resistant to Z. subfasciatus; the results indicate that the use of these three varieties can reduce problems associated with bruchid attacks and enable storage of the product after harvesting.

  6. A comparison of ground beetle assemblages (Coleoptera: Carabidae in conventionally and ecologically managed alfalfa fields

    Directory of Open Access Journals (Sweden)

    P. Kolařík

    2014-12-01

    Full Text Available From 2007-2011, the occurrence of ground beetles (Coleoptera: Carabidae was studied using emergence traps in two differently managed alfalfa fields in the Czech Republic - a conventional and an ecological production system. In total, 784 specimens of ground beetles representing 58 species were trapped in these two alfalfa fields in South Moravia. A slightly higher number of specimens were trapped in the conventionally managed than in the ecological alfalfa stand (404 vs 380, respectively. In the conventionally managed alfalfa stand, the number of species was also higher than in the ecological stand (45 vs 40, respectively. With the exception of 2007 and 2009, Simpson’s indices of diversity were higher in the conventional stand than in the ecological in all study years. Shannon’s index was higher in the conventional alfalfa field in 2008, 2009, and 2011. Regarding distribution, species classified into group E (i.e., those without special demands on the type and quality of their habitat dominated in both types of management throughout the experimental period. The incidence of species classified into group R (i.e., those with narrow ecological amplitude was very low; i.e., only four species. These ground beetle species are included in the Red List of Threatened Species of the Czech Republic, and all of them (i.e. Acupalpus suturalis, Calosoma auropunctatum, Cicindela germanica and Ophonus cribricollis are listed as vulnerable.

  7. Karyotypes of some medium-sized Dytiscidae (Agabinae and Colymbetinae (Coleoptera

    Directory of Open Access Journals (Sweden)

    Robert Angus

    2013-06-01

    Full Text Available An account is given of the karyotypes of 29 species of medium sized Dytiscidae (Coleoptera. Of the 20 species of Agabus Leach, 1817, 18 have karyotypes comprising 21 pairs of autosomes and sex chromosomes which are either X0(♂ or XX (♀. These species are A. serricornis (Paykull, 1799, A. labiatus (Brahm, 1791, A. congener (Thunberg, 1794, A. lapponicus (Thomson, 1867, A. thomsoni (J. Sahlberg, 1871, A. confinis (Gyllenhal, 1808, A. sturmii (Gyllenhal, 1808, A. bipustulatus (Linnaeus, 1767, A. nevadensis Håkan Lindberg, 1939, A. wollastoni Sharp, 1882, A. melanarius Aubé, 1837, A. biguttatus (Olivier, 1795, A. binotatus Aubé, 1837, A. affinis (Paykull, 1798, A. unguicularis (Thomson, 1867, A. ramblae Millan & Ribera, 2001, A. conspersus (Marsham, 1802 and A. nebulosus (Forster, 1771. However two species, A. infuscatus Aubé, 1838 and A. adpressus Aubé, 1837, have developed a neo-XY system, with karyotypes comprising 21 pairs of autosomes and XY sex chromosomes (♂. No chromosomal differences have been detected between typical A. bipustulatus and A. bipustulatus var. solieri Aubé, 1837, nor have any been found between the three species of the A. bipustulatus complex (A. bipustulatus, A. nevadensis and A. wollastoni. The four species of Colymbetes Clairville, 1806, C. fuscus (Linnaeus, 1758, C. paykulli Erichson, 1837, C. piceus Klug, 1834 and C. striatus (Linnaeus, 1758 have karyotypes comprising 20 pairs of autosomes and sex chromosomes which are X0 (♂, XX (♀. Two of the species of Rhantus Dejean, 1833, R. exsoletus (Forster, 1771 and R. suturellus (Harris, 1828 have karyotypes comprising 20 pairs of autosomes and X0/XX sex chromosomes, but the other three species, R. grapii (Gyllenhal, 1808, R. frontalis (Marsham, 1802 and R. suturalis (Macleay, 1825 have 22 pairs of autosomes and X0/XX sex chromosomes. Agabus congener and Rhantus suturellus may have one B-chromosome. Nine of the species have previously published karyotype data but

  8. Comparisons of boll weevil (Coleoptera: Curculionidae) pheromone traps with and without kill strips.

    Science.gov (United States)

    Suh, C P C; Armstrong, J S; Spurgeon, D W; Duke, S

    2009-02-01

    Boll weevil, Anthonomus grandis grandis Boheman (Coleoptera: Curculionidae), eradication programs typically equip pheromone traps with an insecticide-impregnated kill strip. These strips are intended to kill captured insects, thereby simplifying trap servicing and reducing the loss of weevils from predation and escape. However, the effectiveness of kill strips has not been extensively evaluated. We examined the influences of kill strips on weevil captures, trap servicing, and the incidences of weevil predation and trap obstruction (e.g., by spider webs). Evaluations were conducted weekly during three different production periods (pre- to early-, late-, and postseason) of cotton, Gossypium hirsutum L., to represent different environmental conditions and weevil population levels. Within each period, mean weekly captures of weevils in traps with and without kill strips were statistically similar. On average, traps with kill strips took 9 s longer to service than traps without kill strips, but statistical differences were only detected during the late-season period. Overall, the mean weekly proportion of traps with evidence of weevil predation or trap obstruction was significantly lower for traps with kill strips (0.25) than for traps without kill strips (0.37). However, this reduction in the frequency of weevil predation or trap obstruction was too small to produce a corresponding increase in the numbers of weevils captured. In light of these findings, the use of kill strips is likely unnecessary in eradication programs, but may be a consideration in situations when the numbers of deployed traps are reduced and chronic problems with weevil predation or trap obstruction exist.

  9. Chemosensory gene families in adult antennae of Anomala corpulenta Motschulsky (Coleoptera: Scarabaeidae: Rutelinae.

    Directory of Open Access Journals (Sweden)

    Xiao Li

    Full Text Available The metallic green beetle, Anomala corpulenta (Coleoptera: Scarabaeidae: Rutelinae, is a destructive pest in agriculture and horticulture throughout Asia, including China. Olfaction plays a crucial role in the survival and reproduction of A. corpulenta. As a non-model species, A. corpulenta is poorly understood, and information regarding the molecular mechanisms underlying olfaction in A. corpulenta and other scarab species is scant.We assembled separate antennal transcriptome for male and female A. corpulenta using Illumina sequencing technology. The relative abundance of transcripts with gene ontology annotations, including those related to olfaction in males and females was highly similar. Transcripts encoding 15 putative odorant binding proteins, five chemosensory proteins, one sensory neuron membrane protein, 43 odorant receptors, eight gustatory receptors, and five ionotropic receptors were identified. The sequences of all of these chemosensory-related transcripts were confirmed using reverse transcription polymerase chain reaction (RT-PCR, and direct DNA sequencing. The expression patterns of 54 putative chemosensory genes were analyzed using quantitative real time RT-PCR (qRT-PCR. Antenna-specific expression was detected for many of these genes, suggesting that they may have important functions in semiochemical detection.The identification of a large number of chemosensory proteins provides a major resource for the study of the molecular mechanism of odorant detection in A. corpulenta and its chemical ecology. The genes identified, especially those that were expressed at high levels in the antennae may represent novel molecular targets for the development of population control strategies based on the manipulation of chemoreception-driven behaviors.

  10. A importância forense de Oxelytrum discicolle (Brullé, 1840 (Coleoptera, Silphidae

    Directory of Open Access Journals (Sweden)

    Camila Kraiczyi Kotzko

    2015-08-01

    Full Text Available Oxelytrum discicolle Brullé, 1840 é a espécie mais coletada de Silphidae (Coleoptera na América Latina, constituindo um indicador forense na região Neotropical. O objetivo do trabalho é reunir informações sobre biologia e distribuição de O. discicolle, além de ferramentas para utilização desse besouro como indicador forense em casos de morte de humanos. O. discicolle é um besouro de grande porte, de cor preta com um colar vermelho. Larvas da espécie são necrófagas, já os adultos são onívoros e se alimentam tanto de larvas de dípteros quanto da própria carcaça. Nossa revisão aponta que a espécie reduz seu tempo de desenvolvimento conforme a temperatura aumenta, sugerindo que a taxa de desenvolvimento é diferente entre as temperaturas. Estudos mostram que a espécie O. discicolle é um forte indicador forense, porém para que ocorra o avanço das pesquisas de Entomologia Forense em humanos no Brasil é necessário que os Institutos de Criminalística publiquem mais dados sobre insetos que os colonizam. Além disso, são necessários mais estudos em carcaças de animais em diversas regiões e biomas diferentes, desta forma pode ser montado um mapa de distribuição da espécie em nível nacional.

  11. CARABID BEETLES FAUNA (COLEOPTERA, CARABIDAE OF THE TSHETSHEN ISLAND IN THE CASPIAN SEA

    Directory of Open Access Journals (Sweden)

    I. A. Belousov

    2014-01-01

    Full Text Available Aim. Carabid species (Coleoptera, Carabidae are listed for Tshetshen Island in the Caspian Sea, Dagestan. The study is based on examination of 32799 adult carabids belonging to 123 species from 49 genera collected in 2011-1013. One species - Sirdenus grayii (Wollaston, 1862 – is firstly recorded from the territory ofDagestan.Location. Materials for the work served copies for the imago carabids,collected on the Chechen island in 2011-2012 years as staff and the students of ecologo-geografical faculty of Dagistan State University and the Institute for Applied Ecology (Makhachkala Methods. Charges were made with the help of light traps, soil traps, including trap, enhanced light source .Geografpical coordinates of all locations were recorded using GPS- navigator: T1 - 43°57’58” N 47°38’35” E; T2 - 43°58’17” N 47°42’55”; T3 - 43°59’08” N 47°44’39” E; T4 - 43°57’27” N 47°45’05” E; Лагерь - 43°58’11”N47°38’46” E. Results. As a result of investigations indentified the species composition of the carabids of the island Chechen.Main conclusions. Total hectares of the Chechen island collected 32799 copies of the carabids, belonging to 123 species. Sirdenus grayii (Wollaston, 1862 –for the first time actuated in Dagestan.

  12. Selectivity of phytosanitary products used in organic farming on adult of Cryptolaemus montrouzieri (Coleoptera, Coccinellidae under laboratory conditionsSeletividade de produtos fitossanitários, usados no sistema de produção orgânica, sobre adultos de Cryptolaemus montrouzieri (Coleoptera, Coccinellidae, em laboratório

    Directory of Open Access Journals (Sweden)

    Cláudia Bernardes Ourique

    2011-10-01

    Full Text Available The association of pesticides with biological control is possible only if they provide some selectivity to natural enemies. In the organic production system the effect of insecticides on beneficial insects has not been extensively studied. Thus, this study aimed to evaluate in laboratory conditions the effect of pesticides used in this system on the adults of the predator Cryptolaemus montrouzieri Mulsant (Coleoptera, Coccinellidae. We used four treatments, which corresponded to four multiple values (0.25x, 0.5x, 2x and 1x of the concentration recommended by manufacturers of the following products: Rotenat CE®, Pironat®, Biopirol 7M®, Organic Neem®, Natuneem® and lime sulfur, which were tested in C. montrouzieri by topical application and residual exposure. None of the products, at any concentrations tested, had a significant effect on the survival of adults of C. montrouzieri, what did not differ from the distilled water control, showing that the products tested are selective to the adults of this species. However, other forms of exposure and evaluation methods must be studied.A associação do controle biológico com produtos fitossanitários só é possível se estes apresentarem alguma seletividade aos inimigos naturais. No sistema de produção orgânica, o efeito de inseticidas sobre insetos benéficos não tem sido extensivamente estudado. Assim, este trabalho objetivou avaliar em laboratório o efeito de produtos fitossanitários utilizados neste sistema, sobre adultos do predador Cryptolaemus montrouzieri Mulsant (Coleoptera, Coccinellidae. Foram utilizados quatro tratamentos, os quais corresponderam quatro múltiplos (0,25x, 0,5x, 1x e 2x da concentração recomendada pelos fabricantes dos seguintes produtos comerciais: Rotenat CE®, Pironat®, Biopirol 7M®, Organic neem®, Natuneem® e calda sulfocálcica, que foram testados sobre C. montrouzieri por aplicação tópica e exposição a resíduos. Nenhum dos produtos, em qualquer

  13. Nuevos datos sobre la distribución de Stenostoma rostratum (Fabricius, 1787 en Cataluña (nordeste de la península Ibérica (Coleoptera, Oedemeridae

    Directory of Open Access Journals (Sweden)

    Agulló, J.

    2013-02-01

    Full Text Available New data on the distribution of Stenostoma rostratum (Fabricius, 1787 in Catalonia (northeastern Iberian peninsula (Coleoptera, Oedemeridae Distribution of Stenostoma rostratum (Fabricius, 1787 in Catalonia is updated. New data were obtained from recent prospecting at two natural reserves on the Mediterranean coast, the Espais Naturals del Delta de Llobregat (province of Barcelona and the Parc Natural de les Illes Medes, Massís del Montgrí i Plana del Baix Ter (province of Girona. The species was found exclusively in sand dunes, occupying a limited area on the Catalan coast. Stenostoma rostratum is considered a threatened species in Catalonia. The latest previous records were published 40 years ago. Remarks about its habitat, ecology and conservation in both protected areas are also provided.

  14. Transgenic Bt Corn, Soil Insecticide, and Insecticidal Seed Treatment Effects on Corn Rootworm (Coleoptera: Chrysomelidae) Beetle Emergence, Larval Feeding Injury, and Corn Yield in North Dakota.

    Science.gov (United States)

    Calles-Torrez, Veronica; Knodel, Janet J; Boetel, Mark A; Doetkott, Curt D; Podliska, Kellie K; Ransom, Joel K; Beauzay, Patrick; French, B Wade; Fuller, Billy W

    2018-02-09

    Northern, Diabrotica barberi Smith & Lawrence (Coleoptera: Chrysomelidae), and western, Diabrotica virgifera virgifera LeConte (Coleoptera: Chrysomelidae), corn rootworms are economic pests of corn, Zea mays L. in North America. We measured the impacts of corn hybrids incorporated with Cry3Bb1, Cry34/35Ab1, and pyramided (Cry3Bb1 + Cry34/35Ab1) Bacillus thuringiensis Berliner (Bt) proteins, tefluthrin soil insecticide, and clothianidin insecticidal seed treatment on beetle emergence, larval feeding injury, and corn yield at five locations from 2013 to 2015 in eastern North Dakota. In most cases, emergence was significantly lower in Bt-protected corn than in non-Bt corn hybrids. Exceptions included Wyndmere, ND (2013), where D. barberi emergence from Cry34/35Ab1 plots was not different from that in the non-Bt hybrid, and Arthur, ND (2013), where D. v. virgifera emergence from Cry3Bb1 plots did not differ from that in the non-Bt hybrid. Bt hybrids generally produced increased grain yield compared with non-Bt corn where rootworm densities were high, and larval root-feeding injury was consistently lower in Bt-protected plots than in non-Bt corn. The lowest overall feeding injury and emergence levels occurred in plots planted with the Cry3Bb1 + Cry34/35Ab1 hybrid. Time to 50% cumulative emergence of both species was 5-7 d later in Bt-protected than in non-Bt hybrids. Tefluthrin and clothianidin were mostly inconsequential in relation to beetle emergence and larval root injury. Our findings could suggest that some North Dakota populations could be in early stages of increased tolerance to some Bt toxins; however, Bt corn hybrids currently provide effective protection against rootworm injury in eastern North Dakota. © The Author(s) 2017. Published by Oxford University Press on behalf of Entomological Society of America. All rights reserved. For permissions, please e-mail: journals.permissions@oup.com.

  15. Seasonal changes in antifreeze protein gene transcription and water content of beetle Microdera punctipennis (Coleoptera, Tenebrionidae) from Gurbantonggut desert in Central Asia.

    Science.gov (United States)

    Hou, F; Ma, J; Liu, X; Wang, Y; Liu, X N; Zhang, F C

    2010-01-01

    Desert beetle Microdera punctipennis (Coleoptera: Tenebriondae) is a special species in Gurbantonggut Desert in Central Asia. To investigate the possible strategy it employs for cold survival, seasonal changes in supercooling point (SCP), body water content, haemolymph osmolality and antifreeze protein gene (Mpafp) expression were measured over 13 months. Our results show SCPs in M. punctipennis adults changed from -8.0°C in summer to -18.7°C in winter. During winter, adults endured modest water loss; total water decreased from 65.4 percent in summer to 55.9% in winter. Mpafp mRNAs level increased by 13.1 fold from summer to early winter, and haemolymph osmolality increased accordingly from 550 mOsm to 1486 mOsm. Correlation coefficient of Mpafp mRNAs level and SCP indicates that Mpafp mRNA explained 65.3 percent of the variation in SCPs. The correlation between Mpafp mRNA level and total water reflected an indirect influence of antifreeze protein on water content via reducing SCP.

  16. Taxonomic key for the genera of Elmidae (Coleoptera, Byrrhoidea occurring in Goiás State, Brazil, including new records and distributional notes

    Directory of Open Access Journals (Sweden)

    Felipe F. Barbosa

    2013-06-01

    Full Text Available A taxonomic key for the genera of Elmidae (Coleoptera, Byrrhoidea occurring in Goiás State, Brazil, including new records and distributional notes. Despite their great diversity and high abundance in Neotropical aquatic environments, the fauna of Elmidae remains practically unknown in some areas and even entire biomes in this region. In this work we bring, for the first time, faunistic data for the Elmidae of central Brazil. The aim of this work was to inventory the Elmidae fauna in central, southwestern and southeastern Goiás State, Brazil and to produce a taxonomic key, at genus level, for adults from the studied region. The taxonomic key presented herein offers means for the identification of all the 13 genera known to occur in Goiás, 11 of them being new records for the State. Moreover, the number of named species registered for Goiás increased from one to nine.

  17. BIOECOLOGIA DE Oncideres cervina (COLEOPTERA: CERAMBYCIDAE EM CANELA-GUAICÁ (Ocotea puberula: Lauraceae NA REGIÃO CENTRAL DO RIO GRANDE DO SUL, BRASIL

    Directory of Open Access Journals (Sweden)

    Leopoldo Witeck Neto

    2015-01-01

    Full Text Available ABSTRACTThe insect fauna knowledge of forest ecosystems have their importance in relation to damage caused bytheir different segments. The bioecology of theOncideres cervina(Coleoptera: Cerambycidae inOcoteapuberula(Lauraceae was studied in the central region of Rio Grande do Sul state, Brazil. In 49 cut twigswere analyzed the cutoff frequency, the diameter of cut twigs and sections, twig length, posture incisionsfrequency, adult emergence, exit orifice size, length and volume of the larvae gallery of this species. Thecut twigs period extends from February to March and this species is fit as thick cutter twigs. The incisionsposture number is variable, but the highest concentration is found on sections 20 to 40 cm from the cut, withan average value of 11 incisions. Two hundred adults emerged from 27 twigs, with the most emergent onthe first half of December. In order to complete its development, this species requires less wood volume ifcompared to other twig girdlers species.

  18. Boring in response to bark and phloem extracts from North American trees does not explain host acceptance behavior of Orthotomicus erosus (Coleoptera: Scolytidae)

    Science.gov (United States)

    Abigail J. Walter; Stephen A. Kells; Robert C. Venette; Steven J. Seybold

    2010-01-01

    When invasive herbivorous insects encounter novel plant species, they must determine whether the novel plants are hosts. The Mediterranean pine engraver, Orthotomicus erosus (Wollaston), an exotic bark beetle poised to expand its range in North America, accepts hosts after contacting the bark. To test the hypothesis that O. erosus...

  19. Dicty_cDB: Contig-U13775-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Y310255_1( AY310255 |pid:none) Docodesmus trinidadensis voucher D... 165 8e-40 AY310269_1( AY310269 |pid:none) Narceus american...ctylus oerstedii voucher ... 160 4e-38 AY310275_1( AY310275 |pid:none) Uroblaniulus canadensi...biania investiens elongation fa... 135 7e-31 EU624190_1( EU624190 |pid:none) Halichrysis micans...QAFPQCVFDHWASIGVVNKDKKATEVALATRKRKGLAPEIPD LDKFHEKL*ti*valefsnivtxxkk Translated ..._285( FM992689 |pid:none) Candida dubliniensis CD36 chromo... 147 2e-34 AY618550_

  20. Avaliação proteica e parâmetros populacionais de Cynaeus angustus Le Conte (Coleoptera: Tenebrionidae

    Directory of Open Access Journals (Sweden)

    Pedro Peixoto

    2016-08-01

    Protein Evaluation and Static life Table Cynaeus angustus (LeConte (Coleoptera: Tenebrionidae Abstract. Cynaeus angustus (LeConte is characterized as a pest of stored grain, there is several food substrates on their feeding ecology including corn, wheat, sorghum and soybeans. But there is no record of their habits in peanut in natura, so the aim of this study was to present the static life table, to C. angustus in laboratory conditions using as substrate the peanut, and evaluate the protein composition in different stages of development C. angustus. The quantification of proteins was taken by microbiureto method and qualitative method was done per electrophoretic method. Protein quantitation indicated an increase of its values during development of insects: larvae 38,22 mg/mL, pupae 47,53 mg/mL and adults 60,00 mg/mL. It was possible to observe the electrophoretic profile C. angustus showed a significant increase in the variety of proteins (29-700 kDa on the different stages of the insect. Data obtained from the population analysis indicate that C. angustus shows higher initial survival rates, high biotic potential and continuous developing in favorable conditions showing potential growing conditions and, that can be used as a nutritional source such as mentioned for other species of the same family.

  1. Updated distribution of Osmoderma eremita in Abruzzo (Italy and agro-pastoral practices affecting its conservation (Coleoptera: Scarabaeidae

    Directory of Open Access Journals (Sweden)

    Patrizia Giangregorio

    2015-12-01

    Full Text Available New records of Osmoderma eremita (Scopoli, 1763 (Coleoptera: Scarabaeidae: Cetoniinae are reported for Abruzzo (Italy, together with a review of its distribution in this region. O. eremita is a saproxylic beetle dependent on the presence of hollow deciduous trees with abundant wood mould in their cavities. The major threats for the species are habitat loss and fragmentation. EU Habitats Directive requests to the member States its protection and the monitoring of its conservation status. Detection of its occurrence is the first step to protect the species. The surveys have been carried out in ten sites of Abruzzo by using black cross-windows traps baited with specific pheromone. The species has been recorded for the first time in the Sant’Antonio forest and its presence is confirmed in the Peligna Valley, after a decade. The populations seem to be confined to small patches of suitable habitats. At local level, the abandonment of the pollarding practice (willow and beech forests and the use of pollarded trees as biomass for fuel are the major threats for this species. Indeed some key actions, such as the protection of old hollow trees and the continuation of pollarding practice in rural landscape, could be key factors for the conservation strategies of the species in the study area.

  2. Occurrence of adults and biological aspects of Geniates borelli Camerano (Coleoptera, Scarabaeidae, Rutelinae in Aquidauana, MS, Brazil

    Directory of Open Access Journals (Sweden)

    Sergio Roberto Rodrigues

    2012-09-01

    Full Text Available Occurrence of adults and biological aspects of Geniates borelli Camerano (Coleoptera, Scarabaeidae, Rutelinae in Aquidauana, Mato Grosso do Sul, Brazil. Due to the importance of Geniates borelli Camerano as a pest in many crops, studies were developed at Universidade Estadual de Mato Grosso do Sul, Aquidauana campus, MS, Brazil. Adults were collected with a light trap from January 2006 to December 2007. 3,320 adults were collected, and the highest quantities were obtained in October 2006 and November 2007, with 1,548 and 802 adults recorded, respectively. Collected adults were kept in plastic containers with soil and Brachiaria decumbens seedlings for oviposition. 535 eggs measuring 2.30 × 1.60 mm were obtained. As the embryonic development progressed, eggs increased in size to 3.00 × 2.70 mm, and this change occurred between 6 and 10 days after oviposition. The embryonic period lasted 17.9 days. The first, second, and third instars lasted 37.6, 49.7, and 74 days, respectively. The prepupal stage lasted 65.9 days and the pupal stage lasted an average of 18.5 days. The biological cycle is completed in 315.8 days, which characterizes the species as univoltine. The average longevity of females was 35.4 days and 28.5 days for males.

  3. Lectotype designations and nomenclatural changes in Xylographus Mellié (Coleoptera, Ciidae

    Directory of Open Access Journals (Sweden)

    Vivian E. Sandoval-Gómez

    2014-01-01

    Full Text Available We designate lectotypes and propose nomenclatural changes in Xylographus Mellié (Coleoptera, Ciidae based on type specimens deposited in the Museum of Comparative Zoology (USA, Museum für Naturkunde Berlin (Germany, the Natural History Museum (UK, Muséum d’Histoire Naturelle de la Ville de Genève (Switzerland, Muséum National d’Histoire Naturelle (France, Naturhistoriska Riksmuseet (Sweden and Naturhistorisches Museum Wien (Austria. We designate lectotypes for the following species: Cis fultoni Broun, 1886, Xylographus anthracinus Mellié, 1849, X. bicolor Pic, 1916, X. brasiliensis Pic, 1916, X. ceylonicus Ancey, 1876, X. contractus Mellié, 1849, X. corpulentus Mellié, 1849, X. dentatus Pic, 1922, X. gibbus Mellié, 1849, X. hypocritus Mellié, 1849, X. javanus Pic, 1937, X. lemoulti Pic, 1916, X. longicollis Pic, 1922, X. madagascariensis Mellié, 1849, X. nitidissimus Pic, 1916, X. perforatus Gerstaecker, 1871, X. porcus Gorham, 1886, X. punctatus Mellié, 1849, X. ritsemai Pic, 1921, X. rufescens Pic, 1921, X. rufipennis Pic, 1934, X. rufipes Pic, 1930, X. seychellensis Scott, 1926, X. subopacus Pic, 1929, X. subsinuatus Pic, 1916, X. suillus Gorham, 1886, X. testaceitarsis Pic, 1916 and X. tomicoides Reitter, 1902. We propose the following syn. n. (senior synonym listed first: X. anthracinus = X. testaceitarsis, X. brasiliensis = X. lucasi Lopes-Andrade & Zacaro, X. corpulentus = X. lemoulti and X. richardi Mellié, X. madagascariensis = X. eichelbaumi Reitter, X. rufipennis, X. seychellensis Scott and X. tarsalis Fåhraeus, X. nitidissimus = X. longicollis, X. subsinuatus = X. rufescens. We exclude three species from Xylographus: Cis renominatus, nom.n. (for X. dentatus Pic, 1922, not C. dentatus Mellié, 1849, Paratrichapus fultoni (Broun, 1886, comb. n. and P. javanus (Pic, 1937, comb. n.

  4. Bazı Biyolojik Preparatların Sitophilus granarius (Coleoptera: Curculionidae Erginlerine Etkileri

    Directory of Open Access Journals (Sweden)

    Tuğba AYYILDIZ

    2017-09-01

    Full Text Available Bu çalışmada, Entomopatojen funguslardan Biocatch, Nibortem (Verticillium lecani, BMAUM-M3-003 (Metharizum anisopliae ile okaliptus ve zencefil bitkilerinden elde edilen uçucu yağların ve bir bitkisel ekstrakt preparatı olan Nibedicine EC (Azadiractin’in buğdaylarda oldukça önemli zarara neden olan Sitophilus granarius (Coleoptera: Curculionidae erginlerine karşı laboratuar koşullarında etkinlikleri denenmiştir. 10x10x8 cm boyutlarında ağızları tül ile yapıştırılmış olan plastik kaplarda ve 25±1 °C sıcaklık, %60±5 nem oranlarında ve 16:8 saat ışıklandırma süresine ayarlı iklim odasında yetiştirilen S. granarius erginleri üzerine Biocatch, Nibortem (Verticillium lecanii entomopatojen funguslardan 1x109  cfu/mL, BMAUM-M3-003 (Metharizum anisopliae 1x108  cfu/mL dozunda, Nibedicine EC (Azadirachtin 3000 ppm dozunda, uçucu yağlar ise %1 (1 l/100 l dozunda uygulanmıştır. Çalışma sonucunda elde edilen verilere göre BMAUM-M3-003 kodlu entomopatojen fungus (M. anisopliae, S. granarius’u zamana bağlı olarak en fazla etkileyen etmen olmuştur. Yapılan değerlendirmeler sonucunda kullanılan preparatların 21 gün sonunda etkileri incelendiğinde, zencefilin %89.47, diğerlerinin ise %100 ölüm oranına sahip olduğu saptanmıştır.

  5. A molecular phylogeny shows the single origin of the Pyrenean subterranean Trechini ground beetles (Coleoptera: Carabidae).

    Science.gov (United States)

    Faille, A; Ribera, I; Deharveng, L; Bourdeau, C; Garnery, L; Quéinnec, E; Deuve, T

    2010-01-01

    Trechini ground beetles include some of the most spectacular radiations of cave and endogean Coleoptera, but the origin of the subterranean taxa and their typical morphological adaptations (loss of eyes and wings, depigmentation, elongation of body and appendages) have never been studied in a formal phylogenetic framework. We provide here a molecular phylogeny of the Pyrenean subterranean Trechini based on a combination of mitochondrial (cox1, cyb, rrnL, tRNA-Leu, nad1) and nuclear (SSU, LSU) markers of 102 specimens of 90 species. We found all Pyrenean highly modified subterranean taxa to be monophyletic, to the exclusion of all epigean and all subterranean species from other geographical areas (Cantabrian and Iberian mountains, Alps). Within the Pyrenean subterranean clade the three genera (Geotrechus, Aphaenops and Hydraphaenops) were polyphyletic, indicating multiple origins of their special adaptations to different ways of life (endogean, troglobitic or living in deep fissures). Diversification followed a geographical pattern, with two main clades in the western and central-eastern Pyrenees respectively, and several smaller lineages of more restricted range. Based on a Bayesian relaxed-clock approach, and using as an approximation a standard mitochondrial mutation rate of 2.3% MY, we estimate the origin of the subterranean clade at ca. 10 MY. Cladogenetic events in the Pliocene and Pleistocene were almost exclusively within the same geographical area and involving species of the same morphological type.

  6. Effects of insecticide exposure on movement and population size estimates of predatory ground beetles (Coleoptera: Carabidae).

    Science.gov (United States)

    Prasifka, Jarrad R; Lopez, Miriam D; Hellmich, Richard L; Prasifka, Patricia L

    2008-01-01

    Estimates of arthropod population size may paradoxically increase following insecticide applications. Research with ground beetles (Coleoptera: Carabidae) suggests that such unusual results reflect increased arthropod movement and capture in traps rather than real changes in population size. However, it is unclear whether direct (hyperactivity) or indirect (prey-mediated) mechanisms produce increased movement. Video tracking of Scarites quadriceps Chaudior indicated that brief exposure to lambda-cyhalothrin or tefluthrin increased total distance moved, maximum velocity and percentage of time moving. Repeated measurements on individual beetles indicated that movement decreased 240 min after initial lambda-cyhalothrin exposure, but increased again following a second exposure, suggesting hyperactivity could lead to increased trap captures in the field. Two field experiments in which ground beetles were collected after lambda-cyhalothrin or permethrin application attempted to detect increases in population size estimates as a result of hyperactivity. Field trials used mark-release-recapture methods in small plots and natural carabid populations in larger plots, but found no significant short-term (<6 day) increases in beetle trap captures. The disagreement between laboratory and field results suggests mechanisms other than hyperactivity may better explain unusual changes in population size estimates. When traps are used as a primary sampling tool, unexpected population-level effects should be interpreted carefully or with additional data less influenced by arthropod activity.

  7. Two types of phytases (histidine acid phytase and β-propeller phytase) in Serratia sp. TN49 from the gut of Batocera horsfieldi (coleoptera) larvae.

    Science.gov (United States)

    Zhang, Rui; Yang, Peilong; Huang, Huoqing; Shi, Pengjun; Yuan, Tiezheng; Yao, Bin

    2011-11-01

    Microbial phytases play a major role in the mineralization of organic phosphorous, especially in symbiotic plants and animals. In this study, we identified two types of phytases in Serratia sp. TN49 that was harbored in the gut of Batocera horsfieldi (Coleoptera) larvae. The two phytases, an acidic histidine acid phosphatase (PhyH49) and an alkaline β-propeller phytase (PhyB49), shared low identities with known phytases (61% at most). PhyH49 and PhyB49 produced in Escherichia coli exhibited maximal activities at pH 5.0 (60°C) and pH 7.5-8.0 (45°C), respectively, and are complementary in phytate degradation over the pH range 2.0-9.0. Serratia sp. TN49 harboring both PhyH49 and PhyB49 might make it more adaptive to environment change, corresponding to the evolution trend of microorganism.

  8. On the identity of the fossil hydrophilid beetles from the Tertiary localities in the southern part of the Upper Rhine Graben (Coleoptera: Hydrophilidae, Dytiscidae

    Directory of Open Access Journals (Sweden)

    Martin Fikácek

    2011-01-01

    Full Text Available This study focuses on the beetles from the Oligocene localities in the southern part of the Upper Rhine Graben (Brunstatt: France, Alsace; and Kleinkems: Germany, Baden-Württemberg assigned to the family Hydrophilidae by previous authors. The identity of Escheria convexa Förster, 1891 is fixed by the designation of its neotype, the species is redescribed, illustrated and transferred from the hydrophilid genus Hydrobius Leach, 1815 to the genus Copelatus Erichson, 1832 (Coleoptera: Adephaga: Dytiscidae and compared with other fossil representatives of Copelatus. The identity of the remaining three species is briefly evaluated on the basis of the original descriptions and illustrations only, because their types were lost or destroyed during World War II; all three species are removed from the fossil record of the Hydrophiloidea and placed into Polyphaga incertae sedis. The geology and stratigraphy of both fossil outcrops is discussed briefly.

  9. ATIVIDADE INSETICIDA DE ÓLEOS VEGETAIS SOBRE Sitophilus zeamais MOTS. (COLEOPTERA: CURCULIONIDAE EM MILHO ARMAZENADO

    Directory of Open Access Journals (Sweden)

    Rodrigo Leandro Braga de Castro Coitinho

    2006-01-01

    Full Text Available Oils of andiroba (Carapa guianensis Aubl., copaiba (Copaifera sp., Eucaliptus globulus Labill. and Eucaliptus citriodora Hook., neem (Azadirachta indica A. Juss, eugenol, souari nut (Caryocar brasiliense Camb., rosemary (Lippia gracillis HBK., and cedar (Cedrela fissilis Vell. were evaluated in adults of Sitophilus zeamais Mots. (Coleoptera: Curculionidae. In the non-choice test, 20 g of corn grains per plot were treated with 50¿L of each oil and homogenized for two minutes. The plot was infested with eight 0 to 15 days-old S. zeamais adults. The E. globulus, eugenol, rosemary, and neem oils caused 100% mortality in S. zeamais adults. Except for copaiba, all oils caused mortality above 87% and the reduction in emergence of 100%. In the free-choice tests, arenas consisting of two plastic containers symmetrically interconnected to a central box by two plastic tubes were used. Twenty grams of non-treated corn (control were placed in one of the boxes and the same amount of grain treated with 50¿L of each oil comprised the other treatment. Sixteen non-sexed S. zeamais adults (0-15 days old were released in the central box. The rosemary, E. citriodora, eugenol and copaiba oils were the most repellent for S. zeamais adults, with repellence percentage varying from 97.3 to 87.7. Rosemary, andiroba, neem, and cedar reduced S. zeamais emergence in 100%, while the reduction caused by the other oils ranged from 72.7 to 97.9%.

  10. The coastal rove beetles (Coleoptera, Staphylinidae of Atlantic Canada: a survey and new records

    Directory of Open Access Journals (Sweden)

    Christopher Majka

    2008-09-01

    Full Text Available The coastline inhabiting rove beetles (Coleoptera: Staphylinidae of Atlantic Canada are surveyed. Thirty-three species have now been recorded in Atlantic Canada including 26 in New Brunswick, 15 in Newfoundland, 31 in Nova Scotia, and 13 on Prince Edward Island. Oligota parva Kraatz, Acrotona avia (Casey, Strigota ambigua (Erichson, and Myrmecopora vaga (LeConte, are all newly recorded in Canada, and Bledius mandibularis Erichson is newly recorded in Atlantic Canada. We retain A. avia as a species distinct from A. subpygmaea Bernhauer and designate a lectotype and paralectotypes for A. avia. Ten new provincial records are reported, one from New Brunswick, six from Nova Scotia, and three from Prince Edward Island. Four functional groups, halobiont (obligate, halophile (facultative, haloxene (tolerant, and incidental coastal species, are distinguished and the fauna is examined from the perspective of the particular coastline habitats and microhabitats they have been found to inhabit. Fourteen of the 33 staphylinids are introduced, Palearctic species, and eight of these have been associated with historic dry ballast shipping to the region from Great Britain. A trophic analysis indicates that some species are phytophagous algae feeders, while others are either generalist predators, or predators specializing on particular taxonomic or functional groups of invertebrates. Finally, some attention is devoted to discussing the diminished areas of coastline environments such as coastal marshes, and the various kinds of environmental disturbances and degradations they have experienced. These indicate the potential vulnerability of such coastal habitats and consequently of the communities of beetles that inhabit them.

  11. Geometric analysis of nutrient balancing in the mealworm beetle, Tenebrio molitor L. (Coleoptera: Tenebrionidae).

    Science.gov (United States)

    Rho, Myung Suk; Lee, Kwang Pum

    2014-12-01

    Geometric analysis of the nutritional regulatory responses was performed on an omnivorous mealworm beetle, Tenebrio molitor L. (Coleoptera: Tenebrionidae) to test whether this beetle had the capacity to balance the intake of protein and carbohydrate. We also identified the pattern of ingestive trade-off employed when the insect was forced to balance the costs of over- and under-ingesting macronutrients. When allowed to mix their diet from two nutritionally imbalanced but complementary foods (protein-biased food: p35:c7 or p28:c5.6; carbohydrate-biased food: p7:c35 or p5.6:c28), beetles of both sexes actively regulated their intake of protein and carbohydrate to a ratio of 1:1. When confined to one of seven nutritionally imbalanced foods (p0:c42, p7:c35, p14:c28, p21:c21, p28:c14, p35:c7 or p42:c0), beetles over-ingested the excessive nutrient from these foods to such an extent that all the points of protein-carbohydrate intake aligned linearly in the nutrient space, a pattern that is characteristic of generalist feeders and omnivores. Under the restricted feeding conditions, males ate more nutrients but were less efficient at retaining their body lipids than females. Body lipid content was higher on carbohydrate-rich foods and was positively correlated with starvation resistance. Our results are consistent with the prediction based on the nutritional heterogeneity hypothesis, which links the nutritional regulatory responses of insects to their diet breadth and feeding ecology. Copyright © 2014. Published by Elsevier Ltd.

  12. Diversidad de la familia Carabidae (Coleoptera en Chile Diversity of the family Carabidae (Coleoptera in Chile

    Directory of Open Access Journals (Sweden)

    SERGIO ROIG-JUÑENT

    2001-09-01

    Full Text Available Carabidae constituye dentro de los coléopteros chilenos, la cuarta familia en importancia por su cantidad de especies. El presente trabajo incluye una breve compilación acerca de la historia de la familia y de las primeras expediciones realizadas en Chile. También se realizan comparaciones de la diversidad de carábidos chilenos con respecto a otros países y el Neotrópico. Para Chile, se conocen 21 tribus, con 95 géneros y 365 especies, que representan el 38,8, 28,8 y 7,9 % de la fauna del Neotrópico, respectivamente. Chile posee un bajo número de tribus comparado con otros países, sin embargo, constituye un área importante por la presencia de seis tribus relictuales, principalmente pangeicas o gondwánicas. Chile posee 18 géneros endémicos (18,5 % de su fauna de Carabidae, 28 cuya distribución está restringida a Chile y Argentina y seis restringidos a Chile, Argentina y Uruguay. La cantidad de especies presentes en Chile es inferior a la que poseen otros países de América del Sur, pero la cantidad de especies endémicas es muy alta (204 y representa el 55,8 % de su fauna de carábidos. El alto grado de endemismo que posee Chile con respecto a otros países de América del Sur puede deberse a su condición de aislamiento, siendo las barreras más importantes la región desértica del norte y la cordillera de Los Andes. Este hecho también se vislumbra por la ausencia de importantes tribus neotropicales como Galeritini, Scaritini y Brachinini. También se incluyen en este trabajo claves para la identificación de todas las tribus y géneros presentes en Chile, como así también una breve descripción acerca de la diversidad y ambientes en los que se encuentra cada géneroThe family Carabidae is the fourth largest Coleoptera family in Chile. The present work includes a brief compilation on the taxonomic history of the family and the first expeditions to Chile. In addition, knowledge of carabid diversity in Chile is compared with

  13. Circulating Hemocytes from Larvae of the Japanese Rhinoceros Beetle Allomyrina dichotoma (Linnaeus) (Coleoptera: Scarabaeidae) and the Cellular Immune Response to Microorganisms.

    Science.gov (United States)

    Hwang, Sejung; Bang, Kyeongrin; Lee, Jiae; Cho, Saeyoull

    2015-01-01

    Hemocytes of the last larva of the Japanese rhinoceros beetle A. dichotoma (Linnaeus) (Coleoptera: Scarabaeidae) were classified as granulocytes, plasmatocytes, oenocytoids, spherulocytes, prohemocytes, and adipohemocytes. Among these cell types, only the granulocytes became immunologically activated with obvious morphological changes, displaying large amoeba-like, lobopodia-like, and fan-like structures. In addition, their cytoplasmic granules became larger and greatly increased in number. To explore whether these granules could be immunologically generated as phagosomes, total hemocytes were stained with LysoTracker. Greater than 90% of the granulocytes retained the LysoTracker dye at 4 h post-bacterial infection. In flow cytometry analysis, the red fluorescent signal was highly increased at 4 h post-bacterial infection (60.36%) compared to controls (5.08%), as was confirmed by fluorescent microscopy. After 12 h post-infection, these signals returned to basal levels. The uptake of pathogens by granulocytes rapidly triggered the translocation of the microtubule-associated protein 1 light chain 3 alpha (LC3) to the phagosome, which may result in enhanced pathogen killing.

  14. Circulating Hemocytes from Larvae of the Japanese Rhinoceros Beetle Allomyrina dichotoma (Linnaeus (Coleoptera: Scarabaeidae and the Cellular Immune Response to Microorganisms.

    Directory of Open Access Journals (Sweden)

    Sejung Hwang

    Full Text Available Hemocytes of the last larva of the Japanese rhinoceros beetle A. dichotoma (Linnaeus (Coleoptera: Scarabaeidae were classified as granulocytes, plasmatocytes, oenocytoids, spherulocytes, prohemocytes, and adipohemocytes. Among these cell types, only the granulocytes became immunologically activated with obvious morphological changes, displaying large amoeba-like, lobopodia-like, and fan-like structures. In addition, their cytoplasmic granules became larger and greatly increased in number. To explore whether these granules could be immunologically generated as phagosomes, total hemocytes were stained with LysoTracker. Greater than 90% of the granulocytes retained the LysoTracker dye at 4 h post-bacterial infection. In flow cytometry analysis, the red fluorescent signal was highly increased at 4 h post-bacterial infection (60.36% compared to controls (5.08%, as was confirmed by fluorescent microscopy. After 12 h post-infection, these signals returned to basal levels. The uptake of pathogens by granulocytes rapidly triggered the translocation of the microtubule-associated protein 1 light chain 3 alpha (LC3 to the phagosome, which may result in enhanced pathogen killing.

  15. SINOPSIS DE LOS ESCARABAJOS COPRÓFAGOS (COLEOPTERA: SCARABAEINAE DEL CARIBE COLOMBIANO

    Directory of Open Access Journals (Sweden)

    JORGE ARI NORIEGA

    2013-12-01

    Full Text Available La subfamilia Scarabaeinae (Coleoptera: Scarabaeidae es un grupo de gran importancia en los ecosistemas por su significativa participación en el proceso de reciclaje de nutrientes. Para Colombia existen algunos acercamientos al análisis de su diversidad en ciertas regiones biogeográficas. Sin embargo, existen zonas que necesitan un mayor estudio, como es el caso de la región Caribe. Con el fin de llenar el vacío de información se realizó una revisión de la información depositada en 16 colecciones a nivel nacional y de la literatura en esta zona. Se registran 90 especies pertenecientes a 24 géneros, agrupadas en seis tribus. Se reportan 20 nuevas especies para el departamento de La Guajira, 18 para Sucre, once para Magdalena, nueve para Bolívar, nueve para Córdoba, tres para Atlántico y dos para Cesar. El departamento con la mayor riqueza es Magdalena ya que es el mejor muestreado incluyendo su rango altitudinal. Al analizar la composición de especies, la región Caribe presenta pocos endemismos, exceptuando las zonas altas del Macizo de la Sierra Nevada de Santa Marta. El género Onthophagus es el más diverso en la región y la especie que presenta el mayor rango altitudinal es Ontherus sanctaemartae (700 hasta 2500 m . La región es homogénea en las zonas bajas, presentándose una mayor afinidad con el Chocó biogeográfico. Se establecen en la región cuatro grandes franjas altitudinales: planicies (0- 500 m , colinas altas (>500- 900 m , zona subandina-andina (> 900 a 2500 m y alta montaña (> 2500 m . Es posible que con el incremento de muestreos en zonas poco estudiadas la homogeneidad específica aumente. Finalmente, es necesario ampliar e intensificar los estudios en esta región, especialmente en los sistemas montañosos aislados.

  16. A model species for agricultural pest genomics: the genome of the Colorado potato beetle, Leptinotarsa decemlineata (Coleoptera: Chrysomelidae).

    Science.gov (United States)

    Schoville, Sean D; Chen, Yolanda H; Andersson, Martin N; Benoit, Joshua B; Bhandari, Anita; Bowsher, Julia H; Brevik, Kristian; Cappelle, Kaat; Chen, Mei-Ju M; Childers, Anna K; Childers, Christopher; Christiaens, Olivier; Clements, Justin; Didion, Elise M; Elpidina, Elena N; Engsontia, Patamarerk; Friedrich, Markus; García-Robles, Inmaculada; Gibbs, Richard A; Goswami, Chandan; Grapputo, Alessandro; Gruden, Kristina; Grynberg, Marcin; Henrissat, Bernard; Jennings, Emily C; Jones, Jeffery W; Kalsi, Megha; Khan, Sher A; Kumar, Abhishek; Li, Fei; Lombard, Vincent; Ma, Xingzhou; Martynov, Alexander; Miller, Nicholas J; Mitchell, Robert F; Munoz-Torres, Monica; Muszewska, Anna; Oppert, Brenda; Palli, Subba Reddy; Panfilio, Kristen A; Pauchet, Yannick; Perkin, Lindsey C; Petek, Marko; Poelchau, Monica F; Record, Éric; Rinehart, Joseph P; Robertson, Hugh M; Rosendale, Andrew J; Ruiz-Arroyo, Victor M; Smagghe, Guy; Szendrei, Zsofia; Thomas, Gregg W C; Torson, Alex S; Vargas Jentzsch, Iris M; Weirauch, Matthew T; Yates, Ashley D; Yocum, George D; Yoon, June-Sun; Richards, Stephen

    2018-01-31

    The Colorado potato beetle is one of the most challenging agricultural pests to manage. It has shown a spectacular ability to adapt to a variety of solanaceaeous plants and variable climates during its global invasion, and, notably, to rapidly evolve insecticide resistance. To examine evidence of rapid evolutionary change, and to understand the genetic basis of herbivory and insecticide resistance, we tested for structural and functional genomic changes relative to other arthropod species using genome sequencing, transcriptomics, and community annotation. Two factors that might facilitate rapid evolutionary change include transposable elements, which comprise at least 17% of the genome and are rapidly evolving compared to other Coleoptera, and high levels of nucleotide diversity in rapidly growing pest populations. Adaptations to plant feeding are evident in gene expansions and differential expression of digestive enzymes in gut tissues, as well as expansions of gustatory receptors for bitter tasting. Surprisingly, the suite of genes involved in insecticide resistance is similar to other beetles. Finally, duplications in the RNAi pathway might explain why Leptinotarsa decemlineata has high sensitivity to dsRNA. The L. decemlineata genome provides opportunities to investigate a broad range of phenotypes and to develop sustainable methods to control this widely successful pest.

  17. ALTURA DE VOO DE ESCOLITÍNEOS (COLEOPTERA, SCOLYTINAE EM POVOAMENTO DE Pinus taeda L. NO SUL DO BRASIL

    Directory of Open Access Journals (Sweden)

    Leonardo Mortari Machado

    2017-01-01

    Full Text Available Scolytids (Curculionidae, Scolytinae are small borer beetles belonging to the order Coleoptera that develop within or under the bark of trees. In northern countries, these insects cause significant damage especially when outbreaks occur. In Brazil, in general, the damage is minor when compared to the northern hemisphere. Given the importance of subfamily Scolytinae, this paper aims at providing a better understanding of the behavior of Scolytids, mainly regarding the flight height in a stand of Pinus taeda L. For the execution of this work 72, intercept flight traps were installed in area belonging to the State Foundation for Agricultural Research (FEPAGRO, located in Santa Maria, Rio Grande do Sul state. The treatments correspond to heights of 0.5; 1.0; 1.5; 2.0; 2.5; 3.0; 3.5; 4.0; 4.5; 5.0; 5.5 and 6.0 meters. It was possible to capture: Hypothenemus eruditus in greater abundance at the range of 1 to 1.5 meters; Xyleborus ferrugineus , Xyleborinus gracilis and Xyleborus affinis to 0.5 meters; Xyleborinus saxeseni and Xylosandrus retusus with no preference. It is concluded that the range between 0.5 and 1.5 meters is ideal to analyze quantitatively the scolytids present in the Pinus taeda.

  18. Seasonal Terpene Variation in Needles of Pinus radiata (Pinales: Pinaceae) Trees Attacked by Tomicus piniperda (Coleoptera: Scolytinae) and the Effect of Limonene on Beetle Aggregation.

    Science.gov (United States)

    Romón, Pedro; Aparicio, Domitila; Palacios, Francisco; Iturrondobeitia, Juan Carlos; Hance, Thierry; Goldarazena, Arturo

    2017-09-01

    Concentrations of four monoterpenes were determined in needles of Pinus radiata (D.Don) (Pinales: Pinaceae) trees that were attacked or nonattacked by Tomicus piniperda (L.) (Coleoptera: Scolytinae). Compounds were identified and quantified by gas chromatography-mass spectrometry. The mean ambient temperature was obtained using climate-recording data loggers. The effect of limonene on field aggregation was also evaluated at three limonene release rates using Lindgren attractant-baited traps and trap logs. Attacked trees produced less α-pinene in March, July, and November than nonattacked trees, less β-pinene in July and November, and less limonene from May to November. Limonene reduced the attraction of T. piniperda to attractant-baited traps and trap logs. Results were linked to better responses to high temperatures, with respect to terpene contents, by the nonattacked trees after the spring attack. © The Author 2017. Published by Oxford University Press on behalf of Entomological Society of America.

  19. Biological aspects of Eriopis connexa (Germar (Coleoptera: Coccinellidae fed on different insect pests of maize (Zea mays L. and sorghum [Sorghum bicolor L. (Moench.

    Directory of Open Access Journals (Sweden)

    RB Silva

    Full Text Available Eriopis connexa (Germar (Coleoptera: Coccinellidae occurs in several countries of South America and its mass rearing is important for biological control programmes. This work evaluated biological aspects of E. connexa larva fed on eggs of Anagasta kuehniella (Zeller (Lepidoptera: Pyralidae and Spodoptera frugiperda (J. E. Smith (Lepidoptera: Noctuidae frozen for one day, fresh eggs of Diatraea saccharalis (Fabricius (Lepidoptera: Pyralidae, S. frugiperda newly-hatched caterpillars, nymphs of Rhopalosiphum maidis (Fitch and Schizaphis graminum (Rondani (Hemiptera: Aphididae. Duration of larva, pupa and larva to adult stages differed among prey offered, whereas the prepupa stage was similar. Larva, pupa, prepupa and larva to adult viabilities were equal or major of 87.5% in all prey, except for larva fed on newly-hatched larvae of S. frugiperda. Eriopis connexa has good adaptation to different prey corroborating its polyphagous feeding habit, which evidences the potential of this natural enemy for controlling corn and sorghum pests.

  20. Landscape patterns of species-level association between ground-beetles and overstory trees in boreal forests of western Canada (Coleoptera, Carabidae

    Directory of Open Access Journals (Sweden)

    Colin Bergeron

    2011-11-01

    Full Text Available Spatial associations between species of trees and ground-beetles (Coleoptera: Carabidae involve many indirect ecological processes, likely reflecting the function of numerous forest ecosystem components. Describing and quantifying these associations at the landscape scale is basic to the development of a surrogate-based framework for biodiversity monitoring and conservation. In this study, we used a systematic sampling grid covering 84 km2 of boreal mixedwood forest to characterize the ground-beetle assemblage associated with each tree species occurring on this landscape. Projecting the distribution of relative basal area of each tree species on the beetle ordination diagram suggests that the carabid community is structured by the same environmental factors that affects the distribution of trees, or perhaps even by trees per se. Interestingly beetle species are associated with tree species of the same rank order of abundance on this landscape, suggesting that conservation of less abundant trees will concomitantly foster conservation of less abundant beetle species. Landscape patterns of association described here are based on characteristics that can be directly linked to provincial forest inventories, providing a basis that is already available for use of tree species as biodiversity surrogates in boreal forest land management.

  1. The Capturing of the Apple Blossom Beetle, Tropinota hirta (Poda (Coleoptera: Scarabaeidae, by Different Traps in Afyonkarahisar

    Directory of Open Access Journals (Sweden)

    Bülent YAŞAR

    2014-03-01

    Full Text Available This study was conducted to determine the most effective traps for capturing Tropinota hirta (Poda (Coleoptera: Scarabaeidae being an economical pest on the flowers of apple trees in Sultandağı county of Afyonkarahisar province in 2010. Blue plastic traps of in the same color (Sticky plate trap, funnel plus water and large bowl plus water and also an attractant containing cinnamyl alcohol and trans-anethol, as a commercial preparation were used in the present study. Four different selected sites were investigated to find the most attractive traps for the mentioned pest. The highest number of captives was achieved in the first (43.60% of total and third (33.13% of total location sites. They were found in the locations second and the fourth as 14.53% and 8.72%, respectively. Most of the adults were captured by the blue funnel plus water traps with the attractants. We assume that the number of apple blossom beetles captured in apple orchards depends upon the age of the trees and whether they are near uncultivated or grain growing areas. In conclusion, we propose that the use of a blue funnel in a cup containing water, and also with an attractant, is an effective biotechnical method for controll ing pest existing on apple trees when chemicals cannot be applied during the blooming period.

  2. Study of the flying ability of Rhynchophorus ferrugineus (Coleoptera: Dryophthoridae) adults using a computer-monitored flight mill.

    Science.gov (United States)

    Ávalos, J A; Martí-Campoy, A; Soto, A

    2014-08-01

    The red palm weevil, Rhynchophorus ferrugineus (Olivier) (Coleoptera: Dryophthoridae), native to tropical Asian regions, has become a serious threat to palm trees all over the world. Knowledge of its flight potential is vital to improving the preventive and curative measures currently used to manage this pest. As R. ferrugineus is a quarantine pest, it is difficult to study its flight potential in the field. A computer-monitored flight mill was adapted to analyse the flying ability of R. ferrugineus through the study of different flight parameters (number of flights, total distance flown, longest single flight, flight duration, and average and maximum speed) and the influence of the weevil's sex, age, and body size on these flight parameters. Despite significant differences in the adult body size (body weight and length) of males and females, the sex of R. ferrugineus adults did not have an influence on their flight potential. Neither adult body size nor age was found to affect the weevil's flying abilities, although there was a significantly higher percentage of individuals flying that were 8-23 days old than 1-7 days old. Compared to the longest single flight, 54% of the insects were classified as short-distance flyers (covering 5000 m), respectively. The results are compared with similar studies on different insect species under laboratory and field conditions.

  3. Parasitism of Ground Beetles (Coleoptera: Carabidae) by a New Species of Hairworm (Nematomorpha: Gordiida) in Arctic Canada.

    Science.gov (United States)

    Ernst, Crystal M; Hanelt, Ben; Buddle, Christopher M

    2016-06-01

    The host-parasite associations between ground beetles (Coleoptera: Carabidae) and hairworms (Nematomorpha: Gordiida) collected from the Arctic (an understudied and ecologically important region) is described. Carabids and their parasites were collected from 12 sites spanning the 3 northernmost ecoclimatic zones of Canada (north boreal, subarctic, and high Arctic) using standardized methods. The beetles and hairworms were identified using traditional morphological approaches. Seven beetle species are recorded as hosts: Amara alpina, Pterostichus caribou, Pterostichus brevicornis, Pterostichus tareumiut, Pterostichus haematopus, Patrobus septentrionis, and Notiophilus borealis. All represent new host records (increasing the known North American host list from 14 to 21), and this is the first record of hairworm infection in the genus Notiophilus. Beetles from Banks Island, Northwest Territory, were infected in high numbers (11-19% per sampling period) and were used as an ecological case study. There was no significant relationship between infection status and host species, body size, or sex. Beetles collected in yellow pan traps and in wet habitats were more likely to be infected, likely due to water-seeking behavior induced by the parasites. Morphological examinations indicate that the hairworms collected from all locations represent a single, new species of Gordionus, making it only the sixth hairworm species and the third species of that genus found in Canada. Hosts are unknown for all other Canadian (and 1 Alaskan) Gordionus species.

  4. A simultaneous journal / wiki publication and dissemination of a new species description: Neobidessodes darwiniensis sp. n. from northern Australia (Coleoptera, Dytiscidae, Bidessini

    Directory of Open Access Journals (Sweden)

    Lars Hendrich

    2011-02-01

    Full Text Available Here, we describe a new Australian species in journal format and simultaneously open the description in a wiki format on the www.species-id.net. The wiki format will always link to the fixed original journal description of the taxon, however it permits future edits and additions to species'  taxonomy and biology. The diving beetle Neobidessodes darwiniensis sp. n. (Coleoptera, Dytiscidae, Bidessini is described based on a single female, collected in a rest pool of the Harriet Creek in the Darwin Area, Northern Territory. Within Neobidessodes the new species is well characterized by its elongate oval body with rounded sides, short and stout segments of antennae, length of body and dorsal surface coloration. In addition to external morphology, we used mitochondrial cox1 sequence data to support generic assignment and to delineate the new species from other Australian Bidessini including all other known Neobidessodes. Illustrations based on digital images are provided here and as online resources. A modified key is provided. Altogether ten species of the genus are now known worldwide, nine from Australia and one from New Guinea.

  5. Effect of Larval Density on Food Utilization Efficiency of Tenebrio molitor (Coleoptera: Tenebrionidae).

    Science.gov (United States)

    Morales-Ramos, Juan A; Rojas, M Guadalupe

    2015-10-01

    Crowding conditions of larvae may have a significant impact on commercial production efficiency of some insects, such as Tenebrio molitor L. (Coleoptera: Tenebrionidae). Although larval densities are known to affect developmental time and growth in T. molitor, no reports were found on the effects of crowding on food utilization. The effect of larval density on food utilization efficiency of T. molitor larvae was studied by measuring efficiency of ingested food conversion (ECI), efficiency of digested food conversion (EDC), and mg of larval weight gain per gram of food consumed (LWGpFC) at increasing larval densities (12, 24, 36, 48, 50, 62, 74, and 96 larvae per dm(2)) over four consecutive 3-wk periods. Individual larval weight gain and food consumption were negatively impacted by larval density. Similarly, ECI, ECD, and LWGpFC were negatively impacted by larval density. Larval ageing, measured as four consecutive 3-wk periods, significantly and independently impacted ECI, ECD, and LWGpFC in a negative way. General linear model analysis showed that age had a higher impact than density on food utilization parameters of T. molitor larvae. Larval growth was determined to be responsible for the age effects, as measurements of larval mass density (in grams of larvae per dm(2)) had a significant impact on food utilization parameters across ages and density treatments (in number of larvae per dm(2)). The importance of mass versus numbers per unit of area as measurements of larval density and the implications of negative effects of density on food utilization for insect biomass production are discussed. Published by Oxford University Press on behalf of Entomological Society of America 2015. This work is written by US Government employees and is in the public domain in the US.

  6. Variability in Small Hive Beetle (Coleoptera: Nitidulidae) Reproduction in Laboratory and Field Experiments.

    Science.gov (United States)

    Meikle, William G; Holst, Niels; Cook, Steven C; Patt, Joseph M

    2015-06-01

    Experiments were conducted to examine how several key factors affect population growth of the small hive beetle, Aethina tumida Murray (Coleoptera: Nitidulidae). Laboratory experiments were conducted to examine effects of food quantity and temperature on reproduction of cohorts of young A. tumida adults (1:1 sex ratio) housed in experimental arenas. Daily numbers and total mass of larvae exiting arenas were highly variable within treatment. Either one or two cohorts of larvae were observed exiting the arenas. Food quantity, either 10 g or 20 g, did not significantly affect the number of larvae exiting arenas at 32°C, but did at 28°C; arenas provided 20 g food produced significantly more larvae than arenas provided 10 g. Temperature did not affect the total mass of larvae provided 10 g food, but did affect larval mass provided 20 g; beetles kept at 28°C produced more larval mass than at 32°C. Field experiments were conducted to examine A. tumida reproductive success in full strength bee colonies. Beetles were introduced into hives as egg-infested frames and as adults, and some bee colonies were artificially weakened through removal of sealed brood. Efforts were unsuccessful; no larvae were observed exiting from, or during the inspection of, any hives. Possible reasons for these results are discussed. The variability observed in A. tumida reproduction even in controlled laboratory conditions and the difficulty in causing beetle infestations in field experiments involving full colonies suggest that accurately forecasting the A. tumida severity in such colonies will be difficult. Published by Oxford University Press on behalf of Entomological Society of America 2015. This work is written by US Government employees and is in the public domain in the US.

  7. Dung beetles (Coleoptera: Scarabaeoidea in three landscapes in Mato Grosso do Sul, Brazil

    Directory of Open Access Journals (Sweden)

    MM. Rodrigues

    Full Text Available Dung beetles (Coleoptera: Scarabaeoidea in three landscapes in Mato Grosso do Sul, Brazil. Dung Beetles are important for biological control of intestinal worms and dipterans of economic importance to cattle, because they feed and breed in dung, killing parasites inside it. They are also very useful as bioindicators of species diversity in agricultural or natural environments. The aims of this paper were to study the species richness, and abundance of dung beetles, helping to answer the question: are there differences in the patterns of dung beetle diversity in three environments (pasture, agriculture and forest in the municipality of Dourados, in the state of Mato Grosso do Sul. A total of 105 samplings were carried out weekly, from November 2005 to November 2007, using three pitfall traps in each environment. The traps were baited with fresh bovine dung, and 44,355 adult dung beetles from 54 species were captured: two from Hyborosidae and 52 from Scarabaeidae. Five species were constant, very abundant and dominant on the pasture, two in the agricultural environment, and two in the environment of Semideciduous forest. Most of the species were characterised as accessories, common and not-dominant. The species with higher abundance was Ataenius platensis Blanchard, 1844. The indexes of Shannon-Wiener diversity were: 2.90 in the pasture, 2.84 in the agricultural environment and 2.66 in the area of native forest. The medium positive presence of dung beetles in the traps in each environment were: 36.88, 42.73 and 20.18 individuals per trap, in the pasture, agricultural environment and in the native forest, respectively. The pasture environment presented a higher diversity index. The species diversity of dung beetles was superior where there was higher abundance and regularity of resource (bovine dung.

  8. Attraction of Callosobruchus maculatus (F.) (Coleoptera: Bruchidae) to four varieties of Lathyrus sativus L. seed volatiles.

    Science.gov (United States)

    Adhikary, P; Mukherjee, A; Barik, A

    2015-04-01

    Callosobruchus maculatus (F.) (Coleoptera: Bruchidae) is an important stored grain pest of Lathyrus sativus L. (Leguminosae), commonly known as khesari, in India, Bangladesh and Ethiopia. Volatiles were collected from four varieties, i.e., Bio L 212 Ratan, Nirmal B-1, WBK-14-7 and WBK-13-1 of uninfested khesari seeds, and subsequently identified and quantified by gas chromatography mass spectrometry and gas chromatography flame ionization detector analyses, respectively. A total of 23 volatiles were identified in the four varieties of khesari seeds. In Bio L 212 Ratan and WBK-13-1 seeds, nonanal was the most abundant followed by farnesyl acetone; whereas farnesyl acetone was predominant followed by nonanal in Nirmal B-1 and WBK-14-7 khesari seeds. The olfactory responses of female C. maculatus toward volatile blends from four varieties of khesari seeds, and individual synthetic compounds and their combinations were examined through Y-shaped glass tube olfactometer bioassays. Callosobruchus maculatus showed significant preference for the whole volatile blends from Bio L 212 Ratan seeds compared to whole volatile blends from other three varieties. The insect exhibited attraction to five individual synthetic compounds, 3-octanone, 3-octanol, linalool oxide, 1-octanol and nonanal. A synthetic blend of 448, 390, 1182, 659 and 8114 ng/20 μl methylene chloride of 3-octanone, 3-octanol, linalool oxide, 1-octanol and nonanal, respectively, was most attractive to C. maculatus, and this combination might be used for insect pest management program such as baited traps.

  9. Effects of carbaryl-bran bait on trap catch and seed predation by ground beetles (Coleoptera: Carabidae).

    Science.gov (United States)

    Fielding, Dennis J; DeFoliart, Linda S; Hagerty, Aaron M

    2013-04-01

    Carbaryl-bran bait is effective against grasshoppers without many impacts on nontarget organisms, but ground beetles (Coleoptera: Carabidae) may be susceptible to these baits. Carabids are beneficial in agricultural settings as predators of insect pests and weed seeds. Carabid species and their consumption of weed seeds have not been previously studied in agricultural settings in Alaska. This study examined the effect of grasshopper bran bait on carabid activity-density, as measured by pitfall trap catches, and subsequent predation by invertebrates of seeds of three species of weed. Data were collected in fallow fields in agricultural landscape in the interior of Alaska, near Delta Junction, in 2008 and 2010. Bait applications reduced ground beetle activity-density by over half in each of 2 yr of bait applications. Seed predation was generally low overall (1-10%/wk) and not strongly affected by the bait application, but predation of lambsquarters (Chenopodium album L.) seed was lower on treated plots in 1 yr (340 seeds recovered versus 317 seeds, on treated versus untreated plots, respectively). Predation of dandelion (Taraxacum officinale G. H. Weber ex Wiggers) seeds was correlated with ground beetle activity-density in 1 yr, and predation of dragonhead mint (Dracocephalum parvifolium Nutt.) seed in the other year. We conclude that applications of carbaryl-bran bait for control of grasshoppers will have only a small, temporary effect on weed seed populations in high-latitude agricultural ecosystems.

  10. Lufenuron impact upon Anthonomus grandis Boheman (Coleoptera: Curculionidae) midgut and its reflection in gametogenesis.

    Science.gov (United States)

    Costa, Hilton Nobre; da Cunha, Franklin Magliano; Cruz, Glaucilane Santos; D'assunção, Carolline Guimarães; Rolim, Guilherme Gomes; Barros, Maria Edna Gomes; Breda, Mariana Oliveira; Teixeira, Alvaro Aguiar Coelho; Teixeira, Valéria Wanderley

    2017-04-01

    The insecticide Match® (lufenuron), one of the main insect growth regulators used in pest control, has been presented as a viable alternative against the boll weevil, Anthonomus grandis (Coleoptera: Curculionidae), by inhibiting chitin synthesis. Thus, this study aimed to examine whether Match® interferes in the synthesis of the peritrophic matrix, leading to changes in the midgut epithelium, resulting in nutritional deficiency and reflecting, thereby, in the gametogenesis process of A. grandis. Floral cotton buds were immersed in the insecticide solution (800μL of Match®+200mL of distilled water) and offered to the adult insects. The midguts of the insects were evaluated after 24 and 120h after feeding. The gonads were evaluated after 120h. The results showed that Match®, in both evaluation periods, induced histopathological alterations such as disorganization, vacuolization and desquamation of the midgut epithelium; histochemical modifications in the distribution patterns of carbohydrates, although without quantitative changes; and a strong decrease in protein levels. No apoptosis were observed, however, there was an increase in the number of regenerative cell nests. In the testicles, a reduction in the amount of spermatozoids and reduced carbohydrate levels were observed, but no difference in protein levels. The ovarioles presented structural disorganization of follicular cells, yolk reduction and decrease in protein levels, however, no change in carbohydrates levels was noted. Therefore, it is concluded that Match® performs histopathologic and histochemical alterations in the midgut epithelium and the gonads of A. grandis adults, reflecting in the gametogenesis process, presenting itself as a promising tool in the management of this pest on cotton crops. Copyright © 2016 Elsevier Inc. All rights reserved.

  11. Relationships of abscised cotton fruit to boll weevil (Coleoptera: Curculionidae) feeding, oviposition, and development.

    Science.gov (United States)

    Showler, Allan T

    2008-02-01

    Abscised cotton, Gossypium hirsutum L., fruit in field plots planted at different times were examined to assess adult boll weevil, Anthonomus grandis grandis Boheman (Coleoptera: Curculionidae), use of squares and bolls during 2002 and 2003 in the Lower Rio Grande Valley of Texas. Although boll abscission is not necessarily related to infestation, generally more bolls abscised than squares and abundances of fallen bolls were not related to the planting date treatments. During 2003, fallen squares were most abundant in the late-planted treatment. Although large squares (5.5-8-mm-diameter) on the plant are preferred for boll weevil oviposition, diameter of abscised squares is not a reliable measurement because of shrinkage resulting from desiccation and larval feeding. Fallen feeding-punctured squares and bolls were most abundant in late plantings but differences between fallen feeding-punctured squares versus fallen feeding-punctured bolls were found in only one treatment in 2003. During the same year, fallen oviposition-punctured squares were more numerous in the late-planted treatment than in the earlier treatments. Treatment effects were not found on numbers of oviposition-punctured bolls, but fallen oviposition-punctured squares were more common than bolls in the late-planted treatment compared with earlier treatments each year. Dead weevil eggs, larvae, and pupae inside fallen fruit were few and planting date treatment effects were not detected. Living third instars and pupae were more abundant in fallen squares of the late-planted treatment than in the earlier treatments and bolls of all three treatments. This study shows that fallen squares in late-planted cotton contribute more to adult boll weevil populations than bolls, or squares of earlier plantings.

  12. Molecular diagnostic for boll weevil (Coleoptera: Curculionidae) based on amplification of three species-specific microsatellites.

    Science.gov (United States)

    Kim, Kyung Seok; Szendrei, Zsofia; Rodriguez-Saona, Cesar; Mulder, Phillip G; Sappington, Thomas W

    2009-04-01

    The boll weevil, Anthonomus grandis grandis Boheman (Coleoptera: Curculionidae), is a serious pest of cultivated cotton, Gossypium hirsutum L., in the Americas, and reinfestation of zones from which they have been eradicated is of perpetual concern. Extensive arrays of pheromone traps monitor for reintroductions, but occasionally the traps collect nontarget weevils that can be misidentified by scouts. For example, the congeneric pepper weevil, Anthonomus eugenii Cano, and other superficially similar weevils are attracted to components of the boll weevil lure or trap color. Although morphologically distinguishable by trained personnel, the potential for misidentification is compounded when captured weevils are dismembered or partially consumed by ants or ground beetles that sometimes feed on them in the traps. Because misidentification can have expensive consequences, a molecular diagnostic tool would be of great value to eradication managers. We demonstrate that a cocktail of three primer pairs in a single polymerase chain reaction (PCR) amplify species-specific microsatellites that unambiguously distinguish the boll weevil from three other weevil species tested, including pepper weevil; cranberry weevil, Anthonomus eugenii musculus Say; and pecan weevil, Curculio caryae Horn. However, it does not distinguish the boll weevil from the subspecific "thurberia" weevil. A universal internal transcribed spacer primer pair included in the cocktail cross-amplifies DNA from all species, serving as a positive control. Furthermore, the diagnostic primers amplified the target microsatellites from various boll weevil adult body parts, indicating that the PCR technology using the primer cocktail is sensitive enough to positively identify a boll weevil even when the body is partly degraded.

  13. Sulfuryl fluoride as a quarantine treatment for Chlorophorus annularis (Coleoptera: Cerambycidae) in Chinese bamboo poles.

    Science.gov (United States)

    Yu, Daojian; Barak, Alan V; Jiao, Yi; Chen, Zhinan; Zhang, Guiming; Chen, Zhilin; Kang, Lin; Yang, Weidong

    2010-04-01

    Bamboo (genera Bambusa and Phyllstachys) is one of the fastest growing and economically important plants in the world, and it is cultivated widely throughout southern China. China annually exports to the United States significant quantities of bamboo garden stakes (Bambusa spp.). In recent years, Plant Protection and Quarantine officers of the U.S. Department of Agriculture-Animal and Plant Health Inspection Service have made numerous interceptions of the bamboo borer, Chlorophorus annularis Fairmaire (Coleoptera: Cerambycidae), in bamboo products from China. This species is considered to have high pest risk potential in the trade of bamboo products. As a fumigant, sulfuryl fluoride (SF) would be a practical alternative to methyl bromide (MeBr) fumigation. Here, we report the results of SF fumigation tests for C. annularis in bamboo poles at three doses--96 g/m3 at 15.9 degrees C, 80 g/m3 at 21.5 degrees C, and 64 g/m3 at 26.0 degrees C--in glass test chambers. Commercial standard fumigations were also conducted in a standard 6.1-m-long, 33.2-m3 (standard height, 20-feet) marine general cargo container loaded to 80% (vol:vol) with similar bamboo poles, and sufficient levels of SF were obtained during the 24-h fumigations. During the course of these tests, 2424 larvae, 90 pupae, and 23 adults in total were killed, with no survivors. A treatment schedule using SF is proposed for bamboo as an alternative to MeBr at several temperatures tested.

  14. Resinosis Inhibits Monochamus spp. (Coleoptera: Cerambycidae) Colonization of Healthy Shortleaf Pines in Southeastern United States.

    Science.gov (United States)

    Ethington, Matthew W; Galligan, Larry D; Stephen, Fred M

    2018-05-14

    The genus Monochamus Dejean (Coleoptera: Cerambycidae) includes large, woodboring, longhorned beetles, which colonize pine trees in North America. Many authors have classified the genus as saprophagous, but one recent study reported successful colonization of standing jack pine trees (Pinus banksiana Lamb.) (Pinales: Pinaceae) following severe wind disturbance in Minnesota. We tested whether two Monochamus species native to the southeastern United States (M. titillator (Fabricius) and M. carolinensis (Olivier)) could successfully colonize healthy shortleaf pines (Pinus echinata Mill.) (Pinales: Pinaceae) in recently harvested stands without coincident abiotic or biotic stressors, such as lightning strikes or bark beetle attacks. We attached commercially available semiochemical lures, including monochamol, ethanol, and ipsenol, to healthy shortleaf pine trees and observed Monochamus spp. oviposition response. Egg development was monitored following oviposition by harvesting attacked trees and dissecting oviposition pits. High numbers of oviposition pits were observed on trees treated with lures containing the bark beetle pheromone ipsenol and pits were highly concentrated on the tree bole near lures. Although egg deposition occurred, pit dissection revealed large amounts of resin present in almost all dissected pits and that egg hatch and subsequent larval development were rare. Our results demonstrate that southeastern Monochamus spp. are unlikely to be primary pests of healthy shortleaf pines due to resinosis. To better understand the host finding behavior of these two Monochamus species, we also conducted trapping trials with several semiochemical combinations. Both species and sexes demonstrated similar attraction to compounds, and the most attractive lure combined host volatiles, pheromone, and sympatric insect kairomone.

  15. Recent occurrence of Aphanogmus dictynna (Waterston) (Hymenoptera: Ceraphronidae) in Kenya – an important hyperparasitoid of the coffee berry borer Hypothenemus hampei (Ferrari) (Coleoptera: Scolytidae)

    Science.gov (United States)

    Aphanogmus dictynna (Waterston) was recently recorded in error as an undescribed species of Aphanogmus. This species is a primary parasitoid on larvae and cocoons of the bethylid Prorops nasuta Waterston, and probably a second bethylid species, Cephalonomia stephanoderis Betrem. Both bethylids are...

  16. Verbenone interrupts attraction to host volatiles and reduces attack on Pinus tabuliformis (Pinaceae) by Dendroctonus valens (Coleoptera: Scolytidae) in the People's Republic of China

    Science.gov (United States)

    Jianghua Sun; Nancy Gillette; Zhengwan Miao; Zhongning Zhang Le Kang; Donald R. Owen; John D Stein

    2003-01-01

    The introduced red turpentine beetle, Dendroctonus valens LeConte, is one of the most economically important forest pests in the People's Republic of China, having killed more than 6 million pines in recent years. There is an urgent need to develop effective behavioral chemicals to monitor and control D. valens in the People...

  17. Giselia arizonica, a new genus and species of mite (Acaria: Tarsonemidae) associated with bark beetles of the genus Pseudopityophthorus (Coleoptera: Scolytidae) in North America

    Science.gov (United States)

    Wojciech L. Magowski; Evert E. Lindquist; John C. Moser

    2005-01-01

    A new genus and species of the mite family Tarsonemidae, subfamily Tarsoneminae, is described and illustrated. Its systematic position among genera of Tarsoneminae and its host association with bark beetles of the genus Pseudopityophthorus Swaine, 1918 in North America are briefly discussed.

  18. Field response of predatorRhizophagus grandis to prey frass and synthetic attractants.

    Science.gov (United States)

    Wainhouse, D; Beech-Garwood, P A; Howell, R S; Kelly, D; Orozco, M P

    1992-10-01

    A lure based on the proportional composition of monoterpenes inD. micans larval frass and deployed in Theysohn slot traps was highly attractive toR. grandis released in the field. The relative response to frass and lure was consistent over a range of doses, and behavior close to traps baited with either lure or frass appeared to be similar. The monoterpenes, formulated with antioxidant, appear to be stable over several weeks when released from proprietary reservoir and wick "air fresheners." The lure may be of value in monitoring predator populations.

  19. The secondary structure of large-subunit rRNA divergent domains, a marker for protist evolution

    DEFF Research Database (Denmark)

    Lenaers, G; Nielsen, Henrik; Engberg, J

    1988-01-01

    The secondary structure of the large-subunit ribosomal RNA (24-26S rRNA) has been studied with emphasis on comparative analysis of the folding patterns of the divergent domains in the available protist sequences, that is Prorocentrum micans (dinoflagellate), Saccharomyces carlsbergensis (yeast......), Tetrahymena thermophila (ciliate), Physarum polycephalum and Dictyostelium discoideum (slime moulds), Crithidia fasciculata and Giardia lamblia (parasitic flagellates). The folding for the D3, D7a and D10 divergent domains has been refined and a consensus model for the protist 24-26S rRNA structure...

  20. Efficacy of multifunnel traps for capturing emerald ash borer (Coleoptera: Buprestidae): effect of color, glue, and other trap coatings.

    Science.gov (United States)

    Francese, Joseph A; Fraser, Ivich; Lance, David R; Mastro, Victor C

    2011-06-01

    Tens of thousands of adhesive-coated purple prism traps are deployed annually in the United States to survey for the invasive emerald ash borer, Agrilus planipennis Fairmaire (Coleoptera: Buprestidae). A reusable, more user-friendly trap is desired by program managers, surveyors, and researchers. Field assays were conducted in southeastern Michigan to ascertain the feasibility of using nonsticky traps as survey and detection tools for emerald ash borer. Three nonsticky trap designs, including multifunnel (Lindgren), modified intercept panel, and drainpipe (all painted purple) were compared with the standard purple prism trap; no statistical differences in capture of emerald ash borer adults were detected between the multifunnel design and the prism. In subsequent color comparison assays, both green- and purple-painted multifunnel traps (and later, plastic versions of these colors) performed as well or better than the prism traps. Multifunnel traps coated with spray-on adhesive caught more beetles than untreated traps. The increased catch, however, occurred in the traps' collection cups and not on the trap surface. In a separate assay, there was no significant difference detected between glue-coated traps and Rain-X (normally a glass treatment)-coated traps, but both caught significantly more A. planipennis adults than untreated traps.

  1. Necrophagous species of Diptera and Coleoptera in northeastern Brazil: state of the art and challenges for the Forensic Entomologist

    Directory of Open Access Journals (Sweden)

    Simão D. Vasconcelos

    2012-03-01

    Full Text Available Inventories on necrophagous insects carried out in Brazil encompass mostly species from the southeastern and central-western regions of the country. This review aims to produce the first checklist of necrophagous Diptera and Coleoptera species of forensic relevance in northeastern Brazil, an area that concentrates high rates of homicides. We performed a literature survey on scientific articles, theses and dissertations regarding necrophagous insect species in the region, and contacted scientists who develop research on forensic entomology. Fifty-two species of Diptera belonging to eight families with previous record of necrophagy were reported in the region: Sarcophagidae, Calliphoridae, Muscidae, Fanniidae, Piophilidae, Phoridae, Anthomyiidae and Stratiomyidae. Coleopteran species from six families of forensic relevance were registered, although taxonomical identification remained superficial. Bait traps were the most frequent methodology used, followed by collection on animal carcasses. Seven Dipteran species from two families were registered on human cadavers. All species had been previously reported in other Brazilian states and/or other countries, although none has been effectively used in legal procedures in the region. The status of research on forensic entomology in northeastern Brazil is incipient, and the checklist produced here contributes to the knowledge on the local diversity of necrophagous insects.

  2. Notas e descrições em Hesperophanini, Eburiini, Piezocerini e Trachyderini (Coleoptera, Cerambycidae, Cerambycinae do Brasil e da Bolívia

    Directory of Open Access Journals (Sweden)

    Ubirajara R. Martins

    2010-01-01

    Full Text Available Novos táxons descritos - Hesperophanini: Paraliostola nigramacula sp. nov., do Brasil (Rondônia; Eburiini: Simplexeburia gen. nov., e sua espécie-tipo, S. divisa sp. nov. do Brasil (Amazonas; Piezocerini: Gorybia amazonensis sp. nov. and G. sulcata sp. nov., ambas do Brasil (Amazonas; Trachyderini: Galissus rubiventris sp. nov., da Bolívia (Santa Cruz. Notas e novos registros são apresentados para Liostola nitida Zajciw, 1962 e Ochrus chapadense Napp & Martins, 1982 (Hesperophanini; Uncieburia rogersi (Bates, 1870 e Quiacaua taguaiba Martins, 1970 (Eburiini.Notes and descriptions on Hesperophanini, Eburiini, Piezocerini and Trachyderini (Coleoptera, Cerambycidae, Cerambycinae from Brazil and Bolivia. New taxa described - Hesperophanini: Paraliostola nigramacula sp. nov. from Brazil (Rondônia; Eburiini: Simplexeburia gen. nov., and its type species, S. divisa sp. nov. from Brazil (Amazonas; Piezocerini: Gorybia amazonensis sp. nov. and G. sulcata sp. nov. both from Brazil (Amazonas; Trachyderini: Galissus rubiventris sp. nov. from Bolivia (Santa Cruz de la Sierra. Notes and records are presented for Liostola nitida Zajciw, 1962 and Ochrus chapadense Napp & Martins, 1982 (Hesperophanini; Uncieburia rogersi (Bates, 1870 and Quiacaua taguaiba Martins, 1997 (Eburiini.

  3. The night and day of dung beetles (Coleoptera, Scarabaeidae in the Serra do Japi, Brazil: elytra colour related to daily activity

    Directory of Open Access Journals (Sweden)

    Malva Isabel Medina Hernández

    2002-01-01

    Full Text Available In the present study 387 dung beetles (Coleoptera: Scarabaeidae were surveyed at the Serra do Japi, in the Atlantic Forest in São Paulo State, with four baited pitfall traps during the months of December, 1998, and January, 1999 during eight 24 hour cycles. A total of 30 species were identified and temporal variation in activity patterns among the species shows a specialization in the use of food resources: 9 species were classified as nocturnal and 13 as diurnal. The daily activity pattern of dung beetles does not necessarily correspond to the taxonomic classification, but is strongly related to the colouring of species, determined by predominant elytra colour: nocturnal species have 89 % more chances of being black as opposed to colourful. Black nocturnal species might have evolved as an interspecific adaptation to avoid predation (cryptic colouring. Among the colourful diurnal dung beetles, measure of body length of each species shows that development of bright colouring was more often found in medium to large species, which suggests that colouring evolved as a response to intraspecific pressures, important in agonistic encounters among males.

  4. Synergism between demethylation inhibitor fungicides or gibberellin inhibitor plant growth regulators and bifenthrin in a pyrethroid-resistant population of Listronotus maculicollis (Coleoptera: Curculionidae).

    Science.gov (United States)

    Ramoutar, D; Cowles, R S; Requintina, E; Alm, S R

    2010-10-01

    In 2007-2008, the "annual bluegrass weevil," Listronotus maculicollis Kirby (Coleoptera: Curculionidae), a serious pest of Poa annua L. (Poales: Poaceae) on U.S. golf courses, was shown to be resistant to two pyrethroids, bifenthrin and lambda-cyhalothrin. In 2008, we showed that bifenthrin resistance was principally mediated by oxidase detoxification (cytochrome P450 [P450]). P450s can be inhibited by demethylation inhibitor fungicides and gibberellin inhibitor plant growth regulators, both of which are commonly used on golf courses. We tested these compounds for synergistic activity with bifenthin against a pyrethroid-resistant population of L. maculicollis. The LD50 value for bifenthrin was significantly reduced from 87 ng per insect (without synergists) to 9.6-40 ng per insect after exposure to the fungicides fenarimol, fenpropimorph, prochloraz, propiconazole, and pyrifenox and the plant growth regulators flurprimidol, paclobutrazol, and trinexapac-ethyl. Simulated field exposure with formulated products registered for use on turf revealed enhanced mortality when adult weevils were exposed to bifenthrin (25% mortality, presented alone) combined with field dosages of propiconizole, fenarimol, flurprimidol, or trinexapac-ethyl (range, 49-70% mortality).

  5. Isolation and Characterization of Yeasts Able to Assimilate Sugarcane Bagasse Hemicellulosic Hydrolysate and Produce Xylitol Associated with Veturius transversus (Passalidae, Coleoptera, and Insecta

    Directory of Open Access Journals (Sweden)

    Italo Thiago Silveira Rocha Matos

    2017-01-01

    Full Text Available Yeasts are an important component of insect gut microbial content, playing roles such as degradation of polymers and toxic compounds, biological control, and hormone, vitamin, and digestive enzyme production. The xylophagous beetle gut is a hyperdiverse habitat and a potential source of new species with industrial abilities such as enzyme production, pentose fermentation, and biodetoxification. In this work, samples of Veturius transversus (Passalidae, Coleoptera, and Insecta were collected from the Central Amazon Rainforest. Their guts were dissected and a total of 20 microbial colonies were isolated using sugarcane bagasse hemicellulosic hydrolysate. They were identified as having 10 distinct biochemical profiles, and genetic analysis allowed identification as three clades in the genera Candida, Williopsis, and Geotrichum. All colonies were able to assimilate D-xylose and 18 were able to produce xylitol, especially a strain of Geotrichum, with a maximum yield of 0.502 g·g−1. These results agree with a previous prediction that the microbial community associated with xylophagous insects is a promising source of species of biotechnological interest.

  6. Phenological changes of the most commonly sampled ground beetle (Coleoptera: Carabidae) species in the UK environmental change network

    Science.gov (United States)

    Pozsgai, Gabor; Baird, John; Littlewood, Nick A.; Pakeman, Robin J.; Young, Mark R.

    2018-03-01

    Despite the important roles ground beetles (Coleoptera: Carabidae) play in ecosystems, the highly valued ecosystem services they provide, and ample descriptive documentation of their phenology, the relative impact of various environmental factors on carabid phenology is not well studied. Using the long-term pitfall trap capture data from 12 terrestrial Environmental Change Network (ECN) sites from the UK, we examined how changing climate influenced the phenology of common carabids, and the role particular climate components had on phenological parameters. Of the 28 species included in the analyses, 19 showed earlier start of their activity. This advance was particularly pronounced in the spring, supporting the view that early phenophases have a greater tendency to change and these changes are more directly controlled by temperature than later ones. Autumn activity extended only a few cases, suggesting a photoperiod-driven start of hibernation. No association was found between life-history traits and the ability of species to change their phenology. Air temperatures between April and June were the most important factors determining the start of activity of each species, whilst late season precipitation hastened the cessation of activity. The balance between the advantages and disadvantages of changing phenology on various levels is likely to depend on the species and even on local environmental criteria. The substantially changing phenology of Carabidae may influence their function in ecosystems and the ecosystem services they provide.

  7. Economic injury level for the coffee berry borer (Coleoptera: Curculionidae: Scolytinae) using attractive traps in Brazilian coffee fields.

    Science.gov (United States)

    Fernandes, F L; Picanço, M C; Campos, S O; Bastos, C S; Chediak, M; Guedes, R N C; Silva, R S

    2011-12-01

    The currently existing sample procedures available for decision-making regarding the control of the coffee berry borer Hypothenemus hampei (Ferrari) (Coleoptera: Curculionidae: Scolytinae) are time-consuming, expensive, and difficult to perform, compromising their adoption. In addition, the damage functions incorporated in such decision levels only consider the quantitative losses, while dismissing the qualitative losses. Traps containing ethanol, methanol, and benzaldehyde may allow cheap and easy decision-making. Our objective was to determine the economic injury level (EIL) for the adults of the coffee berry borer by using attractant-baited traps. We considered both qualitative and quantitative losses caused by the coffee borer in estimating the EILs. These EILs were determined for conventional and organic coffee under high and average plant yield. When the quantitative losses caused by H. hampei were considered alone, the EILs ranged from 7.9 to 23.7% of bored berries for high and average-yield conventional crops, respectively. For high and average-yield organic coffee the ELs varied from 24.4 to 47.6% of bored berries, respectively. When qualitative and quantitative losses caused by the pest were considered together, the EIL was 4.3% of bored berries for both conventional and organic coffee. The EILs for H. hampei associated to the coffee plants in the flowering, pinhead fruit, and ripening fruit stages were 426, 85, and 28 adults per attractive trap, respectively.

  8. Physiological time model for predicting adult emergence of western corn rootworm (Coleoptera: Chrysomelidae) in the Texas High Plains.

    Science.gov (United States)

    Stevenson, Douglass E; Michels, Gerald J; Bible, John B; Jackman, John A; Harris, Marvin K

    2008-10-01

    Field observations at three locations in the Texas High Plains were used to develop and validate a degree-day phenology model to predict the onset and proportional emergence of adult Diabrotica virgifera virgifera LeConte (Coleoptera: Chrysomelidae) adults. Climatic data from the Texas High Plains Potential Evapotranspiration network were used with records of cumulative proportional adult emergence to determine the functional lower developmental temperature, optimum starting date, and the sum of degree-days for phenological events from onset to 99% adult emergence. The model base temperature, 10 degrees C (50 degrees F), corresponds closely to known physiological lower limits for development. The model uses a modified Gompertz equation, y = 96.5 x exp (-(exp(6.0 - 0.00404 x (x - 4.0), where x is cumulative heat (degree-days), to predict y, cumulative proportional emergence expressed as a percentage. The model starts degree-day accumulation on the date of corn, Zea mays L., emergence, and predictions correspond closely to corn phenological stages from tasseling to black layer development. Validation shows the model predicts cumulative proportional adult emergence within a satisfactory interval of 4.5 d. The model is flexible enough to accommodate early planting, late emergence, and the effects of drought and heat stress. The model provides corn producers ample lead time to anticipate and implement adult control practices.

  9. Host Range Specificity of Scymnus camptodromus (Coleoptera: Coccinellidae), A Predator of Hemlock Woolly Adelgid (Hemiptera: Adelgidae).

    Science.gov (United States)

    Limbu, Samita; Cassidy, Katie; Keena, Melody; Tobin, Patrick; Hoover, Kelli

    2016-02-01

    Scymnus (Neopullus) camptodromus Yu and Liu (Coleoptera: Coccinellidae) was brought to the United States from China as a potential biological control agent for hemlock woolly adelgid (Adelges tsugae Annand) (Hemiptera: Adelgidae). Scymnus camptodromus phenology is closely synchronized with that of A. tsugae and has several characteristics of a promising biological control agent. As a prerequisite to field release, S. camptodromus was evaluated for potential nontarget impacts. In host range studies, the predator was given the choice of sympatric adelgid and nonadelgid prey items. Nontarget testing showed that S. camptodromus will feed to some degree on other adelgid species, but highly prefers A. tsugae. We also evaluated larval development of S. camptodromus on pine bark adelgid (Pineus strobi (Hartig)) (Hemiptera: Adelgidae) and larch adelgid (Adelges laricis Vallot) (Hemiptera: Adelgidae); a small proportion of predator larvae was able to develop to adulthood on P. strobi or A. laricis alone. Scymnus camptodromus showed no interest in feeding on woolly alder aphid (Paraprociphilus tessellatus Fitch) (Hemiptera: Aphididae) or woolly apple aphid (Eriosoma lanigerum (Hausmann)) (Hemiptera: Aphididae), and minimal interest in cotton aphid (Aphis gossypii Glover) (Hemiptera: Aphididae) in choice and no-choice experiments. Scymnus camptodromus females did not oviposit on any host material other than A. tsugae-infested hemlock. Under the circumstances of the study, S. camptodromus appears to be a specific predator of A. tsugae, with minimal risk to nontarget species. Although the predator can develop on P. strobi, the likelihood that S. camptodromus would oviposit on pine hosts of this adelgid is small.

  10. Influence of trap color and host volatiles on capture of the emerald ash borer (Coleoptera: Buprestidae).

    Science.gov (United States)

    Crook, Damon J; Khrimian, Ashot; Cossé, Allard; Fraser, Ivich; Mastro, Victor C

    2012-04-01

    Field trapping assays were conducted in 2009 and 2010 throughout western Michigan, to evaluate lures for adult emerald ash borer, A. planipennis Fairmaire (Coleoptera: Buprestidae). Several ash tree volatiles were tested on purple prism traps in 2009, and a dark green prism trap in 2010. In 2009, six bark oil distillate lure treatments were tested against manuka oil lures (used in 2008 by USDA APHIS PPQ emerald ash borer cooperative program). Purple traps baited with 80/20 (manuka/phoebe oil) significantly increased beetle catch compared with traps baited with manuka oil alone. In 2010 we monitored emerald ash borer attraction to dark green traps baited with six lure combinations of 80/20 (manuka/phoebe), manuka oil, and (3Z)-hexenol. Traps baited with manuka oil and (3Z)-hexenol caught significantly more male and total count insects than traps baited with manuka oil alone. Traps baited with manuka oil and (3Z)-hexenol did not catch more beetles when compared with traps baited with (3Z)-hexenol alone. When compared with unbaited green traps our results show that (3Z)-hexenol improved male catch significantly in only one of three field experiments using dark green traps. Dark green traps caught a high number of A. planipennis when unbaited while (3Z)-hexenol was seen to have a minimal (nonsignificant) trap catch effect at several different release rates. We hypothesize that the previously reported kairomonal attractancy of (3Z)-hexenol (for males) on light green traps is not as obvious here because of improved male attractancy to the darker green trap.

  11. Seasonal and nocturnal activities of the rhinoceros borer (Coleoptera: Scarabaeidae) in the north Saharan oases ecosystems.

    Science.gov (United States)

    Ehsine, M'hammed; Belkadhi, Mohamed Sadok; Chaieb, Mohammed

    2014-01-01

    The rhinoceros borer Oryctes agamemnon Burmeister (Coleoptera: Scarabaeidae) is a date palm insect pest that causes damage to trunk and roots of palm trees in several countries, including Tunisia, the United Arab Emirates (UAE), Oman, and Saudi Arabia. The aim of this study was to monitor the seasonal and nocturnal activities of this beetle. Experiments were performed on a date palm of Rjim Maatoug during a 6-yr period (2004-2007, 2009-2010). Field survey using light traps shows that O. agamemnon is a univoltine, with a single population peak. Adults appear in the field around late May-early June and the population continued to build until maximum numbers are reached between the end of July and the beginning of August in the same year. No adults were found after first 10 d of November. This peak was characterized by female dominance in number. The monitoring of nocturnal activity showed that it starts its activities roughly 40 min after the sundown and continues until approximately 1 h before sunrise. The highest number of trapped beetles was remarked in the two first hours of flight activity, with a dominance of female in the first hour and a dominance of male in the second hour. We remarked that the sex ratio (female:male) of the cumulated number of trapped adults in the different years and nights of survey was in favor of females. © The Author 2014. Published by Oxford University Press on behalf of the Entomological Society of America.

  12. Control of Eucryptorrhynchus scrobiculatus (Coleoptera: Cuculionidae), a Major Pest of Ailanthus altissima (Sapindales: Simaroubaceae), Using a Modified Square Trap Net.

    Science.gov (United States)

    Yang, Kailang; Wen, Xiaojian; Ren, Yuan; Wen, Junbao

    2018-04-19

    Eucryptorrhynchus scrobiculatus (Motschulsky) (Coleoptera: Cuculionidae) is a borer that mainly attacks the tree of heaven, Ailanthus altissima (Mill.) Swingle (Sapindales: Simaroubaceae), and is one of the most damaging forestry pests in China. We developed a trap net for entangling and immobilizing soil-emerging weevils in order to reduce their impact. Recapture rates of weevils in the laboratory was significantly higher with nylon netting of 9, 10, or 11 mm mesh sizes than larger sizes, and these sizes were used to make trial nets for preventing weevil emergence from the soil around impacted trees in the field. Nets were 2 × 2 m with a reinforced border and Velcro-closable, radial slit which allowed the net to be arranged around the base of the tree while producing an unbroken barrier beneath the soil surface (i.e., a modified square trap net, MSTN). Recapture rates of weevils released in the soil did not differ among the MSTNs of 9, 10, or 11 mm mesh sizes. MSTN treatments significantly reduced emergence by naturally-occurring weevils from the soil surrounding trees and reduced numbers of weevils caught in population monitoring traps deployed in treated stands. The results demonstrated that MSTNs might be used to manage of E. scrobiculatus.

  13. Isolation of Fungi and Bacteria Associated with the Guts of Tropical Wood-Feeding Coleoptera and Determination of Their Lignocellulolytic Activities

    Directory of Open Access Journals (Sweden)

    Keilor Rojas-Jiménez

    2015-01-01

    Full Text Available The guts of beetle larvae constitute a complex system where relationships among fungi, bacteria, and the insect host occur. In this study, we collected larvae of five families of wood-feeding Coleoptera in tropical forests of Costa Rica, isolated fungi and bacteria from their intestinal tracts, and determined the presence of five different pathways for lignocellulolytic activity. The fungal isolates were assigned to three phyla, 16 orders, 24 families, and 40 genera; Trichoderma was the most abundant genus, detected in all insect families and at all sites. The bacterial isolates were assigned to five phyla, 13 orders, 22 families, and 35 genera; Bacillus, Serratia, and Pseudomonas were the dominant genera, present in all the Coleopteran families. Positive results for activities related to degradation of wood components were determined in 65% and 48% of the fungal and bacterial genera, respectively. Our results showed that both the fungal and bacterial populations were highly diverse in terms of number of species and their phylogenetic composition, although the structure of the microbial communities varied with insect host family and the surrounding environment. The recurrent identification of some lignocellulolytic-positive inhabitants suggests that particular microbial groups play important roles in providing nutritional needs for the Coleopteran host.

  14. Climatic, Edaphic Factors and Cropping History Help Predict Click Beetle (Coleoptera: Elateridae) (Agriotes spp.) Abundance.

    Science.gov (United States)

    Kozina, A; Lemic, D; Bazok, R; Mikac, K M; Mclean, C M; Ivezić, M; Igrc Barčić, J

    2015-01-01

    It is assumed that the abundance of Agriotes wireworms (Coleoptera: Elateridae) is affected by agro-ecological factors such as climatic and edaphic factors and the crop/previous crop grown at the sites investigated. The aim of this study, conducted in three different geographic counties in Croatia from 2007 to 2009, was to determine the factors that influence the abundance of adult click beetle of the species Agriotes brevis Cand., Agriotes lineatus (L.), Agriotes obscurus (L.), Agriotes sputator (L.), and Agriotes ustulatus Schall. The mean annual air temperature, total rainfall, percentage of coarse and fine sand, coarse and fine silt and clay, the soil pH, and humus were investigated as potential factors that may influence abundance. Adult click beetle emergence was monitored using sex pheromone traps (YATLORf and VARb3). Exploratory data analysis was preformed via regression tree models and regional differences in Agriotes species' abundance were predicted based on the agro-ecological factors measured. It was found that the best overall predictor of A. brevis abundance was the previous crop grown. Conversely, the best predictor of A. lineatus abundance was the current crop being grown and the percentage of humus. The best predictor of A. obscurus abundance was soil pH in KCl. The best predictor of A. sputator abundance was rainfall. Finally, the best predictors of A. ustulatus abundance were soil pH in KCl and humus. These results may be useful in regional pest control programs or for predicting future outbreaks of these species. © The Author 2015. Published by Oxford University Press on behalf of the Entomological Society of America.

  15. Ciclo biológico e predação de três espécies de coccinelídeos (Coleoptera, Coccinellidae sobre o pulgão-gigante-do-pinus Cinara atlantica (Wilson (Hemiptera, Aphididae Biological cycle and predation of three coccinellid species (Coleoptera, Coccinellidae on giant conifer aphid Cinara atlantica (Wilson (Hemiptera, Aphididae

    Directory of Open Access Journals (Sweden)

    Nádia Cristina de Oliveira

    2004-12-01

    Full Text Available Afídeos do gênero Cinara Curtis são importantes pragas de coníferas em vários países. No Brasil Cinara atlantica (Wilson, 1919 tem causado danos em plantações comerciais de Pinus spp. e o controle biológico com predadores pode ser uma opção melhor que o controle químico. Este trabalho teve por objetivo estudar a biologia e a capacidade de predação dos coccinelídeos Hippodamia convergens Guérin-Méneville, 1842, Cycloneda sanguinea (Linnaeus, 1763 e Eriopis connexa (German, 1824 (Coleoptera, Coccinellidae sobre ninfas de C. atlantica. O estudo foi conduzido sob condições controladas (temperatura: 23 ± 1ºC, UR: 70 ± 10% e fotofase: 14 h.. Foi verificado que ninfas de C. atlantica são adequadas como alimento para as três espécies de coccinelídeos, assegurando seu desenvolvimento e reprodução. H. convergens e C. sanguinea apresentaram maior longevidade e capacidade de reprodução e também maior capacidade de predação (3832 e 3633 ninfas de C. atlantica em comparação a 2735 ninfas consumidas por E. connexa durante o ciclo completo, respectivamente para as espécies. Estas espécies de predadores podem contribuir para a redução da população de Cinara no campo.The aphids of the genus Cinara Curtis are important pests of conifers in several countries. In Brazil, Cinara atlantica (Wilson, 1919 has damaged commercial plantations of Pinus spp. and biological control with predators can be a better option than chemical control. The objective of this work was to study biology and predation potential of coccinellids Hippodamia convergens Guérin-Méneville, 1842, Cycloneda sanguinea (Linnaeus, 1763 and Eriopis connexa (German, 1824 (Coleoptera, Coccinellidae on nymphs of C. atlantica. The study was carried out under controlled conditions (temperature: 23 ± 1ºC, RH: 70 ± 10% and fotophase: 14 h. It was verified that C. atlantica nymphs are adequate as food for the three coccinellid species, assuring their development and

  16. Importance of log size on host selection and reproductive success of Ips pini (Coleoptera: Scolytidae) in ponderosa pine slash of northern Arizona and western Montana

    Science.gov (United States)

    Brytten E. Steed; Michael R. Wagner

    2004-01-01

    Pine engraver, Ips pini (Say), often use thinning slash, and their populations are known to be influenced by the condition of this material. In our study, we evaluated the importance of three log diameters (5, 10, and 20 cm) and three lengths (60, 120, and 240 cm) on various parameters of bark beetle host attack, development, and emergence....

  17. Evaluation of the antiaggregation pheromone, 3-methylcyclohex-2-en-1-one (MCH), to protect live spruce from spruce beetle (Coleoptera: Scolytidae) infestation in sourthern Utah.

    Science.gov (United States)

    Darrell W. Ross; Gary E. Daterman; A. Steven Munson

    2004-01-01

    The spruce beetle, Dendroctonus rufipennis (Kirby), produces the antiaggregation pheromone 3-methylcyclohex-2-en- 1-one (MCH) (Rudinsky et al. 1974). MCH has reduced the numbers of spruce beetles attracted to infested logs and synthetic semiochemical lures or reduced colonization rates throughout the beetles range (Kline

  18. Inhibitory effects of copper on marine dinoflagellates

    Energy Technology Data Exchange (ETDEWEB)

    Saifullah, S.M.

    1978-01-01

    The effect of copper on three species of marine dinoflagellates (Scrippsiella faeroense (Paulsen) Balech et Soares, Prorocentrum micans Ehrenberg, Gymnodinium splendens Lebour) was studied. It inhibited the growth of all species and was lethal to one species in batch cultures. The effect was more pronounced in semicontinuous culture than in batch cultures. Chlorophyll concentrations and rate of uptake of radioactive carbon by cells of S. faeroense were affected in a manner similar to cell numbers. Copper inhibited growth of cells, most probably either by arresting cell division or by penetrating inside the cell and affecting metabolism.

  19. Plant compounds insecticide activity against Coleoptera pests of stored products Compostos de plantas com atividade inseticida a coleópteros-praga de produtos armazenados

    Directory of Open Access Journals (Sweden)

    Márcio Dionizio Moreira

    2007-07-01

    Full Text Available The objective of this work was to screen plants with insecticide activity, in order to isolate, identify and assess the bioactivity of insecticide compounds present in these plants, against Coleoptera pests of stored products: Oryzaephilus surinamensis L. (Silvanidae, Rhyzopertha dominica F. (Bostrichidae and Sitophilus zeamais Mots. (Curculionidae. The plant species used were: basil (Ocimum selloi Benth., rue (Ruta graveolens L., lion's ear (Leonotis nepetifolia (L. R.Br., jimson weed (Datura stramonium L., baleeira herb (Cordia verbenacea L., mint (Mentha piperita L., wild balsam apple (Mormodica charantia L., and billy goat weed or mentrasto (Ageratum conyzoides L.. The insecticide activity of hexane and ethanol extracts from those plants on R. dominica was evaluated. Among them, only hexane extract of A. conyzoides showed insecticide activity; the hexane extract of this species was successively fractionated by silica gel column chromatography, for isolation and purification of the active compounds. Compounds 5,6,7,8,3',4',5'-heptamethoxyflavone; 5,6,7,8,3'-pentamethoxy-4',5'-methilenedioxyflavone and coumarin were identified. However, only coumarin showed insecticide activity against three insect pests (LD50 from 2.72 to 39.71 mg g-1 a.i.. The increasing order of insects susceptibility to coumarin was R. dominica, S. zeamais and O. surinamensis.O objetivo deste trabalho foi selecionar plantas com atividade inseticida, para isolar, identificar e avaliar a bioatividade de compostos inseticidas presentes nessas plantas, contra as seguintes pragas de produtos armazenados da ordem Coleoptera: Sitophilus zeamais Mots. (Curculionidae, Rhyzopertha dominica F. (Bostrichidae e Oryzaephilus surinamensis L. (Silvanidae. As espécies de plantas usadas foram: anis (Ocimum selloi Benth, arruda (Ruta graveolens L., cordão-de-frade (Leonotis nepetifolia L., datura (Datura stramonium L., erva baleeira (Cordia verbenacea L., hortelã (Mentha piperita L., mel

  20. Consumption of Bt Maize Pollen Containing Cry1Ie Does Not Negatively Affect Propylea japonica (Thunberg (Coleoptera: Coccinellidae

    Directory of Open Access Journals (Sweden)

    Yonghui Li

    2017-03-01

    Full Text Available Propylea japonica (Thunberg (Coleoptera: Coccinellidae are prevalent predators and pollen feeders in East Asian maize fields. They are therefore indirectly (via prey and directly (via pollen exposed to Cry proteins within Bt-transgenic maize fields. The effects of Cry1Ie-producing transgenic maize pollen on the fitness of P. japonica was assessed using two dietary-exposure experiments in the laboratory. In the first experiment, survival, larval developmental time, adult fresh weight, and fecundity did not differ between ladybirds consuming Bt or non-Bt maize pollen. In the second experiment, none of the tested lethal and sublethal parameters of P. japonica were negatively affected when fed a rapeseed pollen-based diet containing Cry1Ie protein at 200 μg/g dry weight of diet. In contrast, the larval developmental time, adult fresh weight, and fecundity of P. japonica were significantly adversely affected when fed diet containing the positive control compound E-64. In both experiments, the bioactivity of the Cry1Ie protein in the food sources was confirmed by bioassays with a Cry1Ie-sensitive lepidopteran species. These results indicated that P. japonica are not affected by the consumption of Cry1Ie-expressing maize pollen and are not sensitive to the Cry1Ie protein, suggesting that the growing of Bt maize expressing Cry1Ie protein will pose a negligible risk to P. japonica.

  1. Evaluation of Agrilus planipennis (Coleoptera: Buprestidae) control provided by emamectin benzoate and two neonicotinoid insecticides, one and two seasons after treatment.

    Science.gov (United States)

    McCullough, Deborah G; Poland, Therese M; Anulewicz, Andrea C; Lewis, Phillip; Cappaert, David

    2011-10-01

    Effective methods are needed to protect ash trees (Fraxinus spp.) from emerald ash borer, Agrilus planipennis Fairmaire (Coleoptera: Buprestidae), an invasive buprestid that has killed millions of North American ash (Fraxinus spp.) trees. We randomly assigned 175 ash trees (11.5-48.1 cm in diameter) in 25 blocks located in three study sites in Michigan to one of seven insecticide treatments in May 2007. Treatments included 1) trunk-injected emamectin benzoate; 2) trunk-injected imidacloprid; 3) basal trunk spray of dinotefuran with or 4) without Pentra-Bark, an agricultural surfactant; 5) basal trunk spray of imidacloprid with or 6) without Pentra-Bark; or (7) control. Foliar insecticide residues (enzyme-linked immunosorbent assay) and toxicity of leaves to adult A. planipennis (4-d bioassays) were quantified at 3-4-wk intervals posttreatment. Seven blocks of trees were felled and sampled in fall 2007 to quantify A. planipennis larval density. Half of the remaining blocks were retreated in spring 2008. Bioassays and residue analyses were repeated in summer 2008, and then all trees were sampled to assess larval density in winter. Foliage from emamectin benzoate-treated trees was highly toxic to adult A. planipennis, and larval density was emamectin benzoate for > or = 2 yr may reduce costs or logistical issues associated with treatment.

  2. Olfactory responses of banana weevil predators to volatiles from banana pseudostem tissue and synthetic pheromone

    NARCIS (Netherlands)

    Tinzaara, W.; Gold, C.S.; Dicke, M.; Huis, van A.

    2005-01-01

    As a response to attack by herbivores, plants can emit a variety of volatile substances that attract natural enemies of these insect pests. Predators of the banana weevil, Cosmopolites sordidus (Germar) (Coleoptera: Curculionidae) such as Dactylosternum abdominale (Coleoptera: Hydrophilidae) and

  3. Evaluation of extended-life pheromone formulations used with and without dichlorvos for boll weevil (Coleoptera: Curculionidae) trapping.

    Science.gov (United States)

    Armstrong, J Scott; Greenberg, Shoil M

    2008-04-01

    Boll weevil traps baited with a ComboLure (25 of mg grandlure + 30 mg of eugenol + 90 of mg dichlorvos [DDVP]), an extended-release lure (25 mg of grandlure + 30 mg of eugenol + 60 of mg DDVP kill-strip), and extended-release lure with no DDVP were evaluated for boll weevil, Anthonomus grandis grandis Boheman (Coleoptera: Curculionidae), captures in South Texas cotton, Gossypium hirsutum L., fields during February-March 2005 and March-April 2006. The traps were serviced once a week for five consecutive weeks by using the same methodology as active boll weevil eradication programs. Mean captured boll weevils from extended-release lures with no DDVP were significantly higher in five of 10 trapping weeks compared with captures of the ComboLure and extended lure. Weekly mortality of boll weevils captured was similar for the ComboLure (72.6 +/- 4.7%) and extended lure + DDVP (73.5 +/- 4.0%), and both were significantly higher than the extended lure (32.8 +/- 5.0%) with no DDVP. The presence or absence of DDVP did not significantly affect the sex ratio of field-captured boll weevils. We found no functional reasoning for using DDVP in large scale trapping of boll weevils regardless of the formulation or presentation in the trap. We conducted two additional trapping evaluations after the 2005 and 2006 studies, but the numbers of boll weevils captured were too low for statistical comparisons, indicating that boll weevil eradication is reducing populations in the Rio Grande Valley of Texas.

  4. Self-selection of two diet components by Tenebrio molitor (Coleoptera: Tenebrionidae) larvae and its impact on fitness.

    Science.gov (United States)

    Morales-Ramos, J A; Rojas, M G; Shapiro-Ilan, D I; Tedders, W L

    2011-10-01

    We studied the ability of Tenebrio molitor L. (Coleoptera: Tenebrionidae) to self-select optimal ratios of two dietary components to approach nutritional balance and maximum fitness. Relative consumption of wheat bran and dry potato flakes was determined among larvae feeding on four different ratios of these components (10, 20, 30, and 40% potato). Groups of early instars were provided with a measured amount of food and the consumption of each diet component was measured at the end of 4 wk and again 3 wk later. Consumption of diet components by T. molitor larvae deviated significantly from expected ratios indicating nonrandom self-selection. Mean percentages of dry potato consumed were 11.98, 19.16, 19.02, and 19.27% and 11.89, 20.48, 24.67, and 25.97% during the first and second experimental periods for diets with 10, 20, 30, and 40% potato, respectively. Life table analysis was used to determine the fitness of T. molitor developing in the four diet mixtures in a no-choice experiment. The diets were compared among each other and a control diet of wheat bran only. Doubling time was significantly shorter in groups consuming 10 and 20% potato than the control and longer in groups feeding on 30 and 40% potato. The self-selected ratios of the two diet components approached 20% potato, which was the best ratio for development and second best for population growth. Our findings show dietary self-selection behavior in T. molitor larvae, and these findings may lead to new methods for optimizing dietary supplements for T. molitor.

  5. Taxonomic revision of Madagascan Rhantus (Coleoptera, Dytiscidae, Colymbetinae with an emphasis on Manjakatompo as a conservation priority

    Directory of Open Access Journals (Sweden)

    Anna Hjalmarsson

    2013-11-01

    Full Text Available We review the diving-beetle genus Rhantus Dejean of Madagascar (Coleoptera, Dytiscidae, Colymbetinae based on museum collection holdings and recently collected expedition material. Both morphology and DNA is used to test species boundaries, in particular whether newly collected material from the Tsaratanana mountains in the north represent a new species or are conspecific with Rhantus manjakatompo Pederzani and Rocchi 2009, described based on a single male specimen from the central Ankaratra mountains. DNA of the holotype of R. manjakatompo was successfully extracted in a non-destructive way and sequenced. The general mixed Yule coalescent model applied to an ultrametric tree constructed from mitochondrial cytochrome c oxidase subunit I (COI sequence data delimited three species. Morphological characters supported the same species unambiguously. We therefore recognise three species of Rhantus to occur in Madagascar: R. latus (Fairmaire, 1869, R. bouvieri Régimbart, 1900 and R. manjakatompo Pederzani and Rocchi, 2009. All three species are endemic to Madagascar and restricted to the highlands of the island. Rhantus stenonychus Régimbart, 1895, syn. n., is considered a junior synonym of R. latus. We designate lectotypes for R. bouvieri and R. goudoti Sharp, 1882, the latter a junior synonym of R. latus. We provide descriptions, a determination key, SEM-images of fine pronotal and elytral structures, distribution maps, habitus photos, and illustrations of male genitalia and pro- and mesotarsal claws. We discuss the role of the Manjakatompo forest as a refugium for Madagascan Rhantus diversity and other endemics of the montane central high plateau.

  6. Comparison of Trap Types, Placement, and Colors for Monitoring Anthonomus musculus (Coleoptera: Curculionidae) Adults in Highbush Blueberries

    Science.gov (United States)

    Silva, Diego; Salamanca, Jordano; Kyryczenko-Roth, Vera; Alborn, Hans T; Rodriguez-Saona, Cesar

    2018-01-01

    Abstract The cranberry weevil, Anthonomus musculus Say (Coleoptera: Curculionidae), is a key (univoltine) pest of highbush blueberries in the northeast United States. To date, however, no trapping system has been developed to successfully monitor this pest. In 2012–2014, studies were conducted in commercial highbush blueberry farms in New Jersey to 1) evaluate the efficacy of various commercially available traps, designed for other weevil species (e.g., pepper weevil, plum curculio, boll weevil, red palm weevil, and black vine weevil), in capturing A. musculus adults; 2) test whether the relative location of traps within the blueberry canopy affects adult captures and 3) determine the effects of different colored (yellow, white, green, red, blue, brown, and black) sticky traps on weevil captures. For a comparison with existing techniques, we also monitored the number of overwintered adult weevils on blueberry bushes using beat sheet sampling. Of all traps and colors tested, the most A. musculus adults were caught on yellow sticky traps and more adults were captured when these traps were placed at the bottom half of the blueberry canopy, i.e., 0.5–1.0 m above ground. Most weevils were caught on colored traps late in the season (i.e., during bloom), which corresponds mostly to the second (summer) adult generation. Thus, number of overwintered adults caught on traps did not correlate with those on bushes. Although our study identified traps that can be used to capture A. musculus adults, these traps alone (i.e., without semiochemicals) have so far limited applicability for monitoring overwintered adult weevils in highbush blueberries.

  7. Exploring the Leaf Beetle Fauna (Coleoptera: Chrysomelidae of an Ecuadorian Mountain Forest Using DNA Barcoding.

    Directory of Open Access Journals (Sweden)

    Birthe Thormann

    Full Text Available Tropical mountain forests are hotspots of biodiversity hosting a huge but little known diversity of insects that is endangered by habitat destruction and climate change. Therefore, rapid assessment approaches of insect diversity are urgently needed to complement slower traditional taxonomic approaches. We empirically compare different DNA-based species delimitation approaches for a rapid biodiversity assessment of hyperdiverse leaf beetle assemblages along an elevational gradient in southern Ecuador and explore their effect on species richness estimates.Based on a COI barcode data set of 674 leaf beetle specimens (Coleoptera: Chrysomelidae of 266 morphospecies from three sample sites in the Podocarpus National Park, we employed statistical parsimony analysis, distance-based clustering, GMYC- and PTP-modelling to delimit species-like units and compared them to morphology-based (parataxonomic species identifications. The four different approaches for DNA-based species delimitation revealed highly similar numbers of molecular operational taxonomic units (MOTUs (n = 284-289. Estimated total species richness was considerably higher than the sampled amount, 414 for morphospecies (Chao2 and 469-481 for the different MOTU types. Assemblages at different elevational levels (1000 vs. 2000 m had similar species numbers but a very distinct species composition for all delimitation methods. Most species were found only at one elevation while this turnover pattern was even more pronounced for DNA-based delimitation.Given the high congruence of DNA-based delimitation results, probably due to the sampling structure, our study suggests that when applied to species communities on a regionally limited level with high amount of rare species (i.e. ~50% singletons, the choice of species delimitation method can be of minor relevance for assessing species numbers and turnover in tropical insect communities. Therefore, DNA-based species delimitation is confirmed as a

  8. Un nuevo Trechus (Coleoptera, Carabidae, Trechini hipogeo de la Sierra de Parapanda (Andalucía, España: taxonomía, sistemática y biología

    Directory of Open Access Journals (Sweden)

    Ortuño, V. M.

    2015-08-01

    Full Text Available A new hypogean Trechus (Coleoptera, Carabidae, Trechini from Sierra de Parapanda (Andalucía, España: taxonomy, systematics and biology Sampling of arthropod fauna by pitfall traps in the cavern ‘Sima de San Rafael’ in Íllora (Granada, Spain has revealed a new carabid beetle species, Trechus parapandus n. sp., with remarkable troglobiomorphic characteristics: eyes visible only as scars, depigmentation, and elongation of antennae and legs. In consonance with these characteristics, this new species, Trechus parapandus n. sp. is absent in the upper region of the cave. The species belongs to the Trechus fulvus species group (that has five species in Andalusia according to the characteristics of both male and female genitalia. Study of the fauna in the cave suggests that Collembola might be the prey of this new species since they are the most abundant group and have a coincidental phenology. A key for the 11 Trechus species present in Andalusia is provided.

  9. Parasitylenchus bifurcatus n. sp. (Tylenchida: Allantonematidae parasitizing Harmonia axyridis (Coleoptera: Coccinellidae

    Directory of Open Access Journals (Sweden)

    Poinar George O

    2012-10-01

    Full Text Available Abstract Background The harlequin ladybird, Harmonia axyridis Pallas (Coleoptera: Coccinellidae is native to central and eastern Asia and was purposely introduced into Europe to control aphids. While it proved to be a good biological control agent, its rapid spread and buildup of large populations made it a nuisance, since it overwinters in homes, emits unpleasant odors, stains fabrics, occasionally bites humans and feeds on apples, pears and grapes. Aside from the above, the ravenous appetite of H. axyridis results in their consumption of harmless native insects, including even other ladybird beetles. A study of the natural enemies of H. axyridis in Denmark revealed the presence of nematodes. The present study describes this nematode parasite and discusses aspects of its development and ecology. Methods Adult harlequin ladybird beetles were collected from March to November from four localities in Copenhagen on different plant species. In addition, groups of last-instar larvae and pupae (n = 50 were examined for the presence of nematodes. Living and recently dead nematodes were removed from adult H. axyridis in 0.5% saline solution, the nematodes were then heat killed (at 75C, fixed in 5% formalin and transferred to glycerin on slides for further examination and measurements. Results A new species of Allantonematidae (Tylenchida, Parasitylenchus bifurcatus n. sp., is described from adults of the harlequin ladybird, Harmonia axyridis in Denmark. The new species is characterized by a straight stylet lacking basal thickenings, a bursa and a forked tail tip in the vermiform (infective females and juvenile males. The new species is compared with P. coccinellinae previously described from ladybird beetles in France. Parasitism resulted in depletion of the fat body and partial or complete atrophy of the reproductive organs of the beetles. Infections occurred throughout the year with rates of parasitism reaching up to 35%. The rate increased to 60

  10. Evaluation of double-decker traps for emerald ash borer (Coleoptera: Buprestidae).

    Science.gov (United States)

    Poland, Therese M; McCullough, Deborah G; Anulewicz, Andrea C

    2011-04-01

    Improved detection tools are needed for the emerald ash borer, Agrilus planipennis Fairmaire (Coleoptera: Buprestidae), an invasive forest insect from Asia that has killed millions of ash (Fraxinus spp.) trees in North America since its discovery in Michigan in 2002. We evaluated attraction of adult A. planipennis to artificial traps incorporating visual (e.g., height, color, silhouette) and olfactory cues (e.g., host volatiles) at field sites in Michigan. We developed a double-decker trap consisting of a 3-m-tall polyvinyl pipe with two purple prisms attached near the top. In 2006, we compared A. planipennis attraction to double-decker traps baited with various combinations of manuka oil (containing sesquiterpenes present in ash bark), a blend of four ash leaf volatiles (leaf blend), and a rough texture to simulate bark. Significantly more A. planipennis were captured per trap when traps without the rough texture were baited with the leaf blend and manuka oil lures than on traps with texture and manuka oil but no leaf blend. In 2007, we also tested single prism traps set 1.5 m above ground and tower traps, similar to double-decker traps but 6 m tall. Double-decker traps baited with the leaf blend and manuka oil, with or without the addition of ash leaf and bark extracts, captured significantly more A. planipennis than similarly baited single prism traps, tower traps, or unbaited double-decker traps. A baited double-decker trap captured A. planipennis at a field site that was not previously known to be infested, representing the first detection event using artificial traps and lures. In 2008, we compared purple or green double-decker traps, single prisms suspended 3-5 m above ground in the ash canopy (canopy traps), and large flat purple traps (billboard traps). Significantly more A. planipennis were captured in purple versus green traps, baited traps versus unbaited traps, and double-decker versus canopy traps, whereas billboard traps were intermediate. At sites

  11. Host range findings on Beauveria bassiana and Metarhizium anisopliae (Ascomycota: Hypocreales in Argentina Espectro de hospedadores hallado en Beauveria bassiana y Metarhizium anisopliae (Ascomycota: Hypocreales en Argentina

    Directory of Open Access Journals (Sweden)

    A. V. Toledo

    2008-12-01

    Full Text Available The natural insect host range of the entomopathogenic fungi (EPF Beauveria bassiana (Bb and Metarhizium anisopliae (Ma was investigated in Argentina during the winter of 2003 through spring of 2004. Fungi- infected insect samples (153 were collected from cornfields and the surrounding uncultivated areas in different localities of Buenos Aires (7, Tucumán (2, and Corrientes (3 provinces. The rates of Bb-infected host range varied among the Coleoptera (37%, Hemiptera (27% and Dermaptera (1.3%. While the rates of Ma-infected host range varied between the Coleoptera (0.7% and Hemiptera (34%. The greater host range resulted with B. bassiana found from eight species of Coleoptera (four families, one species of Dermaptera and four species of Hemiptera (three families, than the host range of M. anisopliae found infecting one species of Coleoptera and three species of Hemiptera (two families. We obtained 75 pure fungal isolates (48 Bb-isolates and 27 to Ma-isolates, and 56 of them (33 Bb-isolates and 23 Ma-isolates were morphologically characterized.El espectro natural de hospedadores de los hongos entomopatógenos (HEP Beauveria bassiana (Bb y Metarhizium anisopliae (Ma fue investigado en Argentina desde el invierno de 2003 hasta la primavera de 2004. Las muestras de insectos con infecciones fúngicas (153 fueron recolectadas a partir de campos de maíz y las áreas no cultivadas circundantes a los mismos, en diferentes localidades de las provincias de Buenos Aires (7, Tucumán (2 y Corrientes (3. El espectro de hospedadores infectados con Bb varió entre los Coleoptera (37%, Hemiptera (27% y Dermaptera (1,3%. Mientras que el espectro de hospedadores infectados con Ma varió entre los Coleoptera (0,7% y los Hemiptera (34%. El mayor espectro lo presentó Bb, encontrado en ocho especies de Coleoptera (cuatro familias, una especie de Dermaptera y cuatro especies de Hemiptera (tres familias, mientras que Ma fue encontrado infectando una especie de

  12. Systematics of the Ceracis furcifer Species-Group (Coleoptera: Ciidae): The Specialized Consumers of the Blood-Red Bracket Fungus Pycnoporus sanguineus

    Science.gov (United States)

    Pecci-Maddalena, Italo S. C.; Lopes-Andrade, Cristiano

    2017-01-01

    The Ceracis furcifer species-group (Coleoptera: Ciidae) originally comprised nine species names: Ceracis cornifer (Mellié, 1849); C. cylindricus (Brèthes, 1922); C. furcifer Mellié, 1849; C. hastifer (Mellié, 1849); C. monocerus Lawrence, 1967; C. ruficornis Pic, 1916; C. simplicicornis (Pic, 1916); C. semipallidus Pic, 1922 and C. unicornis Gorham, 1898. Ceracis semipallidus was synonymised with C. furcifer and then no further changes were made to the composition of the group. Here, we provide a taxonomic revision of the Ceracis furcifer species-group and new data on the geographic distribution and host fungi of the included species. Lectotypes are designated for C. cornifer, C. furcifer, C. hastifer, C. ruficornis, C. semipallidus and C. unicornis. As results we: (i) synonymise C. cylindricus, C. monocerus, C. simplicicornis, C. unicornis with C. cornifer; (ii) confirm the synonymy of C. semipallidus with C. furcifer; (iii) redescribe C. cornifer, C. hastifer, C. furcifer and C. ruficornis; and (iv) provide an identification key for species in the furcifer group. The frontoclypeal horn and body coloration showed great intraspecific variation. We show that species in the furcifer group have distributions wider than previously known and use mainly Pycnoporus sanguineus as host fungus. Species of the furcifer group are the only animals specialized in feeding on basidiomes of P. sanguineus. PMID:28714939

  13. Effects of fertilizer and low rates of Imidacloprid on Adelges tsugae (Hemiptera: Adelgidae).

    Science.gov (United States)

    S. V. Joseph; James Hanula; S. K. Braman; F. J. Byrne

    2011-01-01

    Healthy hemlock trees, Tsuga canadensis (L.) Carriere, and hemlock woolly adelgid, Adelges tsugae Annand (Hemiptera: Adelgidae), populations should favor retention and population growth of adelgid predators such as Laricobius nigrinus Fender (Coleoptera: Derodontidae) and Sasajiscymnus tsugae (Sasaji&McClure) (Coleoptera: Coccinellidae). Eastern hemlock trees...

  14. Improving detection tools for emerald ash borer (Coleoptera: Buprestidae): comparison of multifunnel traps, prism traps, and lure types at varying population densities.

    Science.gov (United States)

    Crook, Damon J; Francese, Joseph A; Rietz, Michael L; Lance, David R; Hull-Sanders, Helen M; Mastro, Victor C; Silk, Peter J; Ryall, Krista L

    2014-08-01

    The emerald ash borer, Agrilus planipennis Fairmaire (Coleoptera: Buprestidae), is a serious invasive pest of North American ash (Fraxinus spp.) that has caused devastating mortality since it was first identified in North America in 2002. In 2012, we conducted field trapping assays that tested the efficacy of purple prism and fluon-coated green multifunnel (Lindgren funnel) traps. Traps were baited with combinations of several lures that were previously shown to be attractive to A. planipennis: manuka oil--a sesquiterpene-rich oil, (3Z)-hexenol--a green leaf volatile, or (3Z)-dodecen-12-olide [= (3Z)-lactone], a sex pheromone. Eighty-nine blocks (trap lines) were tested throughout nine states along the outer edges of the currently known A. planipennis infestation in North America. Trap catch was highest on fluon-coated green multifunnel traps, and trap detections at sites with low A. planipennis population density ranged from 72 to 76% for all trap and lure types tested. (3Z)-hexenol and (3Z)-lactone baited traps functioned as well as (3Z)-hexenol and manuka oil-baited traps. Independent of the lure used, detection rates on green fluon-coated multifunnel traps were comparable with glued purple prism traps in areas with low A. planipennis population densities.

  15. Quercivorol as a lure for the polyphagous and Kuroshio shot hole borers, Euwallacea spp. nr. fornicatus (Coleoptera: Scolytinae, vectors of Fusarium dieback

    Directory of Open Access Journals (Sweden)

    Christine Dodge

    2017-08-01

    Full Text Available The polyphagous shot hole borer and Kuroshio shot hole borer, two members of the Euwallacea fornicatus species complex (Coleoptera: Curculionidae: Scolytinae, are invasive ambrosia beetles that harbor distinct species of Fusarium fungal symbionts. Together with the damage caused by gallery construction, these two phytopathogenic Fusarium species are responsible for the emerging tree disease Fusarium dieback, which affects over 50 common tree species in Southern California. Host trees suffer branch dieback as the xylem is blocked by invading beetles and fungi, forcing the costly removal of dead and dying trees in urban areas. The beetles are also threatening natural riparian habitats, and avocado is susceptible to Fusarium dieback as well, resulting in damage to the avocado industries in California and Israel. Currently there are no adequate control mechanisms for shot hole borers. This paper summarizes efforts to find a suitable lure to monitor shot hole borer invasions and dispersal. Field trials were conducted in two counties in Southern California over a span of two years. We find that the chemical quercivorol is highly attractive to these beetles, and perform subsequent field experiments attempting to optimize this lure. We also explore other methods of increasing trap catch and effects of other potential attractants, as well as the deterrents verbenone and piperitone.

  16. A taxonomic revision of the Cymindis (Pinacodera limbata species group (Coleoptera, Carabidae, Lebiini, including description of a new species from Florida, U.S.A.

    Directory of Open Access Journals (Sweden)

    Wesley Hunting

    2013-01-01

    Full Text Available The Cymindis (Pinacodera limbata species group (Coleoptera, Carabidae, Lebiini is a precinctive New World taxon with ranges extended from portions of temperate southeastern Canada and the U.S.A. through the montane regions of Mexico, south to the Isthmus of Tehuantepec. The group is distinguishable from all other members of the subgenus Pinacodera by males possessing a distinctive sclerite (endophallic plate at the apex of the endophallus. In the past, a lack of material and misunderstandings of range of variation within species have contributed to confusion about how many species there really are.This revision of the limbata species group includes a classification, a key to groups within the subgenus Pinacodera and species within the limbata group, descriptions of species, re-rankings and new synonymies. In total 10 taxa are treated, with 6 new synonyms proposed, 1 new combination introduced and 1 new species described: Cymindis (Pinacodera rufostigma (type locality: Archbold Biological Station, Highlands County, Florida, U.S.A.. Each taxon is characterized in terms of structural features of adults, habitat, geographical distribution, and chorological affinities. Available ecological information and treatments of variation are included.

  17. Species delimitation in northern European water scavenger beetles of the genus Hydrobius (Coleoptera, Hydrophilidae)

    Science.gov (United States)

    Fossen, Erlend I.; Ekrem, Torbjørn; Nilsson, Anders N.; Bergsten, Johannes

    2016-01-01

    Abstract The chiefly Holarctic Hydrobius species complex (Coleoptera, Hydrophilidae) currently consists of Hydrobius arcticus Kuwert, 1890, and three morphological variants of Hydrobius fuscipes (Linnaeus, 1758): var. fuscipes, var. rottenbergii and var. subrotundus in northern Europe. Here molecular and morphological data are used to test the species boundaries in this species complex. Three gene segments (COI, H3 and ITS2) were sequenced and analyzed with Bayesian methods to infer phylogenetic relationships. The Generalized Mixed Yule Coalescent (GMYC) model and two versions of the Bayesian species delimitation method BPP, with or without an a priori defined guide tree (v2.2 & v3.0), were used to evaluate species limits. External and male genital characters of primarily Fennoscandian specimens were measured and statistically analyzed to test for significant differences in quantitative morphological characters. The four morphotypes formed separate genetic clusters on gene trees and were delimited as separate species by GMYC and by both versions of BPP, despite specimens of Hydrobius fuscipes var. fuscipes and Hydrobius fuscipes var. subrotundus being sympatric. Hydrobius arcticus and Hydrobius fuscipes var. rottenbergii could only be separated genetically with ITS2, and were delimited statistically with GMYC on ITS2 and with BPP on the combined data. In addition, six or seven potentially cryptic species of the Hydrobius fuscipes complex from regions outside northern Europe were delimited genetically. Although some overlap was found, the mean values of six male genital characters were significantly different between the morphotypes (p < 0.001). Morphological characters previously presumed to be diagnostic were less reliable to separate Hydrobius fuscipes var. fuscipes from Hydrobius fuscipes var. subrotundus, but characters in the literature for Hydrobius arcticus and Hydrobius fuscipes var. rottenbergii were diagnostic. Overall, morphological and molecular

  18. Impact of planting dates and insecticide strategies for managing crucifer flea beetles (Coleoptera: Chrysomelidae) in spring-planted canola.

    Science.gov (United States)

    Knodel, Janet J; Olson, Denise L; Hanson, Bryan K; Henson, Robert A

    2008-06-01

    Integration of cultural practices, such as planting date with insecticide-based strategies, was investigated to determine best management strategy for flea beetles (Phyllotreta spp.) (Coleoptera: Chrysomelidae) in canola (Brassica napus L.). We studied the effect of two spring planting dates of B. napus and different insecticide-based management strategies on the feeding injury caused by fleabeetles in North Dakota during 2002-2003. Adult beetle peak emergence usually coincided with the emergence of the early planted canola, and this resulted in greater feeding injury in the early planted canola than later planted canola. Use of late-planted canola may have limited potential for cultural control of flea beetle, because late-planted canola is at risk for yield loss due to heat stress during flowering. Flea beetle injury ratings declined when 1) the high rate of insecticide seed treatment plus a foliar insecticide applied 21 d after planting was used, 2) the high rate of insecticide seed treatment only was used, or 3) two foliar insecticide sprays were applied. These insecticide strategies provided better protection than the low rates of insecticide seed treatments or a single foliar spray, especially in areas with moderate-to-high flea beetle populations. The foliar spray on top of the seed treatment controlled later-emerging flea beetles as the seed treatment residual was diminishing and the crop became vulnerable to feeding injury. The best insecticide strategy for management of flea beetle was the high rate of insecticide seed treatment plus a foliar insecticide applied at 21 d after planting, regardless of planting date.

  19. Dietary fatty acids influence the growth and fatty acid composition of the yellow mealworm Tenebrio molitor (Coleoptera: Tenebrionidae).

    Science.gov (United States)

    Dreassi, Elena; Cito, Annarita; Zanfini, Assunta; Materozzi, Lara; Botta, Maurizio; Francardi, Valeria

    2017-03-01

    Fat is the second most abundant component of the nutrient composition of the mealworm Tenebrio molitor (Coleoptera: Tenebrionidae) that represents also an interesting source of PUFA, especially n-6 and n-3 fatty acids, involved in prevention of cardiovascular diseases. This study investigated the possibility of modifying the fat content and the FA composition of yellow mealworms through feeding and how this would be influenced by developmental stages, pupal sex, and generation with the future aim of applying this coleopteran as a diet supplement for human health. Growth rate and cumulative mortality percentage on the different feeding substrates were also evaluated to select the optimal conditions for a mass-raising of this insect species. Despite the different fat content in the six different breeding substrates used, T. molitor larvae and pupae contained a constant fat percentage (>34% in larvae and >30% in pupae). A similar total fat content was found comparing larvae and male and female pupae of the second generation to those of the first generation. On the contrary, FA composition differed both in larvae and pupae reared on the different feeding substrates. However, the exemplars reared on the diets based on 100% bread and 100% oat flour showed SFA, PUFA percentages, and an n-6/n-3 ratio more suitable for human consumption; the diet based on beer yeast, wheat flour, and oat flour resulted in a contemporary diet that most satisfied the balance between a fat composition of high quality and favorable growth conditions.

  20. Efficacy of verbenone for protecting ponderosa pine stands from western pine beetle (Coleoptera: Curculionidae: Scolytinae) attack in California.

    Science.gov (United States)

    Fettig, Christopher J; McKelvey, Stephen R; Borys, Robert R; Dabney, Christopher P; Hamud, Shakeeb M; Nelson, Lori J; Seybold, Steven J

    2009-10-01

    The western pine beetle, Dendroctonus brevicomis LeConte (Coleoptera: Curculionidae: Scolytinae), is a major cause of ponderosa pine, Pinus ponderosa Dougl. ex Laws., mortality in much of western North America. Currently, techniques for managing D. brevicomis infestations are limited. Verbenone (4,6,6-trimethylbicyclo [3.1.1] hept-3-en-2-one) is an antiaggregation pheromone of several Dendroctonus spp., including D. brevicomis, and it has been registered as a biopesticide for control of mountain pine beetle, Dendroctonus ponderosae Hopkins, and southern pine beetle, Dendroctonus frontalis Zimmermann. We evaluated the efficacy of a 5-g verbenone pouch [82%-(-); 50 mg/d] applied at 125 Ulha for protecting P. ponderosa stands (2 ha) from D. brevicomis attack over a 3-yr period. No significant differences in levels of D. brevicomis-caused tree mortality or the percentage of unsuccessfully attacked trees were found between verbenone-treated and untreated plots during each year or cumulatively over the 3-yr period. Laboratory analyses of release rates and chemical composition of volatiles emanating from verbenone pouches after field exposure found no deterioration of the active ingredient or physical malfunction of the release device. The mean release rate of pouches from all locations and exposure periods was 44.5 mg/d. In a trapping bioassay, the range of inhibition of the 5-g verbenone pouch was determined to be statistically constant 2 m from the release device. We discuss the implications of these and other results to the development of verbenone as a semiochemical-based tool for management of D. brevicomis infestations in P. ponderosa stands.