WorldWideScience

Sample records for mh jg kd

  1. MH-60S Fleet Combat Support Helicopter (MH-60S)

    Science.gov (United States)

    2013-12-01

    Aircraft Corporation was awarded July 6, 2012. These two contracts will complete the MH-60S production buys which conclude in FY 2015. MH-60S...UNCLASSIFIED 10 VMAX (KIAS) *Armed Helo FMC Rate (%) 60 60 56 60 60 *Armed Helo MC Rate (%) 75 75 69 74 74 *HC Interoperability (%) 100 N/A N/A N...Countermeasures Ao - Operational Availability CSAR - Combat Search and Rescue CV - Carrier deg - Degree F - Fahrenheit FMC - Fully Mission Capable G

  2. MH17: the Malaysian experience.

    Science.gov (United States)

    Khoo, L S; Hasmi, A H; Abdul Ghani Aziz, S A; Ibrahim, M A; Mahmood, M S

    2016-04-01

    A disaster is a natural or man-made (or technological) hazard resulting in an event of substantial extent causing significant physical damage or destruction, loss of life, or drastic change to the environment. It is a phenomenon that can cause damage to life and property and destroy the economic, social and cultural life of the people; and overwhelms the capacity of the community to cope with the event. The recent tragic aviation accidents in 2014 involving Malaysia Airlines flights MH370 and MH17 shocked the world in an unprecedented manner. This paper focuses on the Malaysian experience in the MH17 mission in Ukraine as well as the first ever international Disaster Victim Identification (DVI) operation for the Malaysian DVI team. The DVI operations in Hilversum, the Netherlands were well described in stages. The Netherlands' Landelijk Team Forensische Opsporing as the lead DVI team in Hilversum operated systematically, ensuring the success of the whole mission. This paper discusses the lessons learned by the Malaysian team on proper DVI structure, inter- and intra-agency cooperation, facilities planning and set up, logistics and health and safety aspects, as well as effective communication and collaboration with other international delegates. Several issues and challenges faced by the Malaysian team were also documented. In addition, the authors shared views, opinions and recommendations for a more comprehensive DVI operation in the future.

  3. Fra SK 4b til MH 17

    DEFF Research Database (Denmark)

    Stræde, Therkel

    2015-01-01

    Om den nazistiske besættelsespolitik i Sydøstukraine og Sonderkommando 4b's udryddelse af jøder på den egn, hvor Malaysian Airlines MH 17 styrtede ned den 17. juli 2014......Om den nazistiske besættelsespolitik i Sydøstukraine og Sonderkommando 4b's udryddelse af jøder på den egn, hvor Malaysian Airlines MH 17 styrtede ned den 17. juli 2014...

  4. dimensional KdV equation

    Indian Academy of Sciences (India)

    volving three arbitrary functions for the (2+1)-dimensional KdV equation. Diverse peri- odic wave solutions ... double periodic and possess properties of trigonometric functions. Detailed expla- nations about ... work is to demonstrate that the singular manifold method [12], a powerful method for obtaining the exact solutions to ...

  5. KdV-Volterra chain

    Energy Technology Data Exchange (ETDEWEB)

    Pritula, G M; Vekslerchik, V E, E-mail: galinapritula@yandex.r, E-mail: vadym.vekslerchik@uclm.e [Institute for Radiophysics and Electronics, Kharkov (Ukraine)

    2010-09-10

    This paper is devoted to the system of coupled KdV-like equations. It is shown that this apparently non-integrable system possesses an integrable reduction which is closely related to the Volterra chain. This fact is used to construct the hyperelliptic solutions of the original system.

  6. New interaction solutions to the combined KdV–mKdV equation from CTE method

    Directory of Open Access Journals (Sweden)

    Hengchun Hu

    2016-10-01

    Full Text Available The consistent tanh expansion (CTE method is developed for the combined KdV–mKdV equation. The combined KdV–mKdV equation is proved to be CTE solvable. New exact interaction solutions such as soliton–cnoidal wave solutions, soliton–periodic wave solutions for the combined KdV–mKdV equation are given out analytically and graphically.

  7. Modelling of rechargeable NiMH batteries

    NARCIS (Netherlands)

    Ledovskikh, A.; Verbitskiy, E.; Ayeb, A.; Notten, P.H.L.

    2003-01-01

    A new mathematical model has been developed for rechargeable NiMH batteries, which is based on the occurring physical–chemical processes inside. This model enables one to simultaneously simulate the battery voltage, internal gas pressures (both PO2 and PH2) and temperature during battery operation.

  8. The response of Serratia marcescens JG to environmental changes by quorum sensing system.

    Science.gov (United States)

    Sun, Shu-Jing; Liu, Hui-Jun; Weng, Cai-Hong; Lai, Chun-Fen; Ai, Liu-Ying; Liu, Yu-Chen; Zhu, Hu

    2016-08-01

    Many bacterial cells are known to regulate their cooperative behaviors and physiological processes through a molecular mechanism called quorum sensing. Quorum sensing in Serratia marcescens JG is mediated by the synthesis of autoinducer 2 (AI-2) which is a furanosyl borate diester. In this study, the response of quorum sensing in S. marcescens JG to environment changes such as the initial pH, carbon sources and boracic acid was investigated by a bioreporter and real-time PCR analysis. The results show that glucose can affect AI-2 synthesis to the greatest extent, and 2.0 % glucose can stimulate S. marcescens JG to produce more AI-2, with a 3.5-fold increase in activity compared with control culture. Furthermore, the response of quorum sensing to changes in glucose concentration was performed by changing the amount of luxS RNA transcripts. A maximum of luxS transcription appeared during the exponential growth phase when the glucose concentration was 20.0 g/L. AI-2 production was also slightly impacted by the low initial pH. It is significant for us that the addition of boracic acid at microdosage (0.1-0.2 g/L) can also induce AI-2 synthesis, which probably demonstrated the feasible fact that the 4,5-dihydroxy-2, 3-pentanedione cyclizes by the addition of borate and the loss of water, is hydrated and is converted to the final AI-2 in S. marcescens JG.

  9. SIFAT-SIFAT BIOKIMIAWI EKSTRAK KASAR LIPASE EKSTRASELULER DARI BAKTERI Azospirillum sp. JG3

    Directory of Open Access Journals (Sweden)

    Puji Lestari

    2009-11-01

    Full Text Available Lipases are valuable biocatalysts because they act under extremely mild conditions, are stable in organic solvents, show broad substrate specificity and exhibit high stereoselectivity. Lipases play important role in various industries such as detergent, cosmetics, flavor, pharmacy and synthesis of organic compounds. The increasing of lipases requirements in industries is goading research to get new lipases resources commited. One of potential lipase resource is Azospirillum sp.JG3 bacteria from Microbiology Laboratory of Biology Faculty University of Jenderal Soedirman. The specific targets of this research are to get crude extract of lipase and investigate its biochemical characteristics. The method used were rejuvenation of Azospirillum sp.JG3 bacteria, inoculum production, determination of optimum production time and bacterium growth phase, extraction and production of lipase to get crude extract, and characterization the biochemical properties of lipase crude extract. The research resulted that crude extract of lipase from Azospirillum sp.JG3 had optimum temperature at 40 °C and optimum pH at pH 7. The lipase was a metalloenzyme with Ca2+ as its cofactor. The lipase was stable in three organic solvents tested, (chloroform, n-hexane and ether.

  10. Vertical diffuse attenuation coefficient (Kd) based optical ...

    Indian Academy of Sciences (India)

    R. Narasimhan (Krishtel eMaging) 1461 1996 Oct 15 13:05:22

    The optical classification of the different water types provides vital input for studies related to primary productivity, water clarity and determination of euphotic depth. Image data of the IRS-. P3 MOS-B, for Path 90 of 27th February, 1998 was used for deriving vertical diffuse attenuation coefficient (Kd) and an optical ...

  11. PEMBUATAN DEKSTRIN DARI PATI UBI KAYU MENGGUNAKAN KATALIS AMILASE HASIL FRAKSINASI DARI Azospirillum sp. JG3

    Directory of Open Access Journals (Sweden)

    Zusfahair

    2012-05-01

    Full Text Available Amilase merupakan salah satu enzim potensial dalam proses industri. Amilase dapat diperoleh dari bakteri Azopsirillum sp. JG3. Amilase ini dapat dimanfaatkan untuk hidrolisis pati ubi kayu pada pembuatan dekstrin. Dekstrin memiliki peran yang cukup penting dalam industri seperti pembuatan roti, makanan bayi dan bahan penyalut lapis tipis tablet. Penelitian ini bertujuan untuk mengetahui karakterisasi biokimiawi amilase hasil fraksinasi dari Azospirillum sp. JG3 serta potensinya dalam pembuatan dekstrin. Tahap penelitian ini dimulai dengan memproduksi enzim yang dilakukan dengan cara menumbuhkan inokulum ke dalam medium produksi selama 30 jam kemudian diekstraksi dengan sentrifugasi sehingga diperoleh ekstrak kasar. Ekstrak kasar amilase kemudian difraksinasi secara bertahap (15%, 30%, 45% dan 60% dengan menggunakan ammonium sulfat dan didialisis. Fraksi yang diperoleh diukur aktivitas, volume dan kadar proteinnya. Fraksi dengan aktivitas spesifik tertinggi dikarakterisasi dan digunakan untuk membuat dekstrin dari pati ubi kayu. Dekstrin pati ubi kayu yang diperoleh dikarakterisasi berupa rendemen, kadar air, kadar abu dan dextrose equivalen. Hasil penelitian menunjukkan bahwa fraksi hasil dialisis 45% (FHD 45% menghasilkan aktivitas dan aktivitas spesifik tertinggi berturut-turut sebesar 11,659 U/mL dan 7,319 U/mg. Aktivitas amilase optimum pada suhu 30°C, pH 7 dan konsentrasi substrat 4%. Dekstrin yang diperoleh memiliki rendemen 95,14, kadar air 3,411%, kadar abu 0,209% dan dextrose equivalen 13,4.

  12. Analytic Solutions of the Space-Time Fractional Combined KdV-mKdV Equation

    Directory of Open Access Journals (Sweden)

    Emad A.-B. Abdel-Salam

    2015-01-01

    Full Text Available The fractional mapping method is proposed to solve fractional differential equations. To illustrate the effectiveness of the method, we discuss the space-time fractional combined KdV-mKdV equation. Many types of exact analytical solutions are obtained. The solutions include generalized trigonometric and hyperbolic functions solutions. These solutions are useful to understand the mechanisms of the complicated nonlinear physical phenomena and fractional differential equations. Among these solutions, some are found for the first time.

  13. MhYTP1 and MhYTP2 from Apple Confer Tolerance to Multiple Abiotic Stresses in Arabidopsis thaliana

    Directory of Open Access Journals (Sweden)

    Na Wang

    2017-08-01

    Full Text Available The first YTH domain-containing RNA binding protein (YTP was found in rat, where it was related to oxidative stress. Unlike characterizations in yeast and animals, functions of plant YTPs are less clear. Malus hupehensis (Pamp. Rehd. YTP1 and YTP2 (MhYTP1 and MhYTP2 are known to be active in leaf senescence and fruit ripening. However, no research has been published about their roles in stress responses. Here, we investigate the stress-related functions of MhYTP1 and MhYTP2 in Arabidopsis thaliana. Both of the two genes participated in salicylic acid (SA, jasmonic acid (JA, and abscisic acid (ABA signaling and play roles in plant responses to oxidative stress, chilling, high temperature, high salinity, and mannitol induced physiological drought stress. Moreover, MhYTP1 plays leading roles in SA and ABA signaling, and MhYTP2 plays leading roles in JA signaling and oxidative stress responses. These results will fill a gap in our knowledge about plant YTPs and stress responses and provide a foundation for future attempts to improve stress tolerance in apple.

  14. Nonholonomic deformation of KdV and mKdV equations and their symmetries, hierarchies and integrability

    Energy Technology Data Exchange (ETDEWEB)

    Kundu, Anjan [Theory Group and CAMCS, Saha Institute of Nuclear Physics, Calcutta (India); Sahadevan, R; Nalinidevi, L [Ramanujan Institute for Advanced Study in Mathematics, University of Madras, Chennai 600 005, Tamilnadu (India)], E-mail: anjan.kundu@saha.ac.in, E-mail: ramajayamsaha@yahoo.co.in, E-mail: lnalinidevi@yahoo.co.in

    2009-03-20

    The recent concept of integrable nonholonomic deformation found for the Korteweg-de Vries (KdV) equation is extended to the modified KdV (mKdV) equation and generalized to the AKNS system. For the deformed mKdV equation we find a matrix Lax pair, a novel two-fold integrable hierarchy and exact N-soliton solutions exhibiting unusual accelerating motion. We show that both the deformed KdV and mKdV systems possess infinitely many generalized symmetries, conserved quantities and a recursion operator.

  15. Color obsessions and phobias in autism spectrum disorders: the case of J.G.

    Science.gov (United States)

    Ludlow, Amanda K; Heaton, Pamela; Hill, Elisabeth; Franklin, Anna

    2014-06-01

    The current study is the first investigation of color 'obsessions' and 'phobias' in ASD. We investigate the color perception and cognition of J.G., a boy with ASD who has a strong obsession with blue, and a strong phobia of other colors. J.G.'s performance on a series of color tasks (color-entity association; chromatic discrimination; color classification) is compared to 13 children with and without autism who do not have color obsessions or phobias. The findings lead to the formalization of two hypotheses: (i) color obsessions and phobias in individuals with ASD are related to an unusually strong ability to associate colors with entities; (ii) color obsessions are related to hyposensitivity, and color phobias to hypersensitivity, in the affected regions of color space.

  16. Characterization of JG024, a pseudomonas aeruginosa PB1-like broad host range phage under simulated infection conditions

    Directory of Open Access Journals (Sweden)

    Rohde Manfred

    2010-11-01

    Full Text Available Abstract Background Pseudomonas aeruginosa causes lung infections in patients suffering from the genetic disorder Cystic Fibrosis (CF. Once a chronic lung infection is established, P. aeruginosa cannot be eradicated by antibiotic treatment. Phage therapy is an alternative to treat these chronic P. aeruginosa infections. However, little is known about the factors which influence phage infection of P. aeruginosa under infection conditions and suitable broad host range phages. Results We isolated and characterized a phage, named JG024, which infects a broad range of clinical and environmental P. aeruginosa strains. Sequencing of the phage genome revealed that the phage JG024 is highly related to the ubiquitous and conserved PB1-like phages. The receptor of phage JG024 was determined as lipopolysaccharide. We used an artificial sputum medium to study phage infection under conditions similar to a chronic lung infection. Alginate production was identified as a factor reducing phage infectivity. Conclusions Phage JG024 is a suitable broad host range phage which could be used in phage therapy. Phage infection experiments under simulated chronic lung infection conditions showed that alginate production reduces phage infection efficiency.

  17. Partial analysis of the central domain of the Bacillus sphaericus JG-A12 S-layer protein

    Energy Technology Data Exchange (ETDEWEB)

    Schnorpfeil, M.; Raff, J.; Flemming, K.; Selenska-Pobell, S.

    2002-05-01

    310 amino acids from the central domain of the B. sphaericus JG-A12 S-layer were analyzed. In contrast to the N-terminal domain of this protein, which possesses a unique structure, the part studied in this work shares a significant identity with the corresponding parts of several other B. sphaericus S-layers. (orig.)

  18. The dependence of quorum sensing in Serratia marcescens JG on the transcription of luxS gene.

    Science.gov (United States)

    Sun, Shu-Jing; Liu, Yu-Chen; Sun, Jiao; Zhu, Hu

    2015-06-01

    Bacteria communicate with one another using chemical signal molecules. This phenomenon termed quorum sensing enables the bacteria to monitor the environment for other bacteria and to alter behavior on a population-wide scale in response to cell density. Serratia marcescens JG, a quorum sensing bacterium, can secrete a furanosyl borate diester autoinducer (AI-2) in the exponential phase of growth. In this study, to further investigate the regulation of AI-2 production in S. marcescens JG, the pfs and luxS promoter fusions to an operon luxCDABE reporter were constructed in a low-copy-number vector pBR322K, which allows an examination of transcription of the genes in the pathway for signal synthesis. The results show that the luxS expression is constitutive, and the transcription of luxS is tightly correlated with AI-2 production in S. marcescens JG because the peaks of AI-2 production and transcriptional level of luxS appear at the same time point. The close relation of the profiles of luxS transcription and AI-2 production was also confirmed with real-time PCR technology. These results support the hypothesis that the quorum sensing in S. marcescens JG is luxS dependent.

  19. Seafloor in the Malaysia Airlines Flight MH370 Search Area

    Science.gov (United States)

    Smith, Walter H. F.; Marks, Karen M.

    2014-05-01

    On the morning of 8 March 2014, Malaysia Airlines flight MH370, from Kuala Lumpur to Beijing, lost contact with air traffic control shortly after takeoff and vanished. While the world waited for any sign of the missing aircraft and the 239 people on board, authorities and scientists began to investigate what little information was known about the plane's actual movements.

  20. Iron-substituted AB5-type MH electrode

    Indian Academy of Sciences (India)

    substituted AB5-type MH electrode. SUMITA SRIVASTAVAa,∗ and R K UPADHYAYAb. aDepartment of Physics, Government P.G. College, Uttarkashi 249 193, India. bDepartment of Physics, Government P.G. College, Rishikesh 249 201, India.

  1. State of charge estimation in Ni-MH rechargeable batteries

    Energy Technology Data Exchange (ETDEWEB)

    Milocco, R.H. [Grupo Control Automatico y Sistemas (GCAyS), Depto. Electrotecnia, Facultad de Ingenieria, Universidad Nacional del Comahue, Buenos Aires 1400, 8300 Neuquen (Argentina); Castro, B.E. [Instituto de Investigaciones Fisicoquimicas Teoricas y Aplicadas (INIFTA), Universidad Nacional de La Plata, Suc 4, CC16 (1900), La Plata (Argentina)

    2009-10-20

    In this work we estimate the state of charge (SOC) of Ni-MH rechargeable batteries using the Kalman filter based on a simplified electrochemical model. First, we derive the complete electrochemical model of the battery which includes diffusional processes and kinetic reactions in both Ni and MH electrodes. The full model is further reduced in a cascade of two parts, a linear time invariant dynamical sub-model followed by a static nonlinearity. Both parts are identified using the current and potential measured at the terminals of the battery with a simple 1-D minimization procedure. The inverse of the static nonlinearity together with a Kalman filter provide the SOC estimation as a linear estimation problem. Experimental results with commercial batteries are provided to illustrate the estimation procedure and to show the performance. (author)

  2. Exact solutions for the Wick-type stochastic Kersten-Krasil'shchik coupled KdV-mKdV equations

    Science.gov (United States)

    Singh, S.; Saha Ray, S.

    2017-11-01

    In this article, exact solutions of Wick-type stochastic Kersten-Krasil'shchik coupled KdV-mKdV equations have been obtained by using the Jacobian elliptic function expansion method. We have used the Hermite transform for transforming the Wick-type stochastic Kersten-Krasil'shchik coupled KdV-mKdV equation into a deterministic partial differential equation. Also, we have applied the inverse Hermite transform for obtaining a set of stochastic solutions in the white noise space.

  3. Spectroscopic characterization of gold nanoparticles formed by cells and S-layer protein of Bacillus sphaericus JG-A12

    Energy Technology Data Exchange (ETDEWEB)

    Merroun, M. [Institute of Radiochemistry, Forschungszentrum Rossendorf, 01314 Dresden (Germany)]. E-mail: m.merroun@fz-rossendorf.de; Rossberg, A. [Institute of Radiochemistry, Forschungszentrum Rossendorf, 01314 Dresden (Germany); Hennig, C. [Institute of Radiochemistry, Forschungszentrum Rossendorf, 01314 Dresden (Germany); Scheinost, A.C. [Institute of Radiochemistry, Forschungszentrum Rossendorf, 01314 Dresden (Germany); Selenska-Pobell, S. [Institute of Radiochemistry, Forschungszentrum Rossendorf, 01314 Dresden (Germany)

    2007-01-15

    The strain Bacillus sphaericus JG-A12, isolated from a uranium mining waste pile near the town of Johanngeorgenstadt, is capable of selective and reversible accumulation of U, Cu, Pb, Al, and Cd from uranium waste waters. The cells of this strain are enveloped by a surface layer protein (S-layer). The highly regular structure of this S-layer with many pores of identical size offers good binding sites for different kinds of molecules and provides nucleation sites for the formation of metal nanoclusters or minerals. In this study we demonstrate that B. sphaericus JG-A12 cells and their purified S-layer protein were capable to reduce Au to metallic nanoclusters in the presence of reducing agents such as molecular H{sub 2}. The gold nanoparticles were regularly distributed and sized according to the pores of the protein lattice. The metallic nature of the clusters was confirmed by different techniques such as extended X-ray absorption fine structure (EXAFS) spectroscopy, X-ray absorption near edge (XANES) spectroscopy, UV-vis spectroscopy and X-ray powder diffraction (XRD). The size of the gold nanoparticles was estimated to be almost 1 nm. Our results demonstrate that B. sphaericus JG-A12 can be used to prepare gold nanoparticles tailor-made for industrial applications.

  4. Division algebras and extended super KdVs

    Energy Technology Data Exchange (ETDEWEB)

    Toppan, F. [Centro Brasileiro de Pesquisas Fisicas (CBPF), Rio de Janeiro, RJ (Brazil). Coordenacao de Teoria de Campos e Particulas]. E-mail: toppan@cbpf.br

    2001-05-01

    The division algebras R, C, H, O are used to construct and analyze the N = 1, 2, 4, 8 supersymmetric extensions of the KdV hamiltonian equation. In particular a global N = 8 super-KdV system is introduced and shown to admit a Poisson bracket structure given by the 'Non-Associate N = 8 Superconformal Algebra'. (author)

  5. dimensional mKdV-ZK equation and the

    Indian Academy of Sciences (India)

    evolution equations in mathematical physics through the (3 + 1)-dimensional mKdV-ZK equation and the (1 + 1)-dimensional compound KdVB equation. This paper is organized as follows: in §2, the new generalized. (. G /G. ) -expansion method is discussed. In §3, this method is applied to the nonlinear evolution equations.

  6. Natural selection acts on Atlantic salmon major histocompatibility (MH) variability in the wild

    NARCIS (Netherlands)

    Eyto, de E.; McGinnity, P.; Consuegra, S.; Coughlan, J.; Tufto, J.; Farrell, K.; Megens, H.J.W.C.; Jordan, W.; Cross, T.; Stet, R.J.M.

    2007-01-01

    Pathogen-driven balancing selection is thought to maintain polymorphism in major histocompatibility (MH) genes. However, there have been few empirical demonstrations of selection acting on MH loci in natural populations. To determine whether natural selection on MH genes has fitness consequences for

  7. On Fifth Order KdV-Type Equation

    CERN Document Server

    Malik, R P

    1997-01-01

    The dynamics of the highly nonlinear fifth order $KdV$-type equation is discussed in the framework of the Lagrangian and Hamiltonian formalisms. The symmetries of the Lagrangian produce three commuting conserved quantities that are found to be recursively related to one-another for a certain specific value of the power of nonlinearity. The above cited recursion relations are obeyed with a second Poisson bracket which sheds light on the integrability properties of the above nonlinear equation. It is shown that a Miura-type transformation can be made to obtain the fifth order $mKdV$-type equation from the fifth order $KdV$-type equation. The spatial dependence of the fields involved is, however, not physically interesting from the point of view of the solitonic solutions. As a consequence, it seems that the fifth order $KdV$- and $mKdV$-type equations are completely independent nonlinear evolution equations in their own right.

  8. Double-Mutated 5-Enol Pyruvylshikimate-3-phosphate Synthase Protein Expressed in MZHG0JG Corn (Zea mays L.) Has No Impact on Toxicological Safety and Nutritional Composition.

    Science.gov (United States)

    Matthews, Bethany A; Launis, Karen L; Bauman, Patricia A; Juba, Nicole C

    2017-09-27

    MZHG0JG corn will offer growers the flexibility to alternate between herbicides with two different modes of action in their weed-management programs, helping to mitigate and manage the evolution of herbicide resistance in weed populations. The proteins conferring herbicide tolerence in MZHG0JG corn, double-mutated 5-enol pyruvylshikimate-3-phosphate synthase protein (mEPSPS) and phosphinothricin acetyltransferase (PAT), as well as the MZHG0JG corn event, have been assessed by regulatory authorities globally and have been determined to be safe for humans, animals, and the environment. In addition to the safety data available for these proteins, further studies were conducted on MZHG0JG corn to assess levels of mEPSPS as compared to previously registered genetically modified (GM) corn. The results support the conclusion of no impact on toxicological safety or nutritional composition.

  9. Fluid Ontologies in the Search for MH370

    OpenAIRE

    Bremner, L.

    2014-01-01

    This paper gives an account of the disappearance of Malaysian Airways Flight MH370 into the southern Indian Ocean in March 2014 and analyses the rare glimpses into remote ocean space this incident opened up. It follows the tenuous clues as to where the aeroplane might have come to rest after it disappeared from radar screens – seven satellite pings, hundreds of pieces of floating debris and six underwater sonic recordings – as ways of entering into and thinking about ocean space. The paper pa...

  10. Decreasing Kd uncertainties through the application of thermodynamic sorption models.

    Science.gov (United States)

    Domènech, Cristina; García, David; Pękala, Marek

    2015-09-15

    Radionuclide retardation processes during transport are expected to play an important role in the safety assessment of subsurface disposal facilities for radioactive waste. The linear distribution coefficient (Kd) is often used to represent radionuclide retention, because analytical solutions to the classic advection-diffusion-retardation equation under simple boundary conditions are readily obtainable, and because numerical implementation of this approach is relatively straightforward. For these reasons, the Kd approach lends itself to probabilistic calculations required by Performance Assessment (PA) calculations. However, it is widely recognised that Kd values derived from laboratory experiments generally have a narrow field of validity, and that the uncertainty of the Kd outside this field increases significantly. Mechanistic multicomponent geochemical simulators can be used to calculate Kd values under a wide range of conditions. This approach is powerful and flexible, but requires expert knowledge on the part of the user. The work presented in this paper aims to develop a simplified approach of estimating Kd values whose level of accuracy would be comparable with those obtained by fully-fledged geochemical simulators. The proposed approach consists of deriving simplified algebraic expressions by combining relevant mass action equations. This approach was applied to three distinct geochemical systems involving surface complexation and ion-exchange processes. Within bounds imposed by model simplifications, the presented approach allows radionuclide Kd values to be estimated as a function of key system-controlling parameters, such as the pH and mineralogy. This approach could be used by PA professionals to assess the impact of key geochemical parameters on the variability of radionuclide Kd values. Moreover, the presented approach could be relatively easily implemented in existing codes to represent the influence of temporal and spatial changes in geochemistry

  11. Gevrey regularity of the periodic gKdV equation

    Science.gov (United States)

    Hannah, Heather; Himonas, A. Alexandrou; Petronilho, Gerson

    2011-03-01

    Using the multilinear estimates, which were derived for proving well-posedness of the generalized Korteweg-de Vries (gKdV) equation, it is shown that if the initial data belongs to Gevrey space G, σ⩾1, in the space variable then the solution to the corresponding Cauchy problem for gKdV belongs also to G in the space variable. Moreover, the solution is not necessarily G in the time variable. However, it belongs to G3σ near 0. When σ=1 these are analytic regularity results for gKdV.

  12. Lagrangian Approach to Dispersionless KdV Hierarchy

    Directory of Open Access Journals (Sweden)

    Amitava Choudhuri

    2007-09-01

    Full Text Available We derive a Lagrangian based approach to study the compatible Hamiltonian structure of the dispersionless KdV and supersymmetric KdV hierarchies and claim that our treatment of the problem serves as a very useful supplement of the so-called r-matrix method. We suggest specific ways to construct results for conserved densities and Hamiltonian operators. The Lagrangian formulation, via Noether's theorem, provides a method to make the relation between symmetries and conserved quantities more precise. We have exploited this fact to study the variational symmetries of the dispersionless KdV equation.

  13. K&D Landscaping and Construction Information Sheet

    Science.gov (United States)

    K&D Landscaping and Construction (the Company) is located in Cazenovia, New York. The settlement involves renovation activities conducted at property constructed prior to 1978, located in Rochester, New York.

  14. Self-similar solutions for some nonlinear evolution equations: KdV, mKdV and Burgers equations

    Directory of Open Access Journals (Sweden)

    S.A. El-Wakil

    2016-02-01

    Full Text Available A method for solving three types of nonlinear evolution equations namely KdV, modified KdV and Burgers equations, with self-similar solutions is presented. The method employs ideas from symmetry reduction to space and time variables and similarity reductions for nonlinear evolution equations are performed. The obtained self-similar solutions of KdV and mKdV equations are related to Bessel and Airy functions whereas those of Burgers equation are related to the error and Hermite functions. These solutions appear as new types of solitary, shock and periodic waves. Also, the method can be applied to other nonlinear evolution equations in mathematical physics.

  15. Seismic and hydroacoustic analysis relevant to MH370

    Energy Technology Data Exchange (ETDEWEB)

    Stead, Richard J. [Los Alamos National Lab. (LANL), Los Alamos, NM (United States)

    2014-07-03

    The vicinity of the Indian Ocean is searched for open and readily available seismic and/or hydroacoustic stations that might have recorded a possible impact of MH370 with the ocean surface. Only three stations are identified: the IMS hydrophone arrays H01 and H08, and the Geoscope seismic station AIS. Analysis of the data from these stations shows an interesting arrival on H01 that has some interference from an Antarctic ice event, large amplitude repeating signals at H08 that obscure any possible arrivals, and large amplitude chaotic noise at AIS precludes any analysis at higher frequencies of interest. The results are therefore rather inconclusive but may point to a more southerly impact location within the overall Indian Ocean search region. The results would be more useful if they can be combined with any other data that are not readily available.

  16. Precision bounds on m$_{H}$ and m$_{t}$

    CERN Document Server

    del Águila, F; Quirós, Mariano

    1992-01-01

    We perform a fit to precise electroweak data to determine the Higgs and top masses. Penalty functions taking into account their production limits are included. We find ${\\displaystyle m_H=65^{+245}_{-4}\\ GeV}$ and ${\\displaystyle m_t=122^{+25}_{-20}\\ GeV}$. However whereas the top $\\chi^2$ distribution behaves properly near the minimum, the Higgs $\\chi^2$ distribution does not, indicating a statistical fluctuation or new physics. In fact no significative bound on the Higgs mass can be given at present. However, if the LEP accuracy is improved and the top is discovered in the preferred range of top masses, a meaningful bound on the Higgs mass could be obtained within the standard model framework.

  17. Bayesian methods in the search for MH370

    CERN Document Server

    Davey, Sam; Holland, Ian; Rutten, Mark; Williams, Jason

    2016-01-01

    This book demonstrates how nonlinear/non-Gaussian Bayesian time series estimation methods were used to produce a probability distribution of potential MH370 flight paths. It provides details of how the probabilistic models of aircraft flight dynamics, satellite communication system measurements, environmental effects and radar data were constructed and calibrated. The probability distribution was used to define the search zone in the southern Indian Ocean. The book describes particle-filter based numerical calculation of the aircraft flight-path probability distribution and validates the method using data from several of the involved aircraft’s previous flights. Finally it is shown how the Reunion Island flaperon debris find affects the search probability distribution.

  18. M(H) shape reconstruction using magnetic spectroscopy

    Energy Technology Data Exchange (ETDEWEB)

    Teliban, Iulian; Chemnitz, Steffen; Thede, Claas; Bechtold, Christoph; Mozooni, Babak [Institute for Materials Science, Christian-Albrechts-University Kiel, 24098 Kiel (Germany); Krause, Hans-Joachim [Peter Gruenberg Institute (PGI-8), Forschungszentrum Juelich, 52425 Juelich (Germany); Quandt, Eckhard, E-mail: eq@tf.uni-kiel.de [Institute for Materials Science, Christian-Albrechts-University Kiel, 24098 Kiel (Germany)

    2012-03-15

    Knowledge about the magnetization behavior M(H) is crucial for the use of magnetic materials in engineering applications. To date many systems exist that are able to measure the magnetization behavior, e.g. VSM, VCM, MOKE. In addition to their huge costs, complex and space-consuming measurement setup, large amount of preparatory work and restricted surface measurements are handicaps which restrict their field of application. Furthermore, the influence of additional physical quantities such as temperature, strain or pressure can only be investigated with great efforts. These influences are, however, of major importance in the development of magnetic sensor systems that are based on the change in magnetic properties. In this paper, a new measurement principle based on a frequency mixing technique is introduced for investigation of the shape of the magnetization curve of soft non-hysteretic magnetic materials. Based on the Taylor expansion of the magnetization curve and the spectral investigation of the inductively detected signal, a mathematical model for the reconstruction of M(H) is proposed. The model is both numerically and experimentally verified. It is shown that the magnetization curve of a nanocrystalline soft magnetic material used in this study can be reconstructed very accurately and the influence of an additional parameter, i.e. strain, can be investigated in detail as well. - Highlights: Black-Right-Pointing-Pointer Non-contact determination of magnetization curve shape of soft magnetic materials. Black-Right-Pointing-Pointer Alternative measurement technique to VSM/VCM or MOKE. Black-Right-Pointing-Pointer Mathematical groundwork about the relation between magnetic spectroscopy and magnetic permeability. Black-Right-Pointing-Pointer Strain monitoring using magnetic spectroscopy.

  19. The Use of Burst Frequency Offsets in the Search for MH370

    OpenAIRE

    Holland, Ian D.

    2017-01-01

    Malaysian Airlines flight MH370 veered off course unexpectedly during a scheduled trip from Kuala Lumpur to Beijing on the 7th of March 2014. MH370 was tracked via military radar into the Malacca Straits and after disappearing from radar was believed to have turned south towards the southern Indian Ocean before crashing approximately six hours later. This article presents details of the Burst Frequency Offsets (BFOs) associated with automated satellite communications messages received from MH...

  20. AMPLIFICATION OF AZOSPIRILLUM SP. JG3 GLPD GENE FRAGMENT USING DEGENERATE PRIMERS GENERATED BY WEB-BASED TOOLS

    Directory of Open Access Journals (Sweden)

    Stalis Norma Ethica

    2013-12-01

    Full Text Available Primaclade and In Silico web-based tools were used as a strategy to obtain the correct-size PCR amplicon targeting a fragment of gene encoding glycerol-3-phosphate dehydrogenase (glpD of Azospirillum sp. JG3. The bacterial strains are soil, Gram-negative PGPR (Plant-Growth Promoting Rhizobacteria isolated from an agricultural land in Purwokerto, Central Java, Indonesia, which have ability to produce several commercial enzymes. The aim is to obtain a pair of reliable degenerate primers from a limited number of glpD sequences from other Azospirilla retrieved in GenBank using bioinformatics approach. We demonstrated degenerate primer design that led to successful PCR amplification corresponding to the targeted DNA fragment. Homology analysis showed that the obtained DNA fragment is 61% and 99% similar to sn-glycerol-3-phosphate dehydrogenase genes of Azospirillum brasilense and Stenotrophomonas maltophili respectively.

  1. Efficient Delaunay Tessellation through K-D Tree Decomposition

    Energy Technology Data Exchange (ETDEWEB)

    Morozov, Dmitriy; Peterka, Tom

    2017-08-21

    Delaunay tessellations are fundamental data structures in computational geometry. They are important in data analysis, where they can represent the geometry of a point set or approximate its density. The algorithms for computing these tessellations at scale perform poorly when the input data is unbalanced. We investigate the use of k-d trees to evenly distribute points among processes and compare two strategies for picking split points between domain regions. Because resulting point distributions no longer satisfy the assumptions of existing parallel Delaunay algorithms, we develop a new parallel algorithm that adapts to its input and prove its correctness. We evaluate the new algorithm using two late-stage cosmology datasets. The new running times are up to 50 times faster using k-d tree compared with regular grid decomposition. Moreover, in the unbalanced data sets, decomposing the domain into a k-d tree is up to five times faster than decomposing it into a regular grid.

  2. Navigating the Legal Horizon: Lawyering the MH17 Disaster

    Directory of Open Access Journals (Sweden)

    Marieke de Hoon

    2017-04-01

    Full Text Available On 17 July 2014, Malaysia Airlines Flight MH17 was shot down over Eastern Ukraine, leaving no survivors. Since, victims’ relatives, States, and the wider public are trying to understand what happened, how it could happen, who is responsible, and how to address these responsibilities. The efforts to find justice have faced many complications and legal complexities. This article aims to provide insight into these legal and political complexities. In particular, it discusses the core legal questions of the criminal accountability of the perpetrators and the State responsibility of those States involved —Ukraine and Russia— through the legal doctrines of public international law and the European Convention on Human Rights. It further offers some core considerations relating to civil liability of States and airline carriers. In addition to providing insight into why the road to justice is long and arduous, the legal options available, and the specific challenges of each, the article also emphasises that having a legal option does not necessarily mean that it is also the best choice to use it. That choice is up to victims’ relatives and the States concerned. The article takes no position in this regard. Instead, it seeks to provide an analysis that may contribute to making such decisions in an informed manner.

  3. Genetic algorithm for investigating flight MH370 in Indian Ocean using remotely sensed data

    Science.gov (United States)

    Marghany, Maged; Mansor, Shattri; Shariff, Abdul Rashid Bin Mohamed

    2016-06-01

    This study utilized Genetic algorithm (GA) for automatic detection and simulation trajectory movements of flight MH370 debris. In doing so, the Ocean Surface Topography Mission(OSTM) on the Jason- 2 satellite have been used within 1 and half year covers data to simulate the pattern of Flight MH370 debris movements across the southern Indian Ocean. Further, multi-objectives evolutionary algorithm also used to discriminate uncertainty of flight MH370 imagined and detection. The study shows that the ocean surface current speed is 0.5 m/s. This current patterns have developed a large anticlockwise gyre over a water depth of 8,000 m. The multi-objectives evolutionary algorithm suggested that objects are existed on satellite data are not flight MH370 debris. In addition, multiobjectives evolutionary algorithm suggested that the difficulties to acquire the exact location of flight MH370 due to complicated hydrodynamic movements across the southern Indian Ocean.

  4. Classification of Dark Modified KdV Equation

    Science.gov (United States)

    Xiong, Na; Lou, Sen-Yue; Li, Biao; Chen, Yong

    2017-07-01

    The dark Korteweg-de Vries (KdV) systems are defined and classified by Kupershmidt sixteen years ago. However, there is no other classifications for other kinds of nonlinear systems. In this paper, a complete scalar classification for dark modified KdV (MKdV) systems is obtained by requiring the existence of higher order differential polynomial symmetries. Different to the nine classes of the dark KdV case, there exist twelve independent classes of the dark MKdV equations. Furthermore, for the every class of dark MKdV system, there is a free parameter. Only for a fixed parameter, the dark MKdV can be related to dark KdV via suitable Miura transformation. The recursion operators of two classes of dark MKdV systems are also given. Supported by the Global Change Research Program of China under Grant No. 2015Cb953904, National Natural Science Foundation of China under Grant Nos. 11675054, 11435005, 11175092, and 11205092 and Shanghai Knowledge Service Platform for Trustworthy Internet of Things (No. ZF1213) and K. C. Wong Magna Fund in Ningbo University

  5. Effects of Bacillus subtilis KD1 on broiler intestinal flora.

    Science.gov (United States)

    Wu, B Q; Zhang, T; Guo, L Q; Lin, J F

    2011-11-01

    A novel Bacillus subtilis KD1 strain was isolated and identified from healthy broilers, and its phylogenetic classification was subsequently analyzed. To evaluate its probiotic availability, its growth characteristics and tolerance for the gut environment were evaluated in vitro. The results suggest that B. subtilis KD1 is superior in secreting neutral protease and is highly tolerant of gastric acid and bile salt. In the logarithmic growth phase, the neutral protease reached a maximum of 1,369.3 U/mL. When all live bacteria had become spores in the broth, B. subtilis KD1 was freeze dried and fed to broilers at 10(9), 5 × 10(9), and 10(10) bacilli/kg of feed. The animal trial results suggest that the addition of the new strain significantly improved intestinal flora by increasing lactobacilli and reducing Escherichia coli (P < 0.05) as compared with the control; hence, B. subtilis KD1 is a promising probiotic organism in broilers.

  6. Biosorption of uranium and copper by Bacillus Sphaericus JG-A12 cells, spores and S-layer proteins embedded in sol-gel ceramics

    Energy Technology Data Exchange (ETDEWEB)

    Raff, J.; Soltmann, U.; Boettcher, H. [Arbeitsgruppe Funktionelle Schichten, GMBU e.V., Dresden (Germany); Matys, S.; Pompe, W. [Inst. fuer Materialwissenschaft, Technische Univ. Dresden (Germany); Selenska-Pobell, S.

    2002-05-01

    Vegetative cells, spores and stabilized S-layer sheets of B. sphaericus JG-A12 were embedded in SiO{sub 2} bulk particles using sol-gel techniques. In sorption experiments the metal binding capacity of the free biocomponents and the corresponding biological ceramics were compared. (orig.)

  7. Discipline and Murder: Panoptic Pedagogy and the Aesthetics of Detection in J.G. Ballard’s Running Wild

    Directory of Open Access Journals (Sweden)

    Macsiniuc Cornelia

    2017-06-01

    Full Text Available My essay proposes a reading of J.G. Ballard’s 1988 novella Running Wild as a cautionary crime story, a parable about the self-fulfilling prophecies of contemporary urban fears and about the “prisons” they create in a consumerist, technology- and media-dominated civilization. Interpreted in the light of Foucault’s concept of panopticism, Ballard’s gated community as a crime setting reveals how a disciplinary pedagogy meant to obtain “docile bodies,” masked under the socially elitist comfort of affluence and parental care, “brands” the inmate-children as potential delinquents and ultimately drives them to an act of “mass tyrannicide.” Ballard uses the murder story as a vehicle for the exploration of the paradoxical effects of a regime of total surveillance and of mediated presence, which, while expected to make “murder mystery” impossible, allows for the precession of the representation to the real (crime. The essay also highlights the way in which Ballard both cites and subverts some of the conventions of the Golden Age detective fiction, mainly by his rejection of the latter’s escapist ethos and by the liminal character of his investigator, at once part of a normalizing panoptic apparatus and eccentric to it, a “poetic figure” (Chesterton relying on imagination and “aestheticizing” the routines of the detection process.

  8. Analytic well-posedness of periodic gKdV

    Science.gov (United States)

    Himonas, A. Alexandrou; Petronilho, Gerson

    In the periodic case, it is proved that the Cauchy problem for the generalized Korteweg-de Vries equation (gKdV) is locally well-posed in a class of analytic functions that can be extended holomorphically in a symmetric strip of the complex plane around the x-axis. Thus, the uniform analyticity radius of the solution does not change as time progresses. Also, information about the regularity of the solution in the time variable is provided.

  9. Framing crisis response messages on Facebook: a second level agenda analysis of MH370

    National Research Council Canada - National Science Library

    Abang Ahmad, Dayang Aizza Maisha; Mohamad Ashari, Noratikah; Samani, Mus Chairil

    2017-01-01

    ...], this study seeks to analyse the message frames used by Malaysia Airlines System (MAS) in the formation of MH370 crisis response messages that that were disseminated directly to the organisations stakeholders on Facebook...

  10. Ds. JG F eenstra

    African Journals Online (AJOL)

    Test

    veroordeel. Dit laat mens onwillekeurig dink aan die beskuldiging wat teen Jesus ingebring was: dat Hy die duiwels sou uitwerp en die krankes sou genees deur Èeëlsebul, die owerste van die duiwels. Wat goed is word, omdat ons nou eenmaal onverdraagsaam en selfver- sekerd is, kwaad genoem. H. P. WoLMARANS.

  11. Electrical performance and chemical composition studies on original and falsified Ni-MH batteries

    OpenAIRE

    Alexandre Urbano; Jair Scarminio; Carlos Roberto Appoloni; Ricardo Floriano; Fábio Luiz Melquíades; Adenílson de Oliveira dos Santos; Paulo Rogério Catarini da Silva; Fábio Lopes; Rafael Bonacin de Oliveira

    2010-01-01

    We show in this paper that falsifications on technological products have hit even rechargeable nickel metal hydride batteries (Ni-MH). The electrical performance and the electrode chemical composition were investigated for authentic and falsified AAA Ni-MH batteries, purchased in the Londrina market, Paraná State. Battery charge capacities were measured at 0,2 C discharge rate and average electrical power was measured at 0.2 and 0.8 C discharge rate. To perform chemical composition analysis, ...

  12. On the nonlinear stability of mKdV breathers

    DEFF Research Database (Denmark)

    Alejo Plana, Miguel Angel; Muñoz, Claudio

    2012-01-01

    Breather modes of the mKdV equation on the real line are known to be elastic under collisions with other breathers and solitons. This fact indicates very strong stability properties of breathers. In this communication we describe a rigorous, mathematical proof of the stability of breathers under...... a class of small perturbations. Our proof involves the existence of a nonlinear equation satisfied by all breather profiles, and a new Lyapunov functional which controls the dynamics of small perturbations and instability modes. In order to construct such a functional, we work in a subspace of the energy...

  13. Bifurcation control in the Burgers-KdV equation

    Energy Technology Data Exchange (ETDEWEB)

    Maccari, Attilio [Technical Institute ' G. Cardano' , Piazza della Resistenza 1, 00015 Monterotondo (Rome) (Italy)], E-mail: solitone@yahoo.it

    2008-03-15

    We consider the bifurcation control for the forced Burgers-KdV equation by means of delay feedback linear terms. We use a perturbation method in order to find amplitude and phase modulation equations as well as external force-response and frequency-response curves. We observe in the resonance response a saddle-node bifurcation that leads to jump and hysteresis phenomena. We compare the uncontrolled and controlled systems and demonstrate that control terms can delay or remove the occurrence of the saddle-node bifurcation and reduce the amplitude peak of the resonant response.

  14. Adiabatic invariants of the extended KdV equation

    Energy Technology Data Exchange (ETDEWEB)

    Karczewska, Anna [Faculty of Mathematics, Computer Science and Econometrics, University of Zielona Góra, Szafrana 4a, 65-246 Zielona Góra (Poland); Rozmej, Piotr, E-mail: p.rozmej@if.uz.zgora.pl [Institute of Physics, Faculty of Physics and Astronomy, University of Zielona Góra, Szafrana 4a, 65-246 Zielona Góra (Poland); Infeld, Eryk [National Centre for Nuclear Research, Hoża 69, 00-681 Warszawa (Poland); Rowlands, George [Department of Physics, University of Warwick, Coventry, CV4 7A (United Kingdom)

    2017-01-30

    When the Euler equations for shallow water are taken to the next order, beyond KdV, momentum and energy are no longer exact invariants. (The only one is mass.) However, adiabatic invariants (AI) can be found. When the KdV expansion parameters are zero, exact invariants are recovered. Existence of adiabatic invariants results from general theory of near-identity transformations (NIT) which allow us to transform higher order nonintegrable equations to asymptotically equivalent (when small parameters tend to zero) integrable form. Here we present a direct method of calculations of adiabatic invariants. It does not need a transformation to a moving reference frame nor performing a near-identity transformation. Numerical tests show that deviations of AI from constant values are indeed small. - Highlights: • We suggest a new and simple method for calculating adiabatic invariants of second order wave equations. • It is easy to use and we hope that it will be useful if published. • Interesting numerics included.

  15. Is there a hot electroweak phase transition at m$_{H}$ $\\geq$ m$_{W}$?

    CERN Document Server

    Kajantie, Keijo; Rummukainen, K; Shaposhnikov, Mikhail E

    1996-01-01

    We provide non-perturbative evidence for the fact that there is no hot electroweak phase transition at large Higgs masses, m_H = 95, 120 and 180 GeV. This means that the line of first order phase transitions separating the symmetric and broken phases at small m_H has an end point m_{H,c}. In the minimal standard electroweak theory 70 GeV <m_{H c}< 95 GeV and most likely m_{H,c} \\approx 80 GeV. If the electroweak theory is weakly coupled and the Higgs boson is found to be heavier than the critical value (which depends on the theory in question), cosmological remnants from the electroweak epoch are improbable.

  16. A multilevel adaptive mesh generation scheme using Kd-trees

    Directory of Open Access Journals (Sweden)

    Alfonso Limon

    2009-04-01

    Full Text Available We introduce a mesh refinement strategy for PDE based simulations that benefits from a multilevel decomposition. Using Harten's MRA in terms of Schroder-Pander linear multiresolution analysis [20], we are able to bound discontinuities in $mathbb{R}$. This MRA is extended to $mathbb{R}^n$ in terms of n-orthogonal linear transforms and utilized to identify cells that contain a codimension-one discontinuity. These refinement cells become leaf nodes in a balanced Kd-tree such that a local dyadic MRA is produced in $mathbb{R}^n$, while maintaining a minimal computational footprint. The nodes in the tree form an adaptive mesh whose density increases in the vicinity of a discontinuity.

  17. Delivering integrated HAZUS-MH flood loss analyses and flood inundation maps over the Web

    Science.gov (United States)

    Hearn,, Paul P.; Longenecker, Herbert E.; Aguinaldo, John J.; Rahav, Ami N.

    2013-01-01

    Catastrophic flooding is responsible for more loss of life and damages to property than any other natural hazard. Recently developed flood inundation mapping technologies make it possible to view the extent and depth of flooding on the land surface over the Internet; however, by themselves these technologies are unable to provide estimates of losses to property and infrastructure. The Federal Emergency Management Agency’s (FEMA's) HAZUS-MH software is extensively used to conduct flood loss analyses in the United States, providing a nationwide database of population and infrastructure at risk. Unfortunately, HAZUS-MH requires a dedicated Geographic Information System (GIS) workstation and a trained operator, and analyses are not adapted for convenient delivery over the Web. This article describes a cooperative effort by the US Geological Survey (USGS) and FEMA to make HAZUS-MH output GIS and Web compatible and to integrate these data with digital flood inundation maps in USGS’s newly developed Inundation Mapping Web Portal. By running the computationally intensive HAZUS-MH flood analyses offline and converting the output to a Web-GIS compatible format, detailed estimates of flood losses can now be delivered to anyone with Internet access, thus dramatically increasing the availability of these forecasts to local emergency planners and first responders.

  18. Overexpressing MhNPR1 in transgenic Fuji apples enhances resistance to apple powdery mildew.

    Science.gov (United States)

    Chen, Xiu-Kong; Zhang, Ji-Yu; Zhang, Zhen; Du, Xiao-Li; Du, Bei-Bei; Qu, Shen-Chun

    2012-08-01

    Fuji is susceptible to fungal diseases like apple powdery mildew. Non-expressor of pathogenesis-related gene 1 (NPR1) plays a key role in regulating salicylic acid (SA)-mediated systemic acquired resistance (SAR). Previous studies show that overexpressing the Malus hupehensis-derived NPR1 (MhNPR1) gene in tobacco induces the transcript expression of pathogenesis-related genes (PRs) and resistance to the fungus Botrytis cinerea. In this study we introduced the MhNPR1 gene into the 'Fuji' apple via Agrobacterium-mediated transformation. Four transgenic apple lines were verified by PCR and RT-PCR. The semi-quantitative RT-PCR results showed that transcript overexpression of the MhNPR1 gene induced the expression of MdPRs and MdMLO genes known to interact with powdery mildew. Furthermore, the transgenic apple plants resisted infection by apple powdery mildew better than the wild-type plants. As a result, transcript overexpression of the MhNPR1 gene induced SAR and enhanced the Fuji apple's resistance to fungal disease.

  19. Data of evolutionary structure change: 1AVBA-1V6MH [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1AVBA-1V6MH 1AVB 1V6M A H SNDASFNVETFNKT--NLILQGDATVSSEGHLLLTNVKG...ryChain> 1AVB A 1AVBA GSRPK---LKG...ryChain> 1AVB A 1AVBA GLFNTTNYDRD...dbChain>A 1AVBA LLYPSSEEKCH 1AVB A 1AVBA ATS

  20. Crisis Response Strategy and Crisis Types Suitability: A Preliminary Study on MH370

    National Research Council Canada - National Science Library

    Mohamad Ashari, Noratikah; Abang Ahmad, Dayang Aizza Maisha; Samani, Mus Chairil

    2017-01-01

    ... of social media as a platform for the organisation in crisis to reach out to its stakeholders. This preliminary paper studies the MH370 crisis in light of Coombs [1] Situational Crisis Communication Theory (SCCT). It aims to discuss the suitability of the CRS applied by Malaysia Airlines System (MAS) with the crisis type/s that was/were experien...

  1. ac MH loop measurements on Mn doped YBa2Cu3O7–δ ...

    Indian Academy of Sciences (India)

    Unknown

    ac MH loop measurements on Mn doped YBa2Cu3O7–δ superconductors. E ISAAC SAMUEL* and V SESHU BAI†. Mechanical Metallurgy Division, Indira Gandhi Centre for Atomic Research, Kalpakkam 603 102, India. †School of Physics, University of Hyderabad, Hyderabad 500 046, India. MS received 16 February 2005.

  2. M(H) dependence and size distribution of SPIONs measured by atomic magnetometry

    CERN Document Server

    Colombo, Simone; Grujic, Zoran D; Dolgovskiy, Vladimir; Weis, Antoine

    2016-01-01

    We demonstrate that the quasistatic recording of the magnetic excitation function M(H) of superparamagnetic iron oxide magnetic nanoparticle (SPION) suspensions by an atomic magnetometer allows a precise determination of the sample's iron mass content mFe and the particle size distribution.

  3. Extended Mixed-Efects Item Response Models with the MH-RM Algorithm

    Science.gov (United States)

    Chalmers, R. Philip

    2015-01-01

    A mixed-effects item response theory (IRT) model is presented as a logical extension of the generalized linear mixed-effects modeling approach to formulating explanatory IRT models. Fixed and random coefficients in the extended model are estimated using a Metropolis-Hastings Robbins-Monro (MH-RM) stochastic imputation algorithm to accommodate for…

  4. A novel nicotine catabolic plasmid pMH1 in Pseudomonas sp. strain HF-1.

    Science.gov (United States)

    Wang, Meizhen; Yang, Guiqin; Min, Hang; Lv, Zhenmei

    2009-03-01

    Attempts were made to acquire a plasmid-loss mutant via various methods (spontaneous mutation, SDS, and mitomycin C), among which the method involving mitomycin C (10 microg/mL) has been proven successful. Concomitant with the loss of the plasmid in Pseudomonas sp. strain HF-1, the cured derivative was identified as having a nicotine-negative (Nic-) phenotype, named mutant strain 6-13 (Nic-). After plasmids were transferred from strain HF-1 (named plasmid pMH1) to the mutant strain 6-13, the mutant strain acquired nicotine-degrading ability, called 6-13 transformant (Nic+). There were no differences in growth or nicotine-degrading efficiency between strain HF-1 (wild-type strain) and strain 6-13 transformant. After pMH1 was transferred to Escherichia coli strain Top10 (Nic-), a distant relative of Pseudomonas, it also gained nicotine-degrading ability, showing the highest nicotine degradation efficiency at pH 7.0, the optimal pH for growth of E. coli. The hsp gene, which encodes 6-hydroxy-3-succinoylpyridine hydroxylase, is involved in nicotine degradation in Pseudomonas putida strain S16 and was present in pMH1 but not in pAO1, the well-known nicotine degradation plasmid in Arthrobacter nicotinovorans. It was demonstrated that plasmid pMH1 is a novel nicotine-degrading plasmid.

  5. An application of the decomposition method for the generalized KdV and RLW equations

    CERN Document Server

    Kaya, D

    2003-01-01

    We consider solitary-wave solutions of the generalized regularized long-wave (RLW) and Korteweg-de Vries (KdV) equations. We prove the convergence of Adomian decomposition method applied to the generalized RLW and KdV equations. Then we obtain the exact solitary-wave solutions and numerical solutions of the generalized RLW and KdV equations for the initial conditions. The numerical solutions are compared with the known analytical solutions. Their remarkable accuracy are finally demonstrated for the generalized RLW and KdV equations.

  6. New solutions for conformable fractional Boussinesq and combined KdV-mKdV equations using Jacobi elliptic function expansion method

    Science.gov (United States)

    Tasbozan, Orkun; Çenesiz, Yücel; Kurt, Ali

    2016-07-01

    In this paper, the Jacobi elliptic function expansion method is proposed for the first time to construct the exact solutions of the time conformable fractional two-dimensional Boussinesq equation and the combined KdV-mKdV equation. New exact solutions are found. This method is based on Jacobi elliptic functions. The results obtained confirm that the proposed method is an efficient technique for analytic treatment of a wide variety of nonlinear conformable time-fractional partial differential equations.

  7. Circumsporozoite Protein-Specific Kd-Restricted CD8+ T Cells Mediate Protective Antimalaria Immunity in Sporozoite-Immunized MHC-I-Kd Transgenic Mice

    Directory of Open Access Journals (Sweden)

    Jing Huang

    2014-01-01

    Full Text Available Although the roles of CD8+ T cells and a major preerythrocytic antigen, the circumsporozoite (CS protein, in contributing protective antimalaria immunity induced by radiation-attenuated sporozoites, have been shown by a number of studies, the extent to which these players contribute to antimalaria immunity is still unknown. To address this question, we have generated C57BL/6 (B6 transgenic (Tg mice, expressing Kd molecules under the MHC-I promoter, called MHC-I-Kd-Tg mice. In this study, we first determined that a single immunizing dose of IrPySpz induced a significant level of antimalaria protective immunity in MHC-I-Kd-Tg mice but not in B6 mice. Then, by depleting various T-cell subsets in vivo, we determined that CD8+ T cells are the main mediator of the protective immunity induced by IrPySpz. Furthermore, when we immunized (MHC-I-Kd-Tg × CS-Tg F1 mice with IrPySpz after crossing MHC-I-Kd-Tg mice with PyCS-transgenic mice (CS-Tg, which are unable to mount PyCS-specific immunity, we found that IrPySpz immunization failed to induce protective antimalaria immunity in (MHC-I-Kd-Tg × CS-Tg F1 mice, thus indicating the absence of PyCS antigen-dependent immunity in these mice. These results indicate that protective antimalaria immunity induced by IrPySpz in MHC-I-Kd-Tg mice is mediated by CS protein-specific, Kd-restricted CD8+ T cells.

  8. Tijdstip van MH-bespuiting in uien en het effect van stikstof en oogsttijdstip op kale uien

    NARCIS (Netherlands)

    Brink, van den L.; Broek, van den R.C.F.M.

    2011-01-01

    In de praktijk zijn er in de bewaring regelmatig problemen met spruitlustige en kale uien. In 2007 heeft PPO-agv in Lelystad twee proeven uitgevoerd: een proef waarin op verschillende tijdstippen MH is gespoten met als doel om na te gaan wat het optimale moment van MH-toediening is; een proef waarin

  9. Crisis leadership by mayors: a qualitative content analysis of newspapers and social media on the MH17 disaster.

    NARCIS (Netherlands)

    Jong, W.; Dückers, M.L.A.; Velden, P.G. van der

    2016-01-01

    Malaysia Airlines Flight MH17 crashed in the Ukraine on 17 July 2014 with 193 Dutch passengers on board. The present study assessed which MH17-related activities (or absence of certain activities) of 54 mayors from the Netherlands were mentioned in (social) media and if and how they were evaluated.

  10. Moyal noncommutative integrability and the Burgers-KdV mapping

    Energy Technology Data Exchange (ETDEWEB)

    Sedra, M.B. [International Centre for Theoretical Physics, Trieste (Italy) and Virtual African Center for Basic Sciences and Technology, VACBT, Focal point: Lab/UFR-Physique des Haute Energies, Faculte des Sciences, Rabat (Morocco) and Groupement National de Physique de Hautes Energies, GNPHE, Rabat (Morocco) and Universite Ibn Tofail, Faculte des Sciences, Departement de Physique, Laboratoire de Physique de la Matiere et Rayonnement - LPMR, Kenitra (Morocco)]. E-mail: sedra@ictp.it

    2006-04-24

    The Moyal momentum algebra, studied in previous occasions, is once again used to discuss some important aspects of NC integrable models and 2d conformal field theories. Among the results presented, we setup algebraic structures and makes useful convention notations leading to extract nontrivial properties of the Moyal momentum algebra. We study also the Lax pair building mechanism for particular examples namely, the noncommutative KdV and Burgers systems. We show in a crucial step that these two systems are mapped to each others through the following crucial mapping -bar {sub t2}-bar -bar {sub t3}=-bar {sub t2}-bar {sub x}+{alpha}-bar {sub x}{sup 3}. This makes a strong constraint on the NC Burgers system which corresponds to linearizing its associated differential equation. From the CFT's point of view, this constraint equation is nothing but the analogue of the conservation law of the conformal current. We believe that the considered mapping might help to bring new insights towards understanding the integrability of noncommutative 2d-systems.

  11. Local well-posedness for the fifth-order KdV equations on T

    Science.gov (United States)

    Kwak, Chulkwang

    2016-05-01

    This paper is a continuation of the paper Low regularity Cauchy problem for the fifth-order modified KdV equations on T[7]. In this paper, we consider the fifth-order equation in the Korteweg-de Vries (KdV) hierarchy as following:

  12. Fractional rate of degradation (kd) of starch in the rumen and its ...

    African Journals Online (AJOL)

    Fractional rate of degradation (kd) of starch in the rumen and its relation to in vivo rumen and total digestibility. ... Estimates of kd for starch was obtained on 19 starch sources originating from barley, wheat, oat, maize and peas and treated in different ways both chemically and physically. The starch sources were fed in mixed ...

  13. Heat shock proteins (HSP-72 kd) in thermotolerant rat sciatic nerves

    NARCIS (Netherlands)

    Hoogeveen, J. F.; van der Kracht, A. H.; Wondergem, J.; Haveman, J.

    1993-01-01

    Localized heating of the rat sciatic nerve over a length of 5 mm for 30 min at 43 degrees C resulted in the production of heat shock protein 72 kd in every nucleated cell and in the induction of thermotolerance in the heated area. HSP-72 kd was never detected in axons. Heat treatment (30 min, 45

  14. Various methods for solving time fractional KdV-Zakharov-Kuznetsov equation

    Science.gov (United States)

    Guner, Ozkan; Aksoy, Esin; Bekir, Ahmet; Cevikel, Adem C.

    2016-06-01

    This paper presents the exact analytical solution of the (3+1)-dimensional time fractional KdV-Zakharov-Kuznetsov (KdV-ZK) equation with the help of the Kudryashov method, the exp-function method and the functional variable method. The fractional derivatives are described in Jumarie's sense.

  15. Fractional rate of degradation (kd) of starch in the rumen and its ...

    African Journals Online (AJOL)

    Ruminal starch pool was estimated from rumen evacuation and starch flow was estimated by duodenal and faeces sampling. Fractional rate of rumen degradation was estimated from the equation [kd = rumen degraded/rumen pool] and rumen and total digestibility of starch from flow measurements. The relation between kd ...

  16. New exact solutions to the generalized KdV equation with ...

    Indian Academy of Sciences (India)

    Abstract. In this paper, by using a transformation and an application of Fan subequation, we study a class of generalized Korteweg–de Vries (KdV) equation with generalized evolution. As a result, more types of exact solutions to the generalized KdV equation with generalized evolution are obtained, which include more ...

  17. On integrability of a (2+1)-dimensional perturbed KdV equation

    CERN Document Server

    Sakovich, S Yu

    1998-01-01

    A (2+1)-dimensional perturbed KdV equation, recently introduced by W.X.Ma and B.Fuchssteiner, is proven to pass the Painleve test for integrability well, and its 4x4 Lax pair with two spectral parameters is found. The results show that the Painleve classification of coupled KdV equations by A.Karasu should be revised.

  18. Ds0⁎±(2317 and KD scattering from Bs0 decay

    Directory of Open Access Journals (Sweden)

    Miguel Albaladejo

    2015-06-01

    Full Text Available We study the B¯s0→Ds−(KD+ weak decay, and look at the KD invariant mass distribution, for which we use recent lattice QCD results for the KD interaction from where the Ds0⁎(2317 resonance appears as a KD bound state. Since there are not yet experimental data on this reaction, in a second step we propose an analysis method to obtain information on the Ds0⁎(2317 resonance from the future experimental KD mass distribution in this decay. For this purpose, we generate synthetic data taking a few points from our theoretical distribution, to which we add a 5% or 10% error. With this analysis method, we prove that one can obtain from these “data” the existence of a bound KD state, the KD scattering length and effective range, and most importantly, the KD probability in the wave function of the bound state obtained, which was found to be largely dominant in lattice QCD studies. This means that one can obtain information on the nature of the Ds0⁎+(2317 resonance from the implementation of this experiment, in the line of finding the structure of resonances, which is one of the main aims in hadron spectroscopy.

  19. Criticality assessment of basket designs for use in the MH-1A shipping cask

    Energy Technology Data Exchange (ETDEWEB)

    Thomas, J.T.

    1982-04-01

    An analytical study is made of a proposed stainless steel basket to be used in the MH-1A cask for the shipment of National Bureau of Standards reactor fuel elements. The use of B/sub 4/C in the basket as a primary control for the prevention of criticality is shown to be effective but not necessary. A basket fabricated of 0.635-cm-thick stainless steel provides a sufficient margin of subcriticality.

  20. CRISIS COMMUNICATION: A STUDY OF MALAYSIA AIRLINES' RESPONSE TO THE MH17 CRISIS

    OpenAIRE

    King, Laura Holdt; Kitchen, Nikolaj Howard; Misimovic, Elvin; Rasmussen, Anne H.W.; Andersen, Kamilla Haugaard

    2015-01-01

    This project investigates Malaysia Airlines communicative efforts in the MH17-crisis. The theoretical frame consists of W. Timothy Coombs’ Situational Crisis Communication Theory (SCCT) and Image Restoration Theory by William L. Benoit. The Coombs’ analysis entails looking at the contextual factors to develop relevant strategies. Benoit is used as a framework in the textual analysis to explore which strategies MAS employed - scrutinising press releases from the first 48 hours. We compar...

  1. COMPARATIVE LIFE CYCLE ASSESSMENT OF ALCALINE CELLS AND NI-MH RECHARGEABLE BATTERIES

    OpenAIRE

    Menet, Jean-Luc; Gruescu, Ion-Cosmin

    2013-01-01

    5 pages; International audience; The present study presents some results obtained by applying the LCA methodology to evaluate the environmental footprint of alkaline cells and Ni-MH batteries. The approach is motivated by the increasing number on markets of electronic systems needing local and portable electricity. The proposed study focuses on a comparison between these two elements on the basis of the same produced energy. The environmental impacts are evaluated by using the Eco-invent 2.0 ...

  2. Crisis Response Strategy and Crisis Types Suitability: A Preliminary Study on MH370

    Directory of Open Access Journals (Sweden)

    Mohamad Ashari Noratikah

    2017-01-01

    Full Text Available In time of crisis, the organisation’s tactic in responding to the crisis according to its type/s may significantly affect the organisation’s effort to survive its reputational damages. The study of crisis response strategy (CRS requires further exploration within the Malaysian context, moreso with the greater and apparent use of social media as a platform for the organisation in crisis to reach out to its stakeholders. This preliminary paper studies the MH370 crisis in light of Coombs [1] Situational Crisis Communication Theory (SCCT. It aims to discuss the suitability of the CRS applied by Malaysia Airlines System (MAS with the crisis type/s that was/were experienced by the organisation. Hence, the need for this paper to investigate the crisis type/s of MH370 and examines the CRS applied by MAS by content analysing media statements that were disseminated directly to the organisation’s stakeholders on Facebook during the first day of the crisis. Results ultimately show an interesting analysis to the crisis type of MH370, and the suitability of the CRS applied by MAS for that matter.

  3. Spent NiMH batteries: Characterization and metal recovery through mechanical processing

    Science.gov (United States)

    Bertuol, Daniel Assumpção; Bernardes, Andréa Moura; Tenório, Jorge Alberto Soares

    The growing concern about the environment, associated with the continuous increase in the production of electronic equipment, such as computers, cell phones, mobile devices and consequently batteries, has induced research to develop new technologies to recycle the huge numbers of spent batteries generated in the last few years. The amount of spent NiMH batteries will tend to grow continually over the next few years. These batteries have in their chemical composition, valuable metals such as Ni, Co and rare earths. In the first stage of this work a characterization of NiMH batteries was done. Batteries from different brands and models were disembled and their components were characterized in relation to their chemical composition and main phases. In a second stage of this work, a sample of spent NiMH batteries was milled and the polymeric and metallic fractions were magnetically separated. The results obtained demonstrate that the recycling study, aimed at the recovery of Ni, Co and rare earths, is viable due to the great amount of these metals that are present batteries. It also demonstrates that magnetic separation is a very efficient process to recovery nickel alloys. However the effects of cadmium contamination (originating from fake batteries) will cause the recycling processes to be re-evaluated.

  4. Alice-Bob Physics: Coherent Solutions of Nonlocal KdV Systems.

    Science.gov (United States)

    Lou, S Y; Huang, Fei

    2017-04-13

    In natural and social science, many events happened at different space-times may be closely correlated. Two events, A (Alice) and B (Bob) are defined correlated if one event is determined by another, say, [Formula: see text] for suitable [Formula: see text] operators. Taking KdV and coupled KdV systems as examples, we can find some types of models (AB-KdV systems) to exhibit the existence on the correlated solutions linked with two events. The idea of this report is valid not only for physical problems related to KdV systems but also for problems described by arbitrary continuous or discrete models. The parity and time reversal symmetries are extended to shifted parity and delayed time reversal. The new symmetries are found to be useful not only to establish AB-systems but also to find group invariant solutions of numerous AB-systems. A new elegant form of the N-soliton solutions of the KdV equation and then the AB-KdV systems is obtained. A concrete AB-KdV system derived from the nonlinear inviscid dissipative and barotropic vorticity equation in a β-plane channel is applied to the two correlated monople blocking events which is responsible for the snow disaster in the winter of 2007/2008 happened in Southern China.

  5. MH(2)c: Characterization of major histocompatibility α-helices - an information criterion approach.

    Science.gov (United States)

    Hischenhuber, B; Frommlet, F; Schreiner, W; Knapp, B

    2012-07-01

    Major histocompatibility proteins share a common overall structure or peptide binding groove. Two binding groove domains, on the same chain for major histocompatibility class I or on two different chains for major histocompatibility class II, contribute to that structure that consists of two α-helices ("wall") and a sheet of eight anti-parallel beta strands ("floor"). Apart from the peptide presented in the groove, the major histocompatibility α-helices play a central role for the interaction with the T cell receptor. This study presents a generalized mathematical approach for the characterization of these helices. We employed polynomials of degree 1 to 7 and splines with 1 to 2 nodes based on polynomials of degree 1 to 7 on the α-helices projected on their principal components. We evaluated all models with a corrected Akaike Information Criterion to determine which model represents the α-helices in the best way without overfitting the data. This method is applicable for both the stationary and the dynamic characterization of α-helices. By deriving differential geometric parameters from these models one obtains a reliable method to characterize and compare α-helices for a broad range of applications. Program title: MH(2)c (MH helix curves) Catalogue identifier: AELX_v1_0 Program summary URL:http://cpc.cs.qub.ac.uk/summaries/AELX_v1_0.html Program obtainable from: CPC Program Library, Queen's University, Belfast, N. Ireland Licensing provisions: Standard CPC licence, http://cpc.cs.qub.ac.uk/licence/licence.html No. of lines in distributed program, including test data, etc.: 327 565 No. of bytes in distributed program, including test data, etc.: 17 433 656 Distribution format: tar.gz Programming language: Matlab Computer: Personal computer architectures Operating system: Windows, Linux, Mac (all systems on which Matlab can be installed) RAM: Depends on the trajectory size, min. 1 GB (Matlab) Classification: 2.1, 4.9, 4.14 External routines: Curve Fitting

  6. Division algebras and extended N = 2, 4, 8 super KdVs

    CERN Document Server

    Carrion, H L; Toppan, F

    2003-01-01

    The first example of an N = 8 supersymmetric extension of the KdV equation is here explicitly constructed. It involves 8 bosonic and 8 fermionic fields. It corresponds to the unique N = 8 solution based a generalized hamiltonian dynamics with (generalized) Poisson brackets given by the Non-associate N = 8 Superconformal Algebra. The complete list of inequivalent classes of parametric-dependent N = 3 and N = 4 superKdVs obtained from the 'Non-associative N= 8 SCA' is also furnished. Furthermore, a fundamental domain characterizing the class of inequivalent N = 4 superKdVs based on the 'minimal N = 4 SCA' is given.

  7. Global well-posedness of NLS-KdV systems for periodic functions

    Directory of Open Access Journals (Sweden)

    Carlos Matheus

    2007-01-01

    Full Text Available We prove that the Cauchy problem of the Schrodinger-Korteweg-deVries (NLS-KdV system for periodic functions is globally well-posed for initial data in the energy space $H^1imes H^1$. More precisely, we show that the non-resonant NLS-KdV system is globally well-posed for initial data in $H^s(mathbb{T}imes H^s(mathbb{T}$ with $s>11/13$ and the resonant NLS-KdV system is globally well-posed with $s>8/9$. The strategy is to apply the I-method used by Colliander, Keel, Staffilani, Takaoka and Tao. By doing this, we improve the results by Arbieto, Corcho and Matheus concerning the global well-posedness of NLS-KdV systems.

  8. Data of evolutionary structure change: 1T5KD-2AANA [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1T5KD-2AANA 1T5K 2AAN D A DKATIPSESPFAAAEVADGAIVVDIA----KMKYETPELHVKVGDTVTWIN--REA...KGEELAFDKTELTVSAGQTVTIRFKNNSAVQQHNWILVKGGEAEAANIANAGLSAGPAANYLPADKSNIIAESPLANGNETVEVTFTAPAAGTYLYICTV...2AAN A 2AANA VEVTFTAPAAGT...2AAN A 2AANA YICTVPGHYPLMQ

  9. Functional Variable Method for conformable fractional modified KdV-ZK equation and Maccari system

    National Research Council Canada - National Science Library

    Yücel Çenesiz; Orkun Tasbozan; Ali Kurt

    2017-01-01

    .... So Maccari system has great application in mentioned areas. The modified KdV is ion acoustic perturbations evolution model in a plasma with two negative ion components which have different temperatures...

  10. Exact Traveling Wave Solutions for Wick-Type Stochastic Schamel KdV Equation

    Directory of Open Access Journals (Sweden)

    Hossam A. Ghany

    2014-01-01

    Full Text Available F-expansion method is proposed to seek exact solutions of nonlinear partial differential equations. By means of Hermite transform, inverse Hermite transform, and white noise analysis, the variable coefficients and Wick-type stochastic Schamel KdV equations are completely described. Abundant exact traveling wave solutions for variable coefficients Schamel KdV equations are given. These solutions include exact stochastic Jacobi elliptic functions, trigonometric functions, and hyperbolic functions solutions.

  11. Significance Of 30 KD Protein As A Diagnostic Marker In CSF Of tuberculour Meningits

    Directory of Open Access Journals (Sweden)

    Kashyap R.S

    2001-01-01

    Full Text Available Tuberculous meningitis (TBM is a sub acute or chronic inflammation of the cerebral meninges caused by tubercule bacilli, the diagnosis for which is still very intricate. To establish a rapid diagnosis, we used Sodium dodecyl suplhate polyacrylamide gel electrophoresis (SDS-PAGE for the detection of marker protein in CSF specific to TBM patients. CSF was collected by standard lumbar puncture technique. Polyclonal antibody was raised against sonicated M.tuberculosis of H37RV in rabbit. 145 CSF samples were collected for this study over a period of two and half years which included 44 suspected and one proven case of TBM. In this communication we have investigated for a possible presence of a marker protein(s in cerebrospinal fluid (CSF of TBM patients. Two bands, a 30kd and a 14kd were detected. The 30kd band was observed in 92% cases of TBM patients. The 14kd band was not much of diagnostic importance since it was found in only about 45%. None of the control group patients had these protein bands. The 30 kd protein band either disappeared or became faint on anti-TB medication. To evaluate whether the eluted 30 kd protein was a mycobacterium tuberculosis product, gel retardation assay was also performed. The 30kd protein did not react with the polyclonal antisera. The CSF biochemical picture correlated well with the presence of this protein band. This study suggests that 30kd protein band observed in CSF is not a Mycobacterium product and is not only an important diagnostic marker for early diagnosis of TBM but may also be useful for monitoring the post treatment phase.

  12. Lanthanide-alkali double sulfate precipitation from strong sulfuric acid NiMH battery waste leachate.

    Science.gov (United States)

    Porvali, Antti; Wilson, Benjamin P; Lundström, Mari

    2018-01-01

    In NiMH battery leaching, rare earth element (REE) precipitation from sulfate media is often reported as being a result of increasing pH of the pregnant leach solution (PLS). Here we demonstrate that this precipitation is a phenomenon that depends on both Na+ and SO42- concentrations and not solely on pH. A two-stage leaching for industrially crushed NiMH waste is performed: The first stage consists of H2SO4 leaching (2 M H2SO4, L/S = 10.4, V = 104 ml, T = 30 °C) and the second stage of H2O leaching (V = 100 ml, T = 25 °C). Moreover, precipitation experiments are separately performed as a function of added Na2SO4 and H2SO4. During the precipitation, higher than stoichiometric quantities of Na to REE are utilized and this increase in both precipitation reagent concentrations results in an improved double sulfate precipitation efficiency. The best REE precipitation efficiencies (98-99%) - achieved by increasing concentrations of H2SO4 and Na2SO4 by 1.59 M and 0.35 M, respectively - results in a 21.8 times Na (as Na2SO4) and 58.3 times SO4 change in stoichiometric ratio to REE. Results strongly indicate a straightforward approach for REE recovery from NiMH battery waste without the need to increase the pH of PLS. Copyright © 2017 The Authors. Published by Elsevier Ltd.. All rights reserved.

  13. Crisis Response Strategy and Crisis Types Suitability: A Preliminary Study on MH370

    OpenAIRE

    Mohamad Ashari Noratikah; Abang Ahmad Dayang Aizza Maisha; Samani Mus Chairil

    2017-01-01

    In time of crisis, the organisation’s tactic in responding to the crisis according to its type/s may significantly affect the organisation’s effort to survive its reputational damages. The study of crisis response strategy (CRS) requires further exploration within the Malaysian context, moreso with the greater and apparent use of social media as a platform for the organisation in crisis to reach out to its stakeholders. This preliminary paper studies the MH370 crisis in light of Coombs [1] Si...

  14. A Benefit Analysis of Using a Low-Cost Flight Simulator for the MH-60R

    Science.gov (United States)

    2016-09-01

    SNAs are sent to Primary Flight Training in either Corpus Christi, Texas , or Milton, Florida, to learn how to fly the T-6 fixed wing training aircraft...more it will have the ability to be utilized, and the lower the utilization rate will be for the OFT and WTT. One way to gauge the effectiveness of...Naval Flight Manual Navy Model MH-60R Helicopter. A1-H60RA-NFM-000. Patuxent River , MD: Naval Air Systems Command. 58 THIS PAGE INTENTIONALLY

  15. Tracing the drift of MH370 debris throughout the Indian Ocean

    Science.gov (United States)

    Biastoch, Arne; Durgadoo, Jonathan V.; Rühs, Siren

    2017-04-01

    On 8 March 2014, a missing Boeing 777 of Malaysia Airlines (MH370) disappeared from radar screens. Since then, extensive search efforts aim to find the missing plane in the southeastern Indian Ocean. Starting with a flaperon washed up at La Réunion in July 2015, several pieces of debris were found at different shores at islands and African coasts in the southwestern Indian Ocean. Ocean currents were examined to understand the drift paths of debris throughout the Indian Ocean, and in consequence to identify the location of MH370. Here we present a series of Lagrangian analyses in which we follow particles representing virtual pieces of debris advected in an operational high-resolution ocean model. Of particular importance is the lare-scale influence of surface waves through Stokes drift. Large number of particles are analysed in statistical approaches to provide most likely starting locations. Different pieces of debris are combined to refine probability maps of their joint start positions. Forward vs. backward advection approaches are compared.

  16. Estimating the state of charge of MH-Ni batteries by measuring their stable internal pressure

    Science.gov (United States)

    Zhang, Jian; Shao, Guangjie; Guo, Weiwen; Lou, Yuwan; Xia, Baojia

    2017-03-01

    Nickel metal hydride (MH-Ni) batteries are widely used in hybrid electric vehicles (HEVs). Estimating a battery's state of charge (SOC) remains challenging in practical applications, and it is also the core technology. Because MH-Ni batteries exhibit high rates of self-discharge and have flat and broad charge-discharge voltage plateaus, the estimation of their SOC through their voltage, current, internal resistance, and temperature is not accurate and has a large cumulative error. In this study, a new method for estimating SOC based on battery's stable internal pressure is proposed using the one-to-one correspondence between the hydrogen equilibrium pressure and the reversible hydrogen-storage capacity described by the pressure-concentration-isotherm (P-C-T) curves of hydrogen storage alloys. The actual SOC and the stable internal pressure of the battery have a one-to-one correspondence after the battery was stored at different temperatures and SOCs, and this relationship is maintained after different cycling number and after four years of storage.

  17. mhFLIM: resolution of heterogeneous fluorescence decays in widefield lifetime microscopy.

    Science.gov (United States)

    Schlachter, S; Elder, A D; Esposito, A; Kaminski, G S; Frank, J H; van Geest, L K; Kaminski, C F

    2009-02-02

    Frequency-domain fluorescence lifetime imaging microscopy (FD-FLIM) is a fast and accurate way of measuring fluorescence lifetimes in widefield microscopy. However, the resolution of multiple exponential fluorescence decays has remained beyond the reach of most practical FD-FLIM systems. In this paper we describe the implementation of FD-FLIM using a 40 MHz pulse train derived from a supercontinuum source for excitation. The technique, which we term multi-harmonic FLIM (mhFLIM), makes it possible to accurately resolve biexponential decays of fluorophores without any a priori information. The system's performance is demonstrated using a mixture of spectrally similar dyes of known composition and also on a multiply-labeled biological sample. The results are compared to those obtained from time correlated single photon counting (TCSPC) microscopy and a good level of agreement is achieved. We also demonstrate the first practical application of an algorithm derived by G. Weber [1] for analysing mhFLIM data. Because it does not require nonlinear minimisation, it offers potential for realtime analysis during acquisition.

  18. Australopithecus sediba and the emergence of Homo: Questionable evidence from the cranium of the juvenile holotype MH 1.

    Science.gov (United States)

    Kimbel, William H; Rak, Yoel

    2017-06-01

    Malapa Hominin (MH) 1, an immature individual whose second permanent molars had recently reached occlusion at the time of death, is the holotype of Australopithecus sediba, a 2-myr-old South African taxon that has been hypothesized to link phylogenetically australopith-grade hominins to the Homo clade. Given the existence of 2.8 myr-old fossils of Homo in eastern Africa, this hypothesis implies a ghost lineage spanning at least 800 kyr. An alternative hypothesis posits a unique relationship between A. sediba and Australopithecus africanus, which predates the Malapa hominins in southern Africa and whose phylogenetic relationships remain ambiguous. The craniofacial morphology of MH 1 looms large in the framing of the two hypotheses. We evaluated these alternatives in two ways. First, we investigated whether the craniofacial morphology of MH 1 was ontogenetically stable at death. Based on data from a late-growth series of chimpanzee, gorilla, and modern human crania, we found that key aspects of MH 1's resemblance to Homo can be accounted for by its immaturity. Second, we studied MH 1 with an eye to identifying craniofacial synapomorphies shared with A. africanus. In this case, MH 1 shows unambiguous affinities in its zygomaticomaxillary and supraorbital morphology to crania from Sterkfontein Member 4, which we found to exhibit unusual derived morphology compared to Homo and other australopiths. We argue that MH 1 provides clear evidence that A. sediba was uniquely related to A. africanus and that the hypothesis of an extensive ghost lineage connecting A. sediba to the root of the Homo clade is unwarranted. Copyright © 2017 Elsevier Ltd. All rights reserved.

  19. Rhizospheric bacterial strain Brevibacterium casei MH8a colonizes plant tissues and enhances Cd, Zn, Cu phytoextraction by white mustard

    Directory of Open Access Journals (Sweden)

    Tomasz ePłociniczak

    2016-02-01

    Full Text Available Environmental pollution by heavy metals has become a serious problem in the world. Phytoextraction, which is one of the plant-based technologies, has attracted the most attention for the bioremediation of soils polluted with these contaminants.The aim of this study was to determine whether the multiple-tolerant bacterium, Brevibacterium casei MH8a isolated from the heavy metal-contaminated rhizosphere soil of Sinapis alba L., is able to promote plant growth and enhance Cd, Zn and Cu uptake by white mustard under laboratory conditions. Additionally, the ability of the rifampicin-resistant spontaneous mutant of MH8a to colonize plant tissues and its mechanisms of plant growth promotion were also examined. In order to assess the ecological consequences of bioaugmentation on autochthonous bacteria, the phospholipid fatty acid (PLFA analysis was used. The MH8a strain exhibited the ability to produce ammonia, 1-amino-cyclopropane-1-carboxylic acid deaminase, indole 3-acetic acid and HCN but was not able to solubilize inorganic phosphate and produce siderophores. Introduction of MH8a into soil significantly increased S. alba biomass and the accumulation of Cd (208%, Zn (86% and Cu (39% in plant shoots in comparison with those grown in non-inoculated soil. Introduced into the soil, MH8a was able to enter the plant and was found in the roots and leaves of inoculated plants thus indicating its endophytic features. PLFA analysis revealed that the MH8a that was introduced into soil had a temporary influence on the structure of the autochthonous bacterial communities. The plant growth-promoting features of the MH8a strain and its ability to enhance the metal uptake by white mustard and its long-term survival in soil as well as its temporary impact on autochthonous microorganisms make the strain a suitable candidate for the promotion of plant growth and the efficiency of phytoextraction.

  20. MH2c: Characterization of major histocompatibility α-helices - an information criterion approach

    Science.gov (United States)

    Hischenhuber, B.; Frommlet, F.; Schreiner, W.; Knapp, B.

    2012-07-01

    Matlab Nature of problem: Major histocompatibility (MH) proteins share a similar overall structure. However, identical MH alleles which present different peptides differ by subtle conformational alterations. One hypothesis is that such conformational differences could be another level of T cell regulation. By this software package we present a reliable and systematic way to compare different MH structures to each other. Solution method: We tested several fitting approaches on all available experimental crystal structures of MH to obtain an overall picture of how to describe MH helices. For this purpose we transformed all complexes into the same space and applied splines and polynomials of several degrees to them. To draw a general conclusion which method fits them best we employed the “corrected Akaike Information Criterion”. The software is applicable for all kinds of helices of biomolecules. Running time: Depends on the data, for a single stationary structure the runtime should not exceed a few seconds.

  1. Detection of 65 kD heat shock protein in cerebrospinal fluid of tuberculous meningitis patients

    Directory of Open Access Journals (Sweden)

    Taori Girdhar M

    2006-09-01

    Full Text Available Abstract Background Diagnosis of tuberculous meningitis (TBM is difficult. Rapid confirmatory diagnosis is essential to initiate required therapy. There are very few published reports about the diagnostic significance of 65 kD heat shock protein (hsp in TBM patients, which is present in a wide range of Mycobacterium tuberculosis species and elicits a cellular and humoral immune response. In the present study we have conducted a prospective evaluation for the demonstration of 65 kD hsp antigen in cerebrospinal fluid (CSF of TBM patients, by indirect ELISA method using monoclonal antibodies (mAb against the 65 kD hsp antigen, for the diagnosis of TBM. Methods A total of 160 CSF samples of different groups of patients (confirmed TBM {n = 18}, clinically suspected TBM {n = 62}, non TBM infectious meningitis {n = 35} and non-infectious neurological diseases {n = 45} were analyzed by indirect ELISA method using mAb to 65 kD hsp antigen. The Kruskal Wallis test (Non-Parametric ANOVA with the Dunnett post test was used for statistical analysis. Results The indirect ELISA method yielded 84% sensitivity and 90% specificity for the diagnosis of TBM using mAb to 65 kD hsp antigen. The mean absorbance value of 65 kD hsp antigen in TBM patients was [0.70 ± 0.23 (0.23–1.29], significantly higher than the non-TBM infectious meningitis group [0.32 ± 0.14 (0.12–0.78, P P P Conclusion The presence of 65 kD hsp antigen in the CSF of confirmed and suspected cases of TBM would indicate that the selected protein is specific to M. tuberculosis and could be considered as a diagnostic marker for TBM.

  2. A method for estimating the diffuse attenuation coefficient (KdPAR)from paired temperature sensors

    Science.gov (United States)

    Read, Jordan S.; Rose, Kevin C.; Winslow, Luke A.; Read, Emily K.

    2015-01-01

    A new method for estimating the diffuse attenuation coefficient for photosynthetically active radiation (KdPAR) from paired temperature sensors was derived. We show that during cases where the attenuation of penetrating shortwave solar radiation is the dominant source of temperature changes, time series measurements of water temperatures at multiple depths (z1 and z2) are related to one another by a linear scaling factor (a). KdPAR can then be estimated by the simple equation KdPAR ln(a)/(z2/z1). A suggested workflow is presented that outlines procedures for calculating KdPAR according to this paired temperature sensor (PTS) method. This method is best suited for conditions when radiative temperature gains are large relative to physical noise. These conditions occur frequently on water bodies with low wind and/or high KdPARs but can be used for other types of lakes during time periods of low wind and/or where spatially redundant measurements of temperatures are available. The optimal vertical placement of temperature sensors according to a priori knowledge of KdPAR is also described. This information can be used to inform the design of future sensor deployments using the PTS method or for campaigns where characterizing sub-daily changes in temperatures is important. The PTS method provides a novel method to characterize light attenuation in aquatic ecosystems without expensive radiometric equipment or the user subjectivity inherent in Secchi depth measurements. This method also can enable the estimation of KdPAR at higher frequencies than many manual monitoring programs allow.

  3. Upper limit on $m_{h}$ in the MSSM and M-SUGRA vs. prospective reach of LEP

    CERN Document Server

    Dedes, A.; Teixeira-Dias, P.; Weiglein, G.

    2000-01-01

    The upper limit on the lightest CP-even Higgs boson mass, mh, is analyzed within the MSSM as a function of tan(beta) for fixed mtop and Msusy. The impact of recent diagrammatic two-loop results on this limit is investigated. We compare the MSSM theoretical upper bound on mh with the lower bound obtained from experimental searches at LEP. We estimate that with the LEP data taken until the end of 1999, the region mh < 108.2 GeV can be excluded at the 95% confidence level. This corresponds to an excluded region 0.6 <= tan(beta) <= 1.9 within the MSSM for mtop = 174.3 GeV and Msusy <= 1 TeV. The final exclusion sensitivity after the end of LEP, in the year 2000, is also briefly discussed. Finally, we determine the upper limit on mh within the Minimal Supergravity (M-SUGRA) scenario up to the two-loop level, consistent with radiative electroweak symmetry breaking. We find an upper bound of mh \\approx 127 GeV for mtop = 174.3 GeV in this scenario, which is slightly below the bound in the unconstrained M...

  4. Division algebras and extended N = 2, 4, 8 super KdVs

    Energy Technology Data Exchange (ETDEWEB)

    Carrion, H.L.; Rojas, M.; Toppan, F. [Centro Brasileiro de Pesquisas Fisicas (CBPF), Rio de Janeiro, RJ (Brazil). Coordenacao de Teoria de Campos e Particulas]. E-mail: lenyj@cbpf.br; mrojas@cbpf.br; toppan@cbpf.br

    2001-09-01

    The first example of an N = 8 supersymmetric extension of the KdV equation is here explicitly constructed. It involves 8 bosonic and 8 fermionic fields. It corresponds to the unique N = 8 solution based a generalized hamiltonian dynamics with (generalized) Poisson brackets given by the Non-associate N = 8 Superconformal Algebra. The complete list of inequivalent classes of parametric-dependent N = 3 and N = 4 superKdVs obtained from the 'Non-associative N= 8 SCA' is also furnished. Furthermore, a fundamental domain characterizing the class of inequivalent N = 4 superKdVs based on the 'minimal N = 4 SCA' is given. (author)

  5. Recovery Of Electrodic Powder From Spent Nickel-Metal Hydride Batteries (NiMH

    Directory of Open Access Journals (Sweden)

    Shin S.M.

    2015-06-01

    Full Text Available This study was focused on recycling process newly proposed to recover electrodic powder enriched in nickel (Ni and rare earth elements (La and Ce from spent nickel-metal hydride batteries (NiMH. In addition, this new process was designed to prevent explosion of batteries during thermal treatment under inert atmosphere. Spent nickel metal hydride batteries were heated over range of 300°C to 600°C for 2 hours and each component was completely separated inside reactor after experiment. Electrodic powder was successfully recovered from bulk components containing several pieces of metals through sieving operation. The electrodic powder obtained was examined by X-ray diffraction (XRD and energy dispersive X-ray spectroscopy (EDX and image of the powder was taken by scanning electron microscopy (SEM. It was finally found that nickel and rare earth elements were mainly recovered to about 45 wt.% and 12 wt.% in electrodic powder, respectively.

  6. THE LOSS OF MALAYSIA AIRLINES FLIGHT MH17: A FORENSIC AND HUMANITARIAN TASK.

    Science.gov (United States)

    Ranson, David

    2015-06-01

    While forensic medical tasks are usually associated with supporting the criminal justice system, there are a range of forensic medical skills that can be brought to bear on addressing humanitarian activities. Disaster victim identification is a procedure that has achieved international standardisation through the work of a multinational Interpol Standing Committee. While part of a police organisation, it includes forensic pathologists, anthropologists, odontologists and molecular biologists who provide most of the specialist scientific input regarding identification that is integrated with police processes such as document examination and fingerprinting. The loss of Malaysian Airlines Flight MH17 represented a major activation of these procedures in an environment that had both humanitarian and forensic criminal investigation components. The information that is derived from the processes involved in disaster victim identification has a value that goes far beyond the determination of identity. It has an important humanitarian role in supporting the family and friends of the victims in their bereavement journey.

  7. Complete genome sequence of Hippea maritima type strain (MH2T)

    Energy Technology Data Exchange (ETDEWEB)

    Huntemann, Marcel [U.S. Department of Energy, Joint Genome Institute; Lu, Megan [Los Alamos National Laboratory (LANL); Nolan, Matt [U.S. Department of Energy, Joint Genome Institute; Lapidus, Alla L. [U.S. Department of Energy, Joint Genome Institute; Lucas, Susan [U.S. Department of Energy, Joint Genome Institute; Hammon, Nancy [U.S. Department of Energy, Joint Genome Institute; Deshpande, Shweta [U.S. Department of Energy, Joint Genome Institute; Cheng, Jan-Fang [U.S. Department of Energy, Joint Genome Institute; Tapia, Roxanne [Los Alamos National Laboratory (LANL); Han, Cliff [Los Alamos National Laboratory (LANL); Goodwin, Lynne A. [Los Alamos National Laboratory (LANL); Pitluck, Sam [U.S. Department of Energy, Joint Genome Institute; Liolios, Konstantinos [U.S. Department of Energy, Joint Genome Institute; Pagani, Ioanna [U.S. Department of Energy, Joint Genome Institute; Ivanova, N [U.S. Department of Energy, Joint Genome Institute; Ovchinnikova, Galina [U.S. Department of Energy, Joint Genome Institute; Pati, Amrita [U.S. Department of Energy, Joint Genome Institute; Chen, Amy [U.S. Department of Energy, Joint Genome Institute; Palaniappan, Krishna [U.S. Department of Energy, Joint Genome Institute; Land, Miriam L [ORNL; Hauser, Loren John [ORNL; Jeffries, Cynthia [Oak Ridge National Laboratory (ORNL); Detter, J. Chris [U.S. Department of Energy, Joint Genome Institute; Brambilla, Evelyne-Marie [DSMZ - German Collection of Microorganisms and Cell Cultures GmbH, Braunschweig, Germany; Rohde, Manfred [HZI - Helmholtz Centre for Infection Research, Braunschweig, Germany; Spring, Stefan [DSMZ - German Collection of Microorganisms and Cell Cultures GmbH, Braunschweig, Germany; Goker, Markus [DSMZ - German Collection of Microorganisms and Cell Cultures GmbH, Braunschweig, Germany; Woyke, Tanja [U.S. Department of Energy, Joint Genome Institute; Bristow, James [U.S. Department of Energy, Joint Genome Institute; Eisen, Jonathan [U.S. Department of Energy, Joint Genome Institute; Markowitz, Victor [U.S. Department of Energy, Joint Genome Institute; Hugenholtz, Philip [U.S. Department of Energy, Joint Genome Institute; Kyrpides, Nikos C [U.S. Department of Energy, Joint Genome Institute; Klenk, Hans-Peter [DSMZ - German Collection of Microorganisms and Cell Cultures GmbH, Braunschweig, Germany; Mavromatis, K [U.S. Department of Energy, Joint Genome Institute

    2011-01-01

    Hippea maritima (Miroshnichenko et al. 1999) is the type species of the genus Hippea, which belongs to the family Desulfurellaceae within the class Deltaproteobacteria. The anaerobic, moderately thermophilic marine sulfur-reducer was first isolated from shallow-water hot vents in Matipur Harbor, Papua New Guinea. H. maritima was of interest for genome se- quencing because of its isolated phylogenetic location, as a distant next neighbor of the ge- nus Desulfurella. Strain MH2T is the first type strain from the order Desulfurellales with a com- pletely sequenced genome. The 1,694,430 bp long linear genome with its 1,723 protein- coding and 57 RNA genes consists of one circular chromosome and is a part of the Genomic Encyclopedia of Bacteria and Archaea project.

  8. An EIS based study of a Ni-MH battery prototype. Modeling and identification analysis

    Energy Technology Data Exchange (ETDEWEB)

    Castro, E.B. [Instituto de Investigaciones Fisicoquimicas Teoricas y Aplicadas (INIFTA). Universidad Nacional de La Plata., CCT La Plata-CONICET, Suc 4, CC16 (1900), La Plata (Argentina); Cuscueta, D.J.; Ghilarducci, A.A.; Salva, H.R. [Centro Atomico Bariloche - Comision Nacional de Energia Atomica (CAB-CNEA), Instituto Balseiro - Universidad Nacional de Cuyo (IB-UNCu), CONICET, Av. Bustillo 9500 - CAB (8400) San Carlos de Bariloche (Argentina); Milocco, R.H. [Grupo de Control Automatico y Sistemas (GCAyS), Depto. Electrotecnia, Facultad de Ingenieria, Universidad Nacional del Comahue, Buenos Aires 1400 (8300) Neuquen (Argentina)

    2010-06-15

    Modeling and simulation of the dynamics of batteries is a useful method to improve design and predict their performance. This paper outlines the development of a simple physicochemical model to simulate the impedance response of the Ni-MH battery system. The model describes the individual electrodes as porous flooded structures where the electrochemical processes take place at the active material/electrolyte interface. The physicochemical system parameters are grouped in such a way that the derived simple model can be experimentally identifiable. Experimental electrochemical impedance spectroscopy (EIS) data, recorded with a laboratory built prototype, are used to identify the model parameters by fitting the theoretical impedance function derived from the model. An analysis of the predicted dependence of the impedance function with the battery SOC and the identifiability of different system parameters are presented. (author)

  9. Seafloor in the Expanded Malaysia Airlines Flight MH370 Search Area

    Science.gov (United States)

    Smith, W. H. F.; Marks, K. M.; Beaman, R. J.

    2014-12-01

    Smith and Marks (Eos Trans. AGU, 95(21), 27 May 2014) illustrated a map of the seafloor in the Malaysia Airlines Flight MH370 search area. This map showed a bathymetric model that is constructed from a combination of available ship soundings and depths estimated from satellite altimetry. They noted that available depth measurements covered only 5% of their study region, and that very few of these measurements were collected using modern multibeam and navigation systems. Recently the MH370 search has been expanded along the "7th Arc" to encompass newly prioritized underwater search areas identified in an Australian Transport Safety Bureau report (AE-2014-054, 26 June 2014). While the new "Priority" search area is within the Eos article Fig. 1, the new "Wide" search area extends beyond the region evaluated in Eos. Additionally, multibeam data that were not incorporated in the bathymetric model have been made available to us after the Eos article was published. This presentation will update and extend the study published in Eos. We will present illustrations of the expanded region, sounding coverage, and tectonic features that are associated with steep topographic slopes. Our results include comparisons of multibeam survey depths and bathymetric model depths. The standard deviation of the differences is 182 m, with the greatest differences (exceeding 1000 m) over steep topographic slopes, and the smallest over low-relief ocean floor. This is consistent with differences found by Smith and Sandwell (JGR, 99(B11), 1994) between soundings and bathymetric predictions from altimetry. Such depth differences are common where bathymetric model constraints are sparse, which is typical of many of the world's oceans.

  10. Using HAZUS-MH for modelling past coastal flooding events in Japan

    Science.gov (United States)

    Robinson, T.; Charvet, I.; Gunasekera, R.

    2012-04-01

    In regions at risk from natural hazards, the ability to pre-determine the vulnerability and exposure of buildings (residential, commercial, industrial and government) from multiple hazard scenarios, allows policy makers and businesses to put forward appropriate policies, planning and intervention methods to mitigate the financial impact. For this purpose, a number of catastrophe models have been developed to provide the decision makers with quantitative risk assessments based on science and engineering knowledge. One of the most sophisticated open source models currently available is HAZUS-MH. The software is a powerful tool for analysing potential losses from floods, hurricane winds, and earthquakes. It was initially designed by FEMA to work with US datasets and has proven to be a great resource for disaster management at both national and local level in order to plan and increase the awareness of the recovery process after a natural disaster. Methodologies have been introduced to export the HAZUS-MH model for global applications. However, currently the international community have been slow to act on this technology breakthrough. The applications of this project will focus on adapting the HAZUS-HM model to provide a reliable vulnerability assessment of Japan's building stock from tsunami flooding. A review of the different methodologies will be carried out and presented as guidance on the best practice. The numerical assessment reports will be compared to real scenarios based on field observations, financial bulletins and government reports. A sensitivity analysis will be carried out on the generation of bespoke datasets based on the quality and density of the available regional data. These results will be compared against results using proxy US datasets. In addition, the significance of regional building standards and practices will be incorporated into the model through the development of new damage functions. The level of confidence and sensitivity (building

  11. Analytical Solutions of Classical and Fractional KP-Burger Equation and Coupled KdV equation

    OpenAIRE

    Ghosh, Uttam; Sarkar, Susmita; Das, Shantanu

    2016-01-01

    Evaluation of analytical solutions of non-linear partial differential equations (both classical and fractional) is a rising subject in Applied Mathematics because its applications in Physical biological and social sciences. In this paper we have used generalized Tanh method to find the exact solution of KP-Burger equation and coupled KdV equation. The fractional Sub-equation method has been used to find the solution of fractional KP-Burger equation and fractional coupled KdV equations. The ex...

  12. Traveling Wave Solutions of Space-Time Fractional Generalized Fifth-Order KdV Equation

    Directory of Open Access Journals (Sweden)

    Dianchen Lu

    2017-01-01

    Full Text Available The Korteweg-de Vries (KdV equation, especially the fractional higher order one, provides a relatively accurate description of motions of long waves in shallow water under gravity and wave propagation in one-dimensional nonlinear lattice. In this article, the generalized exp⁡(-Φ(ξ-expansion method is proposed to construct exact solutions of space-time fractional generalized fifth-order KdV equation with Jumarie’s modified Riemann-Liouville derivatives. At the end, three types of exact traveling wave solutions are obtained which indicate that the method is very practical and suitable for solving nonlinear fractional partial differential equations.

  13. Lie Symmetry Analysis and Explicit Solutions of the Time Fractional Fifth-Order KdV Equation

    Science.gov (United States)

    Wang, Gang wei; Xu, Tian zhou; Feng, Tao

    2014-01-01

    In this paper, using the Lie group analysis method, we study the invariance properties of the time fractional fifth-order KdV equation. A systematic research to derive Lie point symmetries to time fractional fifth-order KdV equation is performed. In the sense of point symmetry, all of the vector fields and the symmetry reductions of the fractional fifth-order KdV equation are obtained. At last, by virtue of the sub-equation method, some exact solutions to the fractional fifth-order KdV equation are provided. PMID:24523885

  14. Lie symmetry analysis and explicit solutions of the time fractional fifth-order KdV equation.

    Science.gov (United States)

    Wang, Gang Wei; Xu, Tian Zhou; Feng, Tao

    2014-01-01

    In this paper, using the Lie group analysis method, we study the invariance properties of the time fractional fifth-order KdV equation. A systematic research to derive Lie point symmetries to time fractional fifth-order KdV equation is performed. In the sense of point symmetry, all of the vector fields and the symmetry reductions of the fractional fifth-order KdV equation are obtained. At last, by virtue of the sub-equation method, some exact solutions to the fractional fifth-order KdV equation are provided.

  15. Exact periodic wave solutions to the coupled schrِodinger-KdV ...

    Indian Academy of Sciences (India)

    Abstract. The exact solutions for the coupled non-linear partial differential equations are studied by means of the mapping method proposed recently by the author. Taking the coupled Schriodinger-KdV equation and DS equations as examples, abundant per- iodic wave solutions in terms of Jacobi elliptic functions are ...

  16. Formation of compression waves with multiscale asymptotics in the Burgers and KdV models

    OpenAIRE

    Zakharov, Sergei V.

    2015-01-01

    The Cauchy problem for the Burgers equation with a small dissipation and an initial weak discontinuity and the Cauchy problem with a large initial gradient for a quasilinear parabolic equation and for the Korteweg-de Vries (KdV) equation are considered. Multiscale asymptotics of solutions corresponding to shock waves are constructed. Some results can also be applied to rarefaction waves.

  17. New modification of Laplace decomposition method for seventh order KdV equation

    Science.gov (United States)

    Kashkari, B. S.; Bakodah, H. O.

    2013-10-01

    In this paper, we develop a new modification of Laplace decomposition method for solving the seventh order KdV equations. The numerical results show that the method converges rapidly and compared with the Adomian decomposition method. The conservation properties of solution are examined by calculating the first three invariants.

  18. Data of evolutionary structure change: 1CERP-1A7KD [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1CERP-1A7KD 1CER 1A7K P D --MKVGINGFGRIGRQVFRILHSRGV-----EVALINDLT-DNKTLAHLLKYDSIY...1CER P 1CERP HSRGV-----EVALI...1CER P 1CERP AIRAT-AVKDP ...1CER P 1CERP VLEEA-FGVEK ...1CER P 1CERP LDLPH-KDLRR

  19. Compacton-like solutions for modified KdV and nonlinear ...

    Indian Academy of Sciences (India)

    2014-07-18

    Jul 18, 2014 ... ... novel compactons for the trigonometric case, and compare their properties with those of the compactons and solitons in the case of modified KdV equation. Keeping in mind the significance of nonlinear Schrödinger equation with external source, for pulse propagation through asymmetric twin-core fibres, ...

  20. Compacton-like solutions for modified KdV and nonlinear ...

    Indian Academy of Sciences (India)

    Abstract. We present new types of compacton-like solutions for modified KdV and nonlinear. Schrödinger equation with external sources, using a recently developed fractional transformation. In particular, we explicate these novel compactons for the trigonometric case, and compare their prop- erties with those of the ...

  1. Implementasi KD-Tree K-Means Clustering untuk Klasterisasi Dokumen

    Directory of Open Access Journals (Sweden)

    Eric Budiman Gosno

    2013-09-01

    Full Text Available Klasterisasi dokumen adalah suatu proses pengelompokan dokumen secara otomatis dan unsupervised. Klasterisasi dokumen merupakan permasalahan yang sering ditemui dalam berbagai bidang seperti text mining dan sistem temu kembali informasi. Metode klasterisasi dokumen yang memiliki akurasi dan efisiensi waktu yang tinggi sangat diperlukan untuk meningkatkan hasil pada mesin pencari web,  dan untuk proses filtering. Salah satu metode klasterisasi yang telah dikenal dan diaplikasikan dalam klasterisasi dokumen adalah K-Means Clustering. Tetapi K-Means Clustering sensitif terhadap pemilihan posisi awal dari titik tengah klaster sehingga pemilihan posisi awal dari titik tengah klaster yang buruk akan mengakibatkan K-Means Clustering terjebak dalam local optimum. KD-Tree K-Means Clustering merupakan perbaikan dari K-Means Clustering. KD-Tree K-Means Clustering menggunakan struktur data K-Dimensional Tree dan nilai kerapatan pada proses inisialisasi titik tengah klaster. Pada makalah ini diimplementasikan algoritma KD-Tree K-Means Clustering untuk permasalahan klasterisasi dokumen. Performa klasterisasi dokumen yang dihasilkan oleh metode KD-Tree K-Means Clustering pada data set 20 newsgroup memiliki nilai distorsi 3×105 lebih rendah dibandingkan dengan nilai rerata distorsi K-Means Clustering dan nilai NIG 0,09 lebih baik dibandingkan dengan nilai NIG K-Means Clustering.

  2. Genome Sequence of the Small-Colony Variant Pseudomonas aeruginosa MH27, Isolated from a Chronic Urethral Catheter Infection.

    Science.gov (United States)

    Tielen, Petra; Wibberg, Daniel; Blom, Jochen; Rosin, Nathalie; Meyer, Ann-Kathrin; Bunk, Boyke; Schobert, Max; Tüpker, Reinhilde; Schatschneider, Sarah; Rückert, Christian; Albersmeier, Andreas; Goesmann, Alexander; Vorhölter, Frank-Jörg; Jahn, Dieter; Pühler, Alfred

    2014-01-23

    Pseudomonas aeruginosa is a notable nosocomial pathogen causing severe chronic infections. Here we present the draft genome sequence of P. aeruginosa MH27, isolated from a patient with a chronic hospital-acquired catheter-associated urinary tract infection. The 7.1-Mb genome sequence organized in 24 scaffolds contributes to the understanding of biofilm formation and antibiotic resistance.

  3. Increased levels of depressive symptoms among pregnant women in The Netherlands after the crash of flight MH17.

    NARCIS (Netherlands)

    Truijens, E.M.; Boerekamp, C.A.M.; Spek, V; van Son, M.J.M.|info:eu-repo/dai/nl/068440340; Oei, S.G.; Pop, V.J.M.

    2015-01-01

    On July 17, 2014, Malaysia Airlines flight MH17 was shot down, a tragedy that shocked the Dutch population. As part of a large longitudinal survey on mental health in pregnant women that had a study inclusion period of 19 months, we were able to evaluate the possible association of that incident

  4. Increased levels of depressive symptoms among pregnant women in the Netherlands after the crash of flight MH17

    NARCIS (Netherlands)

    Truijens, Sophie E. M.; Boerekamp, Carola A. M.; Spek, Viola; van Son, Maarten J. M.; Oei, S. Guid; Pop, Victor J. M.

    2015-01-01

    On July 17, 2014, Malaysia Airlines flight MH17 was shot down, a tragedy that shocked the Dutch population. As part of a large longitudinal survey on mental health in pregnant women that had a study inclusion period of 19 months, we were able to evaluate the possible association of that incident

  5. Tijdstip van MH-bespuiting in uien en effect van stikstof op kale uien : proeven 2007/2008

    NARCIS (Netherlands)

    Brink, van den L.

    2008-01-01

    In 2007 zijn in Lelystad, als vervolg op de literatuurstudie “Het optreden van spruitvorming en kale uien tijdens de bewaring” twee veldproeven uitgevoerd: 1) een proef waarin bij twee rassen en bij twee verschillende stikstofbemestingsniveaus op verschillende momenten met MH is gespoten.

  6. Major histocompatibility (MH) class II ß gene polymorphism influences disease resistance of common carp (Cyprinus carpio L.)

    NARCIS (Netherlands)

    Rakus, K.L.; Wiegertjes, G.F.; Jurecka, P.M.; Walker, P.D.; Pilarczyk, A.; Irnazarow, I.

    2009-01-01

    Genes of the major histocompatibility complex (MHC) are crucial elements of adaptive immunity. High polymorphism renders the MHC genes highly suitable for studies on association with disease resistance. In common carp (Cyprinus carpio L.), there are two paralogous groups of MH class II B genes,

  7. Numerical simulation of blast loading on Malaysia Airlines flight MH17 due to a warhead detonation (U)

    NARCIS (Netherlands)

    2015-01-01

    The Dutch Safety Board (DSB) investigates the crash of Malaysia Airlines flight MH17 which occured on Thursday July 17, 2014 in the Donetsk region (Ukraine). The DSB wants to provide a clear picture of the cause of the crash. A possible cause is fatal damage to the aircraft due to detonation of the

  8. Damage reconstruction due to impact of high-energetic particles on Malaysia Airlines flight MH17 (U)

    NARCIS (Netherlands)

    2015-01-01

    The Dutch Safety Board (DSB) investigates the crash of Malaysia Airlines flight MH17 which occurred on Thursday July 17, 2014 in the Donetsk region (Ukraine). The DSB wants to provide a clear picture of the cause of the crash. A possible cause is fatal damage to the aircraft due to detonation of the

  9. Structure of the N-terminal domain of the protein Expansion: an ‘Expansion’ to the Smad MH2 fold

    Energy Technology Data Exchange (ETDEWEB)

    Beich-Frandsen, Mads; Aragón, Eric [Institute for Research in Biomedicine (IRB Barcelona), Baldiri Reixac 10, 08028 Barcelona (Spain); Llimargas, Marta [Institut de Biologia Molecular de Barcelona, IBMB–CSIC, Baldiri Reixac 10, 08028 Barcelona (Spain); Benach, Jordi [ALBA Synchrotron, BP 1413, km 3.3, Cerdanyola del Vallès (Spain); Riera, Antoni [Institute for Research in Biomedicine (IRB Barcelona), Baldiri Reixac 10, 08028 Barcelona (Spain); Universitat de Barcelona, Martí i Franqués 1-11, 08028 Barcelona (Spain); Pous, Joan [Institute for Research in Biomedicine (IRB Barcelona), Baldiri Reixac 10, 08028 Barcelona (Spain); Platform of Crystallography IBMB–CSIC, Baldiri Reixac 10, 08028 Barcelona (Spain); Macias, Maria J., E-mail: maria.macias@irbbarcelona.org [Institute for Research in Biomedicine (IRB Barcelona), Baldiri Reixac 10, 08028 Barcelona (Spain); Catalan Institution for Research and Advanced Studies (ICREA), Passeig Lluís Companys 23, 08010 Barcelona (Spain)

    2015-04-01

    Expansion is a modular protein that is conserved in protostomes. The first structure of the N-terminal domain of Expansion has been determined at 1.6 Å resolution and the new Nα-MH2 domain was found to belong to the Smad/FHA superfamily of structures. Gene-expression changes observed in Drosophila embryos after inducing the transcription factor Tramtrack led to the identification of the protein Expansion. Expansion contains an N-terminal domain similar in sequence to the MH2 domain characteristic of Smad proteins, which are the central mediators of the effects of the TGF-β signalling pathway. Apart from Smads and Expansion, no other type of protein belonging to the known kingdoms of life contains MH2 domains. To compare the Expansion and Smad MH2 domains, the crystal structure of the Expansion domain was determined at 1.6 Å resolution, the first structure of a non-Smad MH2 domain to be characterized to date. The structure displays the main features of the canonical MH2 fold with two main differences: the addition of an α-helical region and the remodelling of a protein-interaction site that is conserved in the MH2 domain of Smads. Owing to these differences, to the new domain was referred to as Nα-MH2. Despite the presence of the Nα-MH2 domain, Expansion does not participate in TGF-β signalling; instead, it is required for other activities specific to the protostome phyla. Based on the structural similarities to the MH2 fold, it is proposed that the Nα-MH2 domain should be classified as a new member of the Smad/FHA superfamily.

  10. Solid/liquid partition coefficients (Kd) for selected soils and sediments at Forsmark and Laxemar-Simpevarp

    Energy Technology Data Exchange (ETDEWEB)

    Sheppard, Steve; Long, Jeff; Sanipelli, Barb (ECOMatters Inc., Pinawa (Canada)); Sohlenius, Gustav (Geological Survey of Sweden (SGU), Uppsala (Sweden))

    2009-03-15

    Soil and sediment solid/liquid partition coefficients (Kd) are used to indicate the relative mobility of radionuclides and elements of concern from nuclear fuel waste, as well as from other sources. The Kd data are inherently extremely variable, but also vary systematically with key environmental attributes. For soil Kd, the key variables are pH, clay content and organic carbon content. For sediment Kd, water type (freshwater versus marine) and sediment type (benthic versus suspended) are important. This report summarized Kd data for soils and sediments computed from indigenous stable element concentrations measured at the Forsmark and Laxemar-Simpevarp sites. These were then compared to several literature sources of Kd data for Ce, Cl, Co, Cr, Cs, Fe, Ho, I, La, Mn, Mo, Nb, Nd, Ni, Np, Pa, Pb, Pu, Ra, Sb, Se, Sm, Sn, Sr, Tc, Th, Tm, U and Yb. The Kd data computed from indigenous stable element concentrations may be especially relevant for assessment of long-lived radionuclides from deep disposal of waste, because the long time frame for the potential releases is more consistent with the steady state measured using indigenous stable elements. For almost every one of these elements in soils, a statistically meaningful regression equation was developed to allow estimation of Kd for any soil given a modest amount of information about the soil. Nonetheless, the median residual geometric standard deviation (GSD) was 4.3-fold, implying confidence bounds of about 18-fold above and below the best estimate Kd. For sediment, the values are categorised simply by water type and sediment type. The median GSD for sediment Kd as measured at the Forsmark and Laxemar-Simpevarp sites was 2.5-fold, but the median GSD among literature values was as high as 8.6-fold. Clearly, there remains considerable uncertainty in Kd values, and it is important to account for this in assessment applications

  11. A Dynamical System Approach to the Surface Search of Debris from MH370

    Science.gov (United States)

    Mancho, Ana M.; Garcia-Garrido, V. J.; Wiggins, S.; Mendoza, C.

    2015-11-01

    The disappearance of Malaysia Airlines flight MH370 on the morning of the 8th of March 2014 is one of the great mysteries of our time. One relevant aspect of this mystery is that not a single piece of debris from the aircraft was found during the intensive surface search carried out in the months following the crash. Difficulties in the search efforts, due to the uncertainty in the plane's final impact point and the time passed since the accident, brought the question on how the debris was scattered in an always moving ocean, for which there were multiple datasets that do not uniquely determined its state. Our approach to this problem is based on dynamical systems tools that identify dynamic barriers and coherent structures governing transport. By combining different ocean data with these mathematical techniques, we are able to assess the spatio-temporal state of the ocean in the priority search area at the time of impact and the following weeks. Using this information we propose a revised search strategy by showing why one might not have expected to find debris in some large search areas targeted by the search services and determining regions where one might have expected impact debris to be located and that have not been subjected to any exploration. This research has been supported by MINECO under grants MTM2014-56392-R and ICMAT Severo Ochoa project SEV-2011-0087 and ONR grant No. N00014- 01-1-0769. Computational support from CESGA is acknowledged.

  12. Framing crisis response messages on Facebook: a second level agenda analysis of MH370

    Directory of Open Access Journals (Sweden)

    Abang Ahmad Dayang Aizza Maisha

    2017-01-01

    Full Text Available A crisis can certainly bring great threats to an organisation. In time of crisis, what the organisation says and does may impose significant effect on the organisation’s effort to survive its reputational damages. Although crisis responses are considered a common topic, this rapidly growing field of research is however vital to be critically explored. In light of Situational Crisis Communication Theory (SCCT [1] and the Second-level Agenda Setting approach [2], this study seeks to analyse the message frames used by Malaysia Airlines System (MAS in the formation of MH370 crisis response messages that that were disseminated directly to the organisation’s stakeholders on Facebook. The convergence of framing and second level agenda setting has made this study significant as it advances the explication of potential crisis communication effects by underscoring the distinct importance held by certain attributes and frames, in the content of a crisis response message. This paper also includes discussion on the directions for future research on crisis response strategies particularly in the local context.

  13. The negative electrode development for a Ni-MH battery prototype

    Energy Technology Data Exchange (ETDEWEB)

    Cuscueta, D.J., E-mail: cuscueta@cab.cnea.gov.a [Centro Atomico Bariloche-CNEA, Instituto Balseiro-UNCu, CONICET, Av. Bustillo 9500 (8400) San Carlos de Bariloche, R.N. (Argentina); Ghilarducci, A.A.; Salva, H.R. [Centro Atomico Bariloche-CNEA, Instituto Balseiro-UNCu, CONICET, Av. Bustillo 9500 (8400) San Carlos de Bariloche, R.N. (Argentina); Milocco, R.H. [Grupo Control Automatico y Sistemas (GCAyS), Depto. Electrotecnia, Facultad de Ingenieria, Universidad Nacional del Comahue, Buenos Aires 1400 (8300) Neuquen (Argentina); Castro, E.B. [Instituto de Investigaciones Fisicoquimicas Teoricas y Aplicadas (INIFTA) - Universidad Nacional La Plata. Suc 4, CC16 (1900), La Plata, Bs As (Argentina)

    2009-10-01

    The negative electrode development for a nickel-metal hydride battery (Ni-MH) prototype was performed with the following procedure: (1) the Lm{sub 0.95}Ni{sub 3.8}Co{sub 0.3}Mn{sub 0.3}Al{sub 0.4} (Lm=lanthanum rich mischmetal) intermetallic alloy was elaborated by melting the pure elements in an induction furnace inside a boron nitride crucible under an inert atmosphere, (2) the obtained alloy was crushed and sieved between 44 and 74 mum and mixed with teflonized carbon; (3) the compound was assembled together with a current collector and pressed in a cylindrical matrix. The obtained electrode presented a disc shape, with 11 mm diameter and approximately 1 mm thickness. The crystalline structure of the hydrogen storage alloy was examined using X-ray diffractometry. The measured hcp lattice volume was 1.78% larger than the precursor LaNi{sub 5} intermetallic alloy, increasing the available space for hydrogen movement. Energy dispersive spectroscopy (EDS) and scanning electronic microscopy (SEM) measurements were used before and after hydriding in order to verify the alloy sample homogeneity. The negative electrode was electrochemically tested by using a laboratory cell. It activates almost totally in its first cycle, which is an excellent characteristic from the commercial point of view. The maximum discharge capacity reached was 314.2 mA h/g in the 10th cycle.

  14. Effective Dynamics of Double Solitons for Perturbed mKdV

    Science.gov (United States)

    Holmer, Justin; Perelman, Galina; Zworski, Maciej

    2011-07-01

    We consider the perturbed mKdV equation {partial_t u = -partial_x (partial_x^2u + 2u^3- b(x,t)u)} , where the potential {b(x,t)=b_0(hx,ht), 0 < h ≪ 1 } , is slowly varying with a double soliton initial data. On a dynamically interesting time scale the solution is { {mathcal{O}}(h^2) } close in H 2 to a double soliton whose position and scale parameters follow an effective dynamics, a simple system of ordinary differential equations. These equations are formally obtained as Hamilton's equations for the restriction of the mKdV Hamiltonian to the submanifold of solitons. The interplay between algebraic aspects of complete integrability of the unperturbed equation and the analytic ideas related to soliton stability is central in the proof.

  15. A numerical dressing method for the nonlinear superposition of solutions of the KdV equation

    Science.gov (United States)

    Trogdon, Thomas; Deconinck, Bernard

    2014-01-01

    In this paper we present the unification of two existing numerical methods for the construction of solutions of the Korteweg-de Vries (KdV) equation. The first method is used to solve the Cauchy initial-value problem on the line for rapidly decaying initial data. The second method is used to compute finite-genus solutions of the KdV equation. The combination of these numerical methods allows for the computation of exact solutions that are asymptotically (quasi-)periodic finite-gap solutions and are a nonlinear superposition of dispersive, soliton and (quasi-)periodic solutions in the finite (x, t)-plane. Such solutions are referred to as superposition solutions. We compute these solutions accurately for all values of x and t.

  16. Controlling the weights of simulation particles: adaptive particle management using k-d trees

    Science.gov (United States)

    Teunissen, Jannis; Ebert, Ute

    2014-02-01

    In particle simulations, the weights of particles determine how many physical particles they represent. Adaptively adjusting these weights can greatly improve the efficiency of the simulation, without creating severe nonphysical artifacts. We present a new method for the pairwise merging of particles, in which two particles are combined into one. To find particles that are ‘close' to each other, we use a k-d tree data structure. With a k-d tree, close neighbors can be searched for efficiently, and independently of the mesh used in the simulation. The merging can be done in different ways, conserving for example momentum or energy. We introduce probabilistic schemes, which set properties for the merged particle using random numbers. The effect of various merge schemes on the energy distribution, the momentum distribution and the grid moments is compared. We also compare their performance in the simulation of the two-stream instability.

  17. Soliton solutions of the two-dimensional KdV-Burgers equation by homotopy perturbation method

    Energy Technology Data Exchange (ETDEWEB)

    Molabahrami, A. [Department of Mathematics, Ilam University, PO Box 69315516, Ilam (Iran, Islamic Republic of)], E-mail: a_m_bahrami@yahoo.com; Khani, F. [Department of Mathematics, Ilam University, PO Box 69315516, Ilam (Iran, Islamic Republic of); Bakhtar Institute of Higher Education, PO Box 696, Ilam (Iran, Islamic Republic of)], E-mail: farzad_khani59@yahoo.com; Hamedi-Nezhad, S. [Bakhtar Institute of Higher Education, PO Box 696, Ilam (Iran, Islamic Republic of)

    2007-10-29

    In this Letter, the He's homotopy perturbation method (HPM) to finding the soliton solutions of the two-dimensional Korteweg-de Vries Burgers' equation (tdKdVB) for the initial conditions was applied. Numerical solutions of the equation were obtained. The obtained solutions, in comparison with the exact solutions admit a remarkable accuracy. The results reveal that the HPM is very effective and simple.

  18. Scrutinizing the alignment limit in two-Higgs-doublet models: mh=125 GeV

    Science.gov (United States)

    Bernon, Jérémy; Gunion, John F.; Haber, Howard E.; Jiang, Yun; Kraml, Sabine

    2015-10-01

    In the alignment limit of a multidoublet Higgs sector, one of the Higgs mass eigenstates aligns with the direction of the scalar field vacuum expectation values, and its couplings approach those of the Standard Model (SM) Higgs boson. We consider C P -conserving two-Higgs-doublet models (2HDMs) of Type I and Type II near the alignment limit in which the lighter of the two C P -even Higgs bosons, h , is the SM-like state observed at 125 GeV. In particular, we focus on the 2HDM parameter regime where the coupling of h to gauge bosons approaches that of the SM. We review the theoretical structure and analyze the phenomenological implications of the regime of the alignment limit without decoupling, in which the other Higgs scalar masses are not significantly larger than mh and thus do not decouple from the effective theory at the electroweak scale. For the numerical analysis, we perform scans of the 2HDM parameter space employing the software packages 2hdmc and lilith, taking into account all relevant pre-LHC constraints, the latest constraints from the measurements of the 125 GeV Higgs signal at the LHC, as well as the most recent limits coming from searches for heavy Higgs-like states. We contrast these results with the alignment limit achieved via the decoupling of heavier scalar states, where h is the only light Higgs scalar. Implications for Run 2 at the LHC, including expectations for observing the other scalar states, are also discussed.

  19. #WhyWeTweetMH: Understanding Why People Use Twitter to Discuss Mental Health Problems.

    Science.gov (United States)

    Berry, Natalie; Lobban, Fiona; Belousov, Maksim; Emsley, Richard; Nenadic, Goran; Bucci, Sandra

    2017-04-05

    Use of the social media website Twitter is highly prevalent and has led to a plethora of Web-based social and health-related data available for use by researchers. As such, researchers are increasingly using data from social media to retrieve and analyze mental health-related content. However, there is limited evidence regarding why people use this emerging platform to discuss mental health problems in the first place. The aim of this study was to explore the reasons why individuals discuss mental health on the social media website Twitter. The study was the first of its kind to implement a study-specific hashtag for research; therefore, we also examined how feasible it was to circulate and analyze a study-specific hashtag for mental health research. Text mining methods using the Twitter Streaming Application Programming Interface (API) and Twitter Search API were used to collect and organize tweets from the hashtag #WhyWeTweetMH, circulated between September 2015 and November 2015. Tweets were analyzed thematically to understand the key reasons for discussing mental health using the Twitter platform. Four overarching themes were derived from the 132 tweets collected: (1) sense of community; (2) raising awareness and combatting stigma; (3) safe space for expression; and (4) coping and empowerment. In addition, 11 associated subthemes were also identified. The themes derived from the content of the tweets highlight the perceived therapeutic benefits of Twitter through the provision of support and information and the potential for self-management strategies. The ability to use Twitter to combat stigma and raise awareness of mental health problems indicates the societal benefits that can be facilitated via the platform. The number of tweets and themes identified demonstrates the feasibility of implementing study-specific hashtags to explore research questions in the field of mental health and can be used as a basis for other health-related research.

  20. KD-ACP: A Software Framework for Social Computing in Emergency Management

    Directory of Open Access Journals (Sweden)

    Bin Chen

    2015-01-01

    Full Text Available This paper addresses the application of a computational theory and related techniques for studying emergency management in social computing. We propose a novel software framework called KD-ACP. The framework provides a systematic and automatic platform for scientists to study the emergency management problems in three aspects: modelling the society in emergency scenario as the artificial society; investigating the emergency management problems by the repeat computational experiments; parallel execution between artificial society and the actual society managed by the decisions from computational experiments. The software framework is composed of a series of tools. These tools are categorized into three parts corresponding to “A,” “C,” and “P,” respectively. Using H1N1 epidemic in Beijing city as the case study, the modelling and data generating of Beijing city, experiments with settings of H1N1, and intervention measures and parallel execution by situation tool are implemented by KD-ACP. The results output by the software framework shows that the emergency response decisions can be tested to find a more optimal one through the computational experiments. In the end, the advantages of the KD-ACP and the future work are summarized in the conclusion.

  1. Structure of the Λ (1405 ) and the K-d →π Σ n reaction

    Science.gov (United States)

    Ohnishi, Shota; Ikeda, Yoichi; Hyodo, Tetsuo; Weise, Wolfram

    2016-02-01

    The Λ (1405 ) resonance production reaction is investigated within the framework of the coupled-channels Alt-Grassberger-Sandhas (AGS) equations. We perform full three-body calculations for the K ¯N N -π Y N amplitudes on the physical real energy axis and investigate how the signature of the Λ (1405 ) appears in the cross sections of the K-d →π Σ n reactions, also in view of the planned E31 experiment at J-PARC. Two types of meson-baryon interaction models are considered: an energy-dependent interaction based on chiral S U (3 ) effective field theory, and an energy-independent version that has been used repeatedly in phenomenological approaches. These two models have different off-shell properties that imply correspondingly different behavior in the three-body system. We investigate how these features show up in differential cross sections of K-d →π Σ n reactions. Characteristic patterns distinguishing between the two models are found in the invariant mass spectrum of the final π Σ state. The K-d →π Σ n reaction, with different (π±Σ∓ and π0Σ0 ) charge combinations in the final state, is thus demonstrated to be a useful tool for investigating the subthreshold behavior of the K ¯N interaction.

  2. Investigating the X-ray and Radio Evolution of SN 2005kd

    Science.gov (United States)

    Dwarkadas, V.; Romero-Canizales, C.; Reddy, R.; Bauer, F.

    2017-10-01

    SN 2005kd is among the most luminous supernovae (SNe) to be discovered at X-ray wavelengths. We have re-analysed all good angular resolution archival X-ray data for SN 2005kd. The data reveal an X-ray lightcurve that decreases as t^{-1.62 ± 0.06}. Our modelling of the data suggests that the early evolution is dominated by emission from the forward shock in a high-density medium. Emission from the radiative reverse shock is absorbed by the cold dense shell formed behind the reverse shock. Our results suggest a progenitor with a mass-loss rate towards the end of its evolution > 4.3 × 10^{-4} M_{⊙} yr^{-1}, for a wind velocity of 10 km s^{-1}, at 4.0 × 10^{16} cm. This mass-loss rate is too high for most known stars, except perhaps hypergiant stars, or luminous blue variables. The observations are consistent with the fact that Type IIn SNe expand into high-density and high mass-loss rate environments, and also suggest rapid variability in the wind mass-loss parameters within the last 5000 yr of stellar evolution prior to core collapse. We present the radio and X-ray lightcurves of SN 2005kd, and discuss the implications for the evolution of the SN and the identity of the progenitor.

  3. KdV cnoidal waves in a traffic flow model with periodic boundaries

    Science.gov (United States)

    Hattam, L.

    2017-06-01

    An optimal-velocity (OV) model describes car motion on a single lane road. In particular, near to the boundary signifying the onset of traffic jams, this model reduces to a perturbed Korteweg-de Vries (KdV) equation using asymptotic analysis. Previously, the KdV soliton solution has then been found and compared to numerical results (see Muramatsu and Nagatani [1]). Here, we instead apply modulation theory to this perturbed KdV equation to obtain at leading order, the modulated cnoidal wave solution. At the next order, the Whitham equations are derived, which have been modified due to the equation perturbation terms. Next, from this modulation system, a family of spatially periodic cnoidal waves are identified that characterise vehicle headway distance. Then, for this set of solutions, we establish the relationship between the wave speed, the modulation term and the driver sensitivity. This analysis is confirmed with comparisons to numerical solutions of the OV model. As well, the long-time behaviour of these solutions is investigated.

  4. Characterization and leaching of NiCd and NiMH spent batteries for the recovery of metals.

    Science.gov (United States)

    Pietrelli, L; Bellomo, B; Fontana, D; Montereali, M

    2005-01-01

    Since NiMH and NiCd batteries are still used in the electronic devices market, a treatment and recycling plant has many advantages both from the environmental and the economic points of view. Unfortunately, there is no relationship between shape, size and chemical composition of spent batteries, consequently the characterization and the leaching method of the starting material becomes an important step of the overall treatment process in choosing the best conditions for the selective separation of the metals by hydrometallurgy. Leaching at 20 degrees C with H(2)SO(4) 2M for about 2h seems to be a good solution in terms of cost and efficiency for both battery types. The hydroxide compounds can be readily leached while Ni present as metallic form requires more aggressive conditions due to kinetic constraints. In this paper, the characterization of NiMH and NiCd spent batteries and the results of leaching tests in different conditions are reported.

  5. Impact of graphene oxide on viability of Chinese hamster ovary and mouse hepatoma MH-22A cells.

    Science.gov (United States)

    Batiuskaite, Danute; Grinceviciute, Nora; Snitka, Valentinas

    2015-08-01

    The evaluation of the cyto- and bio-compatibility is a critical step in the development of graphene oxide (GO) as a new promising material for in vivo biomedical applications. In this study, we report the impact of GO, with and without the addition of bovine serum albumin, on healthy (Chinese hamster ovary) and a cancer (mouse hepatoma MH-22A) cells viability and the estimation of the intracellular distribution of GO inside the cells in vitro. The viability tests were performed using a colony formation assay. The intracellular distribution of GO was estimated using Raman spectroscopy and imaging. The viability of both cell lines decreased with increasing concentration of graphene oxide (12.5-50.0 μg/ml): in the case of Chinese hamster ovary cells viability decreased from 44% to 11%, in the case of mouse hepatoma MH-22A cells--from 22% to 3%. These cell lines significantly differed in their response to GO and GO-BSA formulations. The results of viability tests correlate with results of atomic force microscopy and Raman spectroscopy and imaging findings. The GO influence on cell morphology changes, cell structure, cells colony growth dynamics and GO accumulation inside the cells was higher in the case of mouse hepatoma MH-22A cells. Copyright © 2015 Elsevier Ltd. All rights reserved.

  6. UNDERSTANDING VARIATION IN PARTITION COEFFICIENT KD, VALUES, VOLUME III: AMERICIUM, ARSENIC, CURIUM, IODINE, NEPTUNIUM, RADIUM, AND TECHNETIUM

    Science.gov (United States)

    This report describes the conceptualization, measurement, and use of the partition (or distribution) coefficient, Kd, parameter, and the geochemical aqueous solution and sorbent properties that are most important in controlling adsorption/retardation behavior of selected contamin...

  7. Exact solitary wave and quasi-periodic wave solutions of the KdV-Sawada-Kotera-Ramani equation

    National Research Council Canada - National Science Library

    Zhang, Lijun; Khalique, Chaudry Masood

    2015-01-01

    In this paper we derive new exact solitary wave solutions and quasi-periodic traveling wave solutions of the KdV-Sawada-Kotera-Ramani equation by using a method which we introduce here for the first time...

  8. Water Wave Solutions of the Coupled System Zakharov-Kuznetsov and Generalized Coupled KdV Equations

    Science.gov (United States)

    Seadawy, A. R.; El-Rashidy, K.

    2014-01-01

    An analytic study was conducted on coupled partial differential equations. We formally derived new solitary wave solutions of generalized coupled system of Zakharov-Kuznetsov (ZK) and KdV equations by using modified extended tanh method. The traveling wave solutions for each generalized coupled system of ZK and KdV equations are shown in form of periodic, dark, and bright solitary wave solutions. The structures of the obtained solutions are distinct and stable. PMID:25374940

  9. Integrable couplings of C-KdV equations hierarchy with self-consistent sources associated with sl-tilde(4)

    Energy Technology Data Exchange (ETDEWEB)

    Yu Fajun [College of Maths and Systematic Science, Shenyang Normal University, Shenyang 110034 (China)], E-mail: yfajun@163.com; Li Li [College of Maths and Systematic Science, Shenyang Normal University, Shenyang 110034 (China)

    2009-04-20

    We present a kind of integrable couplings of soliton equations hierarchy with self-consistent sources by using of loop algebra sl-tilde(4). As an application, a hierarchy of C-KdV equations with self-consistent sources is derived through loop algebra sl-tilde(2). Furthermore, we construct a new integrable couplings of the C-KdV soliton hierarchy with self-consistent sources by using of the enlarged loop algebra sl-tilde(4)

  10. Identification of 92-kD gelatinase in human coronary atherosclerotic lesions. Association of active enzyme synthesis with unstable angina.

    Science.gov (United States)

    Brown, D L; Hibbs, M S; Kearney, M; Loushin, C; Isner, J M

    1995-04-15

    Acute coronary ischemia is usually initiated by rupture of atherosclerotic plaque, leading to intracoronary thrombosis and clinical sequelae. The proximate cause of plaque rupture is unknown. Accordingly, we investigated the potential role of the 92-kD gelatinase member of the matrix metalloproteinase family in acute coronary ischemia. Coronary atherectomy specimens from patients with atherosclerosis and an acute ischemic syndrome consistent with recent plaque rupture (unstable angina) (n = 12) were immunostained for the presence of 92-kD gelatinase; the results were compared with those obtained by identical study of atherectomy specimens from patients with atherosclerosis and angina but without acute ischemia (stable angina) (n = 12). Positive immunostaining for 92-kD gelatinase was present in 83% of specimens from both unstable and stable angina patients. However, intracellular localization of enzyme (indicating active synthesis) was documented in 10 of 10 positively stained specimens from patients with unstable angina compared with 3 of 10 positively stained specimens from patients with stable angina. Macrophages and smooth muscle cells were the major sources of 92-kD gelatinase in all specimens examined by immunostaining of adjacent sections. 92-kD gelatinase is commonly expressed in coronary arterial atherosclerotic lesions. Active synthesis of 92-kD gelatinase by macrophages and smooth muscle cells in atherosclerotic lesions may play a pathogenic role in the development of acute coronary ischemia.

  11. Application of the method of lines for solving the KdV-Burger equation

    Directory of Open Access Journals (Sweden)

    rahma el sadat

    2017-12-01

    Full Text Available This paper presents two methods for obtaining the solutions to the nonlinear Korteweg-de Vries–Burgers (KdVB equation. The first is the method of lines (MOL. The second method is Adomian decomposition method (ADM. The numerical results of the MOL are compared with the analytical results of the ADM. In order to show the reliability of the considered methods we have compared the obtained solutions with the exact ones. The results reveal that the both methods are effective and convenient for solving such types of partial differential equations but the method of lines gives accurate results over the analytical method.

  12. Modulating functions method for parameters estimation in the fifth order KdV equation

    KAUST Repository

    Asiri, Sharefa M.

    2017-07-25

    In this work, the modulating functions method is proposed for estimating coefficients in higher-order nonlinear partial differential equation which is the fifth order Kortewegde Vries (KdV) equation. The proposed method transforms the problem into a system of linear algebraic equations of the unknowns. The statistical properties of the modulating functions solution are described in this paper. In addition, guidelines for choosing the number of modulating functions, which is an important design parameter, are provided. The effectiveness and robustness of the proposed method are shown through numerical simulations in both noise-free and noisy cases.

  13. The histone variant mH2A1.1 interferes with transcription by down-regulating PARP-1 enzymatic activity

    Science.gov (United States)

    Ouararhni, Khalid; Hadj-Slimane, Réda; Ait-Si-Ali, Slimane; Robin, Philippe; Mietton, Flore; Harel-Bellan, Annick; Dimitrov, Stefan; Hamiche, Ali

    2006-01-01

    The histone variant mH2A is believed to be involved in transcriptional repression, but how it exerts its function remains elusive. By using chromatin immunoprecipitation and tandem affinity immunopurification of the mH2A1.1 nucleosome complex, we identified numerous genes with promoters containing mH2A1.1 nucleosomes. In particular, the promoters of the inducible Hsp70.1 and Hsp70.2 genes, but not that of the constitutively expressed Hsp70.8, were highly enriched in mH2A1.1. PARP-1 was identified as a part of the mH2A1.1 nucleosome complex and was found to be associated with the Hsp70.1 promoter. A specific interaction between mH2A1.1 and PARP-1 was demonstrated and found to be associated with inactivation of PARP-1 enzymatic activity. Heat shock released both mH2A1.1 and PARP-1 from the Hsp70.1 promoter and activated PARP-1 automodification activity. The data we present point to a novel mechanism for control of Hsp70.1 gene transcription. mH2A1.1 recruits PARP-1 to the promoter, thereby inactivating it. Upon heat shock, the Hsp70.1 promoter-bound PARP-1 is released to activate transcription through ADP-ribosylation of other Hsp70.1 promoter-bound proteins. PMID:17158748

  14. Building consumers in to service evaluation: development of the MH-CoPES Framework in New South Wales.

    Science.gov (United States)

    Malins, Gillian; Oakley, Karen; Doyle, Rebecca

    2011-08-01

    The aim of this paper is to present the Mental Health Consumer Perceptions and Experiences of Services (MH-CoPES) Framework and discuss its development. The Framework was developed to address the need for a consistent approach across New South Wales mental health services for consumer involvement in service evaluation and planning. A four step Framework has been developed for implementation across adult public mental health services in NSW. The Framework focuses not only on collecting consumers' views of mental health services but on ensuring that procedures to report on and make changes based on this information are in place.

  15. A dynamical systems perspective on the absence of debris associated with the disappearance of flight MH370

    OpenAIRE

    García-Garrido, V. J.; Mancho, A. M.; Wiggins, S.; Mendoza, C.

    2015-01-01

    The disappearance of Malaysia Airlines flight MH370 on the morning of the 8 March 2014 is one of the great mysteries of our time. Perhaps the most relevant aspect of this mystery is that not a single piece of debris from the aircraft has been found. Difficulties in the search efforts, due to the uncertainty in the plane's final impact point and the time that has passed since the accident, bring the question on how the debris has scattered in an always moving ocean, for which...

  16. A dynamical systems approach to the surface search for debris associated with the disappearance of flight MH370

    OpenAIRE

    García-Garrido, V. J.; Mancho, A. M.; Wiggins, S.; Mendoza, C.

    2015-01-01

    The disappearance of Malaysia Airlines flight MH370 on the morning of 8 March 2014 is one of the great mysteries of our time. Perhaps the most relevant aspect of this mystery is that not a single piece of debris from the aircraft was found during the intensive surface search carried out for roughly 2 months following the crash. Difficulties in the search efforts, due to the uncertainty of the plane's final impact point and the time that had passed since the accident, bring t...

  17. The Higgs mass coincidence problem: why is the Higgs mass $m_H^2=m_Z m_t$?

    CERN Document Server

    Torrente-Lujan, E

    2014-01-01

    On the light of the recent LHC boson discovery, we present a phenomenological evaluation of the ratio $\\rho_t=m_Z m_t/m_H^2$, from the LHC combined $m_H$ value, we get ($ (1\\sigma)$) $\\rho_t^{(exp)}= 0.9956\\pm 0.0081$. This value is close to one with a precision of the order $\\sim 1\\%$. Similarly we evaluate the ratio $\\rho_{Wt}=(m_W + m_t)/(2 m_H)$. From the up-to-date mass values we get $\\rho_{Wt}^{(exp)}= 1.0066\\pm 0.0035 (1\\sigma)$. The Higgs mass is numerically close (at the $1\\%$ level) to the $m_H\\sim (m_W+m_t)/2$. From these relations we can write any two mass ratios as a function of, exclusively, the Weinberg angle (with a precision of the order of $1\\%$ or better): \\begin{eqnarray} \\frac{m_i}{m_j}&\\simeq & f_{ij}(\\theta_W),\\quad i,j=W,Z,H,t. \\end{eqnarray} For example:$m_H/m_Z \\simeq 1+\\sqrt{2} s_{\\theta_W/2}^2$, $m_H/m_t c_{\\theta_W} \\simeq 1-\\sqrt{2}s_{ \\theta_W/2}^2$. In the limit $\\cos\\theta_W\\to 1$ all the masses would become equal $m_Z=m_W=m_t=m_H$. We review the theoretical situation ...

  18. New direct linearizations for KdV and solutions of the other Cauchy problem

    Science.gov (United States)

    Sabatier, Pierre C.

    1999-06-01

    The author showed previously that there are several equations that "directly linearize" the Korteweg de Vries equation. They may give different classes of solutions and they correspond either to generalized Gelfand Levitan or generalized Marchenko inversion equations. The idea is developed here with a precise goal: solving by linear methods the "other Cauchy problem" for KdV, i.e., the boundary value problem where the solution is known at fixed x, together with its two first derivatives. After several new direct linearization equations are given and analyzed, the one that solves the problem is eventually obtained. It also corresponds to a new inverse spectral problem, whose scalar equations are fourth order, and that is first studied in the Gelfand Levitan form, and then studied and completely solved in the Marchenko form. The methods given here can be extended probably to most nonlinear integrable equations, and suggest several new problems.

  19. Direct comparison of [18F]MH.MZ and [18F]altanserin for 5-HT2A receptor imaging with PET

    DEFF Research Database (Denmark)

    Hansen, Hanne Demant; Ettrup, Anders; Herth, Matthias Manfred

    2013-01-01

    Imaging the cerebral serotonin 2A (5-HT(2A) ) receptors with positron emission tomography (PET) has been carried out in humans with [(11) C]MDL 100907 and [(18) F]altanserin. Recently, the MDL 100907 analogue [(18) F]MH.MZ was developed combining the selectivity profile of MDL 100907 and the favo......Imaging the cerebral serotonin 2A (5-HT(2A) ) receptors with positron emission tomography (PET) has been carried out in humans with [(11) C]MDL 100907 and [(18) F]altanserin. Recently, the MDL 100907 analogue [(18) F]MH.MZ was developed combining the selectivity profile of MDL 100907...... and the favourable radiophysical properties of fluorine-18. Here, we present a direct comparison of [(18) F]altanserin and [(18) F]MH.MZ. 5-HT(2A) receptor binding in pig cortex and cerebellum was investigated by autoradiography with [(3) H]MDL 100907, [(18) F]MH.MZ, and [(18) F]altanserin. [(18) F]MH.MZ and [(18) F......]altanserin were investigated in Danish Landrace pigs by brain PET scanning at baseline and after i.v. administration of blocking doses of ketanserin. Full arterial input function and HPLC analysis allowed for tissue-compartment kinetic modelling of PET data. In vitro autoradiography showed high binding...

  20. \\bar{\\partial }-problem and Cauchy matrix for the mKdV equation with self-consistent sources

    Science.gov (United States)

    Zhu, Junyi; Zhou, Dewen; Geng, Xianguo

    2014-06-01

    The modified Korteweg-de Vries (mKdV) and Maxwell-Bloch system is studied by using the dressing method based on the local 2 × 2 matrix \\bar{\\partial }-problem. By virtue of a singular dispersion relation, we derive the present mKdV equation with self-consistent sources which change the velocities of the solitons. The explicit solutions, including the bright and dark type N-soliton solutions due to different forms of the spectral transform matrix, are given by virtue of the properties of the Cauchy matrix.

  1. Recommended Distribution Coefficients, Kd Values, for Special Analysis Risk Calculations Related to Waste Disposal and Tank Closure on the Savannah River Site

    Energy Technology Data Exchange (ETDEWEB)

    Kaplan, D

    2005-08-31

    The purpose of this document is to provide a technically defensible list of distribution coefficients, or Kd values, for use in performance assessment (PA) and special analysis (SA) calculations on the SRS. Only Kd values for radionuclides that have new information related to them or that have recently been recognized as being important are discussed in this report. Some 150 Kd values are provided in this report for various waste-disposal or tank-closure environments: soil, corrosion in grout, oxidizing grout waste, gravel, clay, and reducing concrete environments. Documentation and justification for the selection of each Kd value is provided.

  2. On the Fate of Debris Associated with the Disappearance of Flight MH370: a Dynamical System Perspective

    Science.gov (United States)

    Mancho, A. M.; Garcia-Garrido, V. J.; Wiggins, S.; Mendoza, C.

    2015-12-01

    The disappearance of Malaysia Airlines flight MH370 on the morning of the 8th of March 2014 is one of the great mysteries of our time. One relevant aspect of this mystery is that not a single piece of debris from the aircraft was found during the intensive surface search carried out in the months following the crash. Difficulties in the search efforts were due to the uncertainty in the plane's final impact point and the time passed since the accident and rise the question on how the debris was scattered in an always moving ocean, for which there exist multiple datasets that do not uniquely determine its state. Our approach to this problem is based on dynamical systems tools that identify dynamic barriers and coherent structures governing transport. By combining publicly available information supplied by different ocean data sources with these mathematical techniques, we are able to assess the spatio-temporal state of the ocean in the priority search area at the time of impact and the following weeks. Using this information we propose a revised search strategy by showing why one might not have expected to find debris in some large search areas targeted by the search services and determining regions where one might have expected impact debris to be located and that were not subjected to any exploration. This research has been supported by MINECO under grants MTM2014-56392-R and ICMAT Severo Ochoa project SEV-2011-0087 and ONR grant No. N00014- 01-1-0769. Computational support from CESGA is acknowledged. References [1] V. J. García-Garrido, A. M. Mancho, S. Wiggins, and C. Mendoza. A dynamical systems perspective on the absence of debris associated with the disappearance of flight MH370. Nonlin. Processes Geophys. Discuss., 2,1197-1225, doi:10.5194/npgd-2-1197-2015, 2015

  3. Carcass Characteristics of Kacang Goats Fed Ration Containing MH-1 Variety of Kapok Seed Meal (Ceiba pentandra, GAERTN.

    Directory of Open Access Journals (Sweden)

    T. Hidjaz

    2014-04-01

    Full Text Available This research aimed to study the carcass characteristics of Kacang goats fed ration containing kapok seed meal (KSM as a component of the concentrate. The experiment was conducted in two stages. The first stage was to find out the best variety of kapok that will be used in the second experiment; the second stage was to determine the benefits of KSM on carcass characteristics. Twenty-five, 8 months old Kacang goats with initial body weight of 11.71±1.08 kg, were used in this experiment. The animals were housed individually based on completely randomized design (CRD with 5 treatments and 5 replications. The rations were based on forage:concentrate ratio of 50:50 dry matter basis. The ration contained concentrates, with increasing levels of KSM, i.e.: R0 (napier grass + concentrate: rice bran, coconut cake, corn, urea + 0% KSM; R5 (R0 + KSM 5%; R10 (R0 + KSM 10%; R15 (R0 + KSM 15%; and R20 (R0 + KSM 20%. Drinking water was provided ad libitum. The result of first stage showed that KSM variety of MH-1 would be used as a component of the concentrate on the second experiment. The increasing level of KSM in the rations had significant effect (P<0.05 on physical characteristics of the carcass, such as dressing percentage (44.35%, carcass length (54.006 cm, fleshing index (130.59 g/cm, plumpness of leg (87.48%, loin eye area (5.06 cm2, and percentage of carcass meat (64.69%. It is concluded that MH-1 variety of KSM can be used as a feed component up to 20 % in the goat ration.

  4. Hempseed oil induces reactive oxygen species- and C/EBP homologous protein-mediated apoptosis in MH7A human rheumatoid arthritis fibroblast-like synovial cells.

    Science.gov (United States)

    Jeong, Mini; Cho, Jaewook; Shin, Jong-Il; Jeon, Yong-Joon; Kim, Jin-Hyun; Lee, Sung-Joon; Kim, Eun-Soo; Lee, Kyungho

    2014-07-03

    The medicinal efficacy of hempseed (Cannabis sativa L.), which is rich in polyunsaturated fatty acids, in atopic dermatitis, inflammation, and rheumatoid arthritis (RA) has been suggested for centuries. Hempseed has been used as a treatment for these diseases in Korean and Chinese folk medicine. The aim of the study is to investigate the effects of hempseed oil (HO) on MH7A human RA fibroblast-like synovial cells. MH7A cells were used to study the anti-rheumatoid effects of hempseed (Cannabis sativa L., cv. Cheungsam/Cannabaceae) oil by investigating cell viability, apoptosis, lipid accumulation, oxidative stress, and endoplasmic reticulum (ER) stress-induced apoptosis. HO treatment reduced the survival rate of MH7A cells and promoted apoptotic cell death in a time- and dose-dependent manner. Both lipid accumulation and the level of intracellular reactive oxygen species (ROS) increased in HO-treated MH7A cells. Co-treatment with the antioxidant Tiron effectively abrogated the cytotoxic effects of HO; the ROS level was reduced, cell viability was recovered, and apoptotic cell death was significantly diminished. Moreover, HO-treated cells exhibited increased expression of the major ER stress markers, glucose-regulated protein 78 and C/EBP homologous protein (CHOP). The siRNA-mediated knockdown of CHOP prevented HO-induced apoptosis. Our results suggest that HO treatment induced lipid accumulation, ROS production, CHOP expression, and apoptosis in MH7A cells, and that CHOP functions as an anti-rheumatoid factor downstream of HO in MH7A cells. Copyright © 2014 Elsevier Ireland Ltd. All rights reserved.

  5. Autoantibodies to a 140-kd protein in juvenile dermatomyositis are associated with calcinosis.

    LENUS (Irish Health Repository)

    Gunawardena, H

    2009-06-01

    OBJECTIVE: The identification of novel autoantibodies in juvenile dermatomyositis (DM) may have etiologic and clinical implications. The aim of this study was to describe autoantibodies to a 140-kd protein in children recruited to the Juvenile DM National Registry and Repository for UK and Ireland. METHODS: Clinical data and sera were collected from children with juvenile myositis. Sera that recognized a 140-kd protein by immunoprecipitation were identified. The identity of the p140 autoantigen was investigated by immunoprecipitation\\/immunodepletion, using commercial monoclonal antibodies to NXP-2, reference anti-p140, and anti-p155\\/140, the other autoantibody recently described in juvenile DM. DNA samples from 100 Caucasian children with myositis were genotyped for HLA class II haplotype associations and compared with those from 864 randomly selected UK Caucasian control subjects. RESULTS: Sera from 37 (23%) of 162 patients with juvenile myositis were positive for anti-p140 autoantibodies, which were detected exclusively in patients with juvenile DM and not in patients with juvenile DM-overlap syndrome or control subjects. No anti-p140 antibody-positive patients were positive for other recognized autoantibodies. Immunodepletion suggested that the identity of p140 was consistent with NXP-2 (the previously identified MJ autoantigen). In children with anti-p140 antibodies, the association with calcinosis was significant compared with the rest of the cohort (corrected P < 0.005, odds ratio 7.0, 95% confidence interval 3.0-16.1). The clinical features of patients with anti-p140 autoantibodies were different from those of children with anti-p155\\/140 autoantibodies. The presence of HLA-DRB1*08 was a possible risk factor for anti-p140 autoantibody positivity. CONCLUSION: This study has established that anti-p140 autoantibodies represent a major autoantibody subset in juvenile DM. This specificity may identify a further immunogenetic and clinical phenotype within the

  6. Kd Values for Agricultural and Surface Soils for Use in Hanford Site Farm, Residential, and River Shoreline Scenarios

    Energy Technology Data Exchange (ETDEWEB)

    Serne, R. Jeffrey

    2007-08-01

    This report provides best estimate Kd values and a minimum and maximum range of Kd values to be used for agricultural soils and Columbia River bank sediments that exist today or would exist in the future when portions of the Hanford Site are released for farming, residential, and recreational use after the U. S. Department of Energy (DOE) completes clean up of defense waste on the site. The Kd values should be used to determine the fate and transport rates of contaminants and their availability for plant and animal uptake in selected non-groundwater scenarios included in Hanford Site environmental impact statements, risk assessments and specific facility performance assessments. This report describes scenarios such as a small farm where drilling of a well inadvertently goes through buried waste and brings waste to the surface, allowing the tailings to become available for direct human exposure or incorporation into garden crops and farm animals used for food by the farm family. The Kd values recommended in this report can also be used to calculate sediment-water partitioning factors used to predict plant and animal uptake from interaction with the contaminated soil.

  7. A third-order KdV solution for internal solitary waves and its application in the numerical wave tank

    Directory of Open Access Journals (Sweden)

    Qicheng Meng

    2016-04-01

    Full Text Available A third-order KdV solution to the internal solitary wave is derived by a new method based on the weakly nonlinear assumptions in a rigid-lid two-layer system. The solution corrects an error by Mirie and Su (1984. A two-dimensional numerical wave tank has been established with the help of the open source CFD library OpenFOAM and the third-party software waves2Foam. Various analytical solutions, including the first-order to third-order KdV solutions, the eKdV solution and the MCC solution, have been used to initialise the flow fields in the CFD simulations of internal solitary waves. Two groups including 11 numerical cases have been carried out. In the same group, the initial wave amplitudes are the same but the implemented analytical solutions are different. The simulated wave profiles at different moments have been presented. The relative errors in terms of the wave amplitude between the last time step and the initial input have been analysed quantitatively. It is found that the third-order KdV solution results in the most stable internal solitary wave in the numerical wave tank for both small-amplitude and finite-amplitude cases. The finding is significant for the further simulations involving internal solitary waves.

  8. Technetium, Iodine, and Chromium Adsorption/Desorption Kd Values for Vadose Zone Pore Water, ILAW Glass, and Cast Stone Leachates Contacting an IDF Sand Sequence

    Energy Technology Data Exchange (ETDEWEB)

    Last, George V. [Pacific Northwest National Lab. (PNNL), Richland, WA (United States); Snyder, Michelle M.V. [Pacific Northwest National Lab. (PNNL), Richland, WA (United States); Um, Wooyong [Pacific Northwest National Lab. (PNNL), Richland, WA (United States); Stephenson, John R. [Pacific Northwest National Lab. (PNNL), Richland, WA (United States); Leavy, Ian I. [Pacific Northwest National Lab. (PNNL), Richland, WA (United States); Strickland, Christopher E. [Pacific Northwest National Lab. (PNNL), Richland, WA (United States); Bacon, Diana H. [Pacific Northwest National Lab. (PNNL), Richland, WA (United States); Qafoku, Nikolla [Pacific Northwest National Lab. (PNNL), Richland, WA (United States); Serne, R. Jeffrey [Pacific Northwest National Lab. (PNNL), Richland, WA (United States)

    2015-11-01

    Performance and risk assessments of immobilized low-activity waste (ILAW) at the Integrated Disposal Facility (IDF) have shown that risks to groundwater are quite sensitive to adsorption-desorption interactions occurring in the near- and far-field environment. These interactions between the underlying sediments and the contaminants present in the leachates that descend from the buried glass, secondary waste grouts, and potentially Cast Stone low-activity waste packages have been represented in these assessments using the contaminant distribution coefficient (Kd) construct. Some contaminants (99Tc, 129I, and Cr) present in significant quantities in these wastes have low Kd values and tend to drive risk to public health and the environment. Relatively small changes in the Kd value can cause relatively large changes in the retardation factor. Thus, even relatively small uncertainty in the Kd value can result in a relatively large uncertainty in the risk determined through performance assessment modeling. The purpose of this study is to further reduce the uncertainty in Kd values for 99Tc, iodine (iodide and iodate), and Cr (chromate; CrO42-) by conducting systematic adsorption-desorption experiments using actual sand-dominated Hanford formation sediments from beneath the IDF and solutions that closely mimic Hanford vadose zone pore water and leachates from Cast Stone and ILAW glass waste forms. Twenty-four batch and 21 flow-through column experiments were conducted, yielding 261 Kd measurements for these key contaminants, and contributing to our understanding for predicting transport from wastes disposed to the IDF. While the batch Kd methodology is not well-suited for measuring Kd values for non-sorbing species (as noted by the U.S. Environmental Protection Agency), the batch Kd results presented here are not wholly inconsistent with the column Kd results, and could be used for sensitivity purposes. Results from the column experiments are consistent with the best

  9. Reactive transport model and apparent Kd of Ni in the near field of a HLW repository in granite

    Science.gov (United States)

    Lu, Chuanhe; Samper, Javier; Luis Cormenzana, José; Ma, Hongyun; Montenegro, Luis; Ángel Cuñado, Miguel

    2012-12-01

    Current performance assessment models for radionuclide migration through the near field of high-level radioactive waste repositories often rely on the assumption of a constant Kd for sorption. The validity of such assumption is evaluated here with a reactive transport model for Ni2+ in the near field of a repository in granite. Model results show that Ni2+ sorbs mainly by surface complexation on weak sorption sites. The apparent Kd of Ni2+, Kda, depends on the concentration of dissolved Ni and pH and is constant only when the concentration of dissolved Ni is smaller than 10-6 mol/L. The results of the sensitivity runs show that Kda is sensitive to the water flux at the bentonite-granite interface, the effective diffusion of the bentonite and the concentration of weak sorption sites of the bentonite. The competition of other nuclides such as Cs+ on Ni2+ sorption is not important. Corrosion products, however, affect significantly the sorption of Ni2+ on the bentonite. The model with a constant Kd does not reproduce the release rates of Ni2+ from the bentonite into the granite. A model with a variable Kd which depends on the concentration of dissolved Ni2+ and pH may provide an acceptable surrogate of the multicomponent reactive transport model for the conditions of the repository considered in our model. Simulations using the Kd-approach were performed with GoldSim based on the interpolation in the pH and concentration table, while the reactive transport model simulations were performed with CORE2D which incorporates multisite surface complexation.

  10. Modelling radionuclide transport in highly heterogeneous media and under variable hydrochemical conditions using a "dynamic Kd" approach

    Science.gov (United States)

    Trinchero, Paolo; Painter, Scott; Ebrahimi, Hedieh; Koskinen, Lasse; Molinero, jorge; Selroos, Jan-Olof

    2015-04-01

    Due to the high heterogeneity of fractured media and the ubiquitous lack of a complete site characterization, deterministic simulations of radionuclide transport in fractured rocks are notoriously highly uncertain. This uncertainty is usually addressed using stochastic methods; e.g. the connectivity structure of the medium is described using multiple realizations of Discrete Fracture Networks (DFN), which are then combined to particle tracking simulations. In these formulations, many complex geochemical retention processes are typically lumped into a single parameter: the distribution coefficient (Kd). This approach relies on an important assumption: the Kd values are constant in time. This hypothesis is critical under long-term geochemical changes as it is known that the distribution coefficient depends on the pH, redox conditions and major chemistry of the system. In this work, we present a novel methodology that combines the robustness of stochastic methods with an explicit description of water-solute-rock interaction processes. The reconciliation of all these is achieved by using a dynamic Kd approach. The hydrogeochemical evolution of the site of study is first computed using long-term and large-scale mechanistic reactive transport simulations. The simulated hydrochemical conditions are then used to generate a complete database of Kd values, which represent the hydrochemical conditions in every position and time of the model domain. Then, MARFA (Painter and Mancillas, 2009) is used to carry out Time Domain Random Walk (TDRW) simulations of radionuclide transport. In these simulations, Kd values are dynamically updated using the afore-mentioned database. The results (i.e. radionuclide breakthrough curves) bring the signature of the underlying changes in the background geochemistry.

  11. The university münster model surgery system for orthognathic surgery. Part II – KD-MMS

    Directory of Open Access Journals (Sweden)

    Ehmer Ulrike

    2013-01-01

    Full Text Available Abstract Background Model surgery is an integral part of the planning procedure in orthognathic surgery. Most concepts comprise cutting the dental cast off its socket. The standardized spacer plates of the KD-MMS provide for a non-destructive, reversible and reproducible means of maxillary and/or mandibular plaster cast separation. Methods In the course of development of the system various articulator types were evaluated with regard to their capability to provide a means of realizing the concepts comprised of the KD-MMS. Special attention was dedicated to the ability to perform three-dimensional displacements without cutting of plaster casts. Various utilities were developed to facilitate maxillary displacement in accordance to the planning. Objectives of this development comprised the ability to implement the values established in the course of two-dimensional ceph planning. Results The system - KD-MMS comprises a set of hardware components as well as a defined procedure. Essential hardware components are red spacer and blue mounting plates. The blue mounting plates replace the standard yellow SAM mounting elements. The red spacers provide for a defined leeway of 8 mm for three-dimensional movements. The non-destructive approach of the KD-MMS makes it possible to conduct different model surgeries with the same plaster casts as well as to restore the initial, pre-surgical situation at any time. Thereby, surgical protocol generation and gnathologic splint construction are facilitated. Conclusions The KD-MMS hardware components in conjunction with the defined procedures are capable of increasing efficiency and accuracy of model surgery and splint construction. In cases where different surgical approaches need to be evaluated in the course of model surgery, a significant reduction of chair time may be achieved.

  12. Signal Recognition Particle 54 kD Protein (SRP54 from the Marine Sponge Geodia cydonium

    Directory of Open Access Journals (Sweden)

    Sonja Durajlija-Žinić

    2002-01-01

    Full Text Available In the systematic search for phylogenetically conserved proteins in the simplest and most ancient extant metazoan phylum – Porifera, we have identified and analyzed a cDNA encoding the signal recognition particle 54 kD protein (SRP54 from the marine sponge Geodia cydonium (Demospongiae. The signal recognition particle (SRP is a universally conserved ribonucleoprotein complex of a very ancient origin, comprising SRP RNA and several proteins (six in mammals. The nucleotide sequence of the sponge cDNA predicts a protein of 499 amino acid residues with a calculated Mr of 55175. G. cydonium SRP54 displays unusually high overall similarity (90 % with human/mammalian SRP54 proteins, higher than with Drosophila melanogaster (88 %, or Caenorhabditis elegans (82 %. The same was found for the majority of known and phylogenetically conserved proteins from sponges, indicating that the molecular evolutionary rates in protein coding genes in Porifera as well as in highly developed mammals (vertebrates are slower, when compared with the rates in homologous genes from invertebrates (insects, nematodes. Therefore, genes/proteins from sponges might be the best candidates for the reconstruction of ancient structures of proteins and genome/proteome complexity in the ancestral organism, common to all multicellular animals.

  13. Granulocytes of critically ill patients spontaneously express the 72 kD heat shock protein.

    Science.gov (United States)

    Kindås-Mügge, I; Hammerle, A H; Fröhlich, I; Oismüller, C; Micksche, M; Trautinger, F

    1993-04-01

    Polymorphonuclear neutrophils (PMN), through their ability to release oxygen-free radicals and other tissue-damaging molecules, play a major role in the pathogenesis of multiple organ failure syndrome (MOFS). There is evidence that heat shock proteins (stress proteins; HSPs) are involved in cellular repair mechanisms, and are protecting cells against oxidative injury. In this study, we analyzed the spontaneous expression of the 72 kD HSP (HSP72) in peripheral blood PMN of 20 critically ill patients (16 polytrauma victims, four patients after major surgery) admitted to an intensive care unit. The expression of HSP72 was investigated in PMN of patients and healthy donors by immunohistochemistry. We found spontaneous expression of HSP72 in PMN of 12 (60%) of 20 patients. No specific staining was detected in PMN of healthy donors (n = 10). In PMN of six of 12 patients expressing HSP72 without previous heat treatment, we found an impairment of respiratory burst activity (RBA) compared to the control population. These results demonstrate for the first time the in vivo expression of HSP72 in human leukocytes without previous heat treatment, and suggest a possible role of this protein in patients suffering from severe tissue injury.

  14. Tijdstip van MH-bespuiting in uien en effect van stikstof op kale uien; proeven 2009/2010 en eindrapportage 2007-2010

    NARCIS (Netherlands)

    Brink, van den L.

    2011-01-01

    In 2009 is zowel het onderzoek naar het optimale moment van MH(maleïnehydrazide)-bespuiting als het onderzoek naar het effect van stikstofbemesting op het optreden van kale uien voorgezet. Evenals in 2008 zijn in 2009 twee proeven in Lelystad uitgevoerd. Een proef waarin bij zes rassen op

  15. The b-quark mass from non-perturbative $N_f=2$ Heavy Quark Effective Theory at $O(1/m_h)$

    DEFF Research Database (Denmark)

    Bernardoni, F.; Blossier, B.; Bulava, J.

    2014-01-01

    We report our final estimate of the b-quark mass from $N_f=2$ lattice QCD simulations using Heavy Quark Effective Theory non-perturbatively matched to QCD at $O(1/m_h)$. Treating systematic and statistical errors in a conservative manner, we obtain $\\overline{m}_{\\rm b}^{\\overline{\\rm MS}}(2 {\\rm...

  16. Low titer, isolated anti Ro/SSA 60 kd antibodies is correlated with positive pregnancy outcomes in women at risk of congenital heart block.

    Science.gov (United States)

    Tonello, Marta; Hoxha, Ariela; Mattia, Elena; Zambon, Alessandra; Visentin, Silvia; Cerutti, Alessia; Ghirardello, Anna; Milanesi, Ornella; Ruffatti, Amelia

    2017-05-01

    Congenital heart block (CHB) is an autoantibody mediated disorder presumably caused by placental transmission of maternal autoantibodies to Ro/SSA 52 kd, p200, Ro/SSA 60 kd, La/SSB ribonucleoproteins. This study investigated the clinical significance of isolated anti-Ro/SSA 52 kd, anti-p200, anti-Ro/SSA 60 kd, and anti-La/SSB antibodies in positive pregnant patients. One hundred sixty-three pregnant women positive to anti-Ro/SSA 52 kd and/or anti-Ro/SSA 60 kd and/or anti-La/SSB antibodies were prospectively enrolled in the study. Anti-Ro52, anti-Ro60, anti-p200, and anti-La antibodies were assayed using home-made ELISA assays. Isolated antibody positivity was found in 25 women (15.3%), while multiple antibody positivity in 138 (84.7%). Twenty-four developed CHB, and the 139 had a favorable pregnancy outcome. The prevalence of isolated anti-Ro/SSA 60 kd antibodies was significantly higher (p < 0.046) as the prevalence of lower mean antibody titers (p < 0.0001) in the later group. Confirmation of these results by large-scale studies could lead clinicians to recommend less stringent fetal echocardiography monitoring in women with isolated anti-Ro/SSA 60 kd antibodies.

  17. Fragmentations of [M-H]- anions of peptides containing Ser sulfate. A joint experimental and theoretical study.

    Science.gov (United States)

    Tran, T T Nha; Wang, Tianfang; Hack, Sandra; Bowie, John H

    2013-11-15

    To determine the negative-ion cleavages from [M-H](-) ions of Ser sulfate-containing peptides using experiment and theory in concert. Fragmentations were explored using a Waters QTOF2 mass spectrometer in negative-ion electrospray mode, together with calculations at the CAM-B3LYP/6-311++g(d,p) level of theory. Peptides used in this study were: GS(SO3H)(OH) 1 GS(SO3H)(OCH3) 1a GAVS(SO3H)(OH) 2 GAVS(SO3H)(OCH3) 2a GLS(SO3H)(GVA(OH) 3 GLS(SO3H)GDA(OH) 4 GLS(SO3H)GS(SO3H)A(OH) 5. Previously, it has been shown that a peptide containing a Tyr sulfate group shows [(M-H)(-) -SO3] as the base peak. Only a small peak was observed corresponding to HOSO3(-) (formed following rearrangement of the sulfate). A Ser sulfate-containing peptide, in contrast, shows pronounced peaks due to cleavage product anions [(M-H)(-)-SO3] and HOSO3(-). Theoretical calculations at the CAM-B3LYP/6-311++g(d,p) level of theory suggest that rearrangement of a Ser sulfate to give C-terminal CO2SO3H is energetically unfavourable in comparison with fragmentation of the intact Ser sulfate to yield [(M-H)(-)-SO3] and HOSO3(-). [(M-H)(-)-H2SO4] anions are not observed in the spectra of peptides containing Ser sulfate, presumably because HOSO3(-) is a relatively weak gas-phase base (ΔGacid = 1265 kJ mol(-1)). Experimental and theoretical data suggest that [(M-H)(-)-SO3] and HOSO3(-) product anions (from a peptide with a C-terminal Ser sulfate) are formed from the serine sulfate anion accompanied by specific proton transfer. CID MS/MS/MS data for an [(M-H)(-)-SO3] ion of an underivatised sulfate-containing peptide will normally allow the determination of the amino acid sequence of that peptide. The one case we have studied where that is not the case is GLS(SO3H)GDA(OH), where the peptide contains Ser sulfate and Asp, where the diagnostic Asp cleavages are competitive with the Ser sulfate cleavages. Copyright © 2013 John Wiley & Sons, Ltd.

  18. MODELLING SOLUTIONS TO THE KdV-BURGERS EQUATION IN THE CASE OF NONHOMOGENEOUS DISSIPATIVE MEDIA

    Directory of Open Access Journals (Sweden)

    V. Samokhin Alexey

    2017-01-01

    Full Text Available The behavior of the soliton type solutions to the KdV-Burgers equation is studied numerically in the case of non- homogeneous dissipative media. A soliton moves from left to right and it does not change its form. The solitons with great- er amplitude are narrower and move faster. The aim of the presented research is to study the behavior of the soliton that, while moving in nondissipative medium encounters a barrier (finite or infinite with finite constant dissipation; one may imagine an impulse of light meeting on its way a partially absorbing layer. The modelling included the case of a finite dis- sipative layer similar to a wave passing through the air-glass-air as well as a wave passing from a nondissipative layer into a dissipative one (similar to the passage of light from air to water. The present paper is a continuation of the authors’ pub- lications. New results include a numerical model of the wave’s behavior for different types of the media non-homogeneity. The dissipation predictably results in reducing the soliton’s amplitude, but some new effects occur in the case of finite piecewise constant barrier on the soliton path: after the wave leaves the dissipative barrier it retains, on the whole, a soliton form yet some small and rapidly decreasing oscillations arises in front of the soliton. These oscillations are getting larger and spread as the soliton is moving of the barrier; the distance between the soliton and the oscillation grows. That is, the oscillations are faster than the soliton. The modelling used the Maple software PDETools packet; these activities were time and resources consuming.

  19. A dynamical systems approach to the surface search for debris associated with the disappearance of flight MH370

    Science.gov (United States)

    García-Garrido, V. J.; Mancho, A. M.; Wiggins, S.; Mendoza, C.

    2015-11-01

    The disappearance of Malaysia Airlines flight MH370 on the morning of 8 March 2014 is one of the great mysteries of our time. Perhaps the most relevant aspect of this mystery is that not a single piece of debris from the aircraft was found during the intensive surface search carried out for roughly 2 months following the crash. Difficulties in the search efforts, due to the uncertainty of the plane's final impact point and the time that had passed since the accident, bring the question on how the debris scattered in an always moving ocean, for which there are multiple data sets that do not uniquely determine its state. Our approach to this problem is based on the use of Lagrangian descriptors (LD), a novel mathematical tool coming from dynamical systems theory that identifies dynamic barriers and coherent structures governing transport. By combining publicly available information supplied by different ocean data sources with these mathematical techniques, we are able to assess the spatio-temporal state of the ocean in the priority search area at the time of impact and the following weeks. Using this information we propose a revised search strategy by showing why one might not have expected to find debris in some large search areas targeted by the Australian Maritime Safety Authority (AMSA), and determining regions where one might have expected impact debris to be located, which were not subjected to any exploration.

  20. A dynamical systems perspective on the absence of debris associated with the disappearance of flight MH370

    Science.gov (United States)

    García-Garrido, V. J.; Mancho, A. M.; Wiggins, S.; Mendoza, C.

    2015-07-01

    The disappearance of Malaysia Airlines flight MH370 on the morning of the 8 March 2014 is one of the great mysteries of our time. Perhaps the most relevant aspect of this mystery is that not a single piece of debris from the aircraft has been found. Difficulties in the search efforts, due to the uncertainty in the plane's final impact point and the time that has passed since the accident, bring the question on how the debris has scattered in an always moving ocean, for which there are multiple data sets that do not uniquely determine its state. Our approach to this problem is based on the use of Lagrangian Descriptors (LD), a novel mathematical tool coming from dynamical systems theory that identifies dynamic barriers and coherent structures governing transport. By combining publicly available information supplied by different ocean data sources with these mathematical techniques, we are able to assess the spatio-temporal state of the ocean in the priority search area at the time of impact and the following weeks. Using this information we propose a revised search strategy by showing why one might not have expected to find debris in some large search areas targeted by the Australian Maritime Safety Authority (AMSA), and determining regions where one might have expected impact debris to be located and that have not been subjected to any exploration.

  1. An Extension of the Optimal Homotopy Asymptotic Method to Coupled Schrödinger-KdV Equation

    Directory of Open Access Journals (Sweden)

    Hakeem Ullah

    2014-01-01

    Full Text Available We consider the approximate solution of the coupled Schrödinger-KdV equation by using the extended optimal homotopy asymptotic method (OHAM. We obtained the extended OHAM solution of the problem and compared with the exact, variational iteration method (VIM and homotopy perturbation method (HPM solutions. The obtained solution shows that extended OHAM is effective, simpler, easier, and explicit and gives a suitable way to control the convergence of the approximate solution.

  2. The Abelian projection versus the Hitchin fibration of K(D) pairs in four-dimensional QCD

    OpenAIRE

    Bochicchio, Marco

    1999-01-01

    We point out that the concept of Abelian projection gives us a physical interpretation of the role that the Hitchin fibration of parabolic K(D) pairs plays in the large-N limit of four-dimensional QCD. This physical interpretation furnishes also a simple criterium for the confinement of electric fluxes in the large-N limit of QCD. There is also an alternative, compatible interpretation, based on the QCD string.

  3. Boundary conditions for General Relativity on AdS{sub 3} and the KdV hierarchy

    Energy Technology Data Exchange (ETDEWEB)

    Pérez, Alfredo; Tempo, David; Troncoso, Ricardo [Centro de Estudios Científicos (CECs),Av. Arturo Prat 514, Valdivia (Chile)

    2016-06-20

    It is shown that General Relativity with negative cosmological constant in three spacetime dimensions admits a new family of boundary conditions being labeled by a nonnegative integer k. Gravitational excitations are then described by “boundary gravitons” that fulfill the equations of the k-th element of the KdV hierarchy. In particular, k=0 corresponds to the Brown-Henneaux boundary conditions so that excitations are described by chiral movers. In the case of k=1, the boundary gravitons fulfill the KdV equation and the asymptotic symmetry algebra turns out to be infinite-dimensional, abelian and devoid of central extensions. The latter feature also holds for the remaining cases that describe the hierarchy (k>1). Our boundary conditions then provide a gravitational dual of two noninteracting left and right KdV movers, and hence, boundary gravitons possess anisotropic Lifshitz scaling with dynamical exponent z=2k+1. Remarkably, despite spacetimes solving the field equations are locally AdS, they possess anisotropic scaling being induced by the choice of boundary conditions. As an application, the entropy of a rotating BTZ black hole is precisely recovered from a suitable generalization of the Cardy formula that is compatible with the anisotropic scaling of the chiral KdV movers at the boundary, in which the energy of AdS spacetime with our boundary conditions depends on z and plays the role of the central charge. The extension of our boundary conditions to the case of higher spin gravity and its link with different classes of integrable systems is also briefly addressed.

  4. Estimating the Underwater Diffuse Attenuation Coefficient with a Low-Cost Instrument: The KdUINO DIY Buoy

    Directory of Open Access Journals (Sweden)

    Raul Bardaji

    2016-03-01

    Full Text Available A critical parameter to assess the environmental status of water bodies is the transparency of the water, as it is strongly affected by different water quality related components (such as the presence of phytoplankton, organic matter and sediment concentrations. One parameter to assess the water transparency is the diffuse attenuation coefficient. However, the number of subsurface irradiance measurements obtained with conventional instrumentation is relatively low, due to instrument costs and the logistic requirements to provide regular and autonomous observations. In recent years, the citizen science concept has increased the number of environmental observations, both in time and space. The recent technological advances in embedded systems and sensors also enable volunteers (citizens to create their own devices (known as Do-It-Yourself or DIY technologies. In this paper, a DIY instrument to measure irradiance at different depths and automatically calculate the diffuse attenuation Kd coefficient is presented. The instrument, named KdUINO, is based on an encapsulated low-cost photonic sensor and Arduino (an open-hardware platform for the data acquisition. The whole instrument has been successfully operated and the data validated comparing the KdUINO measurements with the commercial instruments. Workshops have been organized with high school students to validate its feasibility.

  5. Two Kinds of Darboux-Bäcklund Transformations for the q-Deformed KdV Hierarchy with Self-Consistent Sources

    Directory of Open Access Journals (Sweden)

    Hongxia Wu

    2016-01-01

    Full Text Available Two kinds of Darboux-Bäcklund transformations (DBTs are constructed for the q-deformed Nth KdV hierarchy with self-consistent sources (q-NKdVHSCS by using the q-deformed pseudodifferential operators. Note that one of the DBTs provides a nonauto Bäcklund transformation for two q-deformed Nth KdV equations with self-consistent sources (q-NKdVESCS with different degree. In addition, the soliton solution to the first nontrivial equation of q-KdVHSCS is also obtained.

  6. Exact periodic cross-kink wave solutions for the new (2+1)-dimensional KdV equation in fluid flows and plasma physics.

    Science.gov (United States)

    Liu, Jian-Guo; Du, Jian-Qiang; Zeng, Zhi-Fang; Ai, Guo-Ping

    2016-10-01

    The Korteweg-de Vries (KdV)-type models have been shown to describe many important physical situations such as fluid flows, plasma physics, and solid state physics. In this paper, a new (2 + 1)-dimensional KdV equation is discussed. Based on the Hirota's bilinear form and a generalized three-wave approach, we obtain new exact solutions for the new (2 + 1)-dimensional KdV equation. With the help of symbolic computation, the properties for some new solutions are presented with some figures.

  7. The formation of [M-H]+ ions in N-alkyl-substituted thieno[3,4-c]-pyrrole-4,6-dione derivatives during atmospheric pressure photoionization mass spectrometry

    KAUST Repository

    Sioud, Salim

    2014-10-09

    RESULTS [M-H]+ ions were observed under APPI conditions. The type of dopant and the length of the alkyl chain affected the formation of these ions. MS/MS fragmentation of [M-H]+ and [M + H]+ ions exhibited completely different patterns. Theoretical calculations revealed that the loss of hydrogen molecules from the [M + H]+ ions is the most favourable condition under which to form [M-H]+ ions.CONCLUSIONS [M-H]+ ions were detected in all the TPD derivatives studied here under the special experimental conditions during APPI, using a halogenated benzene dopant, and TPD containing substituted N-alkyl side chains with a minimum of four carbon atoms. Density functional theory calculations showed that for [M-H]+ ions to be formed under these conditions, the loss of hydrogen molecules from the [M + H]+ ions is proposed to be necessary.RATIONALE The formation of ions during atmospheric pressure photoionization (APPI) mass spectrometry in the positive mode usually provides radical cations and/or protonated species. Intriguingly, during the analysis of some N-alkyl-substituted thieno[3,4-c]pyrrole-4,6-dione (TPD) derivatives synthesized in our laboratory, unusual [M-H]+ ion peaks were observed. In this work we investigate the formation of [M-H]+ ions observed under APPI conditions.METHODS Multiple experimental parameters, including the type of ionization source, the composition of the solvent, the type of dopant, the infusion flow rate, and the length of the alkyl side chain were investigated to determine their effects on the formation of [M-H]+ ions. In addition, a comparison study of the gas-phase tandem mass spectrometric (MS/MS) fragmentation of [M + H]+ vs [M-H]+ ions and computational approaches were used.

  8. Exact solutions for STO and (3+1-dimensional KdV-ZK equations using G′G2-expansion method

    Directory of Open Access Journals (Sweden)

    Sadaf Bibi

    Full Text Available This article deals with finding some exact solutions of nonlinear fractional differential equations (NLFDEs by applying a relatively new method known as G′G2-expansion method. Solutions of space–time fractional Sharma-Tasso-Olever (STO equation of fractional order and (3+1-dimensional KdV-Zakharov Kuznetsov (KdV-ZK equation of fractional order are reckoned to demonstrate the validity of this method. The fractional derivative version of modified Riemann–Liouville, linked with Fractional complex transform is employed to transform fractional differential equations into the corresponding ordinary differential equations. Keywords: Sharma Tasso-Olever (STO equation, (3+1-Dimensional KdV-Zakharov Kuznetsov (KdV-ZK equation, Exact solutions, G′G2-expansion method

  9. Distribution of a 69-kD laminin-binding protein in aortic and microvascular endothelial cells: modulation during cell attachment, spreading, and migration

    DEFF Research Database (Denmark)

    Yannariello-Brown, J; Wewer, U; Liotta, L

    1988-01-01

    Affinity chromatography and immunolocalization techniques were used to investigate the mechanism(s) by which endothelial cells interact with the basement membrane component laminin. Bovine aortic endothelial cells (BAEC) membranes were solubilized and incubated with a laminin-Sepharose affinity...... column. SDS-PAGE analysis of the eluted proteins identified a 69-kD band as the major binding protein, along with minor components migrating at 125, 110, 92, 85, 75, 55, and 30 kD. Polyclonal antibodies directed against a peptide sequence of the 69-kD laminin-binding protein isolated from human tumor...... cells identified this protein in BAEC lysates. In frozen sections, these polyclonal antibodies and monoclonal antibodies raised against human tumor 69-kD stained the endothelium of bovine aorta and the medial smooth muscle cells, but not surrounding connective tissue or elastin fibers. When...

  10. The King-Devick (K-D) test of rapid eye movements: a bedside correlate of disability and quality of life in MS.

    Science.gov (United States)

    Moster, Stephen; Wilson, James A; Galetta, Steven L; Balcer, Laura J

    2014-08-15

    We investigated the King-Devick (K-D) test of rapid number naming as a visual performance measure in a cohort of patients with multiple sclerosis (MS). In this cross-sectional study, 81 patients with MS and 20 disease-free controls from an ongoing study of visual outcomes underwent K-D testing. A test of rapid number naming, K-D requires saccadic eye movements as well as intact vision, attention and concentration. To perform the K-D test, participants are asked to read numbers aloud as quickly as possible from three test cards; the sum of the three test card times in seconds constitutes the summary score. High-contrast visual acuity (VA), low-contrast letter acuity (1.25% and 2.5% levels), retinal nerve fiber layer (RNFL) thickness by optical coherence tomography (OCT), MS Functional Composite (MSFC) and vision-specific quality of life (QOL) measures (25-Item NEI Visual Functioning Questionnaire [NEI-VFQ-25] and 10-Item Neuro-Ophthalmic Supplement) were also assessed. K-D time scores in the MS cohort (total time to read the three test cards) were significantly higher (worse) compared to those for disease-free controls (P=0.003, linear regression, accounting for age). Within the MS cohort, higher K-D scores were associated with worse scores for the NEI-VFQ-25 composite (Pdisability status as disabled (receiving disability pension) did worse on K-D testing compared to those working full-time (P=0.001, accounting for age). The K-D test, a impairment, and reduced vision-specific QOL in patients with MS. Scores reflect work disability as well as structural changes as measured by OCT imaging. History of ON and abnormal binocular acuities were associated with worse K-D scores, suggesting that abnormalities detected by K-D may go along with afferent dysfunction in MS patients. A brief test that requires saccadic eye movements, K-D should be considered for future MS trials as a rapid visual performance measure. Copyright © 2014 Elsevier B.V. All rights reserved.

  11. Lie symmetry analysis, conservation laws and exact solutions of the time-fractional generalized Hirota-Satsuma coupled KdV system

    Science.gov (United States)

    Saberi, Elaheh; Reza Hejazi, S.

    2018-02-01

    In the present paper, Lie point symmetries of the time-fractional generalized Hirota-Satsuma coupled KdV (HS-cKdV) system based on the Riemann-Liouville derivative are obtained. Using the derived Lie point symmetries, we obtain similarity reductions and conservation laws of the considered system. Finally, some analytic solutions are furnished by means of the invariant subspace method in the Caputo sense.

  12. [The involvement of rice protein 16KD in cross-allergenicity between antigens in rice, wheat, corn, Japanese millet, Italian millet].

    Science.gov (United States)

    Yamada, K; Urisu, A; Komada, H; Inagaki, Y; Yamada, M; Nakamura, R; Torii, S

    1991-12-01

    Cross-reactivity between rice, wheat, corn, Japanese millet and Italian millet in Poaceae family were studied by absorption test, radioallergosorbent test (RAST), and RAST inhibition assay. In absorption test using Phadebas RAST discs, more than 50% absorption of IgE antibodies was observed between rice, wheat and corn. There were significant correlations of RAST values for cereal grains including rice, wheat, corn, Japanese millet and Italian millet. RAST inhibition assay between every combinations of these cereals showed dose-dependent decrease in IgE-binding. These data indicated cross-reactivity with IgE antibodies between the five cereals in Poaceae family. RAST values for RP16KD significantly correlated with those for Italian millet as well as rice but not with those for corn and wheat. There was a trend of positive correlation between RAST values for RP16KD and Japanese millet. In RAST inhibition assay using sera with positive RAST for these five cereal grains and RP16KD, RP16KD inhibited IgE-binding to these all cereal discs in dose-dependent manner. Similarly, all of five cereal grain extracts showed an effective diminution in IgE-binding to RP16KD disc. These results indicated possible participation of IgE-binding structure on RP16KD in cross-reactivity between these cereal grains in Poaceae family.

  13. Singular 1-soliton solution of the nonlinear variable-coefficient diffusion reaction and mKdV equations

    Science.gov (United States)

    Guner, Ozkan; Bekir, Ahmet; Unsal, Omer; Cevikel, Adem C.

    2017-01-01

    In this paper, we pay attention to the analytical method named, ansatz method for finding the exact solutions of the variable-coefficient modified KdV equation and variable coefficient diffusion-reaction equation. As a result the singular 1-soliton solution is obtained. These solutions are important for the explanation of some practical physical problems. The obtained results show that these methods provides a powerful mathematical tool for solving nonlinear equations with variable coefficients. This method can be extended to solve other variable coefficient nonlinear partial differential equations.

  14. Generalized and Improved (G′/G)-Expansion Method for (3+1)-Dimensional Modified KdV-Zakharov-Kuznetsev Equation

    Science.gov (United States)

    Naher, Hasibun; Abdullah, Farah Aini; Akbar, M. Ali

    2013-01-01

    The generalized and improved -expansion method is a powerful and advantageous mathematical tool for establishing abundant new traveling wave solutions of nonlinear partial differential equations. In this article, we investigate the higher dimensional nonlinear evolution equation, namely, the (3+1)-dimensional modified KdV-Zakharov-Kuznetsev equation via this powerful method. The solutions are found in hyperbolic, trigonometric and rational function form involving more parameters and some of our constructed solutions are identical with results obtained by other authors if certain parameters take special values and some are new. The numerical results described in the figures were obtained with the aid of commercial software Maple. PMID:23741355

  15. Galilean symmetry invariant solutions to the KdV-Burgers equation and nonlinear superposition of shock waves

    Directory of Open Access Journals (Sweden)

    2016-01-01

    Full Text Available A description of the Galilean symmetry invariant solutions to the KdV-Burgers equation is reduced to studying of phase trajectories of the corresponding ODE depending on a parameter (the velocity of a shock wave propagation. Exact invariant solutions are simple shock waves that become separatrixes on the phase portrait which always has two singular points for a given value of the parameter. For nonlinear superposition of shock waves the phase portrait contains four singular points; its consequent bifurcations lead to oscillations.

  16. Detection of the human 70-kD and 60-kD heat shock proteins in the vagina: relation to microbial flora, vaginal pH, and method of contraception.

    Science.gov (United States)

    Giraldo, P; Neuer, A; Ribeiro-Filho, A; Linhares, I; Witkin, S S

    1999-01-01

    The expression of the 60-kD and 70-kD heat shock proteins (hsp60 and hsp70) in the vaginas of 43 asymptomatic women of reproductive age with or without a history of recurrent vulvovaginitis (RVV) were compared. Vaginal wash samples were obtained and assayed by enzyme-linked immunosorbent assay (ELISA) for human hsp60 and hsp70. Heat shock protein 70 was not detected in any of the 19 women with no history of RVV, and hsp60 was present in only one woman in this group. In contrast, in the RVV group, 11 (45.8%) were hsp60-positive and eight (33.3%) were hsp70-positive. The presence of either heat shock protein in the vagina was associated with an elevated vaginal pH (>4.5). Bacterial vaginosis or Candida was identified in some of the asymptomatic subjects; their occurrence was significantly higher in women with vaginal hsp70 than in women with no heat shock proteins. Oral contraceptives were used by 35.7% of subjects who were negative for vaginal heat shock proteins, as opposed to only 12.5% of women who were positive for hsp70 and 8.3% who were positive for hsp60. Expression of heat shock proteins in the vagina may indicate an altered vaginal environment and a susceptibility to vulvovaginal symptoms. PMID:10231004

  17. Detection of the Human 70-kD and 60-kD Heat Shock Proteins in the Vagina: Relation to Microbial Flora, Vaginal pH, and Method of Contraception

    Directory of Open Access Journals (Sweden)

    P. Giraldo

    1999-01-01

    Full Text Available The expression of the 60-kD and 70-kD heat shock proteins (hsp60 and hsp70 in the vaginas of 43 asymptomatic women of reproductive age with or without a history of recurrent vulvovaginitis (RVV were compared. Vaginal wash samples were obtained and assayed by enzyme-linked immunosorbent assay (ELISA for human hsp60 and hsp70. Heat shock protein 70 was not detected in any of the 19 women with no history of RVV, and hsp60 was present in only one woman in this group. In contrast, in the RVV group, 11 (45.8% were hsp60-positive and eight (33.3% were hsp70-positive. The presence of either heat shock protein in the vagina was associated with an elevated vaginal pH (>4.5. Bacterial vaginosis or Candida was identified in some of the asymptomatic subjects; their occurrence was significantly higher in women with vaginal hsp70 than in women with no heat shock proteins. Oral contraceptives were used by 35.7% of subjects who were negative for vaginal heat shock proteins, as opposed to only 12.5% of women who were positive for hsp70 and 8.3% who were positive for hsp60. Expression of heat shock proteins in the vagina may indicate an altered vaginal environment and a susceptibility to vulvovaginal symptoms. Infect. Dis. Obstet. Gynecol. 7:23–25, 1999.

  18. Analytic Solutions of the Schamel-KdV Equation by Using Different Methods: Application to a Dusty Space Plasma

    Directory of Open Access Journals (Sweden)

    Orhan DÖNMEZ

    2016-12-01

    Full Text Available The wave properties in a dusty space plasma consisting of positively and negatively charged  dust as well as distributed nonisothermal electrons are investigated by using the exact traveling wave solutions of the Schamel-KdV equation. The analytic solutions are obtained by the  different types $(G'/G$-expansion methods and direct integration. The nonlinear dynamics of ion-acoustic waves for the various values of phase speed $V_p$, plasma parameters  $\\alpha$, $\\sigma$, and $\\sigma_d$,  and the source term $\\mu$ are studied. We have observed different types of waves from the different analytic solutions obtained from the different methods. Consequently, we have found the discontinuity, shock or solitary waves. It is also concluded  that these parameters play an important role in the presence of solitary waves inside the plasma. Depending on plasma parameters, the discontinuity wave turns  into solitary wave solution for the  certain values of the phase speed and plasma parameters. Additionally, exact solutions of  the Schamel-KdV equation may also be used to understand the wave types and properties in the different plasma systems.

  19. Adhalin, the 50 kD dystrophin associated protein, is not the locus for severe childhood autosomal recessive dystrophy (SCARMD)

    Energy Technology Data Exchange (ETDEWEB)

    McNally, E.M.; Selig, S.; Kunkel, L.M. [Children`s Hospital, Boston, MA (United States)

    1994-09-01

    Mutations in the carboxyl-terminus in dystrophin are normally sufficient to produce severely dystrophic muscle. This portion of dystrophin binds a complex of dystrophin-associated glycoproteins (DAGs). The genes encoding these DAGs are candidate genes for causing neuromuscular disease. Immunoreactivity for adhalin, the 50 kD DAG, is absent in muscle biopsies from patients with SCARMD, a form of dystrophy clinically similar Duchenne muscular dystrophy. Prior linkage analysis in SCARMD families revealed that the disease gene segregates with markers on chromosome 13. To determine the molecular role that adhalin may play in SCARMD, human cDNA and genomic sequences were isolated. Primers were designed based on predicted areas of conservation in rabbit adhalin and used in RT-PCR with human skeletal and cardiac muscle. RT-PCR products were confirmed by sequence as human adhalin and then used as probes for screening human cDNA and genomic libraries. Human and rabbit adhalin are 90% identical, and among the cDNAs, a novel splice form of adhalin was seen which may encode part of the 35 kD component of the dystrophin-glycoprotein complex. To our surprise, only human/rodent hybrids containing human chromosome 17 amplified adhalin sequences in a PCR analysis. FISH analysis with three overlapping genomic sequences confirmed the chromosome 17 location and further delineated the map position to 17q21. Therefore, adhalin is excluded as the gene causing SCARMD.

  20. Draft genome sequence of Methanoculleus sp. MH98A, a novel methanogen isolated from sub-seafloor methane hydrate deposits in Krishna Godavari basin.

    Science.gov (United States)

    Dabir, Ashwini; Honkalas, Varsha; Arora, Preeti; Pore, Soham; Ranade, D R; Dhakephalkar, Prashant K

    2014-10-22

    Members of the genus Methanoculleus are among the most prevalent methanogens in biomethanation processes especially in marine and brackish environments. A methanogen, identified as a novel species of the genus Methanoculleus, was isolated from deep sub-seafloor sediment obtained from the Krishna Godavari Basin off the eastern coast of India. This methanogen is thought to be the supplier of the methane in the submarine methane hydrate deposits. Further study of this microorganism could possibly help to revolutionize the energy industry. The draft genome of Methanoculleus sp. MH98A is presented. Copyright © 2014. Published by Elsevier B.V.

  1. Stratigraphy of the Perrine and Nun Sulci quadrangles (Jg-2 and Jg-5), Ganymede

    Science.gov (United States)

    Mcgill, George E.; Squyres, Steven W.

    1991-01-01

    Dark and light terrain materials in the Perrine and Nun Sulci quadrangles are divided into nine map units, four dark, and five light. These are placed in time-stratigraphic sequence primarily by means of embayment and cross-cutting relationships. Dark terrain is generally more heavily cratered and thus older that light terrain but, at least in these quadrangles, crater densities are not reliable indicators of relative ages among the four dark material units. The four mapped material units within dark terrain are: cratered dark materials (dc), grooved dark materials (dg), transitional dark materials (di), and dark materials, undivided (d). The five mapped units within light terrain are: intermediate light materials (li), grooved light materials (lg), irregularly grooved light materials (lgl), smooth light materials (ls), and light materials, undivided.

  2. EGS4 and MCNP4b MC Simulation of a Siemens KD2 Accelerator in 6 MV Photon Mode

    CERN Document Server

    Chaves, A; Fragoso, M; Lopes, C; Oliveira, C; Peralta, L; Rodrigues, P; Seco, J; Trindade, A

    2001-01-01

    The geometry of a Siemens Mevatron KD2 linear accelerator in 6 MV photon mode was modeled with EGS4 and MCNP4b. Energy spectra and other phase space distributions have been extensively compared in different plans along the beam line. The differences found have been evaluated both qualitative and quantitatively. The final aim was that both codes, running in different operating systems and with a common set of simulation conditions, met the requirement of fitting the experimental depth dose curves and dose profiles, measured in water for different field sizes. Whereas depth dose calculations are in a certain extent insensible to some simulation parameters like electron nominal energy, dose profiles have revealed to be a much better indicator to appreciate that feature. Fine energy tuning has been tried and the best fit was obtained for a nominal electron energy of 6.15 MeV.

  3. Preparation and Characterization of a Polyclonal Antibody against Human Actin Filament-Associated Protein-120 kD

    Directory of Open Access Journals (Sweden)

    Yujian Chen

    2016-06-01

    Full Text Available Actin filament-associated protein-120kD (AFAP-120 is an alternatively spliced isoform of actin filament-associated protein-110kD (AFAP-110 and contains an additional neuronal insert (NINS fragment in addition to identical domains to the AFAP-110. Unlike AFAP-110 widely expressed in tissues, AFAP-120 is specifically expressed in the nervous system and plays a role in organizing dynamic actin structures during neuronal differentiation. However, anti-AFAP-120 antibody is still commercially unavailable, and this may hinder the function research for AFAP-120. In this study, we simultaneously used the ABCpred online server and the BepiPred 1.0 server to predict B-cell epitopes in the exclusive NINS sequence of human AFAP-120 protein, and found that a 16aa-peptide sequence was the consensus epitope predicted by both tools. This peptide was chemically synthesized and used as an immunogen to develop polyclonal antibody against AFAP-120 (anti-AFAP-120. The sensitivity and specificity of anti-AFAP-120 were analyzed with immunoblotting, immunoprecipitation, and immunofluorescence assays. Our results indicated that anti-AFAP-120 could react with over-expressed and endogenous human AFAP-120 protein under denatured condition, but not with human AFAP-110 protein. Moreover, native human AFAP-120 protein could also be recognized by the anti-AFAP-120 antibody. These results suggested that the prepared anit-AFAP-120 antibody would be a useful tool for studying the biochemical and biological functions of AFAP-120.

  4. Environmental impact assessment and end-of-life treatment policy analysis for Li-ion batteries and Ni-MH batteries.

    Science.gov (United States)

    Yu, Yajuan; Chen, Bo; Huang, Kai; Wang, Xiang; Wang, Dong

    2014-03-18

    Based on Life Cycle Assessment (LCA) and Eco-indicator 99 method, a LCA model was applied to conduct environmental impact and end-of-life treatment policy analysis for secondary batteries. This model evaluated the cycle, recycle and waste treatment stages of secondary batteries. Nickel-Metal Hydride (Ni-MH) batteries and Lithium ion (Li-ion) batteries were chosen as the typical secondary batteries in this study. Through this research, the following results were found: (1) A basic number of cycles should be defined. A minimum cycle number of 200 would result in an obvious decline of environmental loads for both battery types. Batteries with high energy density and long life expectancy have small environmental loads. Products and technology that help increase energy density and life expectancy should be encouraged. (2) Secondary batteries should be sorted out from municipal garbage. Meanwhile, different types of discarded batteries should be treated separately under policies and regulations. (3) The incineration rate has obvious impact on the Eco-indicator points of Nickel-Metal Hydride (Ni-MH) batteries. The influence of recycle rate on Lithium ion (Li-ion) batteries is more obvious. These findings indicate that recycling is the most promising direction for reducing secondary batteries' environmental loads. The model proposed here can be used to evaluate environmental loads of other secondary batteries and it can be useful for proposing policies and countermeasures to reduce the environmental impact of secondary batteries.

  5. Environmental Impact Assessment and End-of-Life Treatment Policy Analysis for Li-Ion Batteries and Ni-MH Batteries

    Directory of Open Access Journals (Sweden)

    Yajuan Yu

    2014-03-01

    Full Text Available Based on Life Cycle Assessment (LCA and Eco-indicator 99 method, a LCA model was applied to conduct environmental impact and end-of-life treatment policy analysis for secondary batteries. This model evaluated the cycle, recycle and waste treatment stages of secondary batteries. Nickel-Metal Hydride (Ni-MH batteries and Lithium ion (Li-ion batteries were chosen as the typical secondary batteries in this study. Through this research, the following results were found: (1 A basic number of cycles should be defined. A minimum cycle number of 200 would result in an obvious decline of environmental loads for both battery types. Batteries with high energy density and long life expectancy have small environmental loads. Products and technology that help increase energy density and life expectancy should be encouraged. (2 Secondary batteries should be sorted out from municipal garbage. Meanwhile, different types of discarded batteries should be treated separately under policies and regulations. (3 The incineration rate has obvious impact on the Eco-indicator points of Nickel-Metal Hydride (Ni-MH batteries. The influence of recycle rate on Lithium ion (Li-ion batteries is more obvious. These findings indicate that recycling is the most promising direction for reducing secondary batteries’ environmental loads. The model proposed here can be used to evaluate environmental loads of other secondary batteries and it can be useful for proposing policies and countermeasures to reduce the environmental impact of secondary batteries.

  6. Delphinidin, a specific inhibitor of histone acetyltransferase, suppresses inflammatory signaling via prevention of NF-{kappa}B acetylation in fibroblast-like synoviocyte MH7A cells

    Energy Technology Data Exchange (ETDEWEB)

    Seong, Ah-Reum; Yoo, Jung-Yoon; Choi, KyungChul [Department of Biochemistry and Molecular Biology, Center for Chronic Metabolic Disease Research, College of Medicine, Yonsei University, Seoul (Korea, Republic of); Lee, Mee-Hee [Department of Biochemistry and Molecular Biology, Center for Chronic Metabolic Disease Research, College of Medicine, Yonsei University, Seoul (Korea, Republic of); Brain Korea 21 Project for Medical Sciences, Yonsei University, College of Medicine, Seoul (Korea, Republic of); Lee, Yoo-Hyun [Department of Food Science and Nutrition, The University of Suwon, Kyunggi-do (Korea, Republic of); Lee, Jeongmin [Department of Medical Nutrition, Kyung Hee University, Kyunggi-do (Korea, Republic of); Jun, Woojin [Department of Food and Nutrition, Chonnam National University, Gwangju (Korea, Republic of); Kim, Sunoh, E-mail: sunoh@korea.ac.kr [Jeollanamdo Institute of Natural Resources Research, Jeonnam (Korea, Republic of); Yoon, Ho-Geun, E-mail: yhgeun@yuhs.ac [Department of Biochemistry and Molecular Biology, Center for Chronic Metabolic Disease Research, College of Medicine, Yonsei University, Seoul (Korea, Republic of); Brain Korea 21 Project for Medical Sciences, Yonsei University, College of Medicine, Seoul (Korea, Republic of)

    2011-07-08

    Highlights: {yields} Delphinidin is a novel inhibitor of p300/CBP histone acetyltransferase. {yields} Delphinidin prevents the hyperacetylation of p65 by inhibiting the HAT activity of p300/CBP. {yields} Delphinidin efficiently suppresses the expression of inflammatory cytokines in MH7A cells via hypoacetylation of NF-{kappa}B. {yields} Delphinidin inhibits cytokine release in the Jurkat T lymphocyte cell line. -- Abstract: Histone acetyltransferase (HAT) inhibitors (HATi) isolated from dietary compounds have been shown to suppress inflammatory signaling, which contributes to rheumatoid arthritis. Here, we identified a novel HATi in Punica granatum L. known as delphinidin (DP). DP did not affect the activity of other epigenetic enzymes (histone deacetylase, histone methyltransferase, or sirtuin1). DP specifically inhibited the HAT activities of p300/CBP. It also inhibited p65 acetylation in MH7A cells, a human rheumatoid arthritis synovial cell line. DP-induced hypoacetylation was accompanied by cytosolic accumulation of p65 and nuclear localization of IKB{alpha}. Accordingly, DP treatment inhibited TNF{alpha}-stimulated increases in NF-{kappa}B function and expression of NF-{kappa}B target genes in these cells. Importantly, DP suppressed lipopolysaccharide-induced pro-inflammatory cytokine expression in Jurkat T lymphocytes, demonstrating that HATi efficiently suppresses cytokine-mediated immune responses. Together, these results show that the HATi activity of DP counters anti-inflammatory signaling by blocking p65 acetylation and that this compound may be useful in preventing inflammatory arthritis.

  7. Environmental Impact Assessment and End-of-Life Treatment Policy Analysis for Li-Ion Batteries and Ni-MH Batteries

    Science.gov (United States)

    Yu, Yajuan; Chen, Bo; Huang, Kai; Wang, Xiang; Wang, Dong

    2014-01-01

    Based on Life Cycle Assessment (LCA) and Eco-indicator 99 method, a LCA model was applied to conduct environmental impact and end-of-life treatment policy analysis for secondary batteries. This model evaluated the cycle, recycle and waste treatment stages of secondary batteries. Nickel-Metal Hydride (Ni-MH) batteries and Lithium ion (Li-ion) batteries were chosen as the typical secondary batteries in this study. Through this research, the following results were found: (1) A basic number of cycles should be defined. A minimum cycle number of 200 would result in an obvious decline of environmental loads for both battery types. Batteries with high energy density and long life expectancy have small environmental loads. Products and technology that help increase energy density and life expectancy should be encouraged. (2) Secondary batteries should be sorted out from municipal garbage. Meanwhile, different types of discarded batteries should be treated separately under policies and regulations. (3) The incineration rate has obvious impact on the Eco-indicator points of Nickel-Metal Hydride (Ni-MH) batteries. The influence of recycle rate on Lithium ion (Li-ion) batteries is more obvious. These findings indicate that recycling is the most promising direction for reducing secondary batteries’ environmental loads. The model proposed here can be used to evaluate environmental loads of other secondary batteries and it can be useful for proposing policies and countermeasures to reduce the environmental impact of secondary batteries. PMID:24646862

  8. Characterization and alternative splicing of the complex I 19-kD subunit in Dunaliella salina: expression and mutual correlation of splice variants under diverse stresses.

    Science.gov (United States)

    Cao, Yu; Jin, Nan; Xu, Hui; Liu, Yi; Zhu, Wei Hua; Li, Xin Ran; Qiao, Dai Rong; Cao, Yi

    2010-01-01

    Complex I is the first enzyme in the mitochondrial respiratory chain. It extracts energy from NADH, which is produced by the oxidation of sugars and fats, and traps the energy by virtue of a potential difference or voltage across the mitochondrial inner membrane. Herein, the genomic sequence and four splice variants encoding the complex I 19-kD subunit were isolated from Dunaliella salina. There were four transcripts coding for the complex I 19-kD subunit due to alternative splicing in algae, and the four transcripts were translated to two protein isoforms with varying C-terminals. We report the splicing pattern in the 3'-region of the D. salina 19-kD subunit, in which three of the exons (5, 6, and 7) could be alternatively spliced. Moreover, we found that four alternatively spliced variants were subject to coordinated transcription in response to different stresses by real-time quantitative PCR.

  9. Time-fractional Schamel–KdV equation for dust-ion-acoustic waves in pair-ion plasma with trapped electrons and opposite polarity dust grains

    Energy Technology Data Exchange (ETDEWEB)

    Guo, Shimin, E-mail: shiminguo@mail.xjtu.edu.cn [School of Mathematics and Statistics, Xi' an Jiaotong University, Xi' an, 710049 (China); Mei, Liquan [School of Mathematics and Statistics, Xi' an Jiaotong University, Xi' an, 710049 (China); He, Yaling [Key Laboratory of Thermo-Fluid Science and Engineering of Ministry of Education, Xi' an Jiaotong University, Xi' an, 710049 (China); Li, Yibao, E-mail: yibaoli@mail.xjtu.edu.cn [School of Mathematics and Statistics, Xi' an Jiaotong University, Xi' an, 710049 (China)

    2016-03-06

    Nonlinear propagation of dust-ion-acoustic (DIA) waves is investigated in a one-dimensional, unmagnetized plasma containing positive ions, negative ions, trapped electrons featuring vortex-like distribution, and immobile dust grains having both positive and negative charges. Via reductive perturbation method, Agrawal's method, and Euler–Lagrange equation, the time-fractional Schamel–KdV equation under the sense of Riesz fractional derivative is derived to describe nonlinear behavior of DIA waves. The approximate solution of the time-fractional Schamel–KdV equation is constructed in terms of Jacobi elliptic functions by variational iteration method. The effect of the plasma parameters on the DIA solitary waves is also discussed in detail. - Highlights: • Electrons obeying vortex-like distribution are considered in the model. • We derive the time-fractional Schamel–KdV equation for the nonlinear waves. • The solution of the time-fractional differential equation is constructed.

  10. The Interactions of N-Soliton Solutions for the Generalized (2+1-Dimensional Variable-Coefficient Fifth-Order KdV Equation

    Directory of Open Access Journals (Sweden)

    Xiangrong Wang

    2015-01-01

    Full Text Available A generalized (2+1-dimensional variable-coefficient KdV equation is introduced, which can describe the interaction between a water wave and gravity-capillary waves better than the (1+1-dimensional KdV equation. The N-soliton solutions of the (2+1-dimensional variable-coefficient fifth-order KdV equation are obtained via the Bell-polynomial method. Then the soliton fusion, fission, and the pursuing collision are analyzed depending on the influence of the coefficient eAij; when eAij=0, the soliton fusion and fission will happen; when eAij≠0, the pursuing collision will occur. Moreover, the Bäcklund transformation of the equation is gotten according to the binary Bell-polynomial and the period wave solutions are given by applying the Riemann theta function method.

  11. Smart Kd-values, their uncertainties and sensitivities - Applying a new approach for realistic distribution coefficients in geochemical modeling of complex systems.

    Science.gov (United States)

    Stockmann, M; Schikora, J; Becker, D-A; Flügge, J; Noseck, U; Brendler, V

    2017-11-01

    One natural retardation process to be considered in risk assessment for contaminants in the environment is sorption on mineral surfaces. A realistic geochemical modeling is of high relevance in many application areas such as groundwater protection, environmental remediation, or disposal of hazardous waste. Most often concepts with constant distribution coefficients (Kd-values) are applied in geochemical modeling with the advantage to be simple and computationally fast, but not reflecting changes in geochemical conditions. In this paper, we describe an innovative and efficient method, where the smart Kd-concept, a mechanistic approach mainly based on surface complexation modeling, is used (and modified for complex geochemical models) to calculate and apply realistic distribution coefficients. Using the geochemical speciation code PHREEQC, multidimensional smart Kd-matrices are computed as a function of varying (or uncertain) environmental conditions. On the one hand, sensitivity and uncertainty statements for the distribution coefficients can be derived. On the other hand, smart Kd-matrices can be used in reactive transport (or migration) codes (not shown here). This strategy has various benefits: (1) rapid computation of Kd-values for large numbers of environmental parameter combinations; (2) variable geochemistry is taken into account more realistically; (3) efficiency in computing time is ensured, and (4) uncertainty and sensitivity analysis are accessible. Results are presented exemplarily for the sorption of uranium(VI) onto a natural sandy aquifer material and are compared to results based on the conventional Kd-concept. In general, the sorption behavior of U(VI) in dependence of changing geochemical conditions is described quite well. Copyright © 2017 Elsevier Ltd. All rights reserved.

  12. Histological response to pegIFNalpha-2a (40KD) plus ribavirin in HIV-hepatitis C virus co-infection.

    Science.gov (United States)

    Lissen, Eduardo; Clumeck, Nathan; Sola, Ricardo; Mendes-Correa, Maria; Montaner, Julio; Nelson, Mark; DePamphilis, Jean; Pessôa, Mário; Buggisch, Peter; Main, Janice; Dieterich, Douglas

    2006-11-14

    Paired liver biopsies from patients enrolled in the multinational AIDS PEGASYS Ribavirin International Co-infection Trial were analysed to investigate a possible correlation between virological and histological responses. A total of 860 HIV-hepatitis C virus (HCV)-co-infected patients were randomly assigned to receive pegIFNalpha-2a (40KD) 180 microg/week plus 800 mg daily ribavirin, pegIFNalpha-2a (40KD) plus placebo or conventional IFNalpha-2a 3 MIU three times a week plus ribavirin for 48 weeks. Paired biopsies were obtained from 401 patients and scored locally using the Ishak-modified histological activity index (HAI). The second biopsy was obtained, on average, 26 weeks or more after the end of treatment. Histological response was defined as a 2-point or greater reduction in the HAI score. The histological response rate was significantly higher in patients receiving pegIFNalpha-2a (40KD) plus ribavirin (57%) than in patients receiving pegIFNalpha-2a (40KD) plus placebo (39%; P IFNalpha-2a plus ribavirin (41%; P = 0.04). Histological response was correlated with virological response, with the histological response rate ranging from 62 to 74% in patients who achieved a sustained virological response (SVR). Histological response was also seen in 32-43% of patients not achieving an SVR. A higher total HAI score was the only prognostic factor for achieving histological response. The histological response rate was significantly higher in HIV-HCV-co-infected patients who received pegIFNalpha-2a (40KD) plus ribavirin than in those receiving pegIFNalpha-2a (40KD) plus placebo or IFNalpha-2a plus ribavirin. Histological response was correlated with virological response, although a substantial proportion of patients who did not achieve an SVR experienced histological improvement.

  13. Advances in Electrochemical Models for Predicting the Cycling Performance of Traction Batteries: Experimental Study on Ni-MH and Simulation Développement de modèles électrochimiques de batteries de traction pour la prédiction de performances : étude expérimentale de batteries NiMH et simulations

    Directory of Open Access Journals (Sweden)

    Bernard J.

    2009-11-01

    Full Text Available Rigorous electrochemical models to simulate the cycling performance of batteries have been successfully developed and reported in the literature. They constitute a very promising approach for State-of-Charge (SoC estimation based on the physics of the cell with regards to other methods since SoC is an internal parameter of these physical models. However, the computational time needed to solve electrochemical battery models for online applications requires to develop a simplified physics-based battery model. In this work, our goal is to present and validate an advanced 0D-electrochemical model of a Ni-MH cell, as an example. This lumped-parameter model will be used to design an extended Kalman filter to predict the SoC of a Ni-MH pack. It is presented, followed by an extensive experimental study conducted on Ni-MH cells to better understand the mechanisms of physico-chemical phenomena occurring at both electrodes and support the model development. The last part of the paper focuses on the evaluation of the model with regards to experimental results obtained on Ni-MH sealed cells but also on the related commercial HEV battery pack. Des modèles électrochimiques fins permettant de simuler le comportement de batteries ont été développés avec succès et reportés dans la littérature. Ils constituent une alternative aux méthodes classiques pour estimer l’état de charge (SoC pour State of Charge des batteries, cette variable étant ici un paramètre interne du modèle physique. Cependant, pour les applications embarquées, il est nécessaire de développer des modèles simplifiés sur la base de ces modèles physiques afin de diminuer le temps de calcul nécessaire à la résolution des équations. Ici, nous présenterons à titre d’exemple un modèle électrochimique 0D avancé d’un accumulateur NiMH et sa validation. Ce modèle à paramètres concentrés sera utilisé pour réaliser un filtre de Kalman qui permettra la prédiction de l

  14. Use of thermodynamic sorption models to derive radionuclide Kd values for performance assessment: Selected results and recommendations of the NEA sorption project

    Science.gov (United States)

    Ochs, M.; Davis, J.A.; Olin, M.; Payne, T.E.; Tweed, C.J.; Askarieh, M.M.; Altmann, S.

    2006-01-01

    For the safe final disposal and/or long-term storage of radioactive wastes, deep or near-surface underground repositories are being considered world-wide. A central safety feature is the prevention, or sufficient retardation, of radionuclide (RN) migration to the biosphere. To this end, radionuclide sorption is one of the most important processes. Decreasing the uncertainty in radionuclide sorption may contribute significantly to reducing the overall uncertainty of a performance assessment (PA). For PA, sorption is typically characterised by distribution coefficients (Kd values). The conditional nature of Kd requires different estimates of this parameter for each set of geochemical conditions of potential relevance in a RN's migration pathway. As it is not feasible to measure sorption for every set of conditions, the derivation of Kd for PA must rely on data derived from representative model systems. As a result, uncertainty in Kd is largely caused by the need to derive values for conditions not explicitly addressed in experiments. The recently concluded NEA Sorption Project [1] showed that thermodynamic sorption models (TSMs) are uniquely suited to derive K d as a function of conditions, because they allow a direct coupling of sorption with variable solution chemistry and mineralogy in a thermodynamic framework. The results of the project enable assessment of the suitability of various TSM approaches for PA-relevant applications as well as of the potential and limitations of TSMs to model RN sorption in complex systems. ?? by Oldenbourg Wissenschaftsverlag.

  15. Low Levels of the 150-kD Insulin -Like Growth Factor Binding Protein 3 Ternary complex in Patients with Anorexia nervosa

    DEFF Research Database (Denmark)

    Støving, René K; Hangaard, Jørgen; Hagen, Claus

    2003-01-01

    BACKGROUND/AIM: In healthy adults, serum insulin-like growth factor I (IGF), IGF-binding protein 3 (IGFBP-3), and acid-labile subunit (ALS) form a 150-kD ternary complex under the control of growth hormone (GH). Circulating IGF-I half-life, bioavailability, and endocrine actions depend on the ter......BACKGROUND/AIM: In healthy adults, serum insulin-like growth factor I (IGF), IGF-binding protein 3 (IGFBP-3), and acid-labile subunit (ALS) form a 150-kD ternary complex under the control of growth hormone (GH). Circulating IGF-I half-life, bioavailability, and endocrine actions depend...... women with AN at the time of diagnosis and after partial weight recovery and in 6 healthy age-matched women serving as controls. RESULTS: Patients with AN had low levels of ALS and IGFBP-3 contained in the 150-kD ternary complex and in the non-150-kD fraction. Following partial weight recovery, the 150...

  16. Arrhenius Equation-Based Cell-Health Assessment: Application to Thermal Energy Management Design of a HEV NiMH Battery Pack

    Directory of Open Access Journals (Sweden)

    Fangyuan Chen

    2013-05-01

    Full Text Available This paper presents a model-based cell-health-conscious thermal energy management method. An Arrhenius equation-based mathematical model is firstly identified to quantify the effect of temperature on the cell lifetime of a Nickel Metal Hydride (NiMH battery pack. The cell aging datasets collected under multiple ambient temperatures are applied to extract the Arrhenius equation parameters. The model is then used as an assessment criterion and guidance for the thermal management design of battery packs. The feasibility and applicability of a pack structure with its cooling system, is then evaluated, and its design problems are studied by a computational fluid dynamics (CFD analysis. The performance and eligibility of the design method is validated by both CFD simulations and experiments.

  17. A missense mutation in PFAS (phosphoribosylformylglycinamidine synthase) is likely causal for embryonic lethality associated with the MH1 haplotype in Montbéliarde dairy cattle.

    Science.gov (United States)

    Michot, Pauline; Fritz, Sébastien; Barbat, Anne; Boussaha, Mekki; Deloche, Marie-Christine; Grohs, Cécile; Hoze, Chris; Le Berre, Laurène; Le Bourhis, Daniel; Desnoes, Olivier; Salvetti, Pascal; Schibler, Laurent; Boichard, Didier; Capitan, Aurélien

    2017-10-01

    A candidate mutation in the sex hormone binding globulin gene was proposed in 2013 to be responsible for the MH1 recessive embryonic lethal locus segregating in the Montbéliarde breed. In this follow-up study, we excluded this candidate variant because healthy homozygous carriers were observed in large-scale genotyping data generated in the framework of the genomic selection program. We fine mapped the MH1 locus in a 702-kb interval and analyzed genome sequence data from the 1,000 bull genomes project and 54 Montbéliarde bulls (including 14 carriers and 40 noncarriers). We report the identification of a strong candidate mutation in the gene encoding phosphoribosylformylglycinamidine synthase (PFAS), a protein involved in de novo purine synthesis. This mutation, located in a class I glutamine amidotransferase-like domain, results in the substitution of an arginine residue that is entirely conserved among eukaryotes by a cysteine (p.R1205C). No homozygote for the cysteine-encoding allele was observed in a large population of more than 25,000 individuals despite a 6.7% allelic frequency and 122 expected homozygotes under neutrality assumption. Genotyping of 18 embryos collected from heterozygous parents as well as analysis on nonreturn rates suggested that most homozygous carriers died between 7 and 35 d postinsemination. The identification of this strong candidate mutation will enable the accurate testing of the reproducers and the efficient selection against this lethal recessive embryonic defect in the Montbéliarde breed. Copyright © 2017 American Dairy Science Association. Published by Elsevier Inc. All rights reserved.

  18. The Applicability of the Distribution Coefficient, KD, Based on Non-Aggregated Particulate Samples from Lakes with Low Suspended Solids Concentrations.

    Directory of Open Access Journals (Sweden)

    Aine Marie Gormley-Gallagher

    Full Text Available Separate phases of metal partitioning behaviour in freshwater lakes that receive varying degrees of atmospheric contamination and have low concentrations of suspended solids were investigated to determine the applicability of the distribution coefficient, KD. Concentrations of Pb, Ni, Co, Cu, Cd, Cr, Hg and Mn were determined using a combination of filtration methods, bulk sample collection and digestion and Inductively Coupled Plasma-Mass Spectrometry (ICP-MS. Phytoplankton biomass, suspended solids concentrations and the organic content of the sediment were also analysed. By distinguishing between the phytoplankton and (inorganic lake sediment, transient variations in KD were observed. Suspended solids concentrations over the 6-month sampling campaign showed no correlation with the KD (n = 15 for each metal, p > 0.05 for Mn (r2 = 0.0063, Cu (r2 = 0.0002, Cr (r2 = 0.021, Ni (r2 = 0.0023, Cd (r2 = 0.00001, Co (r2 = 0.096, Hg (r2 = 0.116 or Pb (r2 = 0.164. The results implied that colloidal matter had less opportunity to increase the dissolved (filter passing fraction, which inhibited the spurious lowering of KD. The findings conform to the increasingly documented theory that the use of KD in modelling may mask true information on metal partitioning behaviour. The root mean square error of prediction between the directly measured total metal concentrations and those modelled based on the separate phase fractions were ± 3.40, 0.06, 0.02, 0.03, 0.44, 484.31, 80.97 and 0.1 μg/L for Pb, Cd, Mn, Cu, Hg, Ni, Cr and Co respectively. The magnitude of error suggests that the separate phase models for Mn and Cu can be used in distribution or partitioning models for these metals in lake water.

  19. The Applicability of the Distribution Coefficient, KD, Based on Non-Aggregated Particulate Samples from Lakes with Low Suspended Solids Concentrations.

    Science.gov (United States)

    Gormley-Gallagher, Aine Marie; Douglas, Richard William; Rippey, Brian

    2015-01-01

    Separate phases of metal partitioning behaviour in freshwater lakes that receive varying degrees of atmospheric contamination and have low concentrations of suspended solids were investigated to determine the applicability of the distribution coefficient, KD. Concentrations of Pb, Ni, Co, Cu, Cd, Cr, Hg and Mn were determined using a combination of filtration methods, bulk sample collection and digestion and Inductively Coupled Plasma-Mass Spectrometry (ICP-MS). Phytoplankton biomass, suspended solids concentrations and the organic content of the sediment were also analysed. By distinguishing between the phytoplankton and (inorganic) lake sediment, transient variations in KD were observed. Suspended solids concentrations over the 6-month sampling campaign showed no correlation with the KD (n = 15 for each metal, p > 0.05) for Mn (r2 = 0.0063), Cu (r2 = 0.0002, Cr (r2 = 0.021), Ni (r2 = 0.0023), Cd (r2 = 0.00001), Co (r2 = 0.096), Hg (r2 = 0.116) or Pb (r2 = 0.164). The results implied that colloidal matter had less opportunity to increase the dissolved (filter passing) fraction, which inhibited the spurious lowering of KD. The findings conform to the increasingly documented theory that the use of KD in modelling may mask true information on metal partitioning behaviour. The root mean square error of prediction between the directly measured total metal concentrations and those modelled based on the separate phase fractions were ± 3.40, 0.06, 0.02, 0.03, 0.44, 484.31, 80.97 and 0.1 μg/L for Pb, Cd, Mn, Cu, Hg, Ni, Cr and Co respectively. The magnitude of error suggests that the separate phase models for Mn and Cu can be used in distribution or partitioning models for these metals in lake water.

  20. Spatial chaos in weakly dispersive and viscous media a nonperturbative theory of the driven KdV-Burgers equation

    CERN Document Server

    Malkov, M A

    1996-01-01

    The asymptotic travelling wave solution of the KdV-Burgers equation driven by the long scale periodic driver is constructed. The solution represents a shock-train in which the quasi-periodic sequence of dispersive shocks or soliton chains is interspersed by smoothly varying regions. It is shown that the periodic solution which has the spatial driver period undergoes period doublings as the governing parameter changes. Two types of chaotic behavior are considered. The first type is a weak chaos, where only a small chaotic deviation from the periodic solution occurs. The second type corresponds to the developed chaos where the solution ``ignores'' the driver period and represents a random sequence of uncorrelated shocks. In the case of weak chaos the shock coordinate being repeatedly mapped over the driver period moves on a chaotic attractor, while in the case of developed chaos it moves on a repellor. Both solutions depend on a parameter indicating the reference shock position in the shock-train. The structure...

  1. Tomato FK506 Binding Protein 12KD (FKBP12 mediates the interaction between rapamycin and Target of Rapamycin (TOR

    Directory of Open Access Journals (Sweden)

    Fangjie Xiong

    2016-11-01

    Full Text Available Target of Rapamycin (TOR signaling is an important regulator in multiple organisms including yeast, plants and animals. However, the TOR signaling in plants is much less understood as compared to that in yeast and animals. TOR kinase can be efficiently suppressed by rapamycin in the presence of functional FK506 Binding Protein 12KD (FKBP12 in yeast and animals. In most examined higher plants rapamycin fails to inhibit TOR kinase due to the non-functional FKBP12. Here we find that tomato plants showed obvious growth inhibition when treated with rapamycin and the inhibitory phenotype is similar to suppression of TOR causing by active-site TOR inhibitors (asTORis such as KU63794, AZD8055 and Torin1. The chemical genetic assays using TOR inhibitors and heterologous expressing SlFKBP12 in Arabidopsis indicated that the TOR signaling is functional in tomato. The protein gel shifting and TOR inhibitors combination assays showed that SlFKBP12 can mediate the interaction between rapamycin and TOR. Furthermore, comparative expression profiling analysis between treatments with rapamycin and KU63794 identified highly overlapped Differentially Expressed Genes (DEGs which are involved in many anabolic and catabolic processes, such as photosynthesis, cell wall restructuring, and senescence in tomato. These observations suggest that SlFFBP12 is functional in tomato. The results provided basic information of TOR signaling in tomato, and also some new insights into how TOR controls plant growth and development through reprogramming the transcription profiles

  2. Type I integrable defects and finite-gap solutions for KdV and sine-Gordon models

    Science.gov (United States)

    Corrigan, E.; Parini, R.

    2017-07-01

    The main purpose of this paper is to extend results, which have been obtained previously to describe the classical scattering of solitons with integrable defects of type I, to include the much larger and intricate collection of finite-gap solutions defined in terms of generalised theta functions. In this context, it is generally not feasible to adopt a direct approach, via ansätze for the fields to either side of the defect tuned to satisfy the defect sewing conditions. Rather, essential use is made of the fact that the defect sewing conditions themselves are intimately related to Bäcklund transformations in order to set up a strategy to enable the calculation of the field on one side by suitably transforming the field on the other side. The method is implemented using Darboux transformations and illustrated in detail for the sine-Gordon and KdV models. An exception, treatable by both methods, indirect and direct, is provided by the genus 1 solutions. These can be expressed in terms of Jacobi elliptic functions, which satisfy a number of useful identities of relevance to this problem. There are new features to the solutions obtained in the finite-gap context but, in all cases, if a (multi)soliton limit is taken within the finite-gap solutions previously known results are recovered.

  3. KD60 METAR

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — METAR is a routine scheduled observation and is the primary observation code used in the United States to satisfy requirements for reporting surface meteorological...

  4. KD50 METAR

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — METAR is a routine scheduled observation and is the primary observation code used in the United States to satisfy requirements for reporting surface meteorological...

  5. KD25 METAR

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — METAR is a routine scheduled observation and is the primary observation code used in the United States to satisfy requirements for reporting surface meteorological...

  6. KD95 METAR

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — METAR is a routine scheduled observation and is the primary observation code used in the United States to satisfy requirements for reporting surface meteorological...

  7. The influence of KD and K anti K mesonic molecules in selected reactions; Auswirkung der im KD- und K anti K-Kanal gebildeten mesonischen Molekuele in verschiedenen Reaktionen

    Energy Technology Data Exchange (ETDEWEB)

    Sassen, F.P.

    2004-07-01

    The attractive potential of the Juelich meson exchange model in the K anti K-channel causes formation of a scalar isoscalar molecule. We investigate this observation from different points of view. First we look at the dependence of pion production in the peripheral reaction {pi}{sup -}p {yields} {pi}{sup 0}{pi}{sup 0}n on the momentum transferred at the nucleus. Accounting for the production via {pi} and a{sub 1} emission in a consistent way, we are able to explain the momentum dependence using the Juelich model. Furthermore we investigate how a measurement of dd {yields} {alpha}K anti K close to threshold may contribute to our knowledge on K anti K interaction and the f{sub 0}(980). The Juelich model links the properties of the f{sub 0}(980) to the a{sub 0}(980). We will use this information to learn about the d anti K-interaction in pp {yields} dK anti K. The recent discovery of the D{sup *}{sub sJ}(2317) o ers a different perspective on the dynamical generation of poles, since it may be connected to the KD-threshold nearby. We construct a SU(4)-extention of the Juelich model including isospin violation. Within this extention a dynamical resonance is formed, which only may explain the D{sup *}{sub sJ}(2317) if isoscalar production is assumed. Special interest is paid to the predicted width of the D{sup *}{sub sJ}(2317) associated with a dynamical interpretation. (orig.)

  8. Determinação do coeficiente de distribuição (Kd de benzo(apireno em solo por isotermas de sorção Determination of the distribution coefficient (kd of benzo(apyrene in soil using sorption isotherms

    Directory of Open Access Journals (Sweden)

    Adriana D'Agostinho

    2006-07-01

    Full Text Available Leaking of diesel oil from gas stations is frequent in Brazil. The presence of polycyclic aromatic hydrocarbons (PAHs, which are highly toxic is an indication of contamination by heavy hydrocarbons from diesel oil. Here were present the determination of the distribution coefficient (Kd of benzo(apyrene (the most carcinogenic of the PAHs in tropical soils using the sorption isotherm model. The sorption curves acquired for benzo(apyrene were of the S-type, probably due to the water/methanol experimental conditions. The sorption curves allowed calculation of the distribution coefficient (Kd. The experimental Kd values were lower than those calculated from literature Koc values (partition coefficient normalized by organic carbon, due mainly to the cosolvency effect and the percentage of organic matter and clay in soil.

  9. Universality of the Break-up Profile for the KdV Equation in the Small Dispersion Limit Using the Riemann-Hilbert Approach

    Science.gov (United States)

    Claeys, T.; Grava, T.

    2009-03-01

    We obtain an asymptotic expansion for the solution of the Cauchy problem for the Korteweg-de Vries (KdV) equation u_t+6uu_x+ɛ2u_{xxx}=0,quad u(x,t=0,ɛ)=u_0(x), for {ɛ} small, near the point of gradient catastrophe ( x c , t c ) for the solution of the dispersionless equation u t + 6 uu x = 0. The sub-leading term in this expansion is described by the smooth solution of a fourth order ODE, which is a higher order analogue to the Painlevé I equation. This is in accordance with a conjecture of Dubrovin, suggesting that this is a universal phenomenon for any Hamiltonian perturbation of a hyperbolic equation. Using the Deift/Zhou steepest descent method applied on the Riemann-Hilbert problem for the KdV equation, we are able to prove the asymptotic expansion rigorously in a double scaling limit.

  10. Chicken liver TGGCA protein purified by preparative mobility shift electrophoresis (PMSE) shows a 36.8 to 29.8 kd microheterogeneity.

    Science.gov (United States)

    Rupp, R A; Sippel, A E

    1987-12-10

    The TGGCA protein, the chicken homologue of HeLa cell NF-I, was purified to homogeneity from liver tissue by a procedure which includes preparative mobility shift electrophoresis (PMSE) as the final step. PMSE was here adjusted for the isolation of the TGGCA protein, but can be used as a general method to characterize the protein moiety of specific DNA-binding proteins. The TGGCA protein is a family of 6 protein species, which show minor differences in molecular weight from 36.8kd to 29.8kd. This microheterogeneity differs from the size distribution reported for HeLa cell NF-I polypeptides. All species of the TGGCA protein bind identically to a synthetic DNA-binding site and appear to be highly related in primary structure. We discuss the possible functional importance of this microheterogeneity.

  11. Mechanism of [m+h]+ formation in atmospheric pressure photoionization mass spectrometry: identification of propionitrile in acetonitrile with high mass accuracy measurement and tandem mass spectrometry and evidence for its involvement in the protonation phenomenon.

    Science.gov (United States)

    Kamel, Amin; Jeanville, Patrick; Colizza, Kevin; J-Rivera, Lauren Elizabeth

    2008-11-01

    The role of propionitrile in the production of [M+H]+ under atmospheric pressure photoionization (APPI) was investigated. In dopant-assisted APPI using acetone and anisole, protonated acetone and anisole radical cations were the most prominent ions observed. In dopant-free or direct APPI in acetonitrile, however, a major ion in acetonitrile was detected and identified as propionitrile, using high accuracy mass measurement and collision induced dissociation studies. Vaporizing ca. 10(-5) M althiazide and bendroflumethazide under direct APPI in acetonitrile produced their corresponding protonated species [M+H]+. In addition to protonated acetonitrile, its dimers, and acetonitrile/water clusters, protonated propionitrile, propionitrile dimer, and propionitrile/water clusters were also observed. The role of propionitrile, an impurity in acetonitrile and/or a possible product of ion-molecule reaction, in the production of [M+H]+ of althiazide and bendroflumethazide was further investigated in the absence of dopant using propionitrile-d5. The formation of [M+D]+ species was observed, suggesting a possible role of propionitrile in the protonation process. Additionally, an increase in the [M+H]+ signal of althiazide and bendroflumethazide was observed as a function of propionitrile concentration in acetonitrile. Theoretical data from the literature supported the assumption that one possible mechanism, among others, for the formation of [M+H]+ could be attributed to photo-initiated isomerization of propionitrile. The most stable isomers of propionitrile, based on their calculated ionization energy (IE) and relative energy (DeltaE), were assumed to undergo proton transfer to the analytes, and mechanisms were proposed.

  12. Chemical and electrochemical recycling of the nickel, cobalt, zinc and manganese from the positives electrodes of spent Ni-MH batteries from mobile phones

    Science.gov (United States)

    Santos, V. E. O.; Celante, V. G.; Lelis, M. F. F.; Freitas, M. B. J. G.

    2012-11-01

    Chemical and electrochemical recycling methods for the Ni, Co, Zn and Mn from the positives electrodes of spent Ni-MH batteries were developed. The materials recycled by chemical precipitation have the composition β-Ni(OH)2, Co(OH)2, Zn(OH)2 and Mn3O4. The powder retains sulphate, nitrate and carbonate anions from the mother solution as well as adsorbed water. Studies using cyclic voltammetry show that the current density decreases for scan rates greater than 10 mV s-1 because of the formation of hydroxide films. The amounts of Ni2+, Co2+, Zn2+ and Mn2+ were obtained by analysis of the solution using the inductively coupled plasma with optical emission spectroscopy technique, which demonstrated that the electrodeposition method exhibits anomalous behaviour. The amount of deposited nickel ions is related to the composition of the sulfamate bath. The presence of manganese in the electrodeposits is due to the precipitation of Mn(OH)2, and Zn(OH)42- does not undergo reduction in the investigated potential range. The electrodeposited material contains Ni, Co, CoO, Co(OH)2, and Mn3O4. A charge efficiency of 83.7% was attained for the electrodeposits formed by the application of -1.1 V vs. Ag/AgCl at a charge density of -90 C cm-2. The dissolution of the electrodeposits depends on the applied potential.

  13. People’s Motivation to Participate in Social Network Sites, Subsequent Behaviours, and Situation Self-Awareness following a Crisis: Evidence from the MH370 Flight Incident

    Directory of Open Access Journals (Sweden)

    Xuequn Wang

    2016-03-01

    Full Text Available As people increasingly integrate social network sites (SNSs into their daily lives, they also turn to these sites for timely information following crises. To date, few studies have examined the effects of different types of motivation on participatory behaviours within SNSs following crises. In this study, self-determination theory (SDT is applied to examine how individuals are motivated to participate in SNSs following a crisis and how individuals’ participatory behaviours can better assist them understand a crisis. The Malaysia Airlines Flight 370 (MH370 incident is selected as the context for this study, and data is collected following the incident. The results show that different types of motivation result in different participatory behaviours. Controlled motivation is positively related to browsing content, commenting and sharing content. Conversely, autonomous motivation is positively associated with browsing and sharing content. Besides, browsing content and commenting are positively related to people’s situational self-awareness. The theoretical and practical implications of this study are discussed.

  14. Fe-Substitution for Ni in Misch Metal-Based Superlattice Hydrogen Absorbing Alloys—Part 2. Ni/MH Battery Performance and Failure Mechanisms

    Directory of Open Access Journals (Sweden)

    Tiejun Meng

    2017-09-01

    Full Text Available The electrochemical performance and failure mechanisms of Ni/MH batteries made with a series of the Fe-substituted A2B7 superlattice alloys as the negative electrodes were investigated. The incorporation of Fe does not lead to improved cell capacity or cycle life at either room or low temperature, although Fe promotes the formation of a favorable Ce2Ni7 phase. Fe-substitution was found to inhibit leaching of Al from the metal hydride negative electrode and promote leaching of Co, which could potentially extend the cycle life of the positive electrode. The failure mechanisms of the cycled cells with the Fe-substituted superlattice hydrogen absorbing alloys were analyzed by scanning electron microscopy, energy dispersive spectroscopy and inductively coupled plasma analysis. The failure of cells with Fe-free and low Fe-content alloys is mainly attributed to the pulverization of the metal hydride alloy. Meanwhile, severe oxidation/corrosion of the negative electrode is observed for cells with high Fe-content alloys, resulting in increased internal cell resistance, formation of micro-shortages in the separator and eventual cell failure.

  15. The Mental Health Leadership and Advocacy Program (mhLAP): a pioneering response to the neglect of mental health in Anglophone West Africa

    Science.gov (United States)

    2014-01-01

    Developing countries in Africa and other regions share a similar profile of insufficient human resources for mental health, poor funding, a high unmet need for services and a low official prioritisation of mental health. This situation is worsened by misconceptions about the causes of mental disorders, stigma and discrimination that frequently result in harmful practices against persons with mental illness. Previous explorations of the required response to these challenges have identified the need for strong leadership and consistent advocacy as potential drivers of the desired change. The Mental Health Leadership and Advocacy Program (mhLAP) is a project that aims to provide and enhance the acquisition of skills in mental health leadership, service development, advocacy and policy planning and to build partnerships for action. Launched in 2010 to serve the Anglophone countries of The Gambia, Ghana, Liberia, Nigeria, Sierra Leone, this paper describes the components of the program, the experience gained since its initiation, and the achievements made during the three years of its implementation. These achievements include: 1) the annual training in mental health leadership and advocacy which has graduated 96 participants from 9 different African countries and 2) the establishment of a broad coalition of service user groups, non-governmental organizations, media practitioners and mental health professionals in each participating country to implement concerted mental health advocacy efforts that are focused on country-specific priorities PMID:24467884

  16. Comparison of 5 monoclonal antibodies for immunopurification of human butyrylcholinesterase on Dynabeads: KD values, binding pairs, and amino acid sequences.

    Science.gov (United States)

    Peng, Hong; Brimijoin, Stephen; Hrabovska, Anna; Targosova, Katarina; Krejci, Eric; Blake, Thomas A; Johnson, Rudolph C; Masson, Patrick; Lockridge, Oksana

    2015-10-05

    Human butyrylcholinesterase (HuBChE) is a stoichiometric bioscavenger of nerve agents and organophosphorus pesticides. Mass spectrometry methods detect stable nerve agent adducts on the active site serine of HuBChE. The first step in sample preparation is immunopurification of HuBChE from plasma. Our goal was to identify monoclonal antibodies that could be used to immunopurify HuBChE on Dynabeads Protein G. Mouse anti-HuBChE monoclonal antibodies were obtained in the form of ascites fluid, dead hybridoma cells stored frozen at -80 °C for 30 years, or recently frozen hybridoma cells. RNA from 4 hybridoma cell lines was amplified by PCR for determination of their nucleotide and amino acid sequences. Full-length light and heavy chains were expressed, and the antibodies purified from culture medium. A fifth monoclonal was purchased. The 5 monoclonal antibodies were compared for ability to capture HuBChE from human plasma on Dynabeads Protein G. In addition, they were evaluated for binding affinity by Biacore and ELISA. Epitope mapping by pairing analysis was performed on the Octet Red96 instrument. The 5 monoclonal antibodies, B2 12-1, B2 18-5, 3E8, mAb2, and 11D8, had similar KD values of 10(-9) M for HuBChE. Monoclonal B2 18-5 outperformed the others in the Dynabeads Protein G assay where it captured 97% of the HuBChE in 0.5 ml plasma. Pairing analysis showed that 3E8 and B2 12-1 share the same epitope, 11D8 and B2 18-5 share the same epitope, but mAb2 and B2 12-1 or mAb2 and 3E8 bind to different epitopes on HuBChE. B2 18-5 was selected for establishment of a stable CHO cell line for production of mouse anti-HuBChE monoclonal. Copyright © 2015 Elsevier Ireland Ltd. All rights reserved.

  17. MH-60R Multi-Mission Helicopter (MH-60R)

    Science.gov (United States)

    2016-03-23

    Operations that replaces the aging SH-60B and SH-60F helicopters. The avionics upgrades over the existing SH-60B/F include: a glass cockpit common...1087 Contract Number: N00019-11-C-0077 Contract Type: Firm Fixed Price (FFP) Award Date: September 27, 2011 Definitization Date: September 27...2011 Contract Price Initial Contract Price ($M) Current Contract Price ($M) Estimated Price At Completion ($M) Target Ceiling Qty Target Ceiling Qty

  18. Comparative Analysis of the 15.5kD Box C/D snoRNP Core Protein in the Primitive Eukaryote Giardia lamblia Reveals Unique Structural and Functional Features

    Energy Technology Data Exchange (ETDEWEB)

    Biswas, Shyamasri; Buhrman, Greg; Gagnon, Keith; Mattos, Carla; Brown, II, Bernard A.; Maxwell, E. Stuart (NCSU); (UTSMC)

    2012-07-11

    Box C/D ribonucleoproteins (RNP) guide the 2'-O-methylation of targeted nucleotides in archaeal and eukaryotic rRNAs. The archaeal L7Ae and eukaryotic 15.5kD box C/D RNP core protein homologues initiate RNP assembly by recognizing kink-turn (K-turn) motifs. The crystal structure of the 15.5kD core protein from the primitive eukaryote Giardia lamblia is described here to a resolution of 1.8 {angstrom}. The Giardia 15.5kD protein exhibits the typical {alpha}-{beta}-{alpha} sandwich fold exhibited by both archaeal L7Ae and eukaryotic 15.5kD proteins. Characteristic of eukaryotic homologues, the Giardia 15.5kD protein binds the K-turn motif but not the variant K-loop motif. The highly conserved residues of loop 9, critical for RNA binding, also exhibit conformations similar to those of the human 15.5kD protein when bound to the K-turn motif. However, comparative sequence analysis indicated a distinct evolutionary position between Archaea and Eukarya. Indeed, assessment of the Giardia 15.5kD protein in denaturing experiments demonstrated an intermediate stability in protein structure when compared with that of the eukaryotic mouse 15.5kD and archaeal Methanocaldococcus jannaschii L7Ae proteins. Most notable was the ability of the Giardia 15.5kD protein to assemble in vitro a catalytically active chimeric box C/D RNP utilizing the archaeal M. jannaschii Nop56/58 and fibrillarin core proteins. In contrast, a catalytically competent chimeric RNP could not be assembled using the mouse 15.5kD protein. Collectively, these analyses suggest that the G. lamblia 15.5kD protein occupies a unique position in the evolution of this box C/D RNP core protein retaining structural and functional features characteristic of both archaeal L7Ae and higher eukaryotic 15.5kD homologues.

  19. The water-soluble fraction (<10 kD) of bee venom (Apis mellifera) produces inhibitory effect on apical transporters in renal proximal tubule cells.

    Science.gov (United States)

    Han, Ho Jae; Yoon, Byeong Cheol; Oh, Young Joon; Park, Soo Hyun; Lee, Jang Hern; Mar, Woong Chon

    2002-01-01

    Human envenomation caused by bee stings has been reported to cause acute renal failure and the pathogenetic mechanisms of these renal functional changes are still unclear. Bee venom is also a complex mixture of enzymes and proteins. Thus, this study was conducted to examine the effects of bee venom (BV, Apis mellifera) fractions on apical transporters' activity and its related signal pathways in primary cultured renal proximal tubule cells. Whole BV was extracted into three fractions according to solubility [a water-soluble fraction (BVA), an ethylacetate-soluble fraction (BVE), and a hexane-soluble fraction (BVH)]. BVA fraction was further separated to three portions according to molecular weights: BF1 (>20 kD), BF2 (10-20 kD), and BF3 (BVH (27 ng/ml) and BVE (43 ng/ml) did not. BF3 (710 ng/ml) among BVA fractions predominantly decreased cell viability and inhibited alpha-methyl-D-glucopyranoside (alpha-MG), phosphate (Pi), and Na(+) uptake. In addition, BF3 increased [(3)H] arachidonic acid release, lipid peroxide formation, and Ca(2+) uptake. These effects of BF3 were blocked by mepacrine and AACOCF(3) (phospholipase A(2) inhibitors) or N-acetylcysteine, vitamin C, and vitamin E (antioxidants). In conclusion, BF3 (<10 kD) among BV fractions is the most effective portion in BV-induced inhibition of alpha-MG, P(i), and Na(+) uptake and these effects of BF3 are associated with phospholipase A(2)-oxidative stress-Ca(2+) signal cascade in the primary cultured rabbit renal proximal tubule cells. Copyright 2002 S. Karger AG, Basel

  20. Ahsg-fetuin blocks the metabolic arm of insulin action through its interaction with the 95-kD β-subunit of the insulin receptor.

    Science.gov (United States)

    Goustin, Anton Scott; Derar, Nada; Abou-Samra, Abdul B

    2013-04-01

    We previously have shown that Ahsg, a liver glycoprotein, inhibits insulin receptor (InsR) tyrosine kinase (TK) activity and the ERK1/2 mitogenic signaling arm of insulin signaling. Here we show that Ahsg blocks insulin-stimulated GLUT4 translocation and Akt activation in intact cells (mouse myoblasts). Furthermore, Ahsg inhibits InsR autophosphorylation of highly-purified insulin holoreceptors in a cell-free, ATP-dependent system, with an IC50 within the range of single-chain Ahsg concentrations in human serum. Binding of (125)I-insulin to living cells overexpressing the InsR shows a dissociation constant (KD) of 250pM, unaltered in the presence of 300 nM Ahsg. A mutant InsR cDNA encoding the signal peptide, the β-subunit and the furin processing site, but deleting the α-subunit, was stably expressed in HEK293 cells. Treatment with peroxovanadate, but not insulin, dramatically increased the 95 kD β-subunit tyrosine phosphoryation. The level of tyrosine phosphorylation of the 95-kD β-subunit can be driven down sharply by treatment of living HEK293 transfectant cells with physiological doses of Ahsg. Treatment of myogenic cells with Ahsg blunts insulin-stimulated InsR autophosphorylation and AKT phosphorylation. Taken together, we show that Ahsg antagonizes the metabolic functions initiated by InsR activation without interference in insulin binding. The experiments suggest a direct interaction of Ahsg with the InsR ectodomain β-subunit in a mode that does not significantly alter the high-affinity binding of insulin to the holoreceptor's two complementing α-subunits. Copyright © 2013 Elsevier Inc. All rights reserved.

  1. High antibody levels to the mycobacterial fibronectin-binding antigen of 30-31 kD in tuberculosis and lepromatous leprosy.

    Science.gov (United States)

    Espitia, C; Sciutto, E; Bottasso, O; González-Amaro, R; Hernández-Pando, R; Mancilla, R

    1992-01-01

    Immunoblot assays showed that mycobacterial fibronectin-binding antigens are important targets of the humoral immune response in tuberculosis and leprosy. Using culture filtrate antigens of Mycobacterium tuberculosis, strong reactivity with the fibronectin-binding of 30-31 kD (Fn 30-31) was demonstrated in 55.9% of tuberculosis sera and in 56.5% of lepromatous leprosy sera. Sera from patients with tuberculoid leprosy and control sera gave very weak binding. Reactivity of tuberculosis and lepromatous leprosy sera with the fibronectin-binding antigen of 58-60 kD (Fn 58-60) was less conspicuous. The ability to react with fibronectin of the antigens of 58-60 and 30-31 kD was demonstrated by parallel labelling with a fibronectin-biotin conjugate. Fn 30-31 was purified to homogeneity by a two-step procedure and used for ELISA. Positive titres were found in 63% out of 65 tuberculosis sera and in 60.5% out of 43 lepromatous leprosy sera. Antibody titres in lepromatous leprosy sera were higher than in tuberculosis sera. Our observations indicate indirectly that M. leprae possess a highly immunogenic molecule homologous to M. tuberculosis Fn 30-31, which elicits a high antibody response in lepromatous leprosy but not in tuberculoid leprosy. In this investigation, direct evidence for the presence of this antigen in M. leprae was obtained by immunochemistry of lepromatous leprosy lesions with a monospecific antibody raised against M. tuberculosis Fn 30-31. Images Fig. 1 Fig. 2 Fig. 3 Fig. 4 Fig. 6 PMID:1371953

  2. Reactions of M(+)(H2O)n, n < 40, M = V, Cr, Mn, Fe, Co, Ni, Cu, and Zn, with D2O reveal water activation in Mn(+)(H2O)n.

    Science.gov (United States)

    van der Linde, Christian; Beyer, Martin K

    2012-11-08

    Reactions of M(+)(H(2)O)(n), n hydrogen occurs. For manganese, HDO formation occurs in the size regime n ≈ 8-20. Additional experiments show that, in this size regime, Mn(+)(H(2)O)(n) is slowly converted into HMnOH(+)(H(2)O)(n-1) under the influence of room temperature blackbody radiation. The reaction is mildly exothermic; ΔH ≈ -21 ± 10 kJ mol(-1).

  3. Vanishing of T sub c and appearance of quantum paraelectricity in KD sub 2 PO sub 4 and KH sub 2 PO sub 4 under high pressure

    CERN Document Server

    Endo, S; Tokunaga, M

    2002-01-01

    The temperature dependences of the dielectric constants of the hydrogen-bond ferroelectrics KH sub 2 PO sub 4 (KDP) and KD sub 2 PO sub 4 (DKDP) were measured under high hydrostatic pressure. Their ferroelectric transition temperatures T sub c monotonically decreased with increasing pressure and the ferroelectric state vanished at p sub c : 1.7 GPa for KDP and 6.1 GPa for DKDP. On the other hand, the Curie constant remained finite at p sub c , which indicates that the ferroelectric phase transition at high pressure is of displacive type. At pressures around p sub c , quantum paraelectricity was observed in KDP and DKDP.

  4. Approximate Analytic Solutions of Time-Fractional Hirota-Satsuma Coupled KdV Equation and Coupled MKdV Equation

    Directory of Open Access Journals (Sweden)

    Jincun Liu

    2013-01-01

    Full Text Available By introducing the fractional derivative in the sense of Caputo and combining the pretreatment technique to deal with long nonlinear items, the generalized two-dimensional differential transform method is proposed for solving the time-fractional Hirota-Satsuma coupled KdV equation and coupled MKdV equation. The presented method is a numerical method based on the generalized Taylor series expansion which constructs an analytical solution in the form of a polynomial. The numerical results show that the generalized two-dimensional differential transform method is very effective for the fractional coupled equations.

  5. The variational iteration method and the variational homotopy perturbation method for solving the KdV-Burgers equation and the Sharma-Tasso-Olver equation

    Energy Technology Data Exchange (ETDEWEB)

    Zayed, Elsayed M.E. [Dept. of Mathematics, Zagazig Univ. (Egypt); Abdel Rahman, Hanan M. [Dept. of Basic Sciences, Higher Technological Inst., Tenth of Ramadan City (Egypt)

    2010-01-15

    In this article, two powerful analytical methods called the variational iteration method (VIM) and the variational homotopy perturbation method (VHPM) are introduced to obtain the exact and the numerical solutions of the (2+1)-dimensional Korteweg-de Vries-Burgers (KdVB) equation and the (1+1)-dimensional Sharma-Tasso-Olver equation. The main objective of the present article is to propose alternative methods of solutions, which avoid linearization and physical unrealistic assumptions. The results show that these methods are very efficient, convenient and can be applied to a large class of nonlinear problems. (orig.)

  6. Programación de altas prestaciones para análisis no lineal de series temporales con kd-tree.

    OpenAIRE

    Águila Guerrero, Julio José

    2011-01-01

    La presente tesis mostrará el desarrollo de aplicaciones basadas en la estructura de datos kd-tree utilizando programación de altas prestaciones en el ámbito del análisis no lineal de series temporales. Su principal aporte es presentar un conjunto de algoritmos que pueden ser utilizados en tiempo real para obtener resultados en una escala de tiempo reducida, aún cuando el tamaño de los registros de datos sea muy grande. Las aplicaciones han sido desarrolladas dentro de un marco de trabajo ...

  7. Mapping Mammalian Cell-type-specific Transcriptional Regulatory Networks Using KD-CAGE and ChIP-seq Data in the TC-YIK Cell Line.

    Science.gov (United States)

    Lizio, Marina; Ishizu, Yuri; Itoh, Masayoshi; Lassmann, Timo; Hasegawa, Akira; Kubosaki, Atsutaka; Severin, Jessica; Kawaji, Hideya; Nakamura, Yukio; Suzuki, Harukazu; Hayashizaki, Yoshihide; Carninci, Piero; Forrest, Alistair R R

    2015-01-01

    Mammals are composed of hundreds of different cell types with specialized functions. Each of these cellular phenotypes are controlled by different combinations of transcription factors. Using a human non islet cell insulinoma cell line (TC-YIK) which expresses insulin and the majority of known pancreatic beta cell specific genes as an example, we describe a general approach to identify key cell-type-specific transcription factors (TFs) and their direct and indirect targets. By ranking all human TFs by their level of enriched expression in TC-YIK relative to a broad collection of samples (FANTOM5), we confirmed known key regulators of pancreatic function and development. Systematic siRNA mediated perturbation of these TFs followed by qRT-PCR revealed their interconnections with NEUROD1 at the top of the regulation hierarchy and its depletion drastically reducing insulin levels. For 15 of the TF knock-downs (KD), we then used Cap Analysis of Gene Expression (CAGE) to identify thousands of their targets genome-wide (KD-CAGE). The data confirm NEUROD1 as a key positive regulator in the transcriptional regulatory network (TRN), and ISL1, and PROX1 as antagonists. As a complimentary approach we used ChIP-seq on four of these factors to identify NEUROD1, LMX1A, PAX6, and RFX6 binding sites in the human genome. Examining the overlap between genes perturbed in the KD-CAGE experiments and genes with a ChIP-seq peak within 50 kb of their promoter, we identified direct transcriptional targets of these TFs. Integration of KD-CAGE and ChIP-seq data shows that both NEUROD1 and LMX1A work as the main transcriptional activators. In the core TRN (i.e., TF-TF only), NEUROD1 directly transcriptionally activates the pancreatic TFs HSF4, INSM1, MLXIPL, MYT1, NKX6-3, ONECUT2, PAX4, PROX1, RFX6, ST18, DACH1, and SHOX2, while LMX1A directly transcriptionally activates DACH1, SHOX2, PAX6, and PDX1. Analysis of these complementary datasets suggests the need for caution in interpreting Ch

  8. Hydrometallurgical method for recycling rare earth metals, cobalt, nickel, iron, and manganese from negative electrodes of spent Ni-MH mobile phone batteries; Metodo hidrometalurgico para reciclagem de metais terras raras, cobalto, niquel, ferro e manganes de eletrodos negativos de baterias exauridas de Ni-MH de telefone celular

    Energy Technology Data Exchange (ETDEWEB)

    Santos, Vinicius Emmanuel de Oliveira dos; Lelis, Maria de Fatima Fontes; Freitas, Marcos Benedito Jose Geraldo de, E-mail: viniciusemmanuel@hotmail.com [Universidade Federal do Espirito Santo (UFES), Vitoria, ES (Brazil). Departamento de Quimica; Celante, Vinicius Guilherme [Instituto Federal do Espirito Santo (IFES), Aracruz, ES (Brazil)

    2014-07-01

    A hydrometallurgical method for the recovery of rare earth metals, cobalt, nickel, iron, and manganese from the negative electrodes of spent Ni-MH mobile phone batteries was developed. The rare earth compounds were obtained by chemical precipitation at pH 1.5, with sodium cerium sulfate (NaCe(SO{sub 4}){sub 2}.H{sub 2}O) and lanthanum sulfate (La{sub 2}(SO{sub 4}){sub 3}.H{sub 2}O) as the major recovered components. Iron was recovered as Fe(OH){sub 3} and FeO. Manganese was obtained as Mn{sub 3}O{sub 4}.The recovered Ni(OH){sub 2} and Co(OH){sub 2} were subsequently used to synthesize LiCoO{sub 2}, LiNiO{sub 2} and CoO, for use as cathodes in ion-Li batteries. The anodes and recycled materials were characterized by analytical techniques. (author)

  9. KNOWLEDGE, BELIEF AND THE TEACHER J.G. Mbae

    African Journals Online (AJOL)

    Plato should put such a claim in the mouth of Socrates who was at all times known to have denied knowledge of anything. "I know only one thing and that is I know nothing". In the same dialogue the philosopher attempts to locate belief in- between complete ignorance and complete knowledge. This is the germ of what will ...

  10. Sequencing and characterization of Pseudomonas aeruginosa phage JG004

    National Research Council Canada - National Science Library

    Garbe, Julia; Bunk, Boyke; Rohde, Manfred; Schobert, Max

    2011-01-01

    .... Pseudomonas aeruginosa. For an effective use of bacteriophages as antimicrobial agents, it is important to understand phage biology but also genes of the bacterial host essential for phage infection...

  11. Tracking hypoglycins A and B over different maturity stages: implications for detoxification of ackee (Blighia sapida K.D. Koenig) fruits.

    Science.gov (United States)

    Bowen-Forbes, Camille S; Minott, Donna A

    2011-04-27

    Consumption of improperly ripened ackee ( Blighia sapida K.D. Koenig) often results in fatalities. The causal toxin, hypoglycin A, decreases in the edible arilli upon maturity; regulation of hypoglycin A in the arilli is thus critical. Hypoglycin B, also toxic, is confined to the seeds. Hypoglycins A and B were tracked in ackees grown in Jamaica over different maturity stages using RP-HPLC. Studies on the 'Butter' and 'Cheese' ackee varieties and across two different harvest seasons were conducted. In 'Cheese' ackees, hypoglycin A decreased from about 8000 mg/kg in the green arilli and seeds to 271 and 1451 mg/kg, respectively, in the ripe fruit whereas hypoglycin B levels in the seeds increased from 1629 to 11774 mg/kg. The strong inverse relationship demonstrated that hypoglycin B in the seeds serves as a sink for hypoglycin A from the ripening arilli and is thereby involved in the detoxification mechanism of the fruit.

  12. Free-Moisture Content and {sup 129}I-Kd Values of Filtercake Material Generated from the F-Area Groundwater Treatment Unit

    Energy Technology Data Exchange (ETDEWEB)

    Kaplan, D.I.

    2001-09-10

    Laboratory tests were conducted for the Environmental Restoration Division (ERD) to evaluate whether filtercake waste generated from the F-Area Ground Water Treatment Unit (GWTU) would satisfy the free moisture Waste Acceptance Criteria, WAC, (less than 1 vol- percent free moisture after transport) of the Nevada Test Site (NTS) (DOE 2000). The vibration test used in this study is an operationally defined parameter that is not expected to simulate precisely the conditions during filtercake transport between the Savannah River Site (SRS) and the NTS. However, the laboratory tests are expected to provide information about trends related to free moisture release. The objectives of this study were to determine: (1) the influence of total moisture content on the amount of free moisture released from the filtercake waste, (2) whether resin material used downstream of the treatment process had mixed into the filtercake, (3) 129I-Kd values for the filtercake, and (4) 129I concentrations in the filtercake.

  13. Waveguides of two-soliton solutions for the coupled KdV equations with variable coefficients in long-distance communication systems

    Science.gov (United States)

    Abdel-Gawad, H. I.; Tantawy, M.

    2017-06-01

    The aim of this paper is to study the collision between the long surface water waves. This is done by considering the coupled KdV equations with the relevant constrains on the variable coefficients. The extended rational traveling wave solutions are obtained. Various solutions of solitary waves, via soliton, periodic, elliptic and two-soliton solutions has also found. The waveguide properties of the characterizing two-soliton are shown to be a graded-index with reflection component and transmission with periodic distributions in long-distance communication. Here the linear refractive index and transmission are been shown to evolute towards solitonic waves enable to confirm data transverse by restricting expansion in low-cost telecommunications systems.

  14. [Efficacy and safety of pegylated interferon α-2b injection (Y shape, 40 kD) in treatment of patients with genotype 1/6 chronic hepatitis C].

    Science.gov (United States)

    Feng, B; Shang, J; Wu, S H; Chen, H; Han, Y; Li, Y Q; Zhang, D Z; Zhao, L F; Wei, S F; Mao, Q; Yin, C B; Han, T; Wang, M R; Chen, S J; Li, J; Xie, Q; Zhen, Z; Gao, Z L; Zhang, Y X; Gong, G Z; Yang, D L; Pan, C; Sheng, J F; Tang, H; Ning, Q; Shi, G F; Niu, J Q; Luo, G H; Sun, Y T; You, H; Wang, G Q; Zhang, L L; Peng, J; Zhang, Q; Liu, J J; Chen, C W; Chen, X Y; Zhao, W; Wang, R H; Sun, L; Wei, L

    2017-03-20

    Objective: To investigate the efficacy and safety of the new investigational drug pegylated interferon α-2b (Peg-IFN-α-2b) (Y shape, 40 kD) injection (180 µg/week) combined with ribavirin in the treatment of patients with genotype 1/6 chronic hepatitis C (CHC), with standard-dose Peg-IFN-α-2a combined with ribavirin as a positive control. Methods: A multicenter, randomized, open-label, and positive-controlled phase III clinical trial was performed. Eligible patients with genotype 1/6 CHC were screened out and randomly divided into Peg-IFN-α-2b(Y shape, 40kD) group and Peg-IFN-α-2a group at a ratio of 2:1. The patients in both groups were given oral ribavirin for 48 weeks in addition and then followed up for 24 weeks after drug withdrawal. Abbott Real Time HCV Genotype II was used to determine HCV genotype, and Cobas TaqMan quantitative real-time PCR was used to measure HCV RNA level at 0, 4, 12, 24, 48, and 72 weeks. Adverse events were recorded in detail. The primary efficacy endpoint was sustained virological response (SVR), and a non-inferiority test was also performed. Results: A total of 561 patients with genotype 1/6 CHC were enrolled, among whom 529 received treatment; 90.9% of these patients had genotype 1 CHC. The data of the full analysis set showed that SVR rate was 69.80% (95% CI 65.00%-74.60%) in the trial group and 74.16% (95% CI 67.73%-80.59%) in the control group (P = 0.297 0). The data of the per protocol set (PPS) showed that SVR rate was 80.63% (95% CI 76.04%-85.23%) in the trial group and 81.33% (95% CI 75.10%-87.57%) in the control group (P = 0.849 8), and the 95% CI of rate difference conformed to the non-inferiority standard. The analysis of the PPS population showed that of all subjects, 47.9% achieved rapid virologic response, with a positive predictive value of 93.8%. The incidence rate of adverse events was 96.30% in the trial group and 94.94% in the control group, and the incidence rate of serious adverse events was 5.13% in the

  15. The association between individual counselling and health behaviour change: the See Kidney Disease (SeeKD) targeted screening programme for chronic kidney disease.

    Science.gov (United States)

    Galbraith, Lauren; Hemmelgarn, Brenda; Manns, Braden; Samuel, Susan; Kappel, Joanne; Valk, Nadine; Ronksley, Paul

    2016-01-01

    Health behaviour change is an important component of management for patients with chronic kidney disease (CKD); however, the optimal method to promote health behaviour change for self-management of CKD is unknown. The See Kidney Disease (SeeKD) targeted screening programme screened Canadians at risk for CKD and promoted health behaviour change through individual counselling and goal setting. The objectives of this study are to determine the effectiveness of individual counselling sessions for eliciting behaviour change and to describe participant characteristics associated with behaviour change. This is a cross-sectional, descriptive study. The study setting is the National SeeKD targeted screening programme. The participants are all 'at risk' patients who were screened for CKD and returned a follow-up health behaviour survey (n = 1129). Health behaviour change was defined as a self-reported change in lifestyle, including dietary changes or medication adherence. An individual counselling session was provided to participants by allied healthcare professionals to promote health behaviour change. A survey was mailed to all participants at risk of CKD within 2-4 weeks following the screening event to determine if behaviour changes had been initiated. Descriptive statistics were used to describe respondent characteristics and self-reported behaviour change following screening events. Results were stratified by estimated glomerular filtration rate (eGFR) (behaviour change. Of the 1129 respondents, the majority (89.8 %) reported making a health behaviour change after the screening event. Respondents who were overweight (body mass index [BMI] 25-29.9 kg/m(2)) or obese (BMI ≥ 30.0 kg/m(2)) were more likely to report a behaviour change (prevalence rate ratio (PRR) 0.66, 95 % confidence interval (CI) 0.44-0.99 and PRR 0.49, 95 % CI 0.30-0.80, respectively). Further, participants with a prior intent to change their behaviour were more likely to make a behaviour

  16. GEMAS: prediction of solid-solution phase partitioning coefficients (Kd) for oxoanions and boric acid in soils using mid-infrared diffuse reflectance spectroscopy.

    Science.gov (United States)

    Janik, Leslie J; Forrester, Sean T; Soriano-Disla, José M; Kirby, Jason K; McLaughlin, Michael J; Reimann, Clemens

    2015-02-01

    The authors' aim was to develop rapid and inexpensive regression models for the prediction of partitioning coefficients (Kd), defined as the ratio of the total or surface-bound metal/metalloid concentration of the solid phase to the total concentration in the solution phase. Values of Kd were measured for boric acid (B[OH]3(0)) and selected added soluble oxoanions: molybdate (MoO4(2-)), antimonate (Sb[OH](6-)), selenate (SeO4(2-)), tellurate (TeO4(2-)) and vanadate (VO4(3-)). Models were developed using approximately 500 spectrally representative soils of the Geochemical Mapping of Agricultural Soils of Europe (GEMAS) program. These calibration soils represented the major properties of the entire 4813 soils of the GEMAS project. Multiple linear regression (MLR) from soil properties, partial least-squares regression (PLSR) using mid-infrared diffuse reflectance Fourier-transformed (DRIFT) spectra, and models using DRIFT spectra plus analytical pH values (DRIFT + pH), were compared with predicted log K(d + 1) values. Apart from selenate (R(2)  = 0.43), the DRIFT + pH calibrations resulted in marginally better models to predict log K(d + 1) values (R(2)  = 0.62-0.79), compared with those from PSLR-DRIFT (R(2)  = 0.61-0.72) and MLR (R(2)  = 0.54-0.79). The DRIFT + pH calibrations were applied to the prediction of log K(d + 1) values in the remaining 4313 soils. An example map of predicted log K(d + 1) values for added soluble MoO4(2-) in soils across Europe is presented. The DRIFT + pH PLSR models provided a rapid and inexpensive tool to assess the risk of mobility and potential availability of boric acid and selected oxoanions in European soils. For these models to be used in the prediction of log K(d + 1) values in soils globally, additional research will be needed to determine if soil variability is accounted on the calibration. © 2014 SETAC.

  17. Novel comprehensive multidimensional liquid chromatography approach for elucidation of the microbosphere of shikimate-producing Escherichia coli SP1.1/pKD15.071 strain.

    Science.gov (United States)

    Cacciola, Francesco; Mangraviti, Domenica; Rigano, Francesca; Donato, Paola; Dugo, Paola; Mondello, Luigi; Cortes, Hernan J

    2017-11-22

    Shikimic acid is a intermediate of aromatic amino acid biosynthesis and the preferred starting material for production of the most commonly prescribed anti-influenza drug, Tamiflu. Its six-membered carbocyclic ring is adorned with several chiral centers and various functionalities, making shikimic acid a valuable chiral synthon. When microbially-produced, in addition to shikimic acid, numerous other metabolites are exported out of the cytoplasm and accumulate in the culture medium. This extracellular matrix of metabolites is referred to as the microbosphere. Due to the high sample complexity, in this study, the microbosphere of shikimate-producing Escherichia coli SP1.1/pKD15.071 was analyzed by liquid chromatography and comprehensive two-dimensional liquid chromatography coupled to photodiode array and mass spectrometry detection. GC analysis of the trimethylsilyl derivatives was also carried out in order to support the elucidation of the selected metabolites in the microbosphere. The elucidation of the metabolic fraction of this bacterial strain might be of valid aid for improving, through genetic changes, the concentration and yield of shikimic acid synthesized from glucose. Graphical abstract.

  18. The induction of recombinant protein bodies in different subcellular compartments reveals a cryptic plastid-targeting signal in the 27 kD γ-zein sequence

    Directory of Open Access Journals (Sweden)

    Anna eHofbauer

    2014-12-01

    Full Text Available Naturally-occurring storage proteins such as zeins are used as fusion partners for recombinant proteins because they induce the formation of ectopic storage organelles known as protein bodies (PBs where the proteins are stabilized by intermolecular interactions and the formation of disulfide bonds. Endogenous PBs are derived from the endoplasmic reticulum (ER. Here we have used different targeting sequences to determine whether ectopic PBs composed of the N-terminal portion of mature 27 kD γ-zein added to a fluorescent protein could be induced to form elsewhere in the cell. The addition of a transit peptide for targeting to plastids causes PB formation in the stroma, whereas in the absence of any added targeting sequence PBs were typically associated with the plastid envelope, revealing the presence of a cryptic plastid targeting signal within the γ-zein cysteine-rich domain. The subcellular localization of the PBs influences their morphology and the solubility of the stored recombinant fusion protein. Our results indicate that the biogenesis and budding of PBs does not require ER-specific factors and therefore confirm that γ-zein is a versatile fusion partner for recombinant proteins offering unique opportunities for the accumulation and bioencapsulation of recombinant proteins in different subcellular compartments.

  19. Frobenius’ Idea Together with Integral Bifurcation Method for Investigating Exact Solutions to a Water Wave Model of the Generalized mKdV Equation

    Directory of Open Access Journals (Sweden)

    Weiguo Rui

    2015-01-01

    Full Text Available By using Frobenius’ idea together with integral bifurcation method, we study a third order nonlinear equation of generalization form of the modified KdV equation, which is an important water wave model. Some exact traveling wave solutions such as smooth solitary wave solutions, nonsmooth peakon solutions, kink and antikink wave solutions, periodic wave solutions of Jacobian elliptic function type, and rational function solution are obtained. And we show their profiles and discuss their dynamic properties aim at some typical solutions. Though the types of these solutions obtained in this work are not new and they are familiar types, they did not appear in any existing literatures because the equation ut+ux+νuxxt+βuxxx + αuux+1/3να(uuxxx+2uxuxx+3μα2u2ux+νμα2(u2uxxx+ux3+4uuxuxx + ν2μα2(ux2uxxx+2uxuxx2 = 0 is very complex. Particularly, compared with the cited references, all results obtained in this paper are new.

  20. The bone matrix protein secreted phosphoprotein 24 kD (Spp24): bone metabolism regulator and starting material for biotherapeutic materials.

    Science.gov (United States)

    Murray, Samuel S; Wang, Jeffrey C; Duarte, Maria Eugenia Leite; Zhao, Ke-Wei; Tian, Haijun; Francis, Timothy; Brochmann Murray, Elsa J

    2015-05-01

    Secreted phosphoprotein 24 kD (Spp24) is a bone matrix protein that appears to be derived primarily from the liver and delivered to other tissues in a protective complex. A significant role in bone growth and turnover is suggested by genetic studies that associate the gene locus (SPP2) with bone mineral density and bone quality. The function of this protein in the normal bone environment is unknown but clues are given by the fact that Spp24, or proteolytic products of Spp24, bind cytokines of the TGF-β superfamily and also activate intracellular signaling pathways. Several potential biotherapeutics have been engineered from this protein including materials that enhance BMP-induced bone healing and, on the other hand, materials that inhibit BMPs in clinical situations where this is called for such as reducing BMP-induced inflammation and inhibiting tumors dependent on BMP autocrine systems. As understanding of the structure and function of this protein increases, more opportunities for rationally developed therapeutics will become apparent.

  1. Antimicrobial and Antioxidant Activities and Phenolic Profile of Eucalyptus globulus Labill. and Corymbia ficifolia (F. Muell. K.D. Hill & L.A.S. Johnson Leaves

    Directory of Open Access Journals (Sweden)

    Ștefan Dezsi

    2015-03-01

    Full Text Available This study was performed to evaluate the in vitro antimicrobial and antioxidant activities and the phenolic profile of Eucalytus globulus Labill. and Corymbia ficifolia (F. Muell. K.D. Hill & L.A.S. Johnson leaves. Both leave extracts contain significant amounts of phenolic compounds, mainly flavonoids. Qualitative and quantitative analyses of the phenolic compounds were performed using a HPLC/MS method. The main flavonoid was hyperoside and its highest amount was found in E. globulus (666.42 ± 5.02 μg/g dw plant material. Regarding the flavonol profile, myricetin was the dominant compound and its highest amount was found in C. ficifolia leaves (124.46 ± 0.24 μg/g dw plant material. The antioxidant activity was evaluated by DPPH, TEAC, hemoglobin ascorbate peroxidase activity inhibition (HAPX and inhibition of lipid peroxidation catalyzed by cytochrome c assays, revealing an important antioxidant potential for both species. In the antimicrobial assays, C. ficifolia extract was found to be more active than E. globulus against both Gram-positive and Gram-negative bacterial strains with the exception of Bacillus subtilis. The results of the present study provide new valuable data regarding the bioactivities of these medicinal species.

  2. Método hidrometalúrgico para reciclagem de metais terras raras, cobalto, níquel, ferro e manganês de eletrodos negativos de baterias exauridas de Ni-MH de telefone celular

    Directory of Open Access Journals (Sweden)

    Vinicius Emmanuel de Oliveira dos Santos

    2014-01-01

    Full Text Available A hydrometallurgical method for the recovery of rare earth metals, cobalt, nickel, iron, and manganese from the negative electrodes of spent Ni - MH mobile phone batteries was developed. The rare earth compounds were obtained by chemical precipitation at pH 1.5, with sodium cerium sulfate (NaCe(SO42.H2O and lanthanum sulfate (La2(SO43.H2O as the major recovered components. Iron was recovered as Fe(OH3 and FeO. Manganese was obtained as Mn3O4.The recovered Ni(OH2 and Co(OH2 were subsequently used to synthesize LiCoO2, LiNiO2 and CoO, for use as cathodes in ion-Li batteries. The anodes and recycled materials were characterized by analytical techniques.

  3. Lower glutamic acid decarboxylase 65kD mRNA and protein levels in the prefrontal cortex in schizoaffective disorder but not schizophrenia

    Science.gov (United States)

    Glausier, JR; Kimoto, S; Fish, KN; Lewis, DA

    2014-01-01

    Background Altered GABA signaling in the prefrontal cortex (PFC) has been associated with cognitive dysfunction in schizophrenia and schizoaffective disorder. PFC levels of the GABA-synthesizing enzyme glutamic acid decarboxylase 67kD (GAD67) has been consistently reported to be lower in these disorders, but the status of the second GABA-synthesizing enzyme, GAD65, remains unclear. Methods GAD65 mRNA levels were quantified in PFC area 9 by quantitative polymerase chain reaction from 62 subjects with schizophrenia or schizoaffective disorder and 62 matched healthy comparison subjects. GAD65 relative protein levels were quantified in a subset of subject pairs by confocal immunofluorescence microscopy. Results Mean GAD65 mRNA levels were 13.6% lower in schizoaffective disorder subjects, but did not differ in schizophrenia subjects, relative to their matched healthy comparison subjects. In the subjects with schizoaffective disorder, mean GAD65 protein levels were 19.4% lower and were correlated with GAD65 mRNA levels. Lower GAD65 mRNA and protein measures within schizoaffective disorder subjects was not attributable to factors commonly comorbid with the diagnosis. Conclusions In concert with previous studies, these findings suggest that schizoaffective disorder is associated with lower levels of both GAD65 and GAD67 mRNA and protein in the PFC, whereas subjects with schizophrenia have lower mean levels of only GAD67 mRNA and protein. Because cognitive function is generally better preserved in subjects with schizoaffective disorder relative to subjects with schizophrenia, these findings may support an interpretation that GAD65 down-regulation provides a homeostatic response complementary to GAD67 down-regulation expression that serves to reduce inhibition in the face of lower PFC network activity. PMID:24993056

  4. Isolation, purification, and radiolabeling of a novel 120-kD surface protein on Blastomyces dermatitidis yeasts to detect antibody in infected patients

    Energy Technology Data Exchange (ETDEWEB)

    Klein, B.S.; Jones, J.M.

    1990-01-01

    No well-defined Blastomyces-specific antigens are currently available. We used sodium dodecyl sulfate-polyacrylamide gel electrophoresis and immunoblotting to identify immunologically active molecules in the cell wall of B. dermatitidis. A major immunoreactive 120-kD protein (WI-1) was present in all five strains studied and comprised 5% of the protein in the cell wall extract obtained after freezing and thawing yeast cells. WI-1 was recognized by serum from all 10 patients with blastomycosis but by none of those from 5 patients with histoplasmosis. It was purified by electroelution, radiolabeled with 125I, and incorporated into a radioimmunoassay (RIA) for serodiagnosis of blastomycosis. Antibody to WI-1 was detected in 58 (85%) of 68 patients with blastomycosis (geometric mean titer, 1:2,981), in two (3%) of 73 patients with histoplasmosis, coccidioidomycosis, sporotrichosis, or candidiasis (titers, 1:86 and 1:91) and in none of 44 healthy persons. WI-1 was shown to be a surface molecule abundant on B. dermatitidis yeasts that were indirectly stained with serum from a rabbit immunized with WI-1. Approximately 0.93 pg of WI-1 or 4.7 x 10(6) WI-1 molecules were found on the surface of an individual yeast using an antigen-inhibition RIA; none was found on Histoplasma capsulatum or Candida albicans yeasts. We conclude that WI-1 is a novel, immunologically active surface molecule on the invasive form of B. dermatitidis and that WI-1 can be used to reliably detect antibody and study the immunopathogenesis of blastomycosis.

  5. The value of adenosine deaminase, interferon-gamma, and interferon-gamma induced protein of 10kD in the diagnosis of tuberculous pleuritis

    Directory of Open Access Journals (Sweden)

    Ya-kun DONG

    2015-07-01

    Full Text Available Objective To explore the value of adenosine deaminase (ADA activity, interferon-gamma (IFN-γ and IFN-γ induced protein of 10kD (IP-10 levels in pleural effusion for the diagnosis of tuberculous pleuritis. Methods ADA activity, IFN-γ and IP-10 levels in pleural effusion were determined in sixty-three patients with tuberculous pleuritis and 50 patients with malignant pleural effusion. Results The mean levels of ADA, IFN-γ and IP-10 in the tuberculous pleural effusion were significantly higher than those in malignant pleural effusion (P<0.01. When 45U/L was regarded as cut off value for ADA, the sensitivity, specificity and diagnostic odds ratio in the diagnosis of tuberculous pleurisy were 71.4%, 94.0% and 39.17 respectively. When 138.5pg/ml was regarded as cut off value for IFN-γ in tuberculous pleural effusion, the sensitivity, specificity and diagnostic odds ratio were 93.7%, 82.0% and 67.19 respectively. When 9.21μg/ml was regarded as cut off value for IP-10 in tuberculous pleural effusion, the sensitivity, specificity and diagnostic odds ratio were 85.7%, 90.0% and 54.00 respectively. The combined determination of the three markers for the diagnosis of tuberculous pleurisy had a sensitivity of 95.2%, specificity of 96.0% and diagnostic odds ratio of 72.16. Conclusion The accuracy of diagnosis for tuberculous pleurisy can be improved by combined determination of ADA, IFN-γ and IP-10. DOI: 10.11855/j.issn.0577-7402.2015.06.07

  6. Re-treatment of previous non-responders and relapsers to interferon plus ribavirin with peginterferon alfa-2a (40KD), ribavirin ± amantadine in patients with chronic hepatitis C: randomized multicentre clinical trial.

    Science.gov (United States)

    Pessôa, Mario G; Cheinquer, Hugo; Almeida, Paulo R L; Silva, Giovanni F; Lima, Maria Patelli J S; Paraná, Raymundo; Lacerda, Marco A; Parise, Edison R; Pernambuco, José R B; Pedrosa, Suelene S; Teixeira, Rosângela; Sette, Hoel; Tatsch, Fernando

    2012-01-01

    A large number of patients with chronic hepatitis C have not been cured with interferon-based therapy. Therefore, we evaluated the efficacy of amantadine combined with the standard of care(pegylated interferon plus ribavirin) in patients who had not responded to or had relapsed after ≥ 24 weeks of treatment with conventional interferon plus ribavirin. Patients stratified by previous response (i.e., non-response or relapse) were randomized to 48 weeks of open-label treatment with peginterferon alfa-2a (40KD) 180 µg/week plus ribavirin 1,000/1,200 mg/day plus amantadine 200 mg/day (triple therapy), or the standard of care (peginterferon alfa-2a [40KD] plus ribavirin). The primary outcome was sustained virological response (SVR), defined as undetectable hepatitis C virus RNA in serum (interferon plus ribavirin achieve an SVR when re-treated with peginterferon alfa-2a (40KD) plus ribavirin. Amantadine does not enhance SVR rates in previously treated patients with chronic hepatitis C and cannot be recommended in this setting.

  7. Bir Kriz İletişimi Yönetimi Vaka Analizi: Kaybolan Malezya Havayolları MH370 Sefer Sayılı Uçağı

    OpenAIRE

    İnci ÇINARLI

    2014-01-01

    Kriz iletişimi yönetiminde kriz ile ilgili olguların tespit edilmesi büyük önem taşımaktadır. Bu olgular kriz çeşidinin sınıflandırılmasına ve dolayısıyla da etkili ‘kriz tepki stratejilerinin’ uygulanmasına olanak verir. Bu makalede, Malezya Havayollarının MH370 sefer sayılı uçağının kriz yönetim süreci bir vaka analizi olarak değerlendirilmiştir. Uçak, içindeki 227 yolcu ve 12 mürettebat ile 8 Mart 2014 tarihinde kaybolmuş ve çok-uluslu arama-kurtarma çalışmalarına rağmen sonuç elde edileme...

  8. Insights into gas-phase structural conformers of hydrated rubidium and cesium cations, M(+)(H2O)(n)Ar (M = Rb, Cs; n = 3-5), using infrared photodissociation spectroscopy.

    Science.gov (United States)

    Ke, Haochen; van der Linde, Christian; Lisy, James M

    2014-02-27

    Infrared photodissociation (IRPD) spectra of M(+)(H2O)nAr (M = Rb, Cs; n = 3-5) with simultaneous monitoring of [Ar] and [Ar+H2O] fragmentation channels are reported. The comparison between the spectral features in the two channels and corresponding energy analysis provide spectral assignments of the stable structural conformers and insight into the competition between ion-water electrostatic and water-water hydrogen bonding interactions. Results show that as the level of hydration increases, the water-water interaction exhibits the tendency to dominate over the ion-water interaction. Cyclic water tetramer and water pentamer substructures appear in Cs(+)(H2O)4Ar and Cs(+)(H2O)5Ar systems, respectively. However, cyclic water tetramer and pentamer structures were not observed for Rb(+)(H2O)4Ar and Rb(+)(H2O)5Ar systems, respectively, due to the stronger influence of the rubidium ion-water electrostatic interaction. The energy analysis, including the available internal energy and the IR photon energy, helped provide an experimental estimate of water binding energies.

  9. Uma contribuição ao ecodesign: metodologia para avaliação e seleção de células de baterias de NiMH, visando o seu reuso

    Directory of Open Access Journals (Sweden)

    Sandra Souza dos Santos

    2010-09-01

    Full Text Available A popularização de aparelhos eletrônicos portáteis e a produção cada vez mais crescente dos mesmos têm aumentado o uso de baterias recarregáveis. Estas, muitas vezes são descartadas antes mesmo do término de sua vida útil, gerando com isso, um grande desperdício de material, de recursos naturais e uma contaminação do meio ambiente. Neste sentido, o objetivo deste trabalho foi desenvolver uma metodologia de seleção e reuso de células de baterias de NiMH descartadas antes do final de seu ciclo de vida, ou seja, com potencial para utilização. Para isso, avaliou-se a capacidade e estimou-se o percentual dessas células que ainda estavam em boas condições operacionais quando as baterias eram descartadas. Os resultados mostraram que ao final do processo de seleção, uma considerável quantidade dessas células apresentou potencial de capacidade para reuso, sendo consideradas aprovadas para reuso aproximadamente 37% do total das células descartadas testadas. A metodologia apresentada neste trabalho mostrou que é possível estabelecer uma alternativa ambientalmente correta para diminuir a quantidade desse tipo de lixo eletrônico.

  10. Spin-State Effects on the Thermal Dihydrogen Release from Solid-State [MH(η2-H2)dppe2]+ (M = Fe, Ru, Os) Organometallic Complexes for Hydrogen Storage Applications

    Science.gov (United States)

    2015-01-01

    Mössbauer spectroscopy, experimental thermodynamic measurements, and computational studies were performed to investigate the properties of molecular hydrogen binding to the organometallic fragments [MHdppe2]+ (M = Fe, Ru, Os; dppe =1,2-bis(diphenylphosphino)ethane) to form the dihydrogen complex fragments [MH(η2-H2)dppe2]+. Mössbauer spectroscopy showed that the dehydrogenated complex [FeHdppe2]+ adopts a geometry consistent with the triplet spin state, transitioning to a singlet state complex upon addition of the dihydrogen molecule in a manner similar to the previously studied dinitrogen complexes. From simulations, this spin transition behavior was found to be responsible for the strong binding behavior experimentally observed in the iron complex. Spin-singlet to spin-singlet transitions were found to exhibit thermodynamics consistent with the 5d > 3d > 4d binding trend observed for other transition metal dihydrogen complexes. Finally, the method for distinguishing between dihydrogen and dihydride complexes based on partial quadrupole splittings observed in Mössbauer spectra was confirmed, providing a tool for further characterization of these unique species for Mössbauer active compounds. PMID:24803973

  11. Bir Kriz İletişimi Yönetimi Vaka Analizi: Kaybolan Malezya Havayolları MH370 Sefer Sayılı Uçağı

    Directory of Open Access Journals (Sweden)

    İnci ÇINARLI

    2014-12-01

    Full Text Available Kriz iletişimi yönetiminde kriz ile ilgili olguların tespit edilmesi büyük önem taşımaktadır. Bu olgular kriz çeşidinin sınıflandırılmasına ve dolayısıyla da etkili ‘kriz tepki stratejilerinin’ uygulanmasına olanak verir. Bu makalede, Malezya Havayollarının MH370 sefer sayılı uçağının kriz yönetim süreci bir vaka analizi olarak değerlendirilmiştir. Uçak, içindeki 227 yolcu ve 12 mürettebat ile 8 Mart 2014 tarihinde kaybolmuş ve çok-uluslu arama-kurtarma çalışmalarına rağmen sonuç elde edilememiştir. Bu amaçla, Timothy W. Coombs’un  ‘kriz yönetiminin üç evresi’ söz konusu vakanın kriz yönetimi sürecine uygulanmıştır. Bu bağlamda, söz konusu krizin yönetilmesinde kullanılan ‘kriz tepki stratejileri’ Coombs’un ‘Durumsal Kriz İletişimi Kuramı’ (SCCT dâhilinde değerlendirilmiştir. Ayrıca Malezya Havayollarının (ve en büyük hissedarı Malezya hükümetinin kriz iletişimi yönetimi uygulamaları ve araçları da analiz edilmiştir. Sonuç olarak, alışılagelenin çok üzerinde bir süre boyunca olgulara ulaşamamanın bir enformasyon vakumu oluşturarak spekülasyonları ve söylentileri içine çektiği ortaya konulmuştur.

  12. Safety and immunogenicity of a freeze-dried, Vero cell culture-derived, inactivated Japanese encephalitis vaccine (KD-287, ENCEVAC®) versus a mouse brain-derived inactivated Japanese encephalitis vaccine in children: a phase III, multicenter, double-blinded, randomized trial.

    Science.gov (United States)

    Yun, Ki Wook; Lee, Hoan Jong; Kang, Jin Han; Eun, Byung Wook; Kim, Yae-Jean; Kim, Kyung-Hyo; Kim, Nam Hee; Hong, Young Jin; Kim, Dong Ho; Kim, Hwang Min; Cha, Sung-Ho

    2015-01-08

    Although mouse brain-derived, inactivated Japanese encephalitis vaccines (JE-MBs) have been successfully used for a long time, potential rare neurological complications have prompted the development of a Vero cell culture-derived inactivated vaccine (JE-VC). In a phase III clinical study, we aimed to compare the safety and immunogenicity of a JE-VC, KD-287 with a JE-MB, JEV-GCC, in children. In this multicenter, double-blinded, randomized controlled trial, the study population consisted of 205 healthy Korean children aged 12-23 months. Each subject was subcutaneously vaccinated with either KD-287 or JEV-GCC twice at an interval of 2 weeks and then vaccinated once 12 months after the second vaccination. Neutralizing antibodies were measured by the plaque reduction neutralization test using the homologous and heterologous, as a post hoc analysis, challenge virus strains. The three-dose regimen of KD-287 showed a comparable safety profile with JEV-GCC except higher incidence of fever after the first dose (30.4% and 14.7%, respectively). Most of the fever was mild degree (61.3% and 66.7%, respectively). KD-287 fulfilled the non-inferiority criteria for seroconversion rate (SCR) and geometric mean titer (GMT) of the neutralizing antibody, which were the primary endpoints, at 4 weeks after the third vaccination (95% CI: -1.00, 3.10 for the SCR difference and 10.8, 17.6 for the GMT ratio). The SCRs of KD-287 were all 100% and the GMTs were higher in the KD-287 group than in the JEV-GCC group after the second vaccination and before and after the third vaccination (GMT ratio: 5.59, 20.13, and 13.79, respectively, p < 0.001 in all). GMTs were higher in the KD-287 group in the heterologous analysis also (GMT ratio: 4.05, 5.15, and 4.19, respectively, p < 0.001 in all). This study suggests that the KD-287, a JE-VC is as safe as and may be more effective than the licensed MB-derived vaccine. KD-287 could thus be useful as a second-generation vaccine and substitute

  13. Comparison of QSAR models based on combinations of genetic algorithm, stepwise multiple linear regression, and artificial neural network methods to predict Kd of some derivatives of aromatic sulfonamides as carbonic anhydrase II inhibitors.

    Science.gov (United States)

    Maleki, Afshin; Daraei, Hiua; Alaei, Loghman; Faraji, Aram

    2014-01-01

    Four stepwise multiple linear regressions (SMLR) and a genetic algorithm (GA) based multiple linear regressions (MLR), together with artificial neural network (ANN) models, were applied for quantitative structure-activity relationship (QSAR) modeling of dissociation constants (Kd) of 62 arylsulfonamide (ArSA) derivatives as human carbonic anhydrase II (HCA II) inhibitors. The best subsets of molecular descriptors were selected by SMLR and GA-MLR methods. These selected variables were used to generate MLR and ANN models. The predictability power of models was examined by an external test set and cross validation. In addition, some tests were done to examine other aspects of the models. The results show that for certain purposes GA-MLR is better than SMLR and for others, ANN overcomes MLR models.

  14. Absolute and relative nonlinear optical coefficients of KDP, KD(asterisk)P, BaB2O4, LiIO3, MgO:LiNbO3, and KTP measured by phase-matched second-harmonic generation

    Science.gov (United States)

    Eckardt, Robert C.; Byer, Robert L.; Masuda, Hisashi; Fan, Yuan Xuan

    1990-01-01

    Both absolute and relative nonlinear optical coefficients of six nonlinear materials measured by second-harmonic generation are discussed. A single-mode, injection-seeded, Q-switched Nd:YAG laser with spatially filtered output was used to generate the 1.064-micron fundamental radiation. The following results were obtained: d36(KDP) = 0.38 pm/V, d36(KD/asterisk/P) = 0.37 pm/V, (parallel)d22(BaB2O4)(parallel) = 2.2 pm/V, d31(LiIO3) = -4.1 pm/V, d31(5 percentMgO:MgO LiNbO3) = -4.7 pm/V, and d(eff)(KTP) = 3.2 pm/V. The accuracy of these measurements is estimated to be better than 10 percent.

  15. A fusion between domains of the human bone morphogenetic protein-2 and maize 27 kD gamma-zein accumulates to high levels in the endoplasmic reticulum without forming protein bodies in transgenic tobacco

    Directory of Open Access Journals (Sweden)

    Valentina eCeresoli

    2016-03-01

    Full Text Available Human Bone Morphogenetic Protein-2 (hBMP2 is an osteoinductive agent physiologically involved in bone remodelling processes. A commercialized recombinant hBMP2 produced in mammalian cell lines is available in different clinical applications where bone regeneration is needed, but widespread use has been hindered due to an unfavorable cost/effective ratio. Protein bodies are very large insoluble protein polymers that originate within the endoplasmic reticulum by prolamine accumulation during the cereal seed development. The N-terminal domain of the maize prolamin 27 kD -zein is able to promote protein body biogenesis when fused to other proteins. To produce high yield of recombinant hBMP2 active domain (ad in stably transformed tobacco plants we have fused it to the γ-zein domain. We show that this zein-hBMP2ad fusion is retained in the endoplasmic reticulum without forming insoluble protein bodies. The accumulation levels are above 1% of total soluble leaf proteins, indicating that it could be a rapid and suitable strategy to produce hBMP2ad at affordable costs.

  16. MERIS_L3m_KD

    Data.gov (United States)

    National Aeronautics and Space Administration — MERIS (Medium Resolution Imaging Spectrometer) is a programmable, medium-spectral resolution, imaging spectrometer operating in the solar reflective spectral range....

  17. MERIS_L3b_KD

    Data.gov (United States)

    National Aeronautics and Space Administration — MERIS (Medium Resolution Imaging Spectrometer) is a programmable, medium-spectral resolution, imaging spectrometer operating in the solar reflective spectral range....

  18. Vertical diffuse attenuation coefficient (Kd) based optical ...

    Indian Academy of Sciences (India)

    The optical classification of the different water types provides vital input for studies related to primary productivity, water clarity and determination of euphotic depth. Image data of the IRS- P3 MOS-B, for Path 90 of 27th February, 1998 was used for deriving vertical diffuse attenuation Coeffcient () and an optical ...

  19. Fast Inverse Distance Weighting-Based Spatiotemporal Interpolation: A Web-Based Application of Interpolating Daily Fine Particulate Matter PM2.5 in the Contiguous U.S. Using Parallel Programming and k-d Tree

    Directory of Open Access Journals (Sweden)

    Lixin Li

    2014-09-01

    Full Text Available Epidemiological studies have identified associations between mortality and changes in concentration of particulate matter. These studies have highlighted the public concerns about health effects of particulate air pollution. Modeling fine particulate matter PM2.5 exposure risk and monitoring day-to-day changes in PM2.5 concentration is a critical step for understanding the pollution problem and embarking on the necessary remedy. This research designs, implements and compares two inverse distance weighting (IDW-based spatiotemporal interpolation methods, in order to assess the trend of daily PM2.5 concentration for the contiguous United States over the year of 2009, at both the census block group level and county level. Traditionally, when handling spatiotemporal interpolation, researchers tend to treat space and time separately and reduce the spatiotemporal interpolation problems to a sequence of snapshots of spatial interpolations. In this paper, PM2.5 data interpolation is conducted in the continuous space-time domain by integrating space and time simultaneously, using the so-called extension approach. Time values are calculated with the help of a factor under the assumption that spatial and temporal dimensions are equally important when interpolating a continuous changing phenomenon in the space-time domain. Various IDW-based spatiotemporal interpolation methods with different parameter configurations are evaluated by cross-validation. In addition, this study explores computational issues (computer processing speed faced during implementation of spatiotemporal interpolation for huge data sets. Parallel programming techniques and an advanced data structure, named k-d tree, are adapted in this paper to address the computational challenges. Significant computational improvement has been achieved. Finally, a web-based spatiotemporal IDW-based interpolation application is designed and implemented where users can visualize and animate

  20. Fast inverse distance weighting-based spatiotemporal interpolation: a web-based application of interpolating daily fine particulate matter PM2:5 in the contiguous U.S. using parallel programming and k-d tree.

    Science.gov (United States)

    Li, Lixin; Losser, Travis; Yorke, Charles; Piltner, Reinhard

    2014-09-03

    Epidemiological studies have identified associations between mortality and changes in concentration of particulate matter. These studies have highlighted the public concerns about health effects of particulate air pollution. Modeling fine particulate matter PM2.5 exposure risk and monitoring day-to-day changes in PM2.5 concentration is a critical step for understanding the pollution problem and embarking on the necessary remedy. This research designs, implements and compares two inverse distance weighting (IDW)-based spatiotemporal interpolation methods, in order to assess the trend of daily PM2.5 concentration for the contiguous United States over the year of 2009, at both the census block group level and county level. Traditionally, when handling spatiotemporal interpolation, researchers tend to treat space and time separately and reduce the spatiotemporal interpolation problems to a sequence of snapshots of spatial interpolations. In this paper, PM2.5 data interpolation is conducted in the continuous space-time domain by integrating space and time simultaneously, using the so-called extension approach. Time values are calculated with the help of a factor under the assumption that spatial and temporal dimensions are equally important when interpolating a continuous changing phenomenon in the space-time domain. Various IDW-based spatiotemporal interpolation methods with different parameter configurations are evaluated by cross-validation. In addition, this study explores computational issues (computer processing speed) faced during implementation of spatiotemporal interpolation for huge data sets. Parallel programming techniques and an advanced data structure, named k-d tree, are adapted in this paper to address the computational challenges. Significant computational improvement has been achieved. Finally, a web-based spatiotemporal IDW-based interpolation application is designed and implemented where users can visualize and animate spatiotemporal interpolation

  1. Fast Inverse Distance Weighting-Based Spatiotemporal Interpolation: A Web-Based Application of Interpolating Daily Fine Particulate Matter PM2.5 in the Contiguous U.S. Using Parallel Programming and k-d Tree

    Science.gov (United States)

    Li, Lixin; Losser, Travis; Yorke, Charles; Piltner, Reinhard

    2014-01-01

    Epidemiological studies have identified associations between mortality and changes in concentration of particulate matter. These studies have highlighted the public concerns about health effects of particulate air pollution. Modeling fine particulate matter PM2.5 exposure risk and monitoring day-to-day changes in PM2.5 concentration is a critical step for understanding the pollution problem and embarking on the necessary remedy. This research designs, implements and compares two inverse distance weighting (IDW)-based spatiotemporal interpolation methods, in order to assess the trend of daily PM2.5 concentration for the contiguous United States over the year of 2009, at both the census block group level and county level. Traditionally, when handling spatiotemporal interpolation, researchers tend to treat space and time separately and reduce the spatiotemporal interpolation problems to a sequence of snapshots of spatial interpolations. In this paper, PM2.5 data interpolation is conducted in the continuous space-time domain by integrating space and time simultaneously, using the so-called extension approach. Time values are calculated with the help of a factor under the assumption that spatial and temporal dimensions are equally important when interpolating a continuous changing phenomenon in the space-time domain. Various IDW-based spatiotemporal interpolation methods with different parameter configurations are evaluated by cross-validation. In addition, this study explores computational issues (computer processing speed) faced during implementation of spatiotemporal interpolation for huge data sets. Parallel programming techniques and an advanced data structure, named k-d tree, are adapted in this paper to address the computational challenges. Significant computational improvement has been achieved. Finally, a web-based spatiotemporal IDW-based interpolation application is designed and implemented where users can visualize and animate spatiotemporal interpolation

  2. A secret hidden and revealed in the threads: Jg 16:4-22

    Directory of Open Access Journals (Sweden)

    Paulo Jackson Nóbrega de Sousa

    2015-07-01

    Full Text Available The stories from the Samson cycle are very well known in the popular imagination.  Utilizing Narrative Analysis in dialogue with the Literary-Historical Method, this article seeks to explain exegetically the story present in Judges 16:4-22.  A dynamic and promising relationship between content and form, aesthetic beauty and theological message is established by a fine literary threading.  The study begins with a morphosyntactic verbal analysis of the narrative and direct speech, studying, in turn, the narrative chain, the notion of time and the repetitive scheme of “3+1” in order to define the plot and understand the action of the characters in each scene.  In addition to the threads that are interwoven, the pericope invites us to contemplate the beautiful and unified tissue.  Delilah, paid by the Philistines, intends to discover the secret of Samson’s force with the objective to subdue and humiliate him.  After three failed attempts, she finally accomplishes her purpose.  The secret is hidden and revealed in the “threads” that become a symbol of human life and, in a particular way, of the history of Israel that fails to recognize the origin of its strength, that is to say, God.

  3. DROUGHT FEEDING OF SHEEP J.G. Cloete z 20r

    African Journals Online (AJOL)

    Application of correct and efficient drought-feeding pro- cedures consequently warrants top priority especially wtpn ... to apply conservation farming, less than I O/' of farmers apply the recommended veld management ..... Briel, 1961) and fluorine (Peirce, 1954) have provided valuable information on the influence of salinity of ...

  4. Menyoal Kembali Teori Evolusi Agama J.G. Frazer dalam Keberagamaan Masyarakat Jawa

    Directory of Open Access Journals (Sweden)

    Muhammad Rikza Muqtada

    2016-06-01

    Full Text Available Religion is seen as the result of philosophers’ thinking production which has a tendency to solve the riddle of life and to spread their ideas and their thoughts to others. Frazer is one pushed for discovering when the religion began to exist. The conclusion is that the human belief system, in accordance with a level of reasoning ability, evolves from magical belief, than religous belief, and ends on science. Nevertheless, when it is compared to the religious phenomenon in Indonesia, especially in Java, Frazer’s theory is not entirely true and debatable. The religious system in Java exactly does not have evolution as interpreted in Frazer’s theory. With its elasticity, genuine Javanese belief – dynamism and animism – only underwent assimilation with foreign cultures that came later like Islam and Christian, and including Western culture. In the context of Javanese religiosity, those three beliefs system as intended by Frazer, take place integrally and parallel in modern Javanese culture.

  5. Sustentación master coach. Coach ejecutivo - J.G.

    OpenAIRE

    Tapia De Souza Ferreyra, Carlos

    2016-01-01

    El presente documento (20) contiene todo el desarrollo y actividades realizadas durante la práctica de coaching ejecutivo efectuadas a un gerente general de una transnacional cuya sede principal es Bogotá – Colombia. El rubro de negocio es la comercialización de productos para la agricultura e insumos químicos para actividades extractivas. (14) Tienen presencia en varios países de habla hispana. La práctica del coaching fue realizada en la localidad de Lima en 10 sesiones de 1.5 horas cada un...

  6. A randomized, open-label clinical study of combined pegylated interferon Alfa-2a (40KD) and entecavir treatment for hepatitis B "e" antigen-positive chronic hepatitis B.

    Science.gov (United States)

    Xie, Qing; Zhou, Huijuan; Bai, Xuefan; Wu, Shuhuan; Chen, Jian-Jie; Sheng, Jifang; Xie, Yao; Chen, Chengwei; Chan, Henry Lik-Yuen; Zhao, Mianzhi

    2014-12-15

    Treatment with pegylated interferon (peg-IFN) alfa-2a (40KD) results in hepatitis B "e" antigen (HBeAg) seroconversion 6 months after treatment in up to 36% of HBeAg-positive chronic hepatitis B patients. This study explored the efficacy of a novel combination of peg-IFN alfa-2a and entecavir (ETV), a potent nucleoside analogue. In total, 218 treatment-naive Chinese HBeAg-positive patients were randomized to peg-IFN alfa-2a (180 µg/week) for 48 weeks, either as monotherapy (n = 72), or with 24 weeks of ETV (0.5 mg/daily) added at week 13 (ETV add-on, n = 73), or pretreatment with a 24-week course of ETV, starting peg-IFN alfa-2a at week 21 (ETV pretreatment, n = 73). The primary endpoint was reduction in quantitative HBeAg from baseline to 24 weeks posttreatment. Significant reductions in HBeAg from baseline were achieved in all treatment groups 24 weeks posttreatment; reductions were comparable across treatment arms (shown as log10 Paul Ehrlich international units [PEIU]/mL): monotherapy: -1.4 (SD, 1.8); ETV add-on: -1.6 (SD, 1.8); ETV pretreatment: -1.3 (SD, 1.7). Rates of HBeAg seroconversion were similar across treatment groups posttreatment (monotherapy: 22 [31%]; ETV add-on: 18 [25%]; ETV pretreatment: 19 [26%]). Significantly greater reductions of hepatitis B virus DNA were achieved with ETV add-on while on treatment, but were not sustained posttreatment. Safety profiles were comparable between treatment groups; adverse events were experienced by 62 (86%) monotherapy, 65 (89%) ETV add-on, and 58 (81%) ETV pretreatment patients. Neither ETV add-on nor ETV pretreatment demonstrated superiority compared with 48 weeks of peg-IFN alfa-2a monotherapy. The optimal treatment strategy using nucleos(t)ide analogues and peg-IFN alfa-2a remains to be determined. Clinical Trials Registration. NCT00614471. © The Author 2014. Published by Oxford University Press on behalf of the Infectious Diseases Society of America. All rights reserved. For Permissions, please e

  7. Acute renal failure in four Comrades Marathon runners ingesting the ...

    African Journals Online (AJOL)

    Ellis C, Cuthill J, Hew-Butler T, George SM, Rosner MH. Exercise-associated hyponatremia with rhabdomyolysis during endurance exercise. Phys Sportsmed 2009;37:126-132. 16. Verbalis JG, Goldsmith SR, Greenberg A, Schrier RW, Sterns RH. Hyponatremia treatment guidelines. 2007: expert panel recommendations.

  8. 24.4 news 918-9 MH IF new

    Indian Academy of Sciences (India)

    x

    Physicists in Italy claimed last week to have seen particles of dark matter. Their announcement has got their rivals riled and raises questions about what constitutes evidence of a new particle. Rita Bernabei of the National Institute of. Nuclear Physics in Rome presented her team's latest results on 16 April at an international.

  9. Iron-substituted AB5-type MH electrode

    Indian Academy of Sciences (India)

    Metal hydride cell; iron substitution; electrochemical properties; structural characterization; pulverization characteristics. ... To study their electrochemical properties viameasurements of discharge capacity, activation process, rate capability and cyclic stability, electrodes are fabricated using as-synthesized and annealed ...

  10. Drift simulation of MH370 debris using superensemble techniques

    OpenAIRE

    Jansen, Eric; Coppini, Giovanni; Pinardi, Nadia

    2016-01-01

    On 7 March 2014 (UTC), Malaysia Airlines flight 370 vanished without a trace. The aircraft is believed to have crashed in the southern Indian Ocean, but despite extensive search operations the location of the wreckage is still unknown. The first tangible evidence of the accident was discovered almost 17 months after the disappearance. On 29 July 2015, a small piece of the right wing of the aircraft was found washed up on the island of Réunion, approximately 4000 km from the ...

  11. Drift simulation of MH370 debris using superensemble techniques

    Science.gov (United States)

    Jansen, Eric; Coppini, Giovanni; Pinardi, Nadia

    2016-07-01

    On 7 March 2014 (UTC), Malaysia Airlines flight 370 vanished without a trace. The aircraft is believed to have crashed in the southern Indian Ocean, but despite extensive search operations the location of the wreckage is still unknown. The first tangible evidence of the accident was discovered almost 17 months after the disappearance. On 29 July 2015, a small piece of the right wing of the aircraft was found washed up on the island of Réunion, approximately 4000 km from the assumed crash site. Since then a number of other parts have been found in Mozambique, South Africa and on Rodrigues Island. This paper presents a numerical simulation using high-resolution oceanographic and meteorological data to predict the movement of floating debris from the accident. Multiple model realisations are used with different starting locations and wind drag parameters. The model realisations are combined into a superensemble, adjusting the model weights to best represent the discovered debris. The superensemble is then used to predict the distribution of marine debris at various moments in time. This approach can be easily generalised to other drift simulations where observations are available to constrain unknown input parameters. The distribution at the time of the accident shows that the discovered debris most likely originated from the wide search area between 28 and 35° S. This partially overlaps with the current underwater search area, but extends further towards the north. Results at later times show that the most probable locations to discover washed-up debris are along the African east coast, especially in the area around Madagascar. The debris remaining at sea in 2016 is spread out over a wide area and its distribution changes only slowly.

  12. 1082-1084 Books and Arts MH AB.indd

    Indian Academy of Sciences (India)

    Gribbin

    2009-08-27

    Aug 27, 2009 ... See http://tinyurl.com/liladaug. Bridging the gender gap in Indian science. Attending a science summer school encouraged geneticist Sudha Bhattacharya to become a researcher. R. RAMAS. W. AM. Y. A set of biographies reveals the trials and triumphs of India's women researchers, says Asha Gopinathan.

  13. 15.9 editorials 295-296 MH

    Indian Academy of Sciences (India)

    Development, currently a branch of the UN Department of Eco- nomic and Social Affairs. Secretary-General Kofi Annan then needs to appoint a heavyweight successor to Töpfer who can provide. UNEP with energetic and determined leadership. That person should continue the policy of partnership with industry, while care-.

  14. Corroborative evidences of TV γ -scaling of the α-relaxation originating from the primitive relaxation/JG β relaxation

    Science.gov (United States)

    Ngai, K. L.; Paluch, M.

    2017-12-01

    Successful thermodynamic scaling of the structural alpha-relaxation time or transport coefficients of glass-forming liquids determined at various temperatures T and pressures P means the data conform to a single function of the product variable TVgamma, where V is the specific volume and gamma is a material specific constant. In the past two decades we have witnessed successful TVgamma-scaling in many molecular, polymeric, and even metallic glass-formers, and gamma is related to the slope of the repulsive part of the intermolecular potential. The advances made indicate TVgamma-scaling is an important aspect of the dynamic and thermodynamic properties of glass-formers. In this paper we show the origin of TVgamma-scaling is not from the structural alpha-relaxation time. Instead it comes from its precursor, the Johari-Goldstein beta-relaxation or the primitive relaxation of the Coupling Model and their relaxation times or tau_0 respectively. It is remarkable that all relaxation times are functions of TVgamma with the same gama, as well as the fractional exponent of the Kohlrausch correlation function of the structural alpha-relaxation. We arrive at this conclusion convincingly based on corroborative evidences from a number of experiments and molecular dynamics simulations performed on a wide variety of glass-formers and in conjunction with consistency with the predictions of the Coupling Model.

  15. J.G. Fichte, Prova dell’illegittimità della ristampa dei libri. Un ragionamento e una parabola

    Directory of Open Access Journals (Sweden)

    Maria Chiara Pievatolo

    2012-07-01

    Full Text Available La difficoltà che si trova a dimostrare una proprietà durevole dello scrittore sul suo libro è derivata dal fatto che non disponiamo di nulla di simile e quel che le sembra in qualche misura simile, ne differisce ancora parecchio sotto molteplici aspetti. Proprio da ciò dipende che la nostra dimostrazione abbia necessariamente un aspetto un po’ cavilloso; cercheremo, tuttavia, di renderla il più possibile chiara. Ma il lettore non deve essere indotto al sospetto, perché si potrà molto facilmente chiarirla e sostanziarla in concreto. – C’è infatti in circolazione una gran quantità di massime su questo oggetto, assunte da ogni benpensante poco informato sulla cosa e non interessato a contraddirle che giudica così il comportamento altrui in questo tipo di cose e orienta in conformità anche il proprio. Tutte queste massime si possono ricondurre facilmente e naturalmente alla nostra proposizione assunta come principio, tanto che questa circostanza è quasi la sua prova, e sarà perciò chiaro che essa è l’assioma alla base di tutti i nostri giudizi su questo oggetto, per quanto oscuri e non sviluppati.

  16. Network analysis in marine ecology. Ed. by F. Wulff, J.G. Field and K.H. Mann

    Digital Repository Service at National Institute of Oceanography (India)

    Dalal, S.G.

    stream_size 2 stream_content_type text/plain stream_name Indian_J_Mar_Sci_19_303.pdf.txt stream_source_info Indian_J_Mar_Sci_19_303.pdf.txt Content-Encoding ISO-8859-1 Content-Type text/plain; charset=ISO-8859-1 ...

  17. CZCS_L3b_SNWI_KD490

    Data.gov (United States)

    National Aeronautics and Space Administration — The Coastal Zone Color Scanner Experiment (CZCS) was the first instrument devoted to the measurement of ocean color and flown on a spacecraft. Although other...

  18. CZCS_L3b_SNAU_KD490

    Data.gov (United States)

    National Aeronautics and Space Administration — The Coastal Zone Color Scanner Experiment (CZCS) was the first instrument devoted to the measurement of ocean color and flown on a spacecraft. Although other...

  19. Generalized solutions to the gKdV equation

    Directory of Open Access Journals (Sweden)

    Maurilio Marcio Melo

    2010-08-01

    Full Text Available In this article we study the Cauchy problem in $mathcal{G}_2((0,Times mathbb{R}$ (the algebra of generalized functions, in the sense of Colombeau for the generalized Korteweg-de Vries equation, with initial condition $varphi in mathcal{G}_2(mathbb{R}$, which contains $H^s(mathbb{R}$, for $sin mathbb{R}$.

  20. VARIABILITY OF KD VALUES IN CEMENTITIOUS MATERIALS AND SEDIMENTS

    Energy Technology Data Exchange (ETDEWEB)

    Almond, P.; Kaplan, D.; Shine, E.

    2012-02-02

    Measured distribution coefficients (K{sub d} values) for environmental contaminants provide input data for performance assessments (PA) that evaluate physical and chemical phenomena for release of radionuclides from wasteforms, degradation of engineered components and subsequent transport of radionuclides through environmental media. Research efforts at SRNL to study the effects of formulation and curing variability on the physiochemical properties of the saltstone wasteform produced at the Saltstone Disposal Facility (SDF) are ongoing and provide information for the PA and Saltstone Operations. Furthermore, the range and distribution of plutonium K{sub d} values in soils is not known. Knowledge of these parameters is needed to provide guidance for stochastic modeling in the PA. Under the current SRS liquid waste processing system, supernate from F & H Tank Farm tanks is processed to remove actinides and fission products, resulting in a low-curie Decontaminated Salt Solution (DSS). At the Saltstone Production Facility (SPF), DSS is mixed with premix, comprised of blast furnace slag (BFS), Class F fly ash (FA), and portland cement (OPC) to form a grout mixture. The fresh grout is subsequently placed in SDF vaults where it cures through hydration reactions to produce saltstone, a hardened monolithic waste form. Variation in saltstone composition and cure conditions of grout can affect the saltstone's physiochemical properties. Variations in properties may originate from variables in DSS, premix, and water to premix ratio, grout mixing, placing, and curing conditions including time and temperature (Harbour et al. 2007; Harbour et al. 2009). There are no previous studies reported in the literature regarding the range and distribution of K{sub d} values in cementitious materials. Presently, the Savannah River Site (SRS) estimate ranges and distributions of K{sub d} values based on measurements of K{sub d} values made in sandy SRS sediments (Kaplan 2010). The actual cementitious material K{sub d} values and solubility values differ from the sandy sediments. The K{sub d} value range and distribution currently used in the PA are estimated to range between 0.25*K{sub d} and 1.75*K{sub d}, where the minimum and maximum values of the ranges reflect the 95% confidence level for the mean K{sub d} value (Kaplan 2010). The objective of the research with cementitious materials was to measure the range and distribution of a monovalent (Cs) and I{sup -} (anion), divalent (Sr), and trivalent (Eu) ions for a variety of laboratory-prepared saltstone surrogate samples to establish a K{sub d} range other than that which is presently used in the PA. It has been observed in laboratory samples that cure temperature profiles can affect properties such as heat of hydration, permeability, porosity, compressive strength, and set time (Harbour et al. 2009). The intent was to identify a range and distribution that could be used by stochastic modelers for the PA. Furthermore, the intent was to replace the arbitrarily selected distributions based on geological sandy sediments and to base it on actual cementitious materials. The scope of this study did not include understanding saltstone sorption mechanisms responsible for increasing or decreasing sorption. Similar to the work with cementitious materials, the purpose of the Pu sediment K{sub d} dataset was not to attempt to understand through statistics how to better understand Pu sorption to sediments or to lower Pu K{sub d} variance. The sediment Pu K{sub d} data is included in this study because it is a key risk driver for the PAs on the SRS, and there is presently no direct studies of Pu variability in SRS soils. Instead the distribution of Pu sediment K{sub d} values was assumed to be similar to other cations, as presented by Kaplan (2010).

  1. Creating, Searching, and Deleting KD Trees Using C++

    Science.gov (United States)

    2014-09-01

    MD): Army Research Laboratory (US); August 2013. Report No.: ARL-TN-559. 4. Vogel, H. A better way to construct the sunflower head. Mathematical...originator. Army Research Laboratory Aberdeen Proving Ground, MD 21005-5066 ARL-TN-0629 September 2014 Creating, Searching, and...5d. PROJECT NUMBER AH80 5e. TASK NUMBER 5f. WORK UNIT NUMBER 7. PERFORMING ORGANIZATION NAME(S) AND ADDRESS(ES) US Army Research Laboratory

  2. OCTS_L3b_SNSU_KD490

    Data.gov (United States)

    National Aeronautics and Space Administration — On August 17, 1996, the Japanese Space Agency (NASDA - National Space Development Agency) launched the Advanced Earth Observing Satellite (ADEOS). ADEOS was in a...

  3. On complexly coupled modified KdV equations

    Indian Academy of Sciences (India)

    structures and examined how the alternative Lagrangian descriptions of the system affected the bi-Hamiltonian structure. Acknowledgements. The author is deeply indebted to Prof. B Talukdar for drawing interest on the subject and for constructive discussions. The author would like to acknowledge the UGC, Government of ...

  4. OCTS_L3b_MO_KD490

    Data.gov (United States)

    National Aeronautics and Space Administration — On August 17, 1996, the Japanese Space Agency (NASDA - National Space Development Agency) launched the Advanced Earth Observing Satellite (ADEOS). ADEOS was in a...

  5. OCTS_L3b_YR_KD490

    Data.gov (United States)

    National Aeronautics and Space Administration — On August 17, 1996, the Japanese Space Agency (NASDA - National Space Development Agency) launched the Advanced Earth Observing Satellite (ADEOS). ADEOS was in a...

  6. MODISA_L3b_SCSP_KD490

    Data.gov (United States)

    National Aeronautics and Space Administration — MODIS (or Moderate Resolution Imaging Spectroradiometer) is a key instrument aboard the Terra (EOS AM) and Aqua (EOS PM) satellites. Terra's orbit around the Earth...

  7. MODISA_L3b_R32_KD490

    Data.gov (United States)

    National Aeronautics and Space Administration — MODIS (or Moderate Resolution Imaging Spectroradiometer) is a key instrument aboard the Terra (EOS AM) and Aqua (EOS PM) satellites. Terra's orbit around the Earth...

  8. On Fusing Recursive Traversals of K-d Trees

    Energy Technology Data Exchange (ETDEWEB)

    Rajbhandari, Samyam; Kim, Jinsung; Krishnamoorthy, Sriram; Pouchet, Louis-Noel; Rastello, Fabrice; Harrison, Robert J.; Sadayappan, Ponnuswamy

    2016-03-17

    Loop fusion is a key program transformation for data locality optimization that is implemented in production compilers. But optimizing compilers currently cannot exploit fusion opportunities across a set of recursive tree traversal computations with producer-consumer relationships. In this paper, we develop a compile-time approach to dependence characterization and program transformation to enable fusion across recursively specified traversals over k-ary trees. We present the FuseT source-to-source code transformation framework to automatically generate fused composite recursive operators from an input program containing a sequence of primitive recursive operators. We use our framework to implement fused operators for MADNESS, Multiresolution Adaptive Numerical Environment for Scientific Simulation. We show that locality optimization through fusion can offer more than an order of magnitude performance improvement.

  9. OCTS_L3b_SNAU_KD490

    Data.gov (United States)

    National Aeronautics and Space Administration — On August 17, 1996, the Japanese Space Agency (NASDA - National Space Development Agency) launched the Advanced Earth Observing Satellite (ADEOS). ADEOS was in a...

  10. K.D. USHINSKY THE FORMATION OF ELEMENTARY SCHOOL STUDENTS

    Directory of Open Access Journals (Sweden)

    З. В. Видякова

    2014-04-01

    Full Text Available The article deals with the system of primary education developed by K. Ushinsky. The essence of this system  is the formation of the Russian character, the moral education of the student's personality,  the formation of the original foundations of knowledges and development of children's abilities to self-intelligent life and activities.The system of primary education developed by K. Ushinsky includes principles (raising a training, nationality, scientific, availability, methods (exercises, self study, repetition, instructional books ("Mother Tongue", "Children's World" and instruction manuals for their use in the educational process.Purchase on Elibrary.ru > Buy now

  11. Numerical Simulation of the Perturbed KdVB Equation

    Directory of Open Access Journals (Sweden)

    Bogdanov Alexander

    2016-01-01

    Full Text Available The solution of nonintegrable nonlinear equations is very diffcult even numerically and practically impossible by standard analytical techniques. New view, offered by heterogeneous computational systems, gives new possibilities, but also need novel approaches for numerical realization of pertinent algorithms. We give some examples of such analysis on the base of nonlinear wave’s evolution study in multiphase media with chemical reaction.

  12. Coupled KdV equations of Hirota-Satsuma type

    CERN Document Server

    Sakovich, S Yu

    1999-01-01

    It is shown that the system of two coupled Korteweg - de Vries equations passes the Painleve test for integrability in nine distinct cases of its coefficients. The integrability of eight cases is verified by direct construction of Lax pairs, whereas for one case it remains unknown.

  13. MODIST_L3b_SNSP_KD490

    Data.gov (United States)

    National Aeronautics and Space Administration — MODIS (or Moderate Resolution Imaging Spectroradiometer) is a key instrument aboard the Terra (EOS AM) and Aqua (EOS PM) satellites. Terra's orbit around the Earth...

  14. MODISA_L3b_YR_KD490

    Data.gov (United States)

    National Aeronautics and Space Administration — MODIS (or Moderate Resolution Imaging Spectroradiometer) is a key instrument aboard the Terra (EOS AM) and Aqua (EOS PM) satellites. Terra's orbit around the Earth...

  15. MODISA_L3b_DAY_KD490

    Data.gov (United States)

    National Aeronautics and Space Administration — MODIS (or Moderate Resolution Imaging Spectroradiometer) is a key instrument aboard the Terra (EOS AM) and Aqua (EOS PM) satellites. Terra's orbit around the Earth...

  16. Cloning, expression and purification of 10 kd culture filtrared protein ...

    African Journals Online (AJOL)

    Recombinant CFP-10 was purified from the soluble supernatant by metal affinity chromatography. SDS-PAGE analysis was performed to confirm expression of CFP-10 as 28 kDa fusion protein. In this study, we cloned, expressed and purified sufficient amounts of CFP-10 that could be usable in sero-diagnostic tests in future ...

  17. Cooperative assembly of Co-Smad4 MH1 with R-Smad1/3 MH1 on DNA: a molecular dynamics simulation study.

    Directory of Open Access Journals (Sweden)

    Guihong Wang

    Full Text Available BACKGROUND: Smads, the homologs of Sma and MAD proteins, play a key role in gene expression regulation in the transforming growth factor-β (TGF-β signaling pathway. Recent experimental studies have revealed that Smad4/R-Smad heterodimers bound on DNA are energetically more favorable than homodimeric R-Smad/R-Smad complexes bound on DNA, which indicates that Smad4 might act as binding vehicle to cooperatively assemble with activated R-Smads on DNA in the nucleus. However, the details of interaction mechanism for cooperative recruitment of Smad4 protein to R-Smad proteins on DNA, and allosteric communication between the Smad4-DNA and R-Smad-DNA interfaces via DNA mediating are not yet clear so far. METHODOLOGY: In the present work, we have constructed a series of Smadn+DNA+Smadn (n = 1, 3, 4 models and carried out molecular dynamics simulations, free energy calculations and DNA dynamics analysis for them to study the interaction properties of Smadn (n = 1, 3, 4 with DNA molecule. RESULTS: The results revealed that the binding of Smad4 protein to DNA molecule facilitates energetically the formation of the heteromeric Smad4+DNA+Smad1/3 complex by increasing the affinity of Smad1/3 with DNA molecule. Further investigations through the residue/base motion correlation and DNA dynamics analyses predicted that the binding of Smad4 protein to DNA molecule in the heteromeric Smad4+DNA+Smad1/3 model induces an allosteric communication from the Smad4-DNA interface to Smad1/Smad3-DNA interface via DNA base-pair helical motions, surface conformation changes and new hydrogen bond formations. The present work theoretically explains the mechanism of cooperative recruitment of Smad4 protein to Smad1/3 protein via DNA-mediated indirect readout mode in the nucleus.

  18. «Quand’anche l’errore sia stato smascherato…». La genesi estetica della filosofia della storia in J.G. Herder

    Directory of Open Access Journals (Sweden)

    Pietro Conte

    2012-05-01

    Full Text Available Adopting a morphological paradigm based on the equidistance of any art form from the concept of beauty, Herder explicitly subverts normative aesthetics and its claim to impose an everlasting canon and to measure all cultural products by the very same yardstick. Focusing on Herder’s early writings about ancient sculpture, poetry and mythology, I point out how they will later influence his philosophy of history, as it developed in works such as This too a Philosophy of History for the Formation of Humanity and Ideas for the Philosophy of History of Humanity.

  19. Polysaccharide-mediated green synthesis of silver nanoparticles from Sargassum siliquosum J.G. Agardh: Assessment of toxicity and hepatoprotective activity

    Directory of Open Access Journals (Sweden)

    Ross D. Vasquez

    2016-01-01

    Full Text Available The current investigation aimed to determine the toxicity and hepatoprotective potential of silver nanoparticles (AgNPs synthesized rapidly using sulfated polysaccharide extract from Sargassum siliquosum, a brown alga. The nanoparticles were characterized by UV–visible spectroscopy (UV–vis, scanning electron microscopy (SEM, fourier transform infra-red spectroscopy (FTIR, energy dispersive X-ray (EDX alongside zeta potential measurement. SPR indicated prominent peaks at 420–460 nm. SEM and DLS showed that biosynthesized AgNPs were in the size range of 20–480 nm and 19.5±6 nm to 471.7±189.4 nm respectively. EDX spectrum indicated strong signal for AgNPs. Zeta potential was −47.4±5.32 to −50±3.49 mV indicating stable AgNPs. AgNPs up to 2000 mg/kg BW did not cause mortality to rats but caused minimal elevation of serum creatinine and blood urea nitrogen. Low dose was effective in revival of liver enzyme parameters to near normal in all intoxicated groups indicating the curing effects on paracetamol induced liver injury.

  20. Framing crisis response messages on Facebook: a second level agenda analysis of MH370

    OpenAIRE

    Abang Ahmad Dayang Aizza Maisha; Mohamad Ashari Noratikah; Samani Mus Chairil

    2017-01-01

    A crisis can certainly bring great threats to an organisation. In time of crisis, what the organisation says and does may impose significant effect on the organisation’s effort to survive its reputational damages. Although crisis responses are considered a common topic, this rapidly growing field of research is however vital to be critically explored. In light of Situational Crisis Communication Theory (SCCT) [1] and the Second-level Agenda Setting approach [2], this study seeks to analyse th...

  1. Advanced Rapid Imaging & Analysis for Monitoring Hazards (ARIA-MH) Project

    Data.gov (United States)

    National Aeronautics and Space Administration — Develop a service-oriented hazard/disaster monitoring data system enabling both science and decision-support communities to monitor ground motion in areas of...

  2. Proton-conducting solid acid electrolytes based upon MH(PO3H)

    NARCIS (Netherlands)

    Zhou, W.

    2011-01-01

    Solid acids, such as CsHSO4 and CsH2PO4, are a novel class of anhydrous proton-conducting compounds that can be used as electrolyte in H2/O2 and direct methanol fuel cells. The disordering of the hydrogen-bonded network above the so-called superprotonic phase transition results in an increase of the

  3. Major histocompatibility (MH) polymorphism of common carp : link with disease resistance

    NARCIS (Netherlands)

    Rakus, K.L.

    2008-01-01

    The impact of diseases caused by a wide range of pathogens (viruses, bacteria and parasites) is the most important problem in aquaculture of common carp (Cyprinus carpio L.). Genetic selection aimed at obtaining population of more resistant common carp is potential and sustainable approach to

  4. Interactions between metal cations with H 2 in the M-H 2 complexes ...

    Indian Academy of Sciences (India)

    Interactions between metal cations with H2 in the M+- H2 complexes: Performance of DFT and DFT-D methods ... Graduate School of Information Science, Nagoya University, Chukusa-ku, Nagoya 464-8601, Aichi, Japan; Department of Spectroscopy, Indian Association for the Cultivation of Science, Jadavpur, Kolkata 700 ...

  5. Optimally Scheduling Distribution of the MH-60S Helicopter and Pilots to Combat Support (HC) Squadrons

    National Research Council Canada - National Science Library

    Culver, Cory

    2002-01-01

    ... (Optimal Transition HC Allocation Model) that minimizes lost flying days. OTHCAM takes into account variable training durations, travel times and tour lengths as well as manpower and aircraft constraints...

  6. A nonstandard numerical method for the modified KdV equation

    Indian Academy of Sciences (India)

    Author Affiliations. AYHAN AYDIN1 CANAN KOROGLU2. Department of Mathematics, Atilim University, Ankara 06836, Turkey; Department of Mathematics, Hacettepe University, Beytepe, Ankara 06800, Turkey ...

  7. MODIST_L3m_SNSP_KD490_9km

    Data.gov (United States)

    National Aeronautics and Space Administration — MODIS (or Moderate Resolution Imaging Spectroradiometer) is a key instrument aboard the Terra (EOS AM) and Aqua (EOS PM) satellites. Terra's orbit around the Earth...

  8. MODIST_L3m_CU_KD490_9km

    Data.gov (United States)

    National Aeronautics and Space Administration — MODIS (or Moderate Resolution Imaging Spectroradiometer) is a key instrument aboard the Terra (EOS AM) and Aqua (EOS PM) satellites. Terra's orbit around the Earth...

  9. SeaWiFS_L3b_SNSU_KD490

    Data.gov (United States)

    National Aeronautics and Space Administration — The SeaWiFS instrument was launched by Orbital Sciences Corporation on the OrbView-2 (a.k.a. SeaStar) satellite in August 1997, and collected data from September...

  10. MODISA_L3m_SCSU_KD490_4km

    Data.gov (United States)

    National Aeronautics and Space Administration — MODIS (or Moderate Resolution Imaging Spectroradiometer) is a key instrument aboard the Terra (EOS AM) and Aqua (EOS PM) satellites. Terra's orbit around the Earth...

  11. MODIST_L3m_MO_KD490_9km

    Data.gov (United States)

    National Aeronautics and Space Administration — MODIS (or Moderate Resolution Imaging Spectroradiometer) is a key instrument aboard the Terra (EOS AM) and Aqua (EOS PM) satellites. Terra's orbit around the Earth...

  12. MODISA_L3m_MC_KD490_9km

    Data.gov (United States)

    National Aeronautics and Space Administration — MODIS (or Moderate Resolution Imaging Spectroradiometer) is a key instrument aboard the Terra (EOS AM) and Aqua (EOS PM) satellites. Terra's orbit around the Earth...

  13. Spectral stability of undercompressive shock profile solutions of a modified KdV-Burgers equation

    Directory of Open Access Journals (Sweden)

    Jeff Dodd

    2007-10-01

    Full Text Available It is shown that certain undercompressive shock profile solutions of the modified Korteweg-de Vries-Burgers equation $$ partial_t u + partial_x(u^3 = partial_x^3 u + alpha partial_x^2 u, quad alpha geq 0 $$ are spectrally stable when $alpha$ is sufficiently small, in the sense that their linearized perturbation equations admit no eigenvalues having positive real part except a simple eigenvalue of zero (due to the translation invariance of the linearized perturbation equations. This spectral stability makes it possible to apply a theory of Howard and Zumbrun to immediately deduce the asymptotic orbital stability of these undercompressive shock profiles when $alpha$ is sufficiently small and positive.

  14. An inverse scattering transform for the lattice potential KdV equation

    Science.gov (United States)

    Butler, Samuel; Joshi, Nalini

    2010-11-01

    The lattice potential Korteweg-de Vries equation (LKdV) is a partial difference equation in two independent variables, which possesses many properties that are analogous to those of the celebrated Korteweg-de Vries equation. These include discrete soliton solutions, Bäcklund transformations and an associated linear problem, called a Lax pair, for which it provides the compatibility condition. In this paper, we solve the initial value problem for the LKdV equation through a discrete implementation of the inverse scattering transform method applied to the Lax pair. The initial value used for the LKdV equation is assumed to be real and decaying to zero as the absolute value of the discrete spatial variable approaches large values. An interesting feature of our approach is the solution of a discrete Gel'fand-Levitan equation. Moreover, we provide a complete characterization of reflectionless potentials and show that this leads to the Cauchy matrix form of N-soliton solutions.

  15. Cauchy problems for fifth-order KdV equations in weighted Sobolev spaces

    Directory of Open Access Journals (Sweden)

    Eddye Bustamante

    2015-05-01

    Full Text Available In this work we study the initial-value problem for the fifth-order Korteweg-de Vries equation $$ \\partial_{t}u+\\partial_{x}^{5}u+u^k\\partial_{x}u=0, \\quad x,t\\in \\mathbb{R}, \\; k=1,2, $$ in weighted Sobolev spaces $H^s(\\mathbb{R}\\cap L^2(\\langle x \\rangle^{2r}dx$. We prove local and global results. For the case $k=2$ we point out the relationship between decay and regularity of solutions of the initial-value problem.

  16. SeaWiFS_L3m_YR_KD490_9km

    Data.gov (United States)

    National Aeronautics and Space Administration — The SeaWiFS instrument was launched by Orbital Sciences Corporation on the OrbView-2 (a.k.a. SeaStar) satellite in August 1997, and collected data from September...

  17. OCTS_L3m_YR_KD490_9km

    Data.gov (United States)

    National Aeronautics and Space Administration — On August 17, 1996, the Japanese Space Agency (NASDA - National Space Development Agency) launched the Advanced Earth Observing Satellite (ADEOS). ADEOS was in a...

  18. OCTS_L3m_SNSU_KD490_9km

    Data.gov (United States)

    National Aeronautics and Space Administration — On August 17, 1996, the Japanese Space Agency (NASDA - National Space Development Agency) launched the Advanced Earth Observing Satellite (ADEOS). ADEOS was in a...

  19. OCTS_L3m_MO_KD490_9km

    Data.gov (United States)

    National Aeronautics and Space Administration — On August 17, 1996, the Japanese Space Agency (NASDA - National Space Development Agency) launched the Advanced Earth Observing Satellite (ADEOS). ADEOS was in a...

  20. 70 kD stress protein (Hsp70) analysis in living shallow-water benthic foraminifera

    Digital Repository Service at National Institute of Oceanography (India)

    Heinz, P.; Marten, R.A; Linshy, V.N; Haap, T.; Geslin, E.; Kohler, H-R.

    Hsp70 is a phylogenetically highly conserved protein family present in all eukaryotic organisms tested so far. Its synthesis is induced by proteotoxic stress. The detection of Hsp70 in foraminifera is presented here. We introduce a standard...

  1. CZCS_L3m_SNWI_KD490_4km

    Data.gov (United States)

    National Aeronautics and Space Administration — The Coastal Zone Color Scanner Experiment (CZCS) was the first instrument devoted to the measurement of ocean color and flown on a spacecraft. Although other...

  2. Exact travelling wave solutions of the (3+1)-dimensional mKdV-ZK ...

    Indian Academy of Sciences (India)

    Author Affiliations. Md Nur Alam1 M Ali Akbar2 M Fazlul Hoque1. Department of Mathematics, Pabna University of Science and Technology, Pabna, Bangladesh; Department of Applied Mathematics, University of Rajshahi, Rajshahi, Bangladesh ...

  3. Generalized atrophic benign epidermolysis bullosa - Either 180-kd bullous pemphigoid antigen or laminin-5 deficiency

    NARCIS (Netherlands)

    Jonkman, MF; DeJong, MCJM; Heeres, K; Steijlen, PM; Owaribe, K; Kuster, W; Meurer, M; GeddeDahl, T; Sonnenberg, A; BrucknerTuderman, L

    Background: Generalized atrophic benign epidermolysis bullosa (GABEB) is a form of nonlethal junctional epidermolysis bullosa, clinically characterized by generalized blistering after birth, atrophic healing, and incomplete universal atrophic alopecia nith onset in childhood. Recently, we discovered

  4. SeaWiFS_L3m_SNWI_KD490_9km

    Data.gov (United States)

    National Aeronautics and Space Administration — The SeaWiFS instrument was launched by Orbital Sciences Corporation on the OrbView-2 (a.k.a. SeaStar) satellite in August 1997, and collected data from September...

  5. SeaWiFS_L3m_8D_KD490_9km

    Data.gov (United States)

    National Aeronautics and Space Administration — The SeaWiFS instrument was launched by Orbital Sciences Corporation on the OrbView-2 (a.k.a. SeaStar) satellite in August 1997, and collected data from September...

  6. SeaWiFS_L3m_MC_KD490_9km

    Data.gov (United States)

    National Aeronautics and Space Administration — The SeaWiFS instrument was launched by Orbital Sciences Corporation on the OrbView-2 (a.k.a. SeaStar) satellite in August 1997, and collected data from September...

  7. Orbital stability of periodic traveling-wave solutions for the log-KdV equation

    Science.gov (United States)

    Natali, Fábio; Pastor, Ademir; Cristófani, Fabrício

    2017-09-01

    In this paper we establish the orbital stability of periodic waves related to the logarithmic Korteweg-de Vries equation. Our motivation is inspired in the recent work [3], in which the authors established the well-posedness and the linear stability of Gaussian solitary waves. By using the approach put forward recently in [20] to construct a smooth branch of periodic waves as well as to get the spectral properties of the associated linearized operator, we apply the abstract theories in [13] and [25] to deduce the orbital stability of the periodic traveling waves in the energy space.

  8. SeaWiFS_L3b_SNSP_KD490

    Data.gov (United States)

    National Aeronautics and Space Administration — The SeaWiFS instrument was launched by Orbital Sciences Corporation on the OrbView-2 (a.k.a. SeaStar) satellite in August 1997, and collected data from September...

  9. SeaWiFS_L3b_8D_KD490

    Data.gov (United States)

    National Aeronautics and Space Administration — The SeaWiFS instrument was launched by Orbital Sciences Corporation on the OrbView-2 (a.k.a. SeaStar) satellite in August 1997, and collected data from September...

  10. OCTS_L3m_CU_KD490_9km

    Data.gov (United States)

    National Aeronautics and Space Administration — On August 17, 1996, the Japanese Space Agency (NASDA - National Space Development Agency) launched the Advanced Earth Observing Satellite (ADEOS). ADEOS was in a...

  11. OCTS_L3m_DAY_KD490_9km

    Data.gov (United States)

    National Aeronautics and Space Administration — On August 17, 1996, the Japanese Space Agency (NASDA - National Space Development Agency) launched the Advanced Earth Observing Satellite (ADEOS). ADEOS was in a...

  12. OCTS_L3m_SNWI_KD490_9km

    Data.gov (United States)

    National Aeronautics and Space Administration — On August 17, 1996, the Japanese Space Agency (NASDA - National Space Development Agency) launched the Advanced Earth Observing Satellite (ADEOS). ADEOS was in a...

  13. Migration of Pu, Am, Np en Tc in aquifers, K-d values and geochemical aspects

    NARCIS (Netherlands)

    Noordijk H; Prins M; Pennders RMJ; Frissel MJ

    1988-01-01

    Het Nederlandse onderzoek naar de opslag van radioactief afval in geologische lagen wordt gecoordineerd door de commissie (OPberging te LAnd). Opslag in ondergrondse zoutformaties lijkt voor de Nederlandse situatie de meest geschikte oplossing. Mogelijke terugkeer van de radionucliden in de

  14. A nonstandard numerical method for the modified KdV equation

    Indian Academy of Sciences (India)

    Ayhan Aydin

    2017-10-25

    Oct 25, 2017 ... where r and q are real parameters. Here u = u(x,t) is a function of the space variable x and time variable t. In most applications, u(x,t) represents the amplitude of the relevant wave mode (e.g., u may represent the vertical displacement of the pycnocline). Equation (1) is a nonlinear partial differential equation ...

  15. MODIST_L3m_SNSU_KD490_9km

    Data.gov (United States)

    National Aeronautics and Space Administration — MODIS (or Moderate Resolution Imaging Spectroradiometer) is a key instrument aboard the Terra (EOS AM) and Aqua (EOS PM) satellites. Terra's orbit around the Earth...

  16. SeaWiFS_L3b_MC_KD490

    Data.gov (United States)

    National Aeronautics and Space Administration — The SeaWiFS instrument was launched by Orbital Sciences Corporation on the OrbView-2 (a.k.a. SeaStar) satellite in August 1997, and collected data from September...

  17. OCTS_L3m_SNAU_KD490_9km

    Data.gov (United States)

    National Aeronautics and Space Administration — On August 17, 1996, the Japanese Space Agency (NASDA - National Space Development Agency) launched the Advanced Earth Observing Satellite (ADEOS). ADEOS was in a...

  18. OCTS_L3m_SNSP_KD490_9km

    Data.gov (United States)

    National Aeronautics and Space Administration — On August 17, 1996, the Japanese Space Agency (NASDA - National Space Development Agency) launched the Advanced Earth Observing Satellite (ADEOS). ADEOS was in a...

  19. SeaWiFS_L3m_SCAU_KD490_9km

    Data.gov (United States)

    National Aeronautics and Space Administration — The SeaWiFS instrument was launched by Orbital Sciences Corporation on the OrbView-2 (a.k.a. SeaStar) satellite in August 1997, and collected data from September...

  20. SeaWiFS_L3b_MO_KD490

    Data.gov (United States)

    National Aeronautics and Space Administration — The SeaWiFS instrument was launched by Orbital Sciences Corporation on the OrbView-2 (a.k.a. SeaStar) satellite in August 1997, and collected data from September...

  1. Polynômes 3-Tangentiels Et Solutions t-Périodiques de KdV

    Science.gov (United States)

    Flédrich, Pierre

    2006-05-01

    Nous étudions, quel que soit le réseau Λ subset mathbb{C}, les courbes hyperelliptiques donnant lieu, via le dictionnaire de Krichever et la formule d’Its-Mateev, à des solutions méromorphes Λ-doublement périodiques en t de l’équation de Korteweg-de Vries. Ce sont des revêtements π _Γ {:} (Γ ,p)rightarrow (X,q) marqués finis particuliers de la courbe elliptique ( X, q)=( C /Λ,0) que nous nommons paires osculatrices hyperelliptiques. Nous sommes amenés à définir la classe des polynômes 3-tangentiels symétriques et à considérer une surface algébrique réglée S→ X et la surface S^{bot } obtenue par un éclatement en huit points de S. Nous associons alors aux polynômes 3-tangentiels symétriques des diviseurs sur S et S^{bot }. En étudiant ces diviseurs, nous démontrons que les paires osculatrices non-ramifiées au point marqué se factorisent via S^{bot }rightarrow Srightarrow X, et reconstruisons ensuite de telles paires sur S^{bot } sous certaines conditions numériques.

  2. MODISA_L3m_DAY_KD490_4km

    Data.gov (United States)

    National Aeronautics and Space Administration — MODIS (or Moderate Resolution Imaging Spectroradiometer) is a key instrument aboard the Terra (EOS AM) and Aqua (EOS PM) satellites. Terra's orbit around the Earth...

  3. MODISA_L3m_SNSP_KD490_4km

    Data.gov (United States)

    National Aeronautics and Space Administration — MODIS (or Moderate Resolution Imaging Spectroradiometer) is a key instrument aboard the Terra (EOS AM) and Aqua (EOS PM) satellites. Terra's orbit around the Earth...

  4. MODIST_L3m_SNSP_KD490_4km

    Data.gov (United States)

    National Aeronautics and Space Administration — MODIS (or Moderate Resolution Imaging Spectroradiometer) is a key instrument aboard the Terra (EOS AM) and Aqua (EOS PM) satellites. Terra's orbit around the Earth...

  5. Estimation of rate of degradation (Kd) of starch in the rumen and its ...

    African Journals Online (AJOL)

    Torben Hvelplund

    Aarhus University, Faculty of Agricultural Sciences, Department of Animal Health and Bioscience, P.O. Box 50, 8830. Tjele, Denmark ... starch sources originating from barley, wheat, oat, maize and peas and treated in different ways both .... Effect of carbohydrate-composition on digestibility of energy and protein. J. Cereal ...

  6. Orthogonal Range Searching in Moderate Dimensions: k-d Trees and Range Trees Strike Back

    OpenAIRE

    Chan, Timothy M.

    2017-01-01

    We revisit the orthogonal range searching problem and the exact l_infinity nearest neighbor searching problem for a static set of n points when the dimension d is moderately large. We give the first data structure with near linear space that achieves truly sublinear query time when the dimension is any constant multiple of log n. Specifically, the preprocessing time and space are O(n^{1+delta}) for any constant delta>0, and the expected query time is n^{1-1/O(c log c)} for d = c log n. The ...

  7. CZCS_L3m_SCSP_KD490_9km

    Data.gov (United States)

    National Aeronautics and Space Administration — The Coastal Zone Color Scanner Experiment (CZCS) was the first instrument devoted to the measurement of ocean color and flown on a spacecraft. Although other...

  8. The integrability of an extended fifth-order KdV equation with Riccati ...

    Indian Academy of Sciences (India)

    Author Affiliations. Yun-Hu Wang1 2 Yong Chen1. Shanghai Key Laboratory of Trustworthy Computing, East China Normal University, Shanghai 200062, People's Republic of China; College of Art and Sciences, Shanghai Maritime University, Shanghai 201306, People's Republic of China ...

  9. Analytical and numerical solutions of the Schrödinger–KdV equation

    Indian Academy of Sciences (India)

    [14] A-M Wazwaz, Comput. Math. Appl. 54, 895 (2007). [15] M Tatari and M Dehghan, Comput. Math. Appl. 58, 2160 (2009). [16] B Batiha, M-S-M Noorani, I Hashim and K Batiha, Phys. Lett. A372, 822 (2008). [17] L-M-B Assas, Chaos, Solitons and Fractals 38, 1225 (2008). [18] N-H Sweilama and R-F Al-Barb, Comput. Math.

  10. The integrability of an extended fifth-order KdV equation with Riccati ...

    Indian Academy of Sciences (India)

    the integrability of nonlinear evolution equations (NLEEs) play an important role in soliton theory, which can be regarded as a pretest and the first step of its exact solv- ability [6]. There are many ..... (No. 2011AA010101) and Shanghai Knowledge Service Platform for Trustworthy. Internet of Things (No. ZF1213). References.

  11. Analytical and numerical solutions of the Schrödinger–KdV equation

    Indian Academy of Sciences (India)

    2015-11-27

    Nov 27, 2015 ... Laboratory of Engineering Mathematics, Tunisia Polytechnic School, University of Carthage, BP 743, La Marsa 2070, Tunisia; Faculty of Mathematical Sciences, University of ... Proceedings of the International Workshop/Conference on Computational Condensed Matter Physics and Materials Science

  12. CZCS_L3m_MO_KD490_4km

    Data.gov (United States)

    National Aeronautics and Space Administration — The Coastal Zone Color Scanner Experiment (CZCS) was the first instrument devoted to the measurement of ocean color and flown on a spacecraft. Although other...

  13. CZCS_L3m_SNWI_KD490_9km

    Data.gov (United States)

    National Aeronautics and Space Administration — The Coastal Zone Color Scanner Experiment (CZCS) was the first instrument devoted to the measurement of ocean color and flown on a spacecraft. Although other...

  14. A nonstandard numerical method for the modified KdV equation

    Science.gov (United States)

    Aydin, Ayhan; Koroglu, Canan

    2017-11-01

    A linearly implicit nonstandard finite difference method is presented for the numerical solution of modified Korteweg-de Vries equation. Local truncation error of the scheme is discussed. Numerical examples are presented to test the efficiency and accuracy of the scheme.

  15. Ad-hoc KEEN-type Waves and their Occasional Resemblance to KdV Waveforms

    Science.gov (United States)

    Tyshetskiy, Yuriy; Afeyan, Bedros

    2005-10-01

    Nonlinear kinetic waves of the KEEN type [1] but constructed with two BGK recipes are tested with 1D Vlasov-Poisson simulation (1DVPS). One is that of Allis [2] as modified by Johnston (unpublished), the other is that of Eliasson and Shukla [3]. Strong kinetic waves survive well, but not weaker ones. The potential wave trains resemble those from the Korteweg-deVries equation. This proves to be natural when charge density variation with electrostatic potential is like a quadratic polynomial. For expositions on the physics of ponderomotively driven KEEN waves, consult presentations by Afeyan and Savchenko, this conference. (Part of this work was performed under the auspices of the U.S. Department of Energy under grant number DE-FG03-NA00059.) [1] B. Afeyan et al., ``Kinetic Electrostatic Electron Nonlinear (KEEN) Waves and their interactions driven by the ponderomotive force of crossing laser beams'', Proc. IFSA (Inertial Fusion Sciences and Applications 2003, Monterey, CA), 213, B. Hammel, D. Meyerhofer, J. Meyer-ter-Vehn and H. Azechi, editors, American Nuclear Society, 2004. [2] W.P. Allis, paper 3 (pp.21-42), in ``In Honor of Philip M. Morse'', ed. H. Feshbach and K. Ingard, MIT Press (1969). [3] B. Eliasson and P.K. Shukla, Phys. Rev. E 71, 046402 (2005)

  16. Elucidating cdc25’s Oncogenic Mechanism in Breast Cancer Using Pin1, a Negative Mitotic Regulator

    Science.gov (United States)

    2001-07-01

    Zhou, X. Z., Kops, 0., Werner , A., Lu, P. J., Shen, M., Stoller, G., Kullertz, G., Stark, M., Fischer, G., and Lu, K. P. (2000b). Pin 1-dependent prolyl...E A P S Q EGK . L’LV 75 Sc Ess1 41JG -. .. .- -T- N KD[QIL H[K]HLR DN V RVRCL4I11 67 XlPinl 59 [ N Q"S RRPS SW Q D K1T DALELINY I QýK KK- - : 96

  17. On a Steel Horse I Ride: A History of the MH-53 Pave Low Helicopters in War and Peace

    Science.gov (United States)

    2012-09-01

    arrived a few days after Connelly. His “welcome” was also rather rushed, and within a week, he was in the combat up- grade program, flying with Capt Ken...found the Pave Low avionics, integrated systems, and computers in- timidating . He was also impressed with the amount of crew coordi- nation necessary to...and eventually up- graded to the 160th Special Operations Aviation Regiment (SOAR).59 Honey Badger also served as the catalyst to move the Pave Low

  18. Scrutinizing the alignment limit in two-Higgs-doublet models. II. mH=125 GeV

    Science.gov (United States)

    Bernon, Jérémy; Gunion, John F.; Haber, Howard E.; Jiang, Yun; Kraml, Sabine

    2016-02-01

    In the alignment limit of a multidoublet Higgs sector, one of the Higgs mass eigenstates aligns in field space with the direction of the scalar field vacuum expectation values, and its couplings approach those of the Standard Model (SM) Higgs boson. We consider C P -conserving two-Higgs-doublet models (2HDMs) of type I and type II near the alignment limit in which the heavier of the two C P -even Higgs bosons, H , is the SM-like state observed with a mass of 125 GeV, and the couplings of H to gauge bosons approach those of the SM. We review the theoretical structure and analyze the phenomenological implications of this particular realization of the alignment limit, where decoupling of the extra states cannot occur given that the lighter C P -even state h must, by definition, have a mass below 125 GeV. For the numerical analysis, we perform scans of the 2HDM parameter space employing the software packages 2hdmc and lilith, taking into account all relevant pre-LHC constraints, constraints from the measurements of the 125 GeV Higgs signal at the LHC, as well as the most recent limits coming from searches for other Higgs-like states. Implications for Run 2 at the LHC, including expectations for observing the other scalar states, are also discussed.

  19. 75 FR 1681 - Receipt of Petition for Decision That Nonconforming 2001 and 2002 Ducati MH900e Motorcycles are...

    Science.gov (United States)

    2010-01-12

    ... identical to their U.S.- certified counterparts with respect to compliance with Standard Nos. 116 Brake Fluid, 119 New Pneumatic Tires for Vehicles Other Than Passenger Cars, and 122 Motorcycle Brake Systems... following standards, in the manner indicated below: Standard No. 106 Brake Hoses: Inspection of all vehicles...

  20. M-H loop tracer based on digital signal processing for low frequency characterization of extremely thin magnetic wires.

    Science.gov (United States)

    Butta, M; Infante, G; Ripka, P; Badini-Confalonieri, G A; Vázquez, M

    2009-08-01

    A high-sensitivity ac hysteresis loop tracer has been developed to measure the low frequency hysteresis loop of soft magnetic materials. It has been applied successfully to characterize straight pieces of amorphous glass-covered microwires with metallic nucleus down to 1.5 microm thick. Based on the electromagnetic induction law, the proposed design is extremely simple and exploits the capabilities of commercially available data acquisition cards together with digital signal processing in order to achieve high-sensitivity without the need of expensive analog equipment.

  1. Beten - und Kanonen kaufen. Evangelium und Gesetz im Zusammenhang von KD II/2 (§§ 36 - 39)

    DEFF Research Database (Denmark)

    Nielsen, Bent Flemming

    2010-01-01

    Med udgangspunkt i Karl Barths møde med danske teologer på Nyborg strand i 1939 analyseres en række bagvedliggende teologiske motiver for den samtale, som udspandt sig mellem Barth og de danske mødedeltagere. Det er en samtale, som er dokumenteret flere steder, og som blandt berører...

  2. The 70 kD heat shock protein (hsp 70) in soil invertebrates: a possible tool for monitoring environmental toxicants.

    Science.gov (United States)

    Köhler, H R; Triebskorn, R; Stöcker, W; Kloetzel, P M; Alberti, G

    1992-04-01

    The expression of hsp 70 after heat shock or exposure to heavy metals/molluscicides was investigated by fluorography or immunoblot in three diplopods (Glomeris marginata, Cylindroiulus punctatus, Tachypodoiulus niger), two slugs (Deroceras reticulatum, Arion ater), and one isopod (Oniscus asellus). In O. asellus, hsp 70 expression occurred after heat shock and also after lead treatment, whereby a solution of 100 mg/kg Pb2+ was sufficient. Animals of the same species taken from a heavy metal polluted site in the vicinity of a lead/zinc smelter also showed the presence of hsp 70. The comparison of laboratory and field experiments demonstrated the suitability of O. asellus for monitoring tests. In contrast, the blot pattern after contamination with 1,000 mg/kg Pb2+ (in the mentioned diplopods) or different concentrations of the molluscicide Cloethocarb (BASF, FRG) (slugs) showed no differences compared to the respective control group.

  3. NPP Visible Infrared Imager-Radiometer Suite (VIIRS) Diffuse Attenuation Coefficient for Downwelling Irradiance (KD) Global Mapped Data

    Data.gov (United States)

    National Aeronautics and Space Administration — The Visible and Infrared Imager/Radiometer Suite (VIIRS) is a multi-disciplinary instrument that is being flown on the Joint Polar Satellite System (JPSS) series of...

  4. NPP Visible Infrared Imager-Radiometer Suite (VIIRS) Diffuse Attenuation Coefficient for Downwelling Irradiance (KD) Global Binned Data

    Data.gov (United States)

    National Aeronautics and Space Administration — The Visible and Infrared Imager/Radiometer Suite (VIIRS) is a multi-disciplinary instrument that is being flown on the Joint Polar Satellite System (JPSS) series of...

  5. Fractional rate of degradation (kd) of starch in the rumen and its relation to in vivo rumen and total digestibility

    DEFF Research Database (Denmark)

    Hvelplund, Torben; Larsen, Mogens; Lund, Peter

    2009-01-01

    in different ways both chemically and physically. The starch sources were fed in mixed diets together with grass silage and soya bean meal and allocated ad libitum to fistulated dairy cows. The starch content varied between 13 and 35% in ration dry matter for the different starch sources. The design...

  6. Fingering patterns in Hele-Shaw flows are density shock wave solutions of dispersionless KdV hierarchy

    Energy Technology Data Exchange (ETDEWEB)

    Teodorescu, Razvan [Los Alamos National Laboratory; Lee, S - Y [MONTREAL, CANADA; Wiegmann, P [UNIV OF CHICAGO

    2008-01-01

    We investigate the hydrodynamics of a Hele-Shaw flow as the free boundary evolves from smooth initial conditions into a generic cusp singularity (of local geometry type x{sup 3} {approx} y{sup 2}), and then into a density shock wave. This novel solution preserves the integrability of the dynamics and, unlike all the weak solutions proposed previously, is not underdetermined. The evolution of the shock is such that the net vorticity remains zero, as before the critical time, and the shock can be interpreted as a singular line distribution of fluid deficit.

  7. Neutrophil predominance in induced sputum from asthmatic patients: Therapeutic implications and role of clara cell 16-KD protein

    Directory of Open Access Journals (Sweden)

    Elisa M. Uribe Echevarría

    2011-08-01

    Full Text Available Eosinophil is considered to be a main protagonist in asthma; however, often discordances between clinical manifestations and response to treatment are observed. We aimed to determine the occurrence of neutrophil predominance in asthma and to identify its characteristics on the basis of clinical-functional features, induced sputum cellular pattern and soluble molecules, to guide the appropriated anti-inflammatory therapy. A total of 41 patients were included in randomized groups: 21-40 year-old, with stable mild-to-severe asthma, steroid-naïve and non-smokers. An induced sputum sample was obtained under basal conditions, a second one after treatment with budesonide (400 µg b.i.d. or montelukast (10 mg/d for six weeks, and a final one after a 4-week washout period. By cytospin we evaluated eosinophil (EP or neutrophil predominance (NP, and in supernatant we determined LTE4, and CC16. Peak expiratory flow variability (PEFV was measured. A total of 23/41 patients corresponded to EP and 18/41 patients to NP. The PEFV was higher in EP than in NP. LTE4 was higher with NP than with EP. No difference was found for CC16. Montelukast reduced the predominant cell in both subsets, whereas budesonide only reduced eosinophils in EP. Budesonide and montelukast reduced PEFV in EP but not in NP. Considering the total treated-samples in each subset, CC16 level increased significantly in EP. In conclusion: a NP subset of asthmatic patients was identified. These patients show a lower bronchial lability; the leukotriene pathway is involved which responds to anti-leukotriene treatment. This phenotype shows a poor recovery of CC16 level after treatment.

  8. ESTIMATED NEPTUNIUM SEDIMENT SORPTION VALUES AS A FUNCTION OF PH AND MEASURED BARIUM AND RADIUM KD VALUES

    Energy Technology Data Exchange (ETDEWEB)

    Kaplan, D.

    2011-01-13

    The objective of this document is to provide traceability and justification for a select few new geochemical data used in the Special Analysis entitled 'Special Analysis for the Dose Assessment of the Final Inventories in Center Slit Trenches One through Five'. Most values used in the Special Analysis came from the traditional geochemical data package, however, some recent laboratory measurements have made it possible to estimate barium K{sub d} values. Additionally, some recent calculations were made to estimate neptunium K{sub d} values as a function of pH. The assumptions, justifications, and calculations needed to generate these new values are presented in this document, and the values are summarized.

  9. Sorption (Kd) measurements on cinder block and grout in support of dose assessments for Zion Nuclear Station decommissioning

    Energy Technology Data Exchange (ETDEWEB)

    Milian L.; Sullivan T.

    2014-06-24

    The Zion Nuclear Power Station is being decommissioned. ZionSolutions proposes to leave much of the below grade structures in place and to fill them with a backfill to provide structural support. Backfills under consideration include “clean” concrete demolition debris from the above grade parts of the facility, a flowable grout, cinder block construction debris and sand. A previous study (Yim, 2012) examined the sorption behavior of five nuclides (Fe-55, Co-60, Ni-63, Sr-85, and Cs-137) on concrete and local soils. This study, commissioned by ZionSolutions and conducted by the Brookhaven National Laboratory (BNL) examines the sorption behavior on cinder block and grout materials. Specifically, this study measured the distribution coefficient for four radionuclides of concern using site-groundwater and cinder block from the Zion site and a flowable grout. The distributions coefficient is a measure of the amount of the radionuclide that will remain sorbed to the solid material that is present relative to the amount that will remain in solution. A high distribution coefficient indicates most of the radionuclide will remain on the solid material and will not be available for transport by the groundwater. The radionuclides examined in this set of tests were Co-60, Ni-63, Sr-85, and Cs-137. Tests were performed following ASTM C1733-10, Standard Test Methods for Distribution Coefficients of Inorganic Species by the Batch Method. Sr-85 was used in the testing as an analogue for Sr-90 because it behaves similarly with respect to sorption and has a gamma emission that is easier to detect than the beta emission from Sr-90.

  10. Pleurotus giganteus (Berk.) Karunarathna & K.D. Hyde: Nutritional value and in vitro neurite outgrowth activity in rat pheochromocytoma cells.

    Science.gov (United States)

    Phan, Chia-Wei; Wong, Wei-Lun; David, Pamela; Naidu, Murali; Sabaratnam, Vikineswary

    2012-07-19

    Drugs dedicated to alleviate neurodegenerative diseases like Parkinson's and Alzheimer's have always been associated with debilitating side effects. Medicinal mushrooms which harness neuropharmacological compounds offer a potential possibility for protection against such diseases. Pleurotus giganteus (formerly known as Panus giganteus) has been consumed by the indigenous people in Peninsular Malaysia for many years. Domestication of this wild mushroom is gaining popularity but to our knowledge, medicinal properties reported for this culinary mushroom are minimal. The fruiting bodies P. giganteus were analysed for its nutritional values. Cytotoxicity of the mushroom's aqueous and ethanolic extracts towards PC12, a rat pheochromocytoma cell line was assessed by using 3-[4,5-dimethythiazol-2-yl]-2,5-diphenyltetrazolium bromide (MTT) assay. Neurite outgrowth stimulation assay was carried out with nerve growth factor (NGF) as control. To elucidate signaling mechanisms involved by mushroom extract-induced neurite outgrowth, treatment of specific inhibitor for MEK/ERK and PI3K signalling pathway was carried out. The fruiting bodies of P. giganteus were found to have high carbohydrate, dietary fibre, potassium, phenolic compounds and triterpenoids. Both aqueous and ethanolic extracts induced neurite outgrowth of PC12 cells in a dose- and time-dependant manner with no detectable cytotoxic effect. At day 3, 25 μg/ml of aqueous extract and 15 μg/ml of ethanolic extract showed the highest percentage of neurite-bearing cells, i.e. 31.7 ± 1.1% and 33.3 ± 0.9%; respectively. Inhibition treatment results suggested that MEK/ERK and PI3K/Akt are responsible for neurite outgrowth of PC12 cells stimulated by P. giganteus extract. The high potassium content (1345.7 mg/100 g) may be responsible for promoting neurite extension, too. P. giganteus contains bioactive compounds that mimic NGF and are responsible for neurite stimulation. Hence, this mushroom may be developed as a nutraceutical for the mitigation of neurodegenerative diseases.

  11. Level structure of 42K from the 41(n, γ) and 41K(d, p) reactions

    Science.gov (United States)

    Krusche, B.; Winter, Ch.; Lieb, K. P.; Hungerford, P.; Schmidt, H. H.; Von Egidy, T.; Scheerer, H. J.; Kerr, S. A.; Börner, H. G.

    1985-06-01

    The γ-ray spectrum emitted after thermal neutron capture in 41K has been measured with pair and Ge(Li) spectrometers at the ILL high-flux reactor. About 630 transitions have been assigned to the decay of 133 excited states in 42K. The level energies have been determined with a precison of 20 ppm; the neutron binding energy was determined to be EB = 7533.82(15) keV. On the basis of the many transitions to known states, several spin-parity assignments have been made. In addition, high-resolution proton spectra of the reaction 41K(d,p) have been taken at 20MeV deuteron energy with the München Q3D spectrometer. These data have been essential in establishing the newly-found levels and in differentiating between primary and secondary transitions in the (n, γ) work. A statistical analysis of the level density and relative strengths of primary transitions is given.

  12. GEOQUÌMICO : an interactive tool for comparing sorption conceptual models (surface complexation modeling verus K[D]).

    Energy Technology Data Exchange (ETDEWEB)

    Hammond, Glenn E. (Pacific Northwest National Laboratory, Richland, WA); Cygan, Randall Timothy

    2007-11-01

    Within reactive geochemical transport, several conceptual models exist for simulating sorption processes in the subsurface. Historically, the K{sub D} approach has been the method of choice due to ease of implementation within a reactive transport model and straightforward comparison with experimental data. However, for modeling complex sorption phenomenon (e.g. sorption of radionuclides onto mineral surfaces), this approach does not systematically account for variations in location, time, or chemical conditions, and more sophisticated methods such as a surface complexation model (SCM) must be utilized. It is critical to determine which conceptual model to use; that is, when the material variation becomes important to regulatory decisions. The geochemical transport tool GEOQUIMICO has been developed to assist in this decision-making process. GEOQUIMICO provides a user-friendly framework for comparing the accuracy and performance of sorption conceptual models. The model currently supports the K{sub D} and SCM conceptual models. The code is written in the object-oriented Java programming language to facilitate model development and improve code portability. The basic theory underlying geochemical transport and the sorption conceptual models noted above is presented in this report. Explanations are provided of how these physicochemical processes are instrumented in GEOQUIMICO and a brief verification study comparing GEOQUIMICO results to data found in the literature is given.

  13. Recommended values for the distribution coefficient (Kd) to be used in dose assessments for decommissioning the Zion Nuclear Power Plant

    Energy Technology Data Exchange (ETDEWEB)

    Sullivan, T. [Brookhaven National Lab. (BNL), Upton, NY (United States)

    2014-09-24

    ZionSolutions is in the process of decommissioning the Zion Nuclear Power Plant. The site contains two reactor Containment Buildings, a Fuel Building, an Auxiliary Building, and a Turbine Building that may be contaminated. The current decommissioning plan involves removing all above grade structures to a depth of 3 feet below grade. The remaining underground structures will be backfilled. The remaining underground structures will contain low amounts of residual licensed radioactive material. An important component of the decommissioning process is the demonstration that any remaining activity will not cause a hypothetical individual to receive a dose in excess of 25 mrem/y as specified in 10CFR20 SubpartE.

  14. Recommended values for the distribution coefficient (Kd) to be used in dose assessments for decommissioning the Zion Nuclear Power Plant

    Energy Technology Data Exchange (ETDEWEB)

    Sullivan T.

    2014-06-09

    ZionSolutions is in the process of decommissioning the Zion Nuclear Power Plant. The site contains two reactor Containment Buildings, a Fuel Building, an Auxiliary Building, and a Turbine Building that may be contaminated. The current decommissioning plan involves removing all above grade structures to a depth of 3 feet below grade. The remaining underground structures will be backfilled. The remaining underground structures will contain low amounts of residual licensed radioactive material. An important component of the decommissioning process is the demonstration that any remaining activity will not cause a hypothetical individual to receive a dose in excess of 25 mrem/y as specified in 10CFR20 SubpartE.

  15. Estimating the Underwater Diffuse Attenuation Coefficient with a Low-Cost Instrument: The KdUINO DIY Buoy

    NARCIS (Netherlands)

    Bardaji, R.; Sánchez, A.-M.; Simon, C.; Wernand, M.R.; Piera, J.

    2016-01-01

    A critical parameter to assess the environmental status of water bodies is the transparency of the water, as it is strongly affected by different water quality related components (such as the presence of phytoplankton, organic matter and sediment concentrations). One parameter to assess the water

  16. On the method of strained parameters for a KdV type of equation with exact dispersion property

    CERN Document Server

    Karjanto, N

    2016-01-01

    This paper provides an alternative methodology for analysis of three-wave interactions under the exact dispersion relation associated with gravity waves in fluid of intermediate depth. A Korteweg-de Vries type of equation with exact dispersion property is adopted as the governing equation for unidirectional wave packet evolution. Following the idea from Zakharov's seminal paper (Zakharov, V. E. (1968) Stability of periodic waves of finite amplitude on the surface of a deep fluid. \\textit{Journal of Applied Mechanics and Technical Physics}, {\\bf 9}, 190--194), the equation is transformed from the spatial--temporal domain to the wavenumber--temporal domain. The solution of the transformed equation is sought using the perturbation theory, for which the ansatz is expressed in the form of a regular expansion in the increasing order of a small parameter. After implementing the na\\"{i}ve perturbation method, due to nonlinear mode generation and particular combinations of wavenumbers, the third-order solution contain...

  17. Using an implicit min/max KD-Tree for doing efficient terrain line of sight calculations

    CSIR Research Space (South Africa)

    Duvenhage, B

    2009-02-01

    Full Text Available of computing resources, a number of LOS algorithms are reported in the literature to either efficiently compute LOS information or reduce the impact of LOS queries on the run-time performance of synthetic environments. From the literature it is known that a k...

  18. Historical Report Atomic Bomb Tests Able and Baker (Operation Crossroads). Volume 2

    Science.gov (United States)

    1946-07-25

    exposure, as well as various vaccines and sera,- with a special representative to supervise their tests. ►„ .•;<•...<•■, •V\\->.v ,-.v-v£< ’_r ’ -"^_K...Lt. (jg) KIRMSER, P. G., Lt. (jg) LEEDOM, E. C, Lt. (jg) REYNOLDS, J. T., Lt. (jg) SCHWARTZ, J. A., Lt. (jg) TOME, J. M., Lt. (jg) WAKEFIELD , M

  19. Spatial location of neutralizing and non-neutralizing B cell epitopes on domain 1 of ricin toxin's binding subunit.

    Directory of Open Access Journals (Sweden)

    Yinghui Rong

    Full Text Available Ricin toxin's binding subunit (RTB is a galactose-/N-acetylgalactosamine (Gal/GalNac-specific lectin that mediates uptake and intracellular trafficking of ricin within mammalian cells. Structurally, RTB consists of two globular domains, each divided into three homologous sub-domains (α, β, γ. In this report, we describe five new murine IgG monoclonal antibodies (mAbs against RTB: MH3, 8A1, 8B3, LF1, and LC5. The mAbs have similar binding affinities (KD for ricin holotoxin, but displayed a wide range of in vitro toxin-neutralizing activities. Competition ELISAs indicate that the two most potent toxin-neutralizing mAbs (MH3, 8A1, as well as one of the moderate toxin-neutralizing mAbs (LF1, recognize distinct epitopes near the low affinity Gal recognition domain in RTB subdomain 1α. Evaluated in a mouse model of systemic ricin challenge, all five mAbs afforded some benefit against intoxication, but only MH3 was protective. However, neither MH3 nor 24B11, another well-characterized mAb against RTB subdomain 1α, could passively protect mice against a mucosal (intranasal ricin challenge. This is in contrast to SylH3, a previously characterized mAb directed against an epitope near RTB's high affinity Gal/GalNac recognition element in sub-domain 2γ, which protected animals against systemic and mucosal ricin exposure. SylH3 was significantly more effective than MH3 and 24B11 at blocking ricin attachment to host cell receptors, suggesting that mucosal immunity to ricin is best imparted by antibodies that target RTB's high affinity Gal/GalNac recognition element in subdomain 2γ, not the low affinity Gal recognition domain in subdomain 1α.

  20. An Application Framework for the Rapid Deployment of Ocean Models in Support of Emergency Services: Application to the MH370 Search

    OpenAIRE

    Rosebrock, Uwe; Oke, Peter,; Carroll, Gary

    2015-01-01

    Part 4: Modelling and Simulation Systems; International audience; Ocean models are beneficial to many different applications, including industry, public-good, and defence. Many applications use high-resolution models to produce detailed maps of the ocean circulation. High-resolution models are historically time-consuming to configure – often taking weeks to months to properly prepare. A system for automatically configuring and executing a model to predict the past, present, or future state of...

  1. Transition metal containing decatungstosilicate dimer [M(H(2)O)(2)(gamma-SiW(10)O(35))(2)](10-) (M = Mn(2+), Co(2+), Ni(2+)).

    Science.gov (United States)

    Bassil, Bassem S; Dickman, Michael H; Reicke, Markus; Kortz, Ulrich; Keita, Bineta; Nadjo, Louis

    2006-09-21

    The new, monometal substituted silicotungstates [Mn(H(2)O)(2)(gamma-SiW(10)O(35))(2)](10-) (1), [Co(H(2)O)(2)(gamma-SiW(10)O(35))(2)](10-) (2) and [Ni(H(2)O)(2)(gamma-SiW(10)O(35))(2)](10-) (3) have been synthesized and isolated as the potassium salts K(10)[Mn(H(2)O)(2)(gamma-SiW(10)O(35))(2)] x 8.25 H(2)O (K-1), K(10)[Co(H(2)O0(2)(gamma-SiW(10)O(35))(2)] x 8.25 H(2)O (K-2) and K(10)[Ni(H(2)O)(2)(gamma-SiW(10)O(35))(2)] x 13.5 H(2)O (K-3), which have been characterized by IR spectroscopy, single crystal X-ray diffraction, elemental analysis and cyclic voltammetry. Polyanions 1-3 are composed of two (gamma-SiW(10)O(36)) units fused on one side via two W-O-W' bridges and on the other side by an octahedrally coordinated trans-MO(4)(OH(2))(2) transition metal fragment, resulting in a structure with C(2v) point group symmetry. Anions 1-3 were synthesized by reaction of the dilacunary precursor [gamma-SiW(10)O(36)](8-) with Mn(2+), Co(2+) and Ni(2+) ions, respectively, in 1 M KCl solution at pH 4.5. The electrochemical properties of 1-3 were studied by cyclic voltammetry and controlled potential coulometry in a pH 5 buffer medium. The waves associated with the W-centers are compared with each other and with those of the parent lacunary precursor [gamma-SiW(10)O(36)](8-) in the same medium. They appear to be dominated by the acid-base properties of the intermediate reduced species. A facile merging of the waves for 3 is observed while those for 1 and 2 remain split. Controlled potential coulometry of the single wave of 3 or the combined waves of 1 and 2 is accompanied by catalysis of the hydrogen evolution reaction. No redox activity was detected for the Ni(2+) center in 3, whereas the Co(2+) center in 2 shows a one-electron redox process. The two-electron, chemically reversible process of the Mn(2+) center in 1 is accompanied by a film deposition on the electrode surface.

  2. Influence of Zr Addition on Structure and Performance of Rare Earth Mg-Based Alloys as Anodes in Ni/MH Battery

    Directory of Open Access Journals (Sweden)

    Shujun Qiu

    2015-04-01

    Full Text Available In this study, the substitution of Mg with Zr in La0.7Mg0.3(Ni0.85Co0.153.5 was carried out with the purpose of improving the electrochemical performances. The structural and hydrogen storage properties in both gas-solid reaction and the electrochemical system were systematically studied on La0.7(Mg0.3−xZrx(Ni0.85Co0.153.5 (x = 0.05, 0.1, 0.2, 0.3 alloys. Each tested alloy is composed of LaNi3 phase, LaNi5 phase and ZrNi3 phase with different phase abundances. The electrochemical studies indicated that all Zr-substituted anodes possessed a much higher cycling capacity retention than pristine La0.7Mg0.3(Ni0.85Co0.153.5. However, the maximum discharge capacity was reduced with the increase of Zr content. The potential-step tests showed that the diffusion of hydrogen atoms inside the anodes was decelerated after the introduction of Zr.

  3. Transient extensional viscosity of polymer melts in the filament stretching rheometer. A. Bach, H. Bastian, M.H. Wagner, H.K. Rasmussen and O. Hassager

    DEFF Research Database (Denmark)

    Rasmussen, Henrik Koblitz; Bach, Anders; Bastian, Heike

    2002-01-01

    In many polymer processing operations, the polymer molecules becomes highly elongated and the extensional viscosity becomes an inportant parameter in estimating properties during and after the process....

  4. Associations between diabetes, major depressive disorder and generalized anxiety disorder comorbidity, and disability: findings from the 2012 Canadian Community Health Survey--Mental Health (CCHS-MH).

    Science.gov (United States)

    Deschênes, Sonya S; Burns, Rachel J; Schmitz, Norbert

    2015-02-01

    To examine the associations between diabetes, disability, and the likelihood of comorbid major depressive disorder (MDD) and generalized anxiety disorder (GAD). Data were obtained from the 2012 Canadian Community Health Survey - Mental Health (N=17 623). Diabetes assessment consisted of a self-reported diagnosis of diabetes made by a health care professional. Disability was assessed via self-report. 12-Month and lifetime MDD and GAD were assessed with the Composite International Diagnostic Interview 3.0. In multinomial logistic regression models adjusted for sociodemographic and health-related factors, having diabetes was associated with a greater likelihood of 12-month comorbid MDD and GAD (OR=1.99, 95% CI [1.22, 3.25], p=.006), compared with those with neither MDD nor GAD. No significant associations were found for MDD without GAD or GAD without MDD. This pattern of effects held when lifetime diagnoses of MDD and GAD were considered. For individuals with diabetes (n=1730), adjusted binary logistic regression models demonstrated that with 12-month diagnoses, MDD without GAD (OR=2.79, 95% CI [1.39-5.62], p=.004), GAD without MDD (OR=3.69, 95% CI [1.34-10.11], p=.01), and comorbid MDD and GAD (OR=4.17, 95% CI [1.66-10.51], p=.002) were associated with greater disability than the control group. Only comorbid MDD and GAD were associated with disability when lifetime diagnoses of MDD and GAD were considered. Individuals with diabetes may be particularly vulnerable to comorbid MDD and GAD, and MDD-GAD comorbidity may exacerbate disability in persons with diabetes. Copyright © 2014 Elsevier Inc. All rights reserved.

  5. Mafqūd and Fasakh in the Writings of Muslim Jurists and Provisions of Malaysian Federal Territory Islamic Family Law: The Case of MH 370 Missing Plane

    National Research Council Canada - National Science Library

    Mek Wok Mahmud; Siti Zulaikha binti Mokhtar

    2017-01-01

    .... This is known as mafqud, or missing person. Therefore, the objective of this study is to discuss the concept of fasakh and mafqud in accordance with the views of Muslim jurists and the provisions of Islamic family law in Malaysia...

  6. People’s Motivation to Participate in Social Network Sites, Subsequent Behaviours, and Situation Self-Awareness following a Crisis: Evidence from the MH370 Flight Incident

    OpenAIRE

    Xuequn Wang

    2016-01-01

    As people increasingly integrate social network sites (SNSs) into their daily lives, they also turn to these sites for timely information following crises. To date, few studies have examined the effects of different types of motivation on participatory behaviours within SNSs following crises. In this study, self-determination theory (SDT) is applied to examine how individuals are motivated to participate in SNSs following a crisis and how individuals’ participatory behaviours can better assis...

  7. Suppression of human cartilage proteoglycan synthesis by rheumatoid synovial fluid mononuclear cells activated with mycobacterial 60-kd heat-shock protein

    NARCIS (Netherlands)

    Wilbrink, B.; Holewijn, M.; Bijlsma, J. W.; van Roy, J. L.; den Otter, W.; van Eden, W.

    1993-01-01

    To examine whether T cell reactivity toward heat-shock proteins (HSP) contributes to cartilage destruction in rheumatoid arthritis (RA). An in vitro system was used, in which human cartilage explants were cocultured with hsp60-activated synovial fluid mononuclear cells (SFMC) from patients with RA,

  8. Expression of 58-kD Microspherule Protein (MSP58 is Highly Correlated with PET Imaging of Tumor Malignancy and Cell Proliferation in Glioma Patients

    Directory of Open Access Journals (Sweden)

    Wei Lin

    2016-02-01

    Full Text Available Background/Aims: The nucleolar 58-kDa microspherule protein (MSP58 has important transcriptional regulation functions and plays a crucial role in the tumorigenesis and progression of cancers. 3'-deoxy-3'-[18F]fluorothymidine (FLT has emerged as a promising positron emission tomography (PET tracer for evaluating tumor malignancy and cell proliferation. Methods: In the present study, the expression of MSP58 was evaluated by immunohistochemistry and the corresponding PET image was examined using FLT-PET in 55 patients with various grades of gliomas. Results: The immunoreactivity score (IRS of MSP58 increased with tumor grade with grade IV gliomas exhibiting the highest expression and showed a highly significant positive correlation with the Ki-67 index (r = 0.65, P r = 0.61, P r = 0.59, P Conclusion: These results indicate that MSP58 plays an important role in cell proliferation and will be one of the potential candidates of molecular therapy targeting proliferation. FLT-PET might be used as an early measure of treatment response in the proliferation-targeted therapy.

  9. H2O2 production rate in Lactobacillus johnsonii is modulated via the interplay of a heterodimeric flavin oxidoreductase with a soluble 28 Kd PAS domain containing protein.

    Directory of Open Access Journals (Sweden)

    Ricardo B Valladares

    2015-07-01

    Full Text Available Host and commensals crosstalk, mediated by reactive oxygen species (ROS, has triggered a growing scientific interest to understand the mechanisms governing such interaction. However, the majority of the scientific studies published do not evaluate the ROS production by commensals bacteria. In this context we recently showed that Lactobacillus johnsonii N6.2, a strain of probiotic value, modulates the activity of the critical enzymes 2,3-indoleamine dioxygenase via H2O2 production. L. johnsonii N6.2 by decreasing IDO activity, is able to modify the tryptophan/kynurenine ratio in the host blood with further systemic consequences. Understanding the mechanisms of H2O2 production is critical to predict the probiotic value of these strains and to optimize bacterial biomass production in industrial processes. We performed a transcriptome analysis to identify genes differentially expressed in L. johnsonii N6.2 cells collected from cultures grown under different aeration conditions. Herein we described the biochemical characteristics of a heterodimeric FMN reductase (FRedA/B whose in vitro activity is controlled by LjPAS protein with a typical Per-Arnst-Sim (PAS sensor domain. Interestingly, LjPAS is fused to the FMN reductase domains in other lactobacillaceae. In L. johnsonii, LjPAS is encoded by an independent gene which expression is repressed under anaerobic conditions (>3 fold. Purified LjPAS was able to slow down the FRedA/B initial activity rate when the holoenzyme precursors (FredA, FredB and FMN were mixed in vitro. Altogether the results obtained suggest that LjPAS module regulates the H2O2 production helping the cells to minimize oxidative stress in response to environmental conditions.

  10. Assessment of the domestication state of ackee (Blighia sapida K.D. Koenig) in Benin based on AFLP and microsatellite markers

    OpenAIRE

    Ekué, Marius; Gailing, Oliver; Vornam, Barbara; Finkeldey,Reiner

    2011-01-01

    Ackee (Blighia sapida) is a native multipurpose species important for the livelihoods of the rural populations in Benin. Trees are found in natural forests or are managed by farmers in different traditional agroforestry systems. Genetic variation at amplified fragment length polymorphism (AFLP) markers, four nuclear microsatellites (nSSRs) and one chloroplast microsatellite (cpSSR) were investigated in 279 individuals from six wild and eight cultivated populations from Benin. The AFLP data re...

  11. Uses, traditional management, perception of variation and preferences in ackee (Blighia sapida K.D. Koenig) fruit traits in Benin: implications for domestication and conservation

    OpenAIRE

    Eyog-Matig Oscar; Sinsin Brice; Ekué Marius RM; Finkeldey Reiner

    2010-01-01

    Abstract Background Blighia sapida is a woody perennial multipurpose fruit tree species native to the Guinean forests of West Africa. The fleshy arils of the ripened fruits are edible. Seeds and capsules of the fruits are used for soap-making and all parts of the tree have medicinal properties. Although so far overlooked by researchers in the region, the tree is highly valued by farmers and is an important component of traditional agroforestry systems in Benin. Fresh arils, dried arils and so...

  12. Uses, traditional management, perception of variation and preferences in ackee (Blighia sapida K.D. Koenig) fruit traits in Benin: implications for domestication and conservation.

    Science.gov (United States)

    Ekué, Marius R M; Sinsin, Brice; Eyog-Matig, Oscar; Finkeldey, Reiner

    2010-03-19

    Blighia sapida is a woody perennial multipurpose fruit tree species native to the Guinean forests of West Africa. The fleshy arils of the ripened fruits are edible. Seeds and capsules of the fruits are used for soap-making and all parts of the tree have medicinal properties. Although so far overlooked by researchers in the region, the tree is highly valued by farmers and is an important component of traditional agroforestry systems in Benin. Fresh arils, dried arils and soap are traded in local and regional markets in Benin providing substantial revenues for farmers, especially women. Recently, ackee has emerged as high-priority species for domestication in Benin but information necessary to elaborate a clear domestication strategy is still very sketchy. This study addresses farmers' indigenous knowledge on uses, management and perception of variation of the species among different ethnic groups taking into account also gender differences. 240 randomly selected persons (50% women) belonging to five different ethnic groups, 5 women active in the processing of ackee fruits and 6 traditional healers were surveyed with semi-structured interviews. Information collected refer mainly to the motivation of the respondents to conserve ackee trees in their land, the local uses, the perception of variation, the preference in fruits traits, the management practices to improve the production and regenerate ackee. People have different interests on using ackee, variable knowledge on uses and management practices, and have reported nine differentiation criteria mainly related to the fruits. Ackee phenotypes with preferred fruit traits are perceived by local people to be more abundant in managed in-situ and cultivated stands than in unmanaged wild stands, suggesting that traditional management has initiated a domestication process. As many as 22 diseases have been reported to be healed with ackee. In general, indigenous knowledge about ackee varies among ethnic and gender groups. With the variation observed among ethnic groups and gender groups for indigenous knowledge and preference in fruits traits, a multiple breeding sampling strategy is recommended during germplasm collection and multiplication. This approach will promote sustainable use and conservation of ackee genetic resources.

  13. The Phenotype of a Virescent Chloroplast Mutation in Tobacco Is Associated with the Absence of a 37.5 kD Thylakoid Polypeptide 1

    Science.gov (United States)

    Archer, E. Kathleen; Håkansson, Gunilla; Bonnett, Howard T.

    1987-01-01

    The Vir-c mutation is a virescent chloroplast mutation found in a line of plants derived from protoplast fusions between a Nicotina tabacum line and a line containing N. tabacum nuclei with Nicotiana suaveolens cytoplasm. Vir-c displays a lag period in chlorophyll accumulation and granal stack formation in young leaves. We examined total chloroplast protein in young leaves and showed the mutant contains 1.3 to 2.1 times less stromal protein, and 2.9 to 4.3 times less thylakoid protein when compared to the N. tabacum var “Turkish Samsun” control. Electrophoretic patterns of total thylakoid proteins indicated three polypeptides were specifically decreased in amount within the context of the overall reduction in thylakoid protein. Electrophoresis of thylakoid proteins synthesized by chloroplasts isolated from half-expanded leaves demonstrated that mutant chloroplasts did not synthesize a 37.5 kilodalton polypeptide which was synthesized by “Samsun” chloroplasts. A polypeptide of this molecular weight was synthesized by Vir-c chloroplasts isolated from mature leaves which had recovered the normal phenotype. Restriction digestion and electrophoresis of the mutant's chloroplast DNA produced a pattern of restriction fragments different from either N. tabacum or N. suaveolens chloroplast DNA. Images Fig. 1 Fig. 2 Fig. 3 Fig. 4 Fig. 5 Fig. 6 PMID:16665365

  14. Uses, traditional management, perception of variation and preferences in ackee (Blighia sapida K.D. Koenig fruit traits in Benin: implications for domestication and conservation

    Directory of Open Access Journals (Sweden)

    Eyog-Matig Oscar

    2010-03-01

    Full Text Available Abstract Background Blighia sapida is a woody perennial multipurpose fruit tree species native to the Guinean forests of West Africa. The fleshy arils of the ripened fruits are edible. Seeds and capsules of the fruits are used for soap-making and all parts of the tree have medicinal properties. Although so far overlooked by researchers in the region, the tree is highly valued by farmers and is an important component of traditional agroforestry systems in Benin. Fresh arils, dried arils and soap are traded in local and regional markets in Benin providing substantial revenues for farmers, especially women. Recently, ackee has emerged as high-priority species for domestication in Benin but information necessary to elaborate a clear domestication strategy is still very sketchy. This study addresses farmers' indigenous knowledge on uses, management and perception of variation of the species among different ethnic groups taking into account also gender differences. Methods 240 randomly selected persons (50% women belonging to five different ethnic groups, 5 women active in the processing of ackee fruits and 6 traditional healers were surveyed with semi-structured interviews. Information collected refer mainly to the motivation of the respondents to conserve ackee trees in their land, the local uses, the perception of variation, the preference in fruits traits, the management practices to improve the production and regenerate ackee. Results People have different interests on using ackee, variable knowledge on uses and management practices, and have reported nine differentiation criteria mainly related to the fruits. Ackee phenotypes with preferred fruit traits are perceived by local people to be more abundant in managed in-situ and cultivated stands than in unmanaged wild stands, suggesting that traditional management has initiated a domestication process. As many as 22 diseases have been reported to be healed with ackee. In general, indigenous knowledge about ackee varies among ethnic and gender groups. Conclusions With the variation observed among ethnic groups and gender groups for indigenous knowledge and preference in fruits traits, a multiple breeding sampling strategy is recommended during germplasm collection and multiplication. This approach will promote sustainable use and conservation of ackee genetic resources.

  15. Hafik-Düzyayla (Sivas Kd Yöresinin Stratigrafisi ve Küçük Memeli Fosillerinin Taksonomik Biyokronolojik ve Paleobiyocoğrafik İncelemesi

    Directory of Open Access Journals (Sweden)

    Fadime SUATA ALPASLAN

    2016-09-01

    Full Text Available Özet. Bu çalışma, Sivas’ın kuzey doğusunda yer alan Orta-Geç Miyosen yaşlı Hafik ve İncesu formasyonlarında gerçekleştirilmiştir. Düzyayla Orta-Geç Miyosen lokalitesinden bulunan Rodentia, Lagomorpha ve Insectivora fosilleri taksonomik olarak incelenmiş ve bu fauna topluluğunun bileşimi biyokronokronolojik ve paleobiyocoğrafik olarak yorumlanmıştır.Hafik-Düzyayla lokalitesinde 11 takson tanımlanmıştır. Bu taksonlar, altısı Rodentia, (Muridae, Cricetidae, Gerbillidae, Gliridae, Sciuridae, Eomyidae, biri Lagomorpha takımından  (Ochotonidae diğeri Insectivora takımından (Soricidae olmak üzere sekiz aileye aittir.Fauna topluluğunun göreli yaşı Rodentia ve Lagomorpha dişlerinin evrimsel aşamasına dayalı olarak çıkarılmıştır. Fauna Geç Miyosen (MN 12 olarak dikkate alınmıştır.Hafik-Düzyayla Geç Miyosen Rodentia ve Lagomorpha faunalarında geniş coğrafik dağılımları olan Avrupa ve Asya türleri baskındır.Anahtar Kelimeler: Hafik-Düzyayla, Orta-Geç Miyosen, Stratigrafi, Rodentia-Lagomorpha, Taksonomi, Biyokronoloji Abstract: This study is occurred in İncesu and Hafik formations of Middle-Late Miocene age located in the northern of Sivas. The taxonomy of the Rodentia and Lagomorpha from the Düzyayla Middle-Late Miocene locality is studied and the composition of this assemblage is interpreted in terms of biostratigraphy and palebiogeography.Eleven species of rodents belonging to six families (Muridae, Cricetidae, Gerbillidae, Gliridae, Sciuridae, Eomyidae, one of Insectivora and one of Ochotonidae are recognised.The relative age of the assemblage is inferred on the basis of the stage-of-evolution of the rodent dentitions. The fauna is considered to be of Late Miocene age (MN 12.The Middle-Late rodent and lagomorph faunas are dominated by European and Asiatic species with large geographical ranges.Keywords: Hafik-Düzyayla, Middle-Late Miocene, Stratigraphy Rodentia-Lagomorpha, Taxonomy,  Biocronology.

  16. H2O2 production rate in Lactobacillus johnsonii is modulated via the interplay of a heterodimeric flavin oxidoreductase with a soluble 28 Kd PAS domain containing protein.

    Science.gov (United States)

    Valladares, Ricardo B; Graves, Christina; Wright, Kaitlyn; Gardner, Christopher L; Lorca, Graciela L; Gonzalez, Claudio F

    2015-01-01

    Host and commensals crosstalk, mediated by reactive oxygen species (ROS), has triggered a growing scientific interest to understand the mechanisms governing such interaction. However, the majority of the scientific studies published do not evaluate the ROS production by commensals bacteria. In this context we recently showed that Lactobacillus johnsonii N6.2, a strain of probiotic value, modulates the activity of the critical enzymes 2,3-indoleamine dioxygenase via H2O2 production. L. johnsonii N6.2 by decreasing IDO activity, is able to modify the tryptophan/kynurenine ratio in the host blood with further systemic consequences. Understanding the mechanisms of H2O2 production is critical to predict the probiotic value of these strains and to optimize bacterial biomass production in industrial processes. We performed a transcriptome analysis to identify genes differentially expressed in L. johnsonii N6.2 cells collected from cultures grown under different aeration conditions. Herein we described the biochemical characteristics of a heterodimeric FMN reductase (FRedA/B) whose in vitro activity is controlled by LjPAS protein with a typical Per-Arnst-Sim (PAS) sensor domain. Interestingly, LjPAS is fused to the FMN reductase domains in other lactobacillaceae. In L. johnsonii, LjPAS is encoded by an independent gene which expression is repressed under anaerobic conditions (>3 fold). Purified LjPAS was able to slow down the FRedA/B initial activity rate when the holoenzyme precursors (FredA, FredB, and FMN) were mixed in vitro. Altogether the results obtained suggest that LjPAS module regulates the H2O2 production helping the cells to minimize oxidative stress in response to environmental conditions.

  17. Neutrophil predominance in induced sputum from asthmatic patients: Therapeutic implications and role of clara cell 16-KD protein Predominio de neutrófilos en esputo inducido de asmáticos: Implicancias terapéuticas y rol de la proteína 16-kD de la célula clara

    Directory of Open Access Journals (Sweden)

    Elisa M. Uribe Echevarría

    2011-08-01

    Full Text Available Eosinophil is considered to be a main protagonist in asthma; however, often discordances between clinical manifestations and response to treatment are observed. We aimed to determine the occurrence of neutrophil predominance in asthma and to identify its characteristics on the basis of clinical-functional features, induced sputum cellular pattern and soluble molecules, to guide the appropriated anti-inflammatory therapy. A total of 41 patients were included in randomized groups: 21-40 year-old, with stable mild-to-severe asthma, steroid-naïve and non-smokers. An induced sputum sample was obtained under basal conditions, a second one after treatment with budesonide (400 µg b.i.d. or montelukast (10 mg/d for six weeks, and a final one after a 4-week washout period. By cytospin we evaluated eosinophil (EP or neutrophil predominance (NP, and in supernatant we determined LTE4, and CC16. Peak expiratory flow variability (PEFV was measured. A total of 23/41 patients corresponded to EP and 18/41 patients to NP. The PEFV was higher in EP than in NP. LTE4 was higher with NP than with EP. No difference was found for CC16. Montelukast reduced the predominant cell in both subsets, whereas budesonide only reduced eosinophils in EP. Budesonide and montelukast reduced PEFV in EP but not in NP. Considering the total treated-samples in each subset, CC16 level increased significantly in EP. In conclusion: a NP subset of asthmatic patients was identified. These patients show a lower bronchial lability; the leukotriene pathway is involved which responds to anti-leukotriene treatment. This phenotype shows a poor recovery of CC16 level after treatment.El eosinófilo es considerado la célula protagonista principal en el asma; sin embargo, a menudo se observan discordancias entre las manifestaciones clínicas y la respuesta de los pacientes al tratamiento. Nos propusimos determinar la ocurrencia de predominio de neutrófilos en el asma e identificar las características clínico-funcionales, el patrón celular y las moléculas solubles del esputo inducido, para guiar el tratamiento apropiado anti-inflamatorio. Se incluyeron 41 pacientes: 21 a 40 años de edad, con asma estable leve a grave, no tratados con esteroides tópicos ni sistémicos y no fumadores. Se obtuvo una muestra de esputo inducido en condiciones basales, una segunda muestra después del tratamiento al azar con budesonida (400 µg dos veces al día o el montelukast (10 mg/d durante seis semanas, y una final después de un período de lavado de 4 semanas. En el frotis por citocentrifugado se evaluó el predominio de eosinófilos (EP o neutrófilos (NP, y en el sobrenadante se determinó LTE4, y CC16. Se midió la variabilidad del flujo espiratorio máximo (PEFV. Un total de 23/41 pacientes correspondieron al EP y 18/41 pacientes con NP. El PEFV fue mayor en el EP que en NP. LTE4 fue mayor en NP que en EP. No se encontraron diferencias de los niveles de CC16 en ambos grupos. Montelukast redujo la célula predominante en ambos subgrupos, mientras que budesonida sólo redujo los eosinófilos en EP. Tanto budesonida como montelukast redujeron PEFV en EP, pero no en NP. El nivel de CC16 aumentó significativamente en el EP luego del tratamiento antiinflamatorio. En conclusión: se identificó un subgrupo de asmáticos NP que presentan una menor labilidad bronquial, la vía de los leucotrienos parece estar involucrada y responde al tratamiento anti-leucotrienos. Este fenotipo muestra una escasa recuperación del nivel de CC16 posterior al tratamiento.

  18. Genotypic characterization of Orientia tsutsugamushi from patients in two geographical locations in Sri Lanka.

    Science.gov (United States)

    Premaratna, Ranjan; Blanton, Lucas S; Samaraweera, Dilhar N; de Silva, G Nalika N; Chandrasena, Nilmini T G A; Walker, David H; de Silva, H J

    2017-01-13

    To date more than 20 antigenically distinct strains of Orientia tsutsugamushi (OT) reported within the tsutsugamushi triangle that cause an undifferentiated acute febrile illness in humans. Genotypic characterization of OT in different geographic regions or within the same country, is important in order to establish effective diagnostics, clinical management and to develop effective vaccines. Genetic and antigenic characterization of OT causing human disease in OT-endemic regions is not known for Sri Lanka. Adult patients and children who were admitted with an acute febrile illness and presumed to having acute scrub typhus based on presence of an eschar and other supporting clinical features were recruited. Eschar biopsies and buffy coat samples collected from patients who were confirmed having OT by IFA were further studied by real time PCR (Orientia 47 kD) and nested PCR (Orientia 56 kD) amplification. DNA sequences were obtained for 56 kD gene amplicons and phylogenetic comparisons were analyzed using currently available data in GenBank [Neucleotide substitution per 100 residues, 1000 Bootstrap Trials]. Twenty eschar biopsies (Location1,19, Location 2,1) and eight buffy coat samples (Location1,6, Location2,2) examined by real time PCR revealed Orientia amplicons in 16 samples. DNA sequences were obtained for the 56 kD gene amplicons in 12 eschars and 4 buffy coat samples. The genotypes of the Location1 samples revealed that, 7 exhibiting close homology with JP1 [distantly related to UT177 Thai (Karp related)], five had close homology with Kato strain, two had close homology with JGv and JG AF [Distantly related to Kawasaki M63383] and one had close homology with Gilliam strain. The Location 2 strain was closely related to Kuroki-Boryong L04956, the genotype which is distributed in far eastern Asia. Similar to other patients in the cohort this patient also had never travelled out of Sri Lanka. We observed all three main OT genotypes in Sri Lanka, and the majority

  19. Display of a high-pT H → ZZ* → eeμμ decay (mH = 130 GeV), after full simulation and reconstruction in the ATLAS detector

    CERN Multimedia

    ATLAS, Experiment

    2014-01-01

    The four leptons and the recoiling jet with ET = 135 GeV are clearly visible. Hits in the Inner Detector are shown in green for the four reconstructed leptons, both for the precision tracker (pixel and silicon micro-strip detectors) at the inner radii and for the transition radiation tracker at the outer radii. The other tracks reconstructed with pT > 0.5 GeV in the Inner Detector are shown in blue. The two electrons are depicted as reconstructed tracks in yellow and their energy deposits in each layer of the electromagnetic LAr calorimeter are shown in red. The two muons are shown as combined reconstructed tracks in orange, with the hit strips in the resistive-plate chambers and the hit drift tubes in the monitored drift-tube chambers visible as white lines in the barrel muon stations. The energy deposits from the muons in the barrel tile calorimeter can also be seen in purple.

  20. International metal-on-metal multidisciplinary teams: do we manage patients with metal-on-metal hip arthroplasty in the same way? An analysis from the International Specialist Centre Collaboration on MOM Hips (ISCCoMH).

    Science.gov (United States)

    Berber, R; Skinner, J; Board, T; Kendoff, D; Eskelinen, A; Kwon, Y-M; Padgett, D E; Hart, A

    2016-02-01

    There are many guidelines that help direct the management of patients with metal-on-metal (MOM) hip arthroplasties. We have undertaken a study to compare the management of patients with MOM hip arthroplasties in different countries. Six international tertiary referral orthopaedic centres were invited to participate by organising a multi-disciplinary team (MDT) meeting, consisting of two or more revision hip arthroplasty surgeons and a musculoskeletal radiologist. A full clinical dataset including history, blood tests and imaging for ten patients was sent to each unit, for discussion and treatment planning. Differences in the interpretation of findings, management decisions and rationale for decisions were compared using quantitative and qualitative methods. Overall agreement between the orthopaedic centres and the recommended treatment plans for the ten patients with MOM hip implants was moderate (kappa = 0.6). Full agreement was seen in a third of cases, however split decisions were also seen in a third of cases. Units differed in their interpretation of the significance of the investigation findings and put varying emphasis on serial changes, in the presence of symptoms. In conclusion, the management of raised or rising blood metal ions, cystic pseudotumours and peri-acetabular osteolysis led to inconsistency in the agreement between centres. Coordinated international guidance and MDT panel discussions are recommended to improve consensus in decision making. A lack of evidence and the subsequent variation in regulator guidance leads to differences in opinions, the clinical impact of which can be reduced through a multi-disciplinary team approach to managing patients with MOM hip implants. Cite this article: Bone Joint J 2016;98-B:179-86. ©2016 The British Editorial Society of Bone & Joint Surgery.

  1. Estimate of the $m_H$ shift due to interference between signal and background processes in the $H \\rightarrow \\gamma\\gamma$ channel, for the $\\sqrt{s} = 8$ TeV dataset recorded by ATLAS

    CERN Document Server

    The ATLAS collaboration

    2016-01-01

    In the context of precision measurements of the properties of the Higgs boson, one of the most fundamental parameters is the knowledge of its mass. One of the achievements of the first run of the LHC is the precise estimate of the Higgs Boson mass, that has been measured by the ATLAS and CMS collaborations at a precision of 0.2\\% using $H \\to \\gamma \\, \\gamma$ and $H \\to Z \\, Z^* \\to 4 \\ell$ final states. In the analysis of the experimental data, interference effects of non-resonant $gg \\to \\gamma \\gamma$ and other processes with resonant $gg \\to H \\to \\gamma \\gamma$ production are not taken into account. The real part of the interference terms change the line-shape of $m_{\\gamma \\gamma}$ in such a way that an apparent mass shift appears. In this note a study is carried out that quantifies the expected shift of the mass peak position for the SM Higgs boson in the $H \\to \\gamma \\gamma$ channel for the ATLAS measurement. The purpose is to perform this analysis using the correct detector description and event ca...

  2. Elaboration and characterization of magnesium-substituted La{sub 5}Ni{sub 19} hydride forming alloys as active materials for negative electrode in Ni-MH battery

    Energy Technology Data Exchange (ETDEWEB)

    Ferey, Amelie; Cuevas, Fermin [ICMPE CMTR CNRS UMR 7182, 2-8 rue Henri Dunant, 94320 Thiais Cedex (France); Latroche, Michel [ICMPE CMTR CNRS UMR 7182, 2-8 rue Henri Dunant, 94320 Thiais Cedex (France)], E-mail: michel.latroche@icmpe.cnrs.fr; Knosp, Bernard [SAFT, Direction de la Recherche, 111-113 boulevard Alfred Daney, 33074 Bordeaux (France)], E-mail: bernard.knosp@saftbatteries.com; Bernard, Patrick [SAFT, Direction de la Recherche, 111-113 boulevard Alfred Daney, 33074 Bordeaux (France)

    2009-02-15

    The crystallographic structure as well as the thermodynamic and electrochemical properties of the hydrogen absorbing compounds La{sub 5}Ni{sub 19} and La{sub 4}MgNi{sub 19} have been determined. X-ray diffraction and microprobe analysis have shown the presence of a single hexagonal (P6{sub 3}/mmc) phase for the Mg-free binary compound whereas only one composition but two different crystallographic structures, hexagonal (P6{sub 3}/mmc) and rhombohedral (R-3m), are observed for La{sub 4}MgNi{sub 19}. Each phase can be described as the stacking along the c-axis of n[A{sub 2}B{sub 4}]/m[AB{sub 5}] sub-units with n = 1 and m = 3 and A = La, Mg; B = Ni. Depending on the stacking sequence, either the hexagonal or the rhombohedral phase is obtained. Thermodynamic properties toward hydrogen uptake (capacity and equilibrium pressure) and electrochemical properties (cycling behavior) in alkaline medium have been measured and are compared for these compounds with and without magnesium. It is observed that the Mg-free compound exhibits a much lower reversible hydrogen capacity than the Mg-containing one. However, despite larger capacity, this latter compound remains to be optimized in term of cycle life.

  3. The CERN CMS Barrel Design team: J. Andre, M.-H. Bovard, G. Duthion, J.-P.Girod, J.-P. Grillet, P. Petiot, L. Veillet, T. de Visser, G. Waurick, H. Gerwig, A. Herve.

    CERN Multimedia

    Hubert Gerwig

    2000-01-01

    After 7 years of design, calculation and hard work the first barrel ring of CMS stands free in the surface hall of P5. 1200 tonnes of steel nearly 17m high and 15m in diamter. The width is 2.5 meter. The Ferris Wheel served as a jig to build up the 3-layered ring. At the end of the assembly the ring is separated from the jig by rotating the special corner pieces and then move the whole mass on air pads.

  4. Additive Suppression of LPS-Induced IL-10 and TNF-α by Pre-treatment of Dexamethasone and SB203580 in a Murine Alveolar Macrophage Cell Line (MH-S).

    Science.gov (United States)

    Meng, Aihong; Wang, Bin; Zhang, Xiaopeng; Qi, Na; Liu, Dengchang; Wu, Jiakai

    2015-01-01

    P38 inhibitors are potent anti-inflammatory agents with distinctive mechanism of action from corticosteroid; the potential combined use of both anti-inflammatory agents could be an effective treatment for inflammatory lung disease; however, the impact of such combination on the homeostasis of immune response was poorly understood. To investigate the combined effect of dexamethasone (DEX) and/or SB203580 on tumor necrosis factor (TNF)-α (pro-inflammatory) and interleukin (IL)-10 (anti-inflammatory) secretion in mouse alveolar macrophage cell line. Secreted TNF-α and IL-10 were measured by ELISA. Phosphorylated STAT3 were investigated using Western blotting and immunocytochemistry. Pre-treatment of DEX or SB203580 inhibited lipopolysaccharide (LPS)-stimulated IL-10, TNF-α secretion, and STAT3 phosphorylation. Combined use of both agents showed stronger inhibitory effect. Combining DEX and SB203580 showed strong inhibition on the LPS-induced IL-10 secretion and STAT3 phosphorylation, which might reflect a very important drawback from the combined use of both anti-inflammatory agents.

  5. Lysophosphatidic Acid Acyltransferase from Coconut Endosperm Mediates the Insertion of Laurate at the sn-2 Position of Triacylglycerols in Lauric Rapeseed Oil and Can Increase Total Laurate Levels

    Science.gov (United States)

    Knutzon, Deborah S.; Hayes, Thomas R.; Wyrick, Annette; Xiong, Hui; Maelor Davies, H.; Voelker, Toni A.

    1999-01-01

    Expression of a California bay laurel (Umbellularia californica) 12:0-acyl-carrier protein thioesterase, bay thioesterase (BTE), in developing seeds of oilseed rape (Brassica napus) led to the production of oils containing up to 50% laurate. In these BTE oils, laurate is found almost exclusively at the sn-1 and sn-3 positions of the triacylglycerols (T.A. Voelker, T.R. Hayes, A.C. Cranmer, H.M. Davies [1996] Plant J 9: 229–241). Coexpression of a coconut (Cocos nucifera) 12:0-coenzyme A-preferring lysophosphatitic acid acyltransferase (D.S. Knutzon, K.D. Lardizabal, J.S. Nelsen, J.L. Bleibaum, H.M. Davies, J.G. Metz [1995] Plant Physiol 109: 999–1006) in BTE oilseed rape seeds facilitates efficient laurate deposition at the sn-2 position, resulting in the acccumulation of trilaurin. The introduction of the coconut protein into BTE oilseed rape lines with laurate above 50 mol % further increases total laurate levels. PMID:10398708

  6. Global Transcriptomic Analysis of Targeted Silencing of Two Paralogous ACC Oxidase Genes in Banana

    OpenAIRE

    Xia, Yan; Kuan, Chi; Chiu, Chien-Hsiang; Chen, Xiao-Jing; Do, Yi-Yin; Huang, Pung-Ling

    2016-01-01

    Among 18 1-aminocyclopropane-1-carboxylic acid (ACC) oxidase homologous genes existing in the banana genome there are two genes, Mh-ACO1 and Mh-ACO2, that participate in banana fruit ripening. To better understand the physiological functions of Mh-ACO1 and Mh-ACO2, two hairpin-type siRNA expression vectors targeting both the Mh-ACO1 and Mh-ACO2 were constructed and incorporated into the banana genome by Agrobacterium-mediated transformation. The generation of Mh-ACO1 and Mh-ACO2 RNAi transgen...

  7. Expresión y actividad de posibles polimorfismos provenientes de individuos normales en la proteína de 67 kd del sistema NADPH oxidasa utilizando el sistema COSphox.

    Directory of Open Access Journals (Sweden)

    Andrés Augusto Arias

    2004-09-01

    Full Text Available El sistema NADPH oxidasa de las células fagocíticas cumple una función importante durante la respuesta antimicrobiana del organismo. La activación de este sistema está precedida por la translocación de las proteínas citosólicas p67phox, p47phox y p40phox hacia la membrana para ponerse en contacto con el flavocitocromo b558, lo que induce la generación del anión superóxido, un precursor de agentes microbicidas oxidantes. El presente trabajo presenta un análisis funcional del sistema NADPH oxidasa basado en los hallazgos de polimorfismos encontrados en el gen de p67phox de individuos sanos. Para esto se generaron mutaciones en el cADN que codifica la p67phox y se expresaron en el sistema de células COSphox. Los datos obtenidos en el presente trabajo indican que los cambios Val166?Ile, Pro329?Ser y His389?Gln no generan alteraciones en el funcionamiento de la p67phox cuando su función se analizó en el sistema transgénico basado en células COS-7. Por lo tanto, estos polimorfismos no generan ningún riesgo genético de producir deficiencias en la activación del sistema NADPH oxidasa. Además, se demuestra que el modelo de células COSphox representa un nuevo sistema celular, fácilmente transfectable que permite estudiar la función del sistema NADPH oxidasa de las células fagocíticas y sus particularidades genéticas. Finalmente, los hallazgos con estos polimorfismos nos permiten avanzar en el conocimiento sobre los mecanismos moleculares involucrados en la activación del sistema NADPH oxidasa células fagocíticas.

  8. Polymorphisms in the tumor necrosis factor-alpha gene at position -308 and the inducible 70 kd heat shock protein gene at position +1267 in multifetal pregnancies and preterm premature rupture of fetal membranes.

    Science.gov (United States)

    Kalish, Robin B; Vardhana, Santosh; Gupta, Meruka; Perni, Sriram C; Chasen, Stephen T; Witkin, Steven S

    2004-10-01

    The purpose of this study was to determine the relationship between preterm premature rupture of membranes, tumor necrosis factor-alpha, and heat shock protein-70 gene polymorphisms in multifetal gestations. Buccal swabs from 101 mother-neonate pairs of multifetal pregnancies were tested for single nucleotide polymorphisms at position -308 of the tumor necrosis factor-alpha gene and +1267 of the heat shock protein-70 gene. Pregnancy outcome data were obtained subsequently. Tumor necrosis factor-alpha allele 2 carriage by the first-born occurred in 10 of 27 pregnancies (37.0%) that resulted in preterm premature rupture of membranes compared with 6 of 67 pregnancies (9.0%) without preterm premature rupture of membranes ( P = .002). The allele frequency of tumor necrosis factor-alpha allele 2 and heat shock protein-70 allele 2 in the first born was higher in pregnancies that were complicated by preterm premature rupture of membranes (18.5% vs 4.5%; P = .003; and 57.7% vs 41.3%; P = .04, respectively). There was no relationship between tumor necrosis factor-alpha allele 2 or heat shock protein-70 allele 2 carriage by the second fetus or mother and preterm premature rupture of membranes. Tumor necrosis factor-alpha allele 2 and/or heat shock protein-70 allele 2 carriage by the first-born fetus is associated with preterm premature rupture of membranes in multifetal pregnancies.

  9. Differential effect on TCR:CD3 stimulation of a 90-kD glycoprotein (gp90/Mac-2BP), a member of the scavenger receptor cysteine-rich domain protein family

    DEFF Research Database (Denmark)

    Silvestri, B; Calderazzo, F; Coppola, V

    1998-01-01

    lymphocytes were stimulated with different anti-TCR:CD3 MoAbs, both in soluble and solid-phase form, gp90/Mac-2BP was able to down-regulate the proliferative response to anti-CD3 MoAb, whereas the response to anti-TCR alphabeta MoAb was enhanced. A similar differential effect was observed when a MoAb against...... CD5 (another member of the scavenger receptor superfamily) was added to anti-CD3 or anti-TCR-stimulated cells; anti-CD5 MoAb strongly down-modulated the CD3-mediated response, whereas its presence in culture was associated with potentiation of the response to TCR alphabeta agonists. gp90/Mac-2BP...... was able per se to up-regulate Ca2+ levels in freshly isolated lymphocytes; moreover, its presence in culture was associated with increased Ca2+ mobilization following stimulation with anti-TCR alphabeta, but not anti-CD3 MoAb. These data indicate that gp90/Mac-2BP could be able to influence some immune...

  10. İnsanlıkdışı Suçların İşlenmesinde Ahlakî Bağlantının Kesilmesi

    OpenAIRE

    BANDURA, Albert; ONAY, Yrd. Doç. Dr. Hamdi

    2012-01-01

    Ahlakî yargılar oluşturma ve ahlakî eylemde bulunma ka-pasitesi, hem insanlık dışı bir şekilde davranmaktan sakınma gü-cünde hem de insanca davranmak için önleyici tedbirler alma gü-cünde kendini gösterir. Ahlakî aracılık, kendine-yönelik yaptırımlarla bağlantılı kişisel ahlakî değerlerde kökleşmiş kendini-örgütleyen, önleyici tedbirler alan, kendini-gözlemleyen ve kendini-düzenleyici mekanizmaları kapsayan daha geniş bir sosyo-bilişsel öz kuramında gömülüdür. Etkinleştirilmedikleri takdirde ...

  11. Simian virus Large T antigen interacts with the N-terminal domain of the 70 kD subunit of Replication Protein A in the same mode as multiple DNA damage response factors.

    Directory of Open Access Journals (Sweden)

    Boting Ning

    Full Text Available Simian virus 40 (SV40 serves as an important model organism for studying eukaryotic DNA replication. Its helicase, Large T-antigen (Tag, is a multi-functional protein that interacts with multiple host proteins, including the ubiquitous ssDNA binding protein Replication Protein A (RPA. Tag recruits RPA, actively loads it onto the unwound DNA, and together they promote priming of the template. Although interactions of Tag with RPA have been mapped, no interaction between Tag and the N-terminal protein interaction domain of the RPA 70kDa subunit (RPA70N has been reported. Here we provide evidence of direct physical interaction of Tag with RPA70N and map the binding sites using a series of pull-down and mutational experiments. In addition, a monoclonal anti-Tag antibody, the epitope of which overlaps with the binding site, blocks the binding of Tag to RPA70N. We use NMR chemical shift perturbation analysis to show that Tag uses the same basic cleft in RPA70N as multiple of DNA damage response proteins. Mutations in the binding sites of both RPA70N and Tag demonstrate that specific charge reversal substitutions in either binding partner strongly diminish the interaction. These results expand the known repertoire of contacts between Tag and RPA, which mediate the many critical roles of Tag in viral replication.

  12. Recognizing and managing a malignant hyperthermia crisis: guidelines from the European Malignant Hyperthermia Group

    DEFF Research Database (Denmark)

    Glahn, K P E; Ellis, F.R.; Halsall, P.J.

    2010-01-01

    Survival from a malignant hyperthermia (MH) crisis is highly dependent on early recognition and prompt action. MH crises are very rare and an increasing use of total i.v. anaesthesia is likely to make it even rarer, leading to the potential risk of reduced awareness of MH. In addition, dantrolene....... The guidelines consist of two textboxes: Box 1 on recognizing MH and Box 2 on the treatment of an MH crisis...

  13. Transfer of Maleic Hydrazide into Mainstream Cigarette Smoke

    Directory of Open Access Journals (Sweden)

    Wood W

    2014-12-01

    Full Text Available This report presents the results of a study regarding the transfer of maleic hydrazide (MH into mainstream cigarette smoke. Cigarettes with different levels of MH were used in this study. This included cigarettes with MH preexistent in the tobacco due to the agronomical practice, and with spiked MH. Because the MH can be present in tobacco as bound and free forms, both levels of MH were measured in the tobacco section. The cigarette designs covered a range of possibilities, including Plain, Filter King Size (KS, Lights 100’s, Ultra Lights, etc. The results showed that the amount of MH in smoke, on the one hand, is a function of the total particulate matter (TPM of the cigarette, and higher TPM levels lead to more MH in smoke. On the other hand, the transferred level of MH depends on the total amount of MH (both bound and free in the tobacco. The relative % transfer is higher for lower MH levels than for higher MH levels in tobacco. When normalized by TPM, the transfer as an average is about 0.24% per mg of TPM from the amount of MH in 1 g of tobacco, and as high as 0.46% per mg of TPM from the amount of MH in 1 g tobacco for a nonfilter low MH level cigarette. The resulting MH transfer for a nonfilter cigarette with low tobacco MH is therefore about 8.3% from the total MH in the cigarette. For filter full flavor (FF cigarettes with high tobacco levels of MH, the transfer is about 5.8%. This relative transfer rate appears to be lower from higher MH levels in tobacco.

  14. The Fate of Maleic Hydrazide on Tobacco during Smoking

    Directory of Open Access Journals (Sweden)

    Hongfei Zhang

    2012-01-01

    Full Text Available Tobacco mainstream smoke (MSS and sidestream smoke (SSS, butts, and ashes from commercial cigarettes and maleic hydrazide (MH spiked cigarettes were analyzed for their MH contents. The MH transfer rates obtained for MSS ranged from 1.4% to 3.7%, for SSS ranged from 0.2% to 0.9%, and for butts ranged from 1.1% to 1.9%. And as expected, MH is absent in ashes. The transfer rate of MH into mainstream smoke is the top one during in transfer rate into main-stream, side-stream, ashes, and butts, and higher MH levels lead to more MH in smoke. Further, analysis of total MH in butts and ashes along with that in MSS and SSS indicates that much MH is destructed during the smoking process.

  15. Identification and expression analysis of chitinase genes in parasitic plant Monotropa hypopitys.

    Science.gov (United States)

    Kochieva, E Z; Filyushin, M A; Beletsky, A V; Ravin, N V; Skryabin, K G

    2017-03-01

    Genes encoding six chitinases, five of which belong to classes I (MhCHI3 and MhCHI4), IV (MhCHI1), V (MhCHI5), and VII (MhCHI2), were identified in the transcriptome of the parasitic mixoheterotrophic plant Monotropa hypopitys. The transcription level of MhCHI5 and MhCHI1 was low; however, in the leaves (bracts) and roots it was higher than in flowers. MhCHI4 transcripts were detected primarily in the flowers and were almost absent in the roots, whereas the expression level of MhCHI3 was relatively high in all organs but maximum in the leaves (bracts).

  16. Association between mental health and physical activity in patients with chronic heart failure.

    Science.gov (United States)

    Izawa, Kazuhiro P; Watanabe, Satoshi; Oka, Koichiro; Hiraki, Koji; Morio, Yuji; Kasahara, Yusuke; Osada, Naohiko; Omiya, Kazuto; Shimizu, Hiroyuki

    2014-01-01

    Poor mental health (MH) is common in chronic heart failure (CHF) patients. No studies have reported a relation between MH status and objectively measured physical activity (PA) in CHF patients. The study aim was to determine self-reported MH-related differences associated with PA and target values of PA for improved MH in CHF outpatients. We divided 243 CHF outpatients (mean age 57.1 years) into two groups according to MH assessed by Short Form-36 score: high-MH (≥68 points) group (n = 148) and poor-MH (PA (EE) (kcal) per day for 1 week of PA were assessed by an accelerometer and compared between groups. PA resulting in high MH was determined by the receiver-operating characteristic (ROC) analysis. PA correlated positively with MH in all patients (steps: r = 0.46, p EE: r = 0.43, p EE were significantly lower in the poor-MH versus high-MH group (5020.1 ± 280.7 versus 7174.1 ± 221.5 steps, p PA target values associated with improved MH. Poor MH status may reduce PA. Attaining PA target values may improve MH status of CHF outpatients.

  17. Characterization of pseudogenes in members of the order Frankineae

    Indian Academy of Sciences (India)

    2013-10-01

    Oct 1, 2013 ... the different tracks to gene destruction. Genome Biol. 9 R42. Lawrence JG and Ochman H 1997 Amelioration of bacterial ge- nomes: rates of change and exchange. J. Mol. Evol. 44 383–387. Lawrence JG and Ochman H 1998 Molecular archaeology of the. Escherichia coli genome. Proc. Natl. Acad. Sci.

  18. Data of evolutionary structure change: 1JGZL-2UWUM [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1JGZL-2UWUM 1JGZ 2UWU L M -----ALLSFE--------------RKYRVPGG--TLVG.../alignment> 0 1JGZ L 1JG...ex> 1JGZ L 1JGZL YGL...A CA 337 GLU CA 295 ARG CA 280 1JG...Z L 1JGZL AANPEKGKEMRTPDH

  19. Specificity of drug transport mediated by CaMDR1: a major facilitator ...

    Indian Academy of Sciences (India)

    Unknown

    independently expressed in a common hypersensitive host JG436 of Saccharomyces cerevisiae. This allowed a better comparison between the ... 2.2 Yeast strains and growth media. S. cerevisiae strain JG436, which lacks a ... 80% inhibition of growth compared with drug free controls. 2.6 Radio-labelled drug accumulation ...

  20. Renin secretion from permeabilized juxtaglomerular cells requires a permeant cation

    DEFF Research Database (Denmark)

    Jensen, B L; Ellekvist, Peter; Skøtt, O

    1999-01-01

    The cytosolic concentration of chloride correlates directly with renin secretion from renal juxtaglomerular granular (JG) cells. In the present study, the mechanism by which chloride stimulates renin release was investigated in a preparation of permeabilized rat glomeruli with attached JG cells. ...

  1. Osmotically sensitive renin release from permeabilized juxtaglomerular cells

    DEFF Research Database (Denmark)

    Jensen, B L; Skøtt, O

    1993-01-01

    Renin secretion from juxtaglomerular (JG) cells is sensitive to external osmolality in a way that has been suggested to depend either on cellular volume or on effects on secretory granules. To distinguish between these possibilities, a technique for permeabilization of JG cell membranes was devel...

  2. Research

    African Journals Online (AJOL)

    ebutamanya

    2013-07-05

    Jul 5, 2013 ... Prediction and prevention of recurrent preterm birth. Obstet Obstet Gynecol. 2007 Aug;110(2 Pt 1):405-15. PubMed| Google Scholar. 2. Onrust S, Santema JG, Aarnoudse JG. Pre-eclampsia and the. HELLP syndrome still cause maternal mortality in the. Netherlands and other developed countries: can we ...

  3. Preliminary Studies on Microbial Degradation of Plastics Used in ...

    African Journals Online (AJOL)

    The conditions for the pigmentation could not be ascertained. However, the pigment absorbed radiation within UV region and formed a precipitate with ferric chloride. ... DSC measurement further showed ÄH as 89.936 J/g before and 31.945 J/g after microbial degradation. A decrease was also observed in the crystallization ...

  4. Proteinogramas séricos de ratos Wistar experimentalmente infectados com Trypanosoma evansi Serum protein concentrations in Wistar rats experimentally infected with Trypanosoma evansi

    Directory of Open Access Journals (Sweden)

    M.C.A. Teixeira

    2008-12-01

    Full Text Available Estabeleceu-se o perfil eletroforético de proteínas séricas de ratos Wistar experimentalmente infectados com Tripanosoma evansi, utilizando-se 40 ratos, distribuídos em oito grupos de cinco animais cada. Um grupo foi mantido como testemunho (G1, e os demais (G2 a G8 foram inoculados, via intraperitoneal, com cerca de 10³tripomastigota de T. evansi. Amostras de sangue para obtenção de soro foram coletadas no quinto (G2, 10º (G3, 15º (G4, 30º (G5, 45º (G6, 60º (G7 e 75º (G1 e G8 dia após as inoculações. O fracionamento das proteínas foi realizado pela técnica SDS-PAGE. Foram identificadas 31 proteínas, sendo sete de fase aguda: ceruloplasmina (101KD, hemopexina (83KD, transferrina (75KD, albumina (66KD, antitripsina (60KD, haptoglobina (44KD e glicoproteína ácida (38KD. As proteínas com pesos moleculares 12KD; 22KD; 25KD; 28KD; 32,5KD; 35KD; 53,5KD; 63KD e 72KD apareceram apenas nos ratos inoculados com T. evansi.This study established the electrophoretic profile of serum proteins of Wistar rats experimentally infected with Tripanosoma evansi. For such, 40 rats were allocated into eight groups of five animals. A group was kept as control (G1 and the others (G2 to G8 were intraperitoneally inoculated with 1.0 x 10³ tripomastigote of T. evansi. Blood samples were collected at 5th (G2, 10th (G3, 15th (G4, 30th (G5, 45th (G6, 60th (G7, and 75th (G1 and G8 days after inoculation (DAI. The serum protein concentrations were determined by means of sodium dodecyl sulphate-polyacrylamide gel electrophoresis. Thirty-one distinct proteins were identified, seven of these were identified as acute phase proteins: ceruloplasmin (110KD, hemopexin (83KD, transferrin (75KD, albumin (66KD, antitrypsin (60KD, haptoglobin (44KD, and acid glycoprotein (38KD. The proteins with molecular weights 12KD; 22KD; 25KD; 28KD; 32,5KD; 35KD; 53,5KD; 63KD, and 72KD were found only in infected rats.

  5. Influenza infection and Kawasaki disease

    Directory of Open Access Journals (Sweden)

    Xijing Huang

    2015-06-01

    Full Text Available INTRODUCTION: The objective of this study was to investigate the possible link between influenza (Flu infection and Kawasaki disease (KD. METHODS: We examined the medical records of 1,053 KD cases and 4,669 influenza infection cases hospitalized at our institute from January 1, 2011 to December 31, 2013. Cases of KD with concomitant influenza infection formed the KD + Flu group. Each KD + Flu case was matched with 2 KD cases and 2 influenza infection cases, and these cases were assigned to the KD group and Flu group, respectively. The differences in the principal clinical manifestations, course of disease, incomplete KD rate, intravenous immunoglobulin (IVIG resistance rate, and echocardiographic detection results between the KD + Flu group and KD group were compared. The fever durations and laboratory test results of these three groups were compared. RESULTS: 1 The seasonal variations of the KD + Flu group, KD group and Flu group were similar. 2 The morbidity rate of incomplete KD was higher in the KD + Flu group compared with the KD group. 3 Patients in the KD + Flu group exhibited a longer time to KD diagnosis compared with patients in the KD group. 4 The KD + Flu group exhibited the longest fever duration among the three groups. 5 The CRP and ESR values in the KD + Flu group were higher those in the Flu or KD groups. CONCLUSIONS: Concomitant influenza infection affects the clinical manifestations of KD and can impact the laboratory test results and the diagnosis and treatment of the disease. However, it remains unclear whether influenza contributes to KD etiology.

  6. The "Egg of Columbus" for making the world's toughest fibres.

    Directory of Open Access Journals (Sweden)

    Nicola M Pugno

    Full Text Available In this letter we present the "Egg of Columbus" for making fibres with unprecedented toughness: a slider, in the simplest form just a knot, is introduced as frictional element to dissipate additional energy and thus demonstrating the existence of a previously "hidden" toughness. The proof of concept is experimentally realized making the world's toughest fibre, increasing the toughness modulus of a commercial Endumax macroscopic fibre from 44 J/g up to 1070 J/g (and of a zylon microfiber from 20 J/g up to 1400 J/g. The ideal upperbound toughness is expected for graphene, with a theoretical value of ∼10(5 J/g. This new concept, able of maximizing (one fold increment the structural robustness, could explain the mysterious abundance of knot formations, in spite of their incremental energy cost and topological difficulty, in biological evolved structures, such as DNA strands and proteins.

  7. The “Egg of Columbus” for Making the World's Toughest Fibres

    Science.gov (United States)

    Pugno, Nicola M.

    2014-01-01

    In this letter we present the “Egg of Columbus” for making fibres with unprecedented toughness: a slider, in the simplest form just a knot, is introduced as frictional element to dissipate additional energy and thus demonstrating the existence of a previously “hidden” toughness. The proof of concept is experimentally realized making the world's toughest fibre, increasing the toughness modulus of a commercial Endumax macroscopic fibre from 44 J/g up to 1070 J/g (and of a zylon microfiber from 20 J/g up to 1400 J/g). The ideal upperbound toughness is expected for graphene, with a theoretical value of ∼105 J/g. This new concept, able of maximizing (one fold increment) the structural robustness, could explain the mysterious abundance of knot formations, in spite of their incremental energy cost and topological difficulty, in biological evolved structures, such as DNA strands and proteins. PMID:24695084

  8. The "Egg of Columbus" for making the world's toughest fibres.

    Science.gov (United States)

    Pugno, Nicola M

    2014-01-01

    In this letter we present the "Egg of Columbus" for making fibres with unprecedented toughness: a slider, in the simplest form just a knot, is introduced as frictional element to dissipate additional energy and thus demonstrating the existence of a previously "hidden" toughness. The proof of concept is experimentally realized making the world's toughest fibre, increasing the toughness modulus of a commercial Endumax macroscopic fibre from 44 J/g up to 1070 J/g (and of a zylon microfiber from 20 J/g up to 1400 J/g). The ideal upperbound toughness is expected for graphene, with a theoretical value of ∼10(5) J/g. This new concept, able of maximizing (one fold increment) the structural robustness, could explain the mysterious abundance of knot formations, in spite of their incremental energy cost and topological difficulty, in biological evolved structures, such as DNA strands and proteins.

  9. Renin release from permeabilized juxtaglomerular cells is stimulated by chloride but not by low calcium

    DEFF Research Database (Denmark)

    Jensen, B L; Skøtt, O

    1994-01-01

    The intracellular concentrations of calcium and chloride have been suggested to be involved in the control of renin secretion from juxtaglomerular (JG) cells. We have tested these propositions on permeabilized JG cells. Rat glomeruli with attached JG cells were isolated by the magnetic iron......M]. These maneuvers had no effect on renin release, while 1.5 mM calcium caused a stimulation, which was not inhibited by 50 mM sucrose. Isosmotic increases in the chloride concentration to 25, 60, and 132 mM resulted in prompt stimulations of renin release. Similarly, iodide and nitrate stimulated renin release. We...... conclude that renin release from permeabilized JG cells is unaffected by calcium concentrations in the nano- and micromolar range, while the release is stimulated by chloride or other permeant anions. We suggest that in intact JG cells an increase in calcium inhibits renin release through activation...

  10. Electrochemical properties of LaNi{sub 4.2}Co{sub 0.4}Zn{sub 0.1}Al{sub 0.3} and LaNi{sub 4.3}Co{sub 0.4}Zn{sub 0.1}Al{sub 0.2} alloys as anode materials for Ni-MH batteries

    Energy Technology Data Exchange (ETDEWEB)

    Giza, Krystyna [Czestochowa Univ. of Technology (Poland). Faculty of Production Engineering and Materials Technology

    2017-07-01

    The galvanostatic charge and discharge technique was used for the evaluation of the changes in electrochemical parameters of the tested metal hydride electrodes during the repeated hydrogen absorption and desorption processes. Higher development of the effective surface area during hydrogenation has been obtained for LaNi{sub 4.3}Co{sub 0.4}Zn{sub 0.1}Al{sub 0.2} composite electrode. For the conditions of current ± 0.5 C, the discharge capacities of LaNi{sub 4.2}Co{sub 0.4}Zn{sub 0.1}Al{sub 0.3} and LaNi{sub 4.3}Co{sub 0.4}Zn{sub 0.1}Al{sub 0.2} alloys are 240 and 316 mAh x g{sup -1}, respectively. From the point of view of improving the kinetics of the process of charge transfer at the electrode/electrolyte interface as well as a resistance to self-discharging, a partial substitution of nickel with zinc in the LaNi{sub 4.3}Co{sub 0.4}Al{sub 0.3} alloy is not favorable.

  11. Influence of electroless coatings of Cu, Ni-P and Co-P on MmNi{sub 3.25}Al{sub 0.35}Mn{sub 0.25}Co{sub 0.66} alloy used as anodes in Ni-MH batteries

    Energy Technology Data Exchange (ETDEWEB)

    Raju, M. [Nickel-Metal Hydride Battery Section, Electrochemical Power Sources Division, Central Electrochemical Research Institute, Karaikudi 630006 (India); Ananth, M.V. [Nickel-Metal Hydride Battery Section, Electrochemical Power Sources Division, Central Electrochemical Research Institute, Karaikudi 630006 (India)], E-mail: mvananth@rediffmail.com; Vijayaraghavan, L. [Manufacturing Engineering Section, Department of Mechanical Engineering, Indian Institute of Technology Madras, Chennai 600036 (India)

    2009-05-05

    Electroless coatings of Ni-P, Co-P and Cu were applied on the surface of non-stoichiometric MmNi{sub 3.25}Al{sub 0.35}Mn{sub 0.25}Co{sub 0.66} (Mm: misch metal) metal hydride alloy. Elemental analysis was made with Energy Dispersive X-ray Analysis (EDAX). The structural analysis of bare and coated alloys was done by X-ray diffraction (XRD) whereas surface morphology was examined with scanning electron microscope (SEM) and transmission electron microscope (TEM). The electrode characteristics inclusive of electrochemical capacity and cycle life were studied at C/5 rate. Superior performance is obtained with copper coated alloy. Microstructure observations indicate that the observed excellent performance could be attributed to uniform and efficient surface coverage with copper. Also, lanthanum surface enrichment in samples during Cu coating leads to improvement in performance. It is inferred from electro analytical investigations that copper coatings act as microcurrent collectors with alterations in hydrogen transport mechanism and facilitate charge transfer reaction on the alloy surface without altering battery properties. Moreover, supportive first time TEM evidence of existence of such copper nano current collectors (about 8 nm in diameter and length about 20 nm) is reported.

  12. Congenital central hypoventilation syndrome and desogestrel: a call for caution: addendum to "C. Straus, H. Trang, M.H. Becquemin, P. Touraine, T. Similowski, Chemosensitivity recovery in Ondine's curse syndrome under treatment with desogestrel" [Respir. Physiol. Neurobiol. 171 (2010) 171-174].

    Science.gov (United States)

    Straus, Christian; Similowski, Thomas

    2011-09-15

    Patients suffering from congenital central hypoventilation syndrome (CCHS) depend on mechanical ventilation during sleep, from birth and throughout life. They lack CO₂-chemosensitivity. Hope has recently been raised by serendipitous observations of chemosensitivity recovery under treatment by desogestrel, a very potent progestin (Straus et al., 2010). Caution is however needed, because this effect could depend on dose, idiosyncrasies, or be transient. Desogestrel should not be prescribed to CCHS patients with a respiratory purpose until the results of a pending clinical trial (clinicaltrials.gov. NCT01243697) are available. Copyright © 2011 Elsevier B.V. All rights reserved.

  13. Descriptive Epidemiology of Major Depressive Disorder in Canada in 2012

    National Research Council Canada - National Science Library

    Patten, Scott B; Williams, Jeanne V A; Lavorato, Dina H; Wang, Jian Li; McDonald, Keltie; Bulloch, Andrew G M

    2015-01-01

    ...—Mental Health (CCHS-MH). Method: The CCHS-MH employed an adaptation of the World Health Organization World Mental Health Composite International Diagnostic Interview and had a sample of n = 25 113...

  14. Relationship among shoulder proprioception, kinematics, and pain after stroke

    NARCIS (Netherlands)

    Niessen, M.H.M.; Veeger, H.E.J.; Meskers, C.G.M.; Koppe, P.A.; Konijnenbelt, M.H.; Janssen, T.W.J.

    2009-01-01

    Niessen MH, Veeger DH, Meskers CG, Koppe PA, Konijnenbelt MH, Janssen TW. Relationship among shoulder proprioception, kinematics, and pain after stroke. Objective: To identify a possible relationship among chronic poststroke shoulder pain (PSSP), scapular resting pose, and shoulder proprioception.

  15. Dicty_cDB: VFL760 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available fvnn*FVFLKKKRXSEATXVELLKRLDQAXTRL EAVEKS--- ---PAPASSAPAAPVAPAVSSTPVESKKGPGLGAVFGELSKGDGVTSGLKKVTNDMKSKN...l*iinlyf*kkkgxxkqlxlny*kd*ikxllv *kqxknq--- ---PAPASSAPAAPVAPAVSSTPVESKKGPGLGAVFGELSKGDGVTSGLKKVTNDMKSKN

  16. The superposition method in seeking the solitary wave solutions to ...

    Indian Academy of Sciences (India)

    In this paper, starting from the careful analysis on the characteristics of the Burgers equation and the KdV equation as well as the KdV-Burgers equation, the superposition method is put forward for constructing the solitary wave solutions of the KdV-Burgers equation from those of the Burgers equation and the KdV equation.

  17. Information for global mental health

    OpenAIRE

    Lora, A.; Sharan, P.

    2015-01-01

    Background. Information is needed for development of mental health (MH) services; and particularly in low- and middle-income countries (LAMICs), where the MH systems are relatively weak. World Health Organization (WHO) has worked intensively during the last 15 years for developing a strategy in the field of MH information. Methods. The paper analyzes WHO instruments developed in this area [MH Atlas series and WHO Assessment Instrument for Mental Health Systems (WHO-AIMS)]. Results. Data from ...

  18. X Chromosome Inactivation and Differentiation Occur Readily in ES Cells Doubly-Deficient for MacroH2A1 and MacroH2A2

    Science.gov (United States)

    Tanasijevic, Borko; Rasmussen, Theodore P.

    2011-01-01

    Macrohistones (mH2As) are unusual histone variants found exclusively in vertebrate chromatin. In mice, the H2afy gene encodes two splice variants, mH2A1.1 and mH2A1.2 and a second gene, H2afy2, encodes an additional mH2A2 protein. Both mH2A isoforms have been found enriched on the inactive X chromosome (Xi) in differentiated mammalian female cells, and are incorporated into the chromatin of developmentally-regulated genes. To investigate the functional significance of mH2A isoforms for X chromosome inactivation (XCI), we produced male and female embryonic stem cell (ESC) lines with stably-integrated shRNA constructs that simultaneously target both mH2A1 and mH2A2. Surprisingly, we find that female ESCs deficient for both mH2A1 and mH2A2 readily execute and maintain XCI upon differentiation. Furthermore, male and female mH2A-deficient ESCs proliferate normally under pluripotency culture conditions, and respond to several standard differentiation procedures efficiently. Our results show that XCI can readily proceed with substantially reduced total mH2A content. PMID:21738686

  19. Elasticity of methane hydrate phases at high pressure.

    Science.gov (United States)

    Beam, Jennifer; Yang, Jing; Liu, Jin; Liu, Chujie; Lin, Jung-Fu

    2016-04-21

    Determination of the full elastic constants (cij) of methane hydrates (MHs) at extreme pressure-temperature environments is essential to our understanding of the elastic, thermodynamic, and mechanical properties of methane in MH reservoirs on Earth and icy satellites in the solar system. Here, we have investigated the elastic properties of singe-crystal cubic MH-sI, hexagonal MH-II, and orthorhombic MH-III phases at high pressures in a diamond anvil cell. Brillouin light scattering measurements, together with complimentary equation of state (pressure-density) results from X-ray diffraction and methane site occupancies in MH from Raman spectroscopy, were used to derive elastic constants of MH-sI, MH-II, and MH-III phases at high pressures. Analysis of the elastic constants for MH-sI and MH-II showed intriguing similarities and differences between the phases' compressional wave velocity anisotropy and shear wave velocity anisotropy. Our results show that these high-pressure MH phases can exhibit distinct elastic, thermodynamic, and mechanical properties at relevant environments of their respective natural reservoirs. These results provide new insight into the determination of how much methane exists in MH reservoirs on Earth and on icy satellites elsewhere in the solar system and put constraints on the pressure and temperature conditions of their environment.

  20. Dicty_cDB: Contig-U04257-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available e libr... 46 1.6 1 ( FE669818 ) mh2_0020_G08 Chickpea leave library Cicer arietin... 46 1.6 1 ( FE669572 ) mh2_0018_A12 Chickpea... leave library Cicer arietin... 46 1.6 1 ( FE669126 ) mh2_0013_B03 Chickpea

  1. Recognizing and managing a malignant hyperthermia crisis: guidelines from the European Malignant Hyperthermia Group

    DEFF Research Database (Denmark)

    Glahn, K P E; Ellis, F R; Halsall, P J

    2010-01-01

    , the cornerstone of successful MH treatment, is unavailable in large areas around the world thereby increasing the risk of MH fatalities in these areas. The European Malignant Hyperthermia Group collected and reviewed all guidelines available from the various MH centres in order to provide a consensus document...

  2. Elasticity of methane hydrate phases at high pressure

    Energy Technology Data Exchange (ETDEWEB)

    Beam, Jennifer; Yang, Jing; Liu, Jin [Department of Geological Sciences, Jackson School of Geosciences, The University of Texas at Austin, Austin, Texas 78712 (United States); Liu, Chujie [Laboratory of Seismology and Physics of Earth’s Interior, School of Earth and Space Sciences, University of Science and Technology of China, Hefei, Anhui 230026 (China); Lin, Jung-Fu, E-mail: afu@jsg.utexas.edu [Department of Geological Sciences, Jackson School of Geosciences, The University of Texas at Austin, Austin, Texas 78712 (United States); Center for High Pressure Science and Advanced Technology Research (HPSTAR), Shanghai 201203 (China)

    2016-04-21

    Determination of the full elastic constants (c{sub ij}) of methane hydrates (MHs) at extreme pressure-temperature environments is essential to our understanding of the elastic, thermodynamic, and mechanical properties of methane in MH reservoirs on Earth and icy satellites in the solar system. Here, we have investigated the elastic properties of singe-crystal cubic MH-sI, hexagonal MH-II, and orthorhombic MH-III phases at high pressures in a diamond anvil cell. Brillouin light scattering measurements, together with complimentary equation of state (pressure-density) results from X-ray diffraction and methane site occupancies in MH from Raman spectroscopy, were used to derive elastic constants of MH-sI, MH-II, and MH-III phases at high pressures. Analysis of the elastic constants for MH-sI and MH-II showed intriguing similarities and differences between the phases′ compressional wave velocity anisotropy and shear wave velocity anisotropy. Our results show that these high-pressure MH phases can exhibit distinct elastic, thermodynamic, and mechanical properties at relevant environments of their respective natural reservoirs. These results provide new insight into the determination of how much methane exists in MH reservoirs on Earth and on icy satellites elsewhere in the solar system and put constraints on the pressure and temperature conditions of their environment.

  3. Susceptibility to malignant hyperthermia

    NARCIS (Netherlands)

    Snoeck, Marcus Matheus Johannes

    2004-01-01

    In this thesis the author studied the diagnostic procedures for susceptibility to malignant hyperthermia (MH), with special emphasis upon refining the biological diagnostic test and improving protocols and guidelines for investigation of MH susceptibility. MH is a pharmacogenetic disease of skeletal

  4. National integration of mental health providers in VA home-based primary care: an innovative model for mental health care delivery with older adults.

    Science.gov (United States)

    Karlin, Bradley E; Karel, Michele J

    2014-10-01

    To promote mental health (MH) service access and quality for veterans with complex and chronic medical, social, and behavioral conditions, the U.S. Department of Veterans Affairs (VA) has integrated a full-time MH provider into each VA home-based primary care (HBPC) team. The goal of the current evaluation is to examine the nature and extent to which MH care processes and practices have been integrated into HBPC nationally. Separate surveys assessing the integration of a wide range of MH care practices and HBPC team processes were sent to MH providers and program directors in each HBPC program in 2010. A total of 132 MH providers representing 119 HBPC programs, and 112 program directors completed the surveys. The most common clinical issues addressed by MH providers were depression, coping with illness and disability, anxiety, caregiver/family stress, and cognitive evaluation. Other team members typically conducted initial MH screenings, with MH providers' time focusing on cases with identified needs. Approximately 40% of MH providers' time was devoted to direct clinical care. Significant time was also spent on team activities, driving, and charting. Integration of MH services into HBPC is feasible and facilitates service access for a vulnerable population. Mental health care delivery in HPBC generally involves a high degree of interdisciplinary practice. Mental health integration into HBPC may serve as a model for other systems interested in promoting MH care delivery among homebound and other older individuals. Published by Oxford University Press on behalf of The Gerontological Society of America 2013.

  5. The Effect of the Probability of Correct Response on the Variability of Measures of Differential Item Functioning. Program Statistics Research Technical Report No. 94-4.

    Science.gov (United States)

    Zwick, Rebecca

    The Mantel Haenszel (MH; 1959) approach of Holland and Thayer (1988) is a well-established method for assessing differential item functioning (DIF). The formula for the variance of the MH DIF statistic is based on work by Phillips and Holland (1987) and Robins, Breslow, and Greenland (1986). Recent simulation studies showed that the MH variances…

  6. Vesicle-associated Membrane Protein-2 (VAMP2) Mediates cAMP-stimulated Renin Release in Mouse Juxtaglomerular Cells*

    Science.gov (United States)

    Mendez, Mariela; Gross, Kenneth W.; Glenn, Sean T.; Garvin, Jeffrey L.; Carretero, Oscar A.

    2011-01-01

    Renin is essential for blood pressure control. Renin is stored in granules in juxtaglomerular (JG) cells, located in the pole of the renal afferent arterioles. The second messenger cAMP stimulates renin release. However, it is unclear whether fusion and exocytosis of renin-containing granules is involved. In addition, the role of the fusion proteins, SNAREs (soluble N-ethylmaleimide-sensitive factor attachment proteins), in renin release from JG cells has not been studied. The vesicle SNARE proteins VAMP2 (vesicle associated membrane protein 2) and VAMP3 mediate cAMP-stimulated exocytosis in other endocrine cells. Thus, we hypothesized that VAMP2 and/or -3 mediate cAMP-stimulated renin release from JG cells. By fluorescence-activated cell sorting, we isolated JG cells expressing green fluorescent protein and compared the relative abundance of VAMP2/3 in JG cells versus total mouse kidney mRNA by quantitative PCR. We found that VAMP2 and VAMP3 mRNA are expressed and enriched in JG cells. Confocal imaging of primary cultures of JG cells showed that VAMP2 (but not VAMP3) co-localized with renin-containing granules. Cleavage of VAMP2 and VAMP3 with tetanus toxin blocked cAMP-stimulated renin release from JG cells by ∼50% and impaired cAMP-stimulated exocytosis by ∼50%, as monitored with FM1–43. Then we specifically knocked down VAMP2 or VAMP3 by adenoviral-mediated delivery of short hairpin silencing RNA. We found that silencing VAMP2 blocked cAMP-induced renin release by ∼50%. In contrast, silencing VAMP3 had no effect on basal or cAMP-stimulated renin release. We conclude that VAMP2 and VAMP3 are expressed in JG cells, but only VAMP2 is targeted to renin-containing granules and mediates the stimulatory effect of cAMP on renin exocytosis. PMID:21708949

  7. Natural Resonance Extraction and Annihilation Filtering Methods for Radar Target Identification

    Science.gov (United States)

    1990-09-01

    I1l J=NRT+1,Kd+Kn+1 AVG=AVG+ XPO )**2 111 CONTINUE IF (Kd+Kn+ 1 GT. NRT) AVG=AVG/DBLE(FLOAT(Kd+Kn+ 1-NRT)) DO 132 J=1,Kd+Kn+1 101 DO 177 K=1,Kd+Kn+1 IF...5002 3. Defense Logistic Studies Information Exchange 1 U.S. Army Logistics Management College Fort Lee, Virginia 23801-6043 4. Department Chairman

  8. Behavior of W-based materials in hot helium gas

    Czech Academy of Sciences Publication Activity Database

    Matějíček, Jiří; Vilémová, Monika; Hadraba, Hynek; Di Gabriele, F.; Kuběna, Ivo; Kolíbalová, E.; Michalička, J.; Čech, J.; Jäger, Aleš

    2016-01-01

    Roč. 9, December (2016), s. 405-410 ISSN 2352-1791. [International Conference of Fusion Reactor Material (ICFRM-17) /17./. Aachen, 11.10.2015-16.10.2015] R&D Projects: GA ČR(CZ) GA14-12837S Institutional support: RVO:61389021 ; RVO:68081723 ; RVO:68378271 Keywords : tungsten * helium * fusion materials Subject RIV: JG - Metallurgy; JG - Metallurgy (UFM-A); JG - Metallurgy (FZU-D) http://dx.doi.org/10.1016/j.nme.2016.03.009

  9. Tobacco retail environment near housing programmes for patients with mental health conditions in New York City.

    Science.gov (United States)

    Rogers, Erin S; Vargas, Elizabeth A

    2017-08-30

    The current study sought to characterise the tobacco retail environment of supportive housing facilities for persons with mental health (MH) conditions in New York City (NYC) and to estimate the potential impact of a tobacco retail ban near public schools on the retail environment of MH housing in NYC. Texas A&M Geocoding Services was used to geocode the addresses of housing programmes for patients with MH conditions, non-MH residences, public schools and tobacco retailers in NYC. ESRI ArcMap was used to calculate the number of tobacco retailers within a 500-foot radius around each housing programme and school address point, and the Euclidean distance to the nearest retailer. Generalised linear models were used to compare retail counts and distance between MH and non-MH residences. The mean number of tobacco retailers within 500 feet of an MH housing programme was 2.9 (SD=2.3) and the mean distance to nearest tobacco retailer was 370.6 feet (SD=350.7). MH residences had more retailers within 500 feet and a shorter distance to the nearest retailer compared with non-MH residences in Brooklyn, the Bronx and Staten Island (pretail environment of MH housing programmes and reduce disparities between MH and non-MH residences in some boroughs. People with MH conditions residing in supportive housing in NYC encounter a heavy tobacco retail environment in close proximity to their home, and in some boroughs, one worse than non-MH residences. Implementing a ban on tobacco retail near public schools would improve the tobacco retail environment of MH housing programmes in NYC. © Article author(s) (or their employer(s) unless otherwise stated in the text of the article) 2017. All rights reserved. No commercial use is permitted unless otherwise expressly granted.

  10. Co-instillation of nano-solid magnesium hydroxide enhances corneal permeability of dissolved timolol.

    Science.gov (United States)

    Nagai, Noriaki; Ogata, Fumihiko; Otake, Hiroko; Kawasaki, Naohito; Nakazawa, Yosuke; Kanai, Kazutaka; Okamoto, Norio; Shimomura, Yoshikazu

    2017-12-01

    We prepared magnesium hydroxide (MH) nanoparticles by a bead mill method, and investigated whether the co-instillation of MH nanoparticles improves the low transcorneal penetration of water-soluble drugs, such as the anti-glaucoma eye drug timolol maleate (TM). MH particle size was decreased by the bead mill treatment to a mean particle size of 71 nm. In addition, the MH nanoparticles were highly stable. Next, we demonstrated the effect of MH nanoparticles on the corneal surface. MH shows only slight solubility in lacrimal fluid, and the instillation of MH nanoparticles for 14 days did not affect the behavior (balance of secretion and excretion) of the lacrimal fluid in rabbit corneas. Moreover, there was no observable corneal toxicity of MH nanoparticles, and treatment with MH nanoparticles enhanced the intercellular space ratio in the eyes of rats. MH alone did not permeate into the cornea; however, the co-instillation of MH nanoparticles and dissolved TM (nMTFC) enhanced the corneal penetration of TM. In addition, the intraocular pressure (IOP)-reducing effect of nMTFC was significantly higher than those of the TM solution or the co-instillation of MH microparticles and TM. In conclusion, we found that MH nanoparticles enhance the corneal penetration of dissolved TM with no observable corneal stimulation or obstruction of the nasolacrimal duct by the MH nanoparticles. It is possible that the co-instillation of MH nanoparticles may provide a useful way to improve the bioavailability of water-soluble drugs in the ophthalmic field. These findings provide significant information that can be used to design further studies aimed at developing anti-glaucoma eye drugs. Copyright © 2017 Elsevier Ltd. All rights reserved.

  11. Petrology and Wavespeeds in Central Tibet Indicate a Partially Melted Mica-Bearing Crust

    Science.gov (United States)

    Hacker, B. R.; Ritzwoller, M. H.; Xie, J.

    2013-12-01

    Mineralogist, 81, 202-212, 1996. Duret, F., N.M. Shapiro, Z. Cao, V. Levin, P. Molnar, and S. Roecker, Surface wave dispersion across Tibet: Direct evidence for radial anisotropy in the crust, Geophysical Research Letters, 37, doi:10.1029/2010GL043811, 2010. Hacker, B.R., E. Gnos, L. Ratschbacher, M. Grove, M. McWilliams, S.V. Sobolev, W. Jiang, and Z. Wu, Hot and dry xenoliths from the lower crust of Tibet, Science, 287, 2463-2466, 2000. Mechie, J., S.V. Sobolev, L. Ratschbacher, A.Y. Babeyko, G. Bock, A.G. Jones, K.D. Nelson, K.D. Solon, L.D. Brown, and W. Zhao, Precise temperature estimation in the Tibetan crust from seismic detection of the a-b quartz transition, Geology, 32, 601-604, 2004. Xie, J., M.H. Ritzwoller, W. Shen, Y. Yang, Y. Zheng, and L. Zhou, Crustal radial anisotropy across Eastern Tibet and the Western Yangtze Craton, Journal of Geophysical Research, in press, 2013. Xu, Z.J., X. Song, and L. Zhu, Crustal and uppermost mantle S velocity structure under Hi-CLIMB seismic array in central Tibetan Plateau from joint inversion of surface wave dispersion and receiver function data, Tectonophysics, 584, 209-220, 2013. Yang, Y., M.H. Ritzwoller, Y. Zheng, W. Shen, A.L. Levshin, and Z. Xie, A synoptic view of the distribution and connectivity of the mid-crustal low velocity zone beneath Tibet, Journal of Geophysical Research, 117, 10.1029/2011JB008810, 2012.

  12. Application of metal hydride paper to simple pressure generator for use in soft actuator systems.

    Science.gov (United States)

    Ino, Shuichi; Sakaki, Kouji; Hosono, Minako; Doi, Kouki; Shimada, Shigenobu; Chikai, Manabu

    2015-01-01

    Metal hydride (MH) actuators have a simple structure and a number of features that make them attractive for use in rehabilitation engineering and assistive technology. The MH actuator provides a high power-to-weight ratio, high-strain actuation, human-compatible softness, and noiseless operation, while being environmentally benign. On the other hand, there remain technical challenges to be overcome to improve the MH actuator regarding its speed of operation and energy efficiency, given the low heat conductivity of the MH powder that is used as the pressure generator for soft actuation. To overcome the issues of low heat conductivity and the handling of MH powder, we developed an MH paper, which is a special paper incorporating MH powder and carbon fiber, for use as a new pressure-generating element for a soft MH actuator system. In addition, the basic properties and structure of the proposed MH paper were investigated through scanning electron microscopy (SEM), energy-dispersive X-ray spectroscopy (EDX), and several thermodynamic experiments. The results of these experiments showed that the hydrogen absorption and desorption rates of the MH paper were significantly higher than those of the MH powder around room temperature.

  13. Download this PDF file

    African Journals Online (AJOL)

    bif

    ,. Choudhury BC, Singh L (2004). Development and characterization of novel microsatellite markers from the olive ridley sea turtle. (Lepidochelys olivacea). Mol. Ecol. Notes. 4:77-79. Ausubel FM, Brent R, Kingsten RE, Moore DD, Seidman JG, ...

  14. Comparative trophodynamics of anchovy Engraulis encrasicolus ...

    African Journals Online (AJOL)

    Comparative trophodynamics of anchovy Engraulis encrasicolus and sardine Sardinops sagax in the southern Benguela: are species alternations between small pelagic fish trophodynamically mediated? CD van der Lingen, L Hutchings, JG Field ...

  15. Supervision: Substance and Style

    Science.gov (United States)

    Gellerman, Saul W.

    1976-01-01

    Argues that managerial style and substance are inextricably intertwined, illustrating the discussion with excerpts from an extensive study and job analysis of first-line supervisors in a food packaging plant. (JG)

  16. Participative Management at Work

    Science.gov (United States)

    Harvard Business Review, 1977

    1977-01-01

    This interview with the chief executive of Donnelly Mirrors, Inc. explains the basis of the company's leadership in participative management and discusses why it is more successful than traditional authority-based management styles. (Author/JG)

  17. Critiques of Articles, Comments on Fletcher's Efficiency Ratio, A Reply to Romberg, Montgomery, and Peaker

    Science.gov (United States)

    Romberg, Thomas A.; And Others

    1971-01-01

    A critique is given of the use of an efficiency ratio to reexamine the data of the International Study of Achievement in Mathematics. A reply to this and an earlier critique of the analysis is included. (JG)

  18. Why Data Systems in Nonprofit Organizations Fail

    Science.gov (United States)

    Herzlinger, Regina

    1977-01-01

    Analyzes the managerial shortcomings of nonprofit organizations and offers some remedies for improving their information systems and then using the data generated to produce better funding procedures and more effective training for top managers. (Author/JG)

  19. The Social Organization of the High School: School-Specific Aspects of School Crime

    Science.gov (United States)

    Ianni, Francis A. J.

    1978-01-01

    Describes a study of three New York high schools (rural, suburban, and urban) that developed a model of high school social organization in order to provide a school-specific focus for examining school violence and crime. (JG)

  20. Diagnosing Educational Leadership Problems: A Situational Approach

    Science.gov (United States)

    Gates, Philip E.; And Others

    1976-01-01

    Discusses Situational Leadership Theory, a conceptual framework that can help managers improve their performance by varying their leadership style in various situations to fit the needs and capabilities of their subordinates. (JG)

  1. Interference with Gsα-Coupled Receptor Signaling in Renin-Producing Cells Leads to Renal Endothelial Damage

    DEFF Research Database (Denmark)

    Lachmann, Peter; Hickmann, Linda; Steglich, Anne

    2017-01-01

    Intracellular cAMP, the production of which is catalyzed by the α-subunit of the stimulatory G protein (Gsα), controls renin synthesis and release by juxtaglomerular (JG) cells of the kidney, but may also have relevance for the physiologic integrity of the kidney. To investigate this possibility...... are classic signs of thrombotic microangiopathy. Additionally, we found endothelial damage in peritubular capillaries and vasa recta. Because deficiency of vascular endothelial growth factor (VEGF) results in thrombotic microangiopathy, we addressed the possibility that Gsα knockout may result in impaired...... VEGF production. We detected VEGF expression in JG cells of control mice, and cAMP agonists regulated VEGF expression in cultured renin-producing cells. Our data demonstrate that Gsα deficiency in JG cells of adult mice results in kidney injury, and suggest that JG cells are critically involved...

  2. Management by Crisis

    Science.gov (United States)

    Summers, Jim

    1977-01-01

    Compares the common but unsuccessful management method of "management by crisis" to the principles and results of sound management practice, in an attempt to enable crisis managers to recognize and overcome their mistakes. (Author/JG)

  3. Panic disorder

    Science.gov (United States)

    ... chap 32. Kang CS, Harrison BP. Anxiety and panic disorders. In: Adams JG, ed. Emergency Medicine: ... by: Fred K. Berger, MD, addiction and forensic psychiatrist, Scripps Memorial Hospital, La Jolla, ...

  4. What About the Two-Thirds of the Iceberg?

    Science.gov (United States)

    Seltzer, Richard W.

    1977-01-01

    Argues that juvenile delinquency is merely the tip of the iceberg of fundamentally disaffected youth, and suggests developing year-round residential programs, modeled after the Outward Bound program, for disaffected young people. (JG)

  5. Disease: H00430 [KEGG MEDICUS

    Lifescience Database Archive (English)

    Full Text Available 8328989 (gene, description) ... AUTHORS ... Kaplan FS, Le Merrer M, Glaser DL, Pignol...i IH, Connor JM, Delai P, Glaser DL, LeMerrer M, Morhart R, Rogers JG, Smith R, Triffitt JT, Urtizberea JA,

  6. Genetics Home Reference: Lesch-Nyhan syndrome

    Science.gov (United States)

    ... DJ, Robey KL, Barabas G, Bloem BR, Nyhan W, De Kremer R, Eddey GE, Puig JG, Reich SG; Lesch-Nyhan Disease International Study Group. Delineation of the motor disorder of Lesch-Nyhan disease. Brain. 2006 May; ...

  7. Confusion and Controversy: Brace Yourself for a Lot of Both If Congress Passes This Collective Bargaining Law for Teachers

    Science.gov (United States)

    Lieberman, Myron

    1975-01-01

    Discusses possible implications of H.R. 9730, a bill before Congress that would provide federally guaranteed collective bargaining rights for all state and local public employees, including teachers and other school employees. (JG)

  8. Disease: H00537 [KEGG MEDICUS

    Lifescience Database Archive (English)

    Full Text Available Dollfus H, Massoudi R, Gleeson JG, Andreoli SP, Doherty DG, Lindstrad A, Golzio C, Katsanis N, Pape L, Abbou...sio M, Saunier S, Antignac C, Koenekoop RK, Ren H, Lopez I, Nayir A, Stoetzel C,

  9. Test Marketing in New Product Development

    Science.gov (United States)

    Klompmaker, Jay E.; And Others

    1976-01-01

    Discusses the role of test marketing in new product development, based on interviews with marketing executives. Attempts to clarify when a test market should be done, what its aims should be, and how it should be used. (JG)

  10. Hypotonicity-induced Renin exocytosis from juxtaglomerular cells requires aquaporin-1 and cyclooxygenase-2

    DEFF Research Database (Denmark)

    Friis, Ulla G; Madsen, Kirsten; Svenningsen, Per

    2009-01-01

    The mechanism by which extracellular hypotonicity stimulates release of renin from juxtaglomerular (JG) cells is unknown. We hypothesized that osmotically induced renin release depends on water movement through aquaporin-1 (AQP1) water channels and subsequent prostanoid formation. We recorded...... membrane capacitance (C(m)) by whole-cell patch clamp in single JG cells as an index of exocytosis. Hypotonicity increased C(m) significantly and enhanced outward current. Indomethacin, PLA(2) inhibition, and an antagonist of prostaglandin transport impaired the C(m) and current responses to hypotonicity....... Hypotonicity also increased exocytosis as determined by a decrease in single JG cell quinacrine fluorescence in an indomethacin-sensitive manner. In single JG cells from COX-2(-/ -) and AQP1(-/ -) mice, hypotonicity increased neither C(m) nor outward current, but 0.1-muM PGE(2) increased both in these cells...

  11. 77 FR 31022 - Agency Information Collection Activities; Proposed Collection; Comment Request; Investigational...

    Science.gov (United States)

    2012-05-24

    ..., and Cosmetic Act (the FD&C Act) (21 U.S.C. 360j(g)) establishes the statutory authority to collect... disposition of devices, records of each subject's case history and exposure to the device, informed consent...

  12. 75 FR 2869 - Agency Information Collection Activities; Submission for Office of Management and Budget Review...

    Science.gov (United States)

    2010-01-19

    ..., Drug, and Cosmetic Act (the act) (21 U.S.C. 360j(g)) establishes the statutory authority to collect... of devices, records of each subject's case history and exposure to the device, informed consent...

  13. Randomised control trial on immediate post-operative outcomes on ...

    African Journals Online (AJOL)

    Randomised control trial on immediate post-operative outcomes on patients done either closure or non-closure of peritoneum at caesarean delivery at the Kenyatta national hospital. M Mutua, JG Wanyoike, N Kihara, JB Oyieke ...

  14. Weight Loss and Complementary Health Practices: What the Science Says

    Science.gov (United States)

    ... Blumenthal M, Goldberg A, Brinckman J, eds. Herbal Medicine: Expanded Commission E Monographs. Newton, MA: Lippincott Williams & Wilkins; 2000:287–289. Rioux JG , Ritenbaugh C . Narrative review of yoga intervention clinical trials including weight- ...

  15. Functionele aspecten van de gecomputeriseerde lexicografie

    African Journals Online (AJOL)

    1): 13-20. Kist, J.1996. Bibliodynamica: Slaag- enfaa/kansen bij innovatie van informerende systemen, in het bijzon- der in het uitgeversbedriif. Amsterdam: Cramwinckel. Kruyt, J.G. 1995. Technologies in Computerized Lexicography. Lexikos ...

  16. Glaze poisoning

    Science.gov (United States)

    ... JG, ed. Emergency Medicine . 2nd ed. Philadelphia, PA: Elsevier Saunders; 2013:chap 152. Lee DC. Hydrocarbons. In: ... Concepts and Clinical Practice . 8th ed. Philadelphia, PA: Elsevier Saunders; 2014:chap 158. Mirkin DB. Benzene and ...

  17. Meperidine hydrochloride overdose

    Science.gov (United States)

    ... Concepts and Clinical Practice . 8th ed. Philadelphia, PA: Elsevier Saunders; 2014: chap 162. Christian MR, Bryant SM. ... JG, ed. Emergency Medicine . 2nd ed. Philadelphia, PA: Elsevier Saunders; 2013:chap 147. Lank PM, Kusin S. Ethanol ...

  18. Retrenchment in Brooklyn

    Science.gov (United States)

    Sussman, Herbert M.

    1977-01-01

    A retrospective look at how severe budget reduction during the last two years affected New York City Community College, and at the difficult decisions made and issues considered in retrenchment of services and staff. (JG)

  19. School District Program Cost Accounting: An Alternative Approach

    Science.gov (United States)

    Hentschke, Guilbert C.

    1975-01-01

    Discusses the value for school districts of a program cost accounting system and examines different approaches to generating program cost data, with particular emphasis on the "cost allocation to program system" (CAPS) and the traditional "transaction-based system." (JG)

  20. Muusikamaailm : 50 aastat konkurssi Brüsselis. Festivalid Firenzes, Manchesteris, Brightonis. Herderi preemiad 2001. Edith Picht-Axenfeld lahkunud / Priit Kuusk

    Index Scriptorium Estoniae

    Kuusk, Priit, 1938-

    2001-01-01

    Brüsseli rahvusvahelisest noorte interpreetide konkursist. Firenze maifestivalist "Maggio Musicale Fiorentino", Manchesteri tshellofestivalist, Brightoni festivalist. J.G. von Herderi preemia muusika alal pälvis M.Kopelent. Lühidalt E.Picht-Axenfeld'ist