WorldWideScience

Sample records for mgr ug pgr

  1. Analysis list: PGR [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available PGR Breast,Muscle,Uterus + hg19 http://dbarchive.biosciencedbc.jp/kyushu-u/hg19/tar...get/PGR.1.tsv http://dbarchive.biosciencedbc.jp/kyushu-u/hg19/target/PGR.5.tsv http://dbarchive.biosciencedb...c.jp/kyushu-u/hg19/target/PGR.10.tsv http://dbarchive.biosciencedbc.jp/kyushu-u/hg19/colo/PGR.Breast.tsv,http://dbarchive.bioscience...dbc.jp/kyushu-u/hg19/colo/PGR.Muscle.tsv,http://dbarchive.bioscience...dbc.jp/kyushu-u/hg19/colo/PGR.Uterus.tsv http://dbarchive.biosciencedbc.jp/kyushu-u/hg19/colo/Bre

  2. CLASSIFICATION OF THE MGR SITE LAYOUT SYSTEM

    International Nuclear Information System (INIS)

    S.E. Salzman

    1999-01-01

    The purpose of this analysis is to document the Quality Assurance (QA) classification of the Monitored Geologic Repository (MGR) site layout system structures, systems and components (SSCs) performed by the MGR Safety Assurance Department. This analysis also provides the basis for revision of YMP/90-55Q, Q-List (YMP 1998). The Q-List identifies those MGR SSCs subject to the requirements of DOE/RW-0333P, ''Quality Assurance Requirements and Description'' (QARD) (DOE 1998)

  3. CLASSIFICATION OF THE MGR OFFSITE UTILITIES SYSTEM

    International Nuclear Information System (INIS)

    J.A. Ziegler

    1999-01-01

    The purpose of this analysis is to document the Quality Assurance (QA) classification of the Monitored Geologic Repository (MGR) offsite utilities system structures, systems and components (SSCs) performed by the MGR Safety Assurance Department. This analysis also provides the basis for revision of YMP/90-55Q, Q-List (YMP 1998). The Q-List identifies those MGR SSCs subject to the requirements of DOE/RW-0333P, ''Quality Assurance Requirements and Description'' (QARD) (DOE 1998)

  4. CLASSIFICATION OF THE MGR SITE OPERATIONS SYSTEM

    International Nuclear Information System (INIS)

    J.A. Ziegler

    1999-01-01

    The purpose of this analysis is to document the Quality Assurance (QA) classification of the Monitored Geologic Repository (MGR) site operations system structures, systems and components (SSCs) performed by the MGR Safety Assurance Department. This analysis also provides the basis for revision of YMP/90-55Q, Q-List (YMP 1998). The Q-List identifies those MGR SSCs subject to the requirements of DOE/RW-0333P, ''Quality Assurance Requirements and Description'' (QARD) (DOE 1998)

  5. CLASSIFICATION OF THE MGR SUBSURFACE VENTILATION SYSTEM

    International Nuclear Information System (INIS)

    R.J. Garrett

    1999-01-01

    The purpose of this analysis is to document the Quality Assurance (QA) classification of the Monitored Geologic Repository (MGR) subsurface ventilation system structures, systems and components (SSCs) performed by the MGR Safety Assurance Department. This analysis also provides the basis for revision of YMP/90-55Q, Q-List (YMP 1998). The Q-List identifies those MGR SSCs subject to the requirements of DOE/RW-0333P7 ''Quality Assurance Requirements and Description'' (QARD) (DOE 1998)

  6. Classification of the MGR Assembly Transfer System

    International Nuclear Information System (INIS)

    S.E. Salzman

    1999-01-01

    The purpose of this analysis is to document the Quality Assurance (QA) classification of the Monitored Geologic Repository (MGR) assembly transfer system structures, systems and components (SSCs) performed by the MGR Safety Assurance Department. This analysis also provides the basis for revision of YMP/90-55Q, Q-List (YMP 1998). The Q-List identifies those MGR SSCs subject to the requirements of DOE/RW-0333P, ''Quality Assurance Requirements and Description'' (QARD) (DOE 1998)

  7. CLASSIFICATION OF THE MGR SITE WATER SYSTEM

    International Nuclear Information System (INIS)

    J.A. Ziegler

    1999-01-01

    The purpose of this analysis is to document the Quality Assurance (QA) classification of the Monitored Geologic Repository (MGR) site water system structures, systems and components (SSCs) performed by the MGR Safety Assurance Department. This analysis also provides the basis for revision of YMP/90-55Q, Q-List (YMP 1998). The Q-List identifies those MGR SSCs subject to the requirements of DOE/RW-0333P, ''Quality Assurance Requirements and Description'' (QARD) (DOE 1998)

  8. CLASSIFICATION OF THE MGR EMERGENCY RESPONSE SYSTEM

    International Nuclear Information System (INIS)

    Zeigler, J.A.

    1999-01-01

    The purpose of this analysis is to document the Quality Assurance (QA) classification of the Monitored Geologic Repository (MGR) emergency response system structures, systems and components (SSCs) performed by the MGR Safety Assurance Department. This analysis also provides the basis for revision of YMP/90-55Q, Q-List (YMP 1998). The Q-List identifies those MGR SSCs subject to the requirements of DOE/RW-0333P7 ''Quality Assurance Requirements and Description'' (QARD) (DOE 1998)

  9. CLASSIFICATION OF THE MGR SUBSURFACE EXCAVATION SYSTEM

    International Nuclear Information System (INIS)

    R. Garrett

    1999-01-01

    The purpose of this analysis is to document the Quality Assurance (QA) classification of the Monitored Geologic Repository (MGR) subsurface excavation system structures, systems and components (SSCs) performed by the MGR Safety Assurance Department. This analysis also provides the basis for revision of YMP/90-55Q, Q-List (YMP 1998). The Q-List identifies those MGR SSCs subject to the requirements of DOE/RW-0333P, ''Quality Assurance Requirements and Description'' (QARD) (DOE 1998)

  10. CLASSIFICATION OF THE MGR MUCK HANDLING SYSTEM

    International Nuclear Information System (INIS)

    R. Garrett

    1999-01-01

    The purpose of this analysis is to document the Quality Assurance (QA) classification of the Monitored Geologic Repository (MGR) muck handling system structures, systems and components (SSCs) performed by the MGR Safety Assurance Department. This analysis also provides the basis for revision of YMP/90-55Q, Q-List (YMP 1998). The Q-List identifies those MGR SSCs subject to the requirements of DOE/RW-0333P, ''Quality Assurance Requirements and Description (QARD) (DOE 1998). This QA classification incorporates the current MGR design and the results of the ''Preliminary Preclosure Design Basis Event Calculations for the Monitored Geologic Repository (CRWMS M and O 1998a)

  11. MGR External Events Hazards Analysis

    International Nuclear Information System (INIS)

    Booth, L.

    1999-01-01

    The purpose and objective of this analysis is to apply an external events Hazards Analysis (HA) to the License Application Design Selection Enhanced Design Alternative 11 [(LADS EDA II design (Reference 8.32))]. The output of the HA is called a Hazards List (HL). This analysis supersedes the external hazards portion of Rev. 00 of the PHA (Reference 8.1). The PHA for internal events will also be updated to the LADS EDA II design but under a separate analysis. Like the PHA methodology, the HA methodology provides a systematic method to identify potential hazards during the 100-year Monitored Geologic Repository (MGR) operating period updated to reflect the EDA II design. The resulting events on the HL are candidates that may have potential radiological consequences as determined during Design Basis Events (DBEs) analyses. Therefore, the HL that results from this analysis will undergo further screening and analysis based on the criteria that apply during the performance of DBE analyses

  12. PRELIMINARY SELECTION OF MGR DESIGN BASIS EVENTS

    International Nuclear Information System (INIS)

    Kappes, J.A.

    1999-01-01

    The purpose of this analysis is to identify the preliminary design basis events (DBEs) for consideration in the design of the Monitored Geologic Repository (MGR). For external events and natural phenomena (e.g., earthquake), the objective is to identify those initiating events that the MGR will be designed to withstand. Design criteria will ensure that radiological release scenarios resulting from these initiating events are beyond design basis (i.e., have a scenario frequency less than once per million years). For internal (i.e., human-induced and random equipment failures) events, the objective is to identify credible event sequences that result in bounding radiological releases. These sequences will be used to establish the design basis criteria for MGR structures, systems, and components (SSCs) design basis criteria in order to prevent or mitigate radiological releases. The safety strategy presented in this analysis for preventing or mitigating DBEs is based on the preclosure safety strategy outlined in ''Strategy to Mitigate Preclosure Offsite Exposure'' (CRWMS M andO 1998f). DBE analysis is necessary to provide feedback and requirements to the design process, and also to demonstrate compliance with proposed 10 CFR 63 (Dyer 1999b) requirements. DBE analysis is also required to identify and classify the SSCs that are important to safety (ITS)

  13. CLASSIFICATION OF THE MGR MAINTENANCE AND SUPPLY SYSTEM

    International Nuclear Information System (INIS)

    J.A. Ziegler

    1999-01-01

    The purpose of this analysis is to document the Quality Assurance (QA) classification of the Monitored Geologic Repository (MGR) maintenance and supply system structures, systems and components (SSCs) performed by the MGR Safety Assurance Department. This analysis also provides the basis for revision of YMP/90-55Q, Q-List (YMP 1998). The Q-List identifies those MGR SSCs subject to the requirements of DOE/RW-0333P, ''Quality Assurance Requirements and Description'' (QARD) (DOE 1998)

  14. CLASSIFICATION OF THE MGR SITE COMPRESSED AIR SYSTEM

    International Nuclear Information System (INIS)

    J.A. Ziegler

    1999-01-01

    The purpose of this analysis is to document the Quality Assurance (QA) classification of the Monitored Geologic Repository (MGR) site compressed air system structures, systems and components (SSCs) performed by the MGR Safety Assurance Department. This analysis also provides the basis for revision of YMP/90-55Q, Q-List (YMP 1998). The Q-List identifies those MGR SSCs subject to the requirements of DOE/RW-0333P, ''Quality Assurance Requirements and Description'' (QARD) (DOE 1998)

  15. CLASSIFICATION OF THE MGR WASTE HANDLING BUILDING ELECTRICAL SYSTEM

    International Nuclear Information System (INIS)

    S.E. Salzman

    1999-01-01

    The purpose of this analysis is to document the Quality Assurance (QA) classification of the Monitored Geologic Repository (MGR) waste handling building electrical system structures, systems and components (SSCs) performed by the MGR Safety Assurance Department. This analysis also provides the basis for revision of YMP/90-55Q, Q-List (YMP 1998). The Q-List identifies those MGR SSCs subject to the requirements of DOE/RW-0333P, ''Quality Assurance Requirements and Description'' (QARD) (DOE 1998)

  16. CLASSIFICATION OF THE MGR OPERATIONS MONITORING AND CONTROL SYSTEM

    International Nuclear Information System (INIS)

    R.J. Garrett

    1999-01-01

    The purpose of this analysis is to document the Quality Assurance (QA) classification of the Monitored Geologic Repository (MGR) Operations Monitoring and Control System structures, systems and components (SSCs) performed by the MGR Safety Assurance Department. This analysis also provides the basis for revision of YMP/90-55Q, Q-List (YMP 1998). The Q-List identifies those MGR SSCs subject to the requirements of DOE/RW-0333P7 ''Quality Assurance Requirements and Description'' (QARD) (DOE 1998)

  17. CLASSIFICATION OF THE MGR WASTE EMPLACEMENT/RETRIEVAL SYSTEM

    International Nuclear Information System (INIS)

    J.A. Ziegler

    2000-01-01

    The purpose of this analysis is to document the Quality Assurance (QA) classification of the Monitored Geologic Repository (MGR) waste emplacement/retrieved system structures, systems and components (SSCs) performed by the MGR Preclosure Safety and Systems Engineering Section. This analysis also provides the basis for revision of YMP/90-55Q, Q-List (YMP 2000). The Q-List identifies those MGR SSCs subject to the requirements of DOE/RW-0333P, Quality Assurance Requirements and Description (QARD) (DOE 2000). This QA classification incorporates the current MGR design and the results of the ''Design Basis Event Frequency and Dose Calculation for Site Recommendation'' (CRWMS M andO 2000a). The content and technical approach of this analysis is in accordance with the development plan ''QA Classification of MGR Structures, Systems, and Components'' (CRWMS M andO 1999b)

  18. CLASSIFICATION OF THE MGR WASTE HANDLING BUILDING VENTILATION SYSTEM

    International Nuclear Information System (INIS)

    J.A. Ziegler

    2000-01-01

    The purpose of this analysis is to document the Quality Assurance (QA) classification of the Monitored Geologic Repository (MGR) waste handling building ventilation system structures, systems and components (SSCs) performed by the MGR Preclosure Safety and Systems Engineering Section. This analysis also provides the basis for revision of YMP/90-55Q, Q-List (YMP 2000). The Q-List identifies those MGR SSCs subject to the requirements of DOE/RW-0333P, ''Quality Assurance Requirements and Description'' (QARD) (DOE 2000). This QA classification incorporates the current MGR design and the results of the ''Design Basis Event Frequency and Dose Calculation for Site Recommendation'' (CRWMS M andO 2000a) and ''Bounding Individual Category 1 Design Basis Event Dose Calculation to Support Quality Assurance Classification'' (Gwyn 2000)

  19. Nuclear Progestin Receptor (Pgr Knockouts in Zebrafish Demonstrate Role for Pgr in Ovulation But Not in Rapid Nongenomic Steroid Mediated Meiosis Resumption

    Directory of Open Access Journals (Sweden)

    Yong eZhu

    2015-03-01

    Full Text Available Progestins, progesterone derivatives, are the most critical signaling steroid for initiating final oocyte maturation (FOM and ovulation, in order to advance fully-grown immature oocytes to become fertilizable eggs in basal vertebrates. It is well-established that progestin induces FOM via an elusive membrane receptor and a nongenomic steroid signaling process, which precedes progestin triggered ovulation that is mediated through a nuclear progestin receptor (Pgr and genomic signaling pathway. To determine whether Pgr plays a role in a nongenomic signaling mechanism during FOM, we knocked out Pgr in zebrafish using transcription activator-like effector nucleases (TALENs and studied the oocyte maturation phenotypes of Pgr knockouts (Pgr-KOs. Three TALENs-induced mutant lines with different frame shift mutations were generated. Homozygous Pgr-KO female fish were all infertile while no fertility effects were evident in homozygous Pgr-KO males. Oocytes developed and underwent FOM normally in vivo in homozygous Pgr-KO female compared to the wildtype controls, but these mature oocytes were trapped within the follicular cells and failed to ovulate from the ovaries. These oocytes also underwent normal germinal vesicle breakdown (GVBD and FOM in vitro, but failed to ovulate even after treatment with human chronic gonadotropin (HCG or progestin (17alpha,20beta-dihydroxyprogesterone or DHP, which typically induce FOM and ovulation in wildtype oocytes. The results indicate that anovulation and infertility in homozygous Pgr-KO female fish was, at least in part, due to a lack of functional Pgr-mediated genomic progestin signaling in the follicular cells adjacent to the oocytes. Our study of Pgr-KO supports previous results that demonstrate a role for Pgr in steroid-dependent genomic signaling pathways leading to ovulation, and the first convincing evidence that Pgr is not essential for initiating nongenomic progestin signaling and triggering meiosis resumption.

  20. Knockdown of Progesterone Receptor (PGR) in Macaque Granulosa Cells Disrupts Ovulation and Progesterone Production.

    Science.gov (United States)

    Bishop, Cecily V; Hennebold, Jon D; Kahl, Christoph A; Stouffer, Richard L

    2016-05-01

    Adenoviral vectors (vectors) expressing short-hairpin RNAs complementary to macaque nuclear progesterone (P) receptor PGR mRNA (shPGR) or a nontargeting scrambled control (shScram) were used to determine the role PGR plays in ovulation/luteinization in rhesus monkeys. Nonluteinized granulosa cells collected from monkeys (n = 4) undergoing controlled ovarian stimulation protocols were exposed to either shPGR, shScram, or no virus for 24 h; human chorionic gonadotropin (hCG) was then added to half of the wells to induce luteinization (luteinized granulosa cells [LGCs]; n = 4-6 wells/treatment/monkey). Cells/media were collected 48, 72, and 120 h postvector for evaluation of PGR mRNA and P levels. Addition of hCG increased (P < 0.05) PGR mRNA and medium P levels in controls. However, a time-dependent decline (P < 0.05) in PGR mRNA and P occurred in shPGR vector groups. Injection of shPGR, but not shScram, vector into the preovulatory follicle 20 h before hCG administration during controlled ovulation protocols prevented follicle rupture in five of six monkeys as determined by laparoscopic evaluation, with a trapped oocyte confirmed in three of four follicles of excised ovaries. Injection of shPGR also prevented the rise in serum P levels following the hCG bolus compared to shScram (P < 0.05). Nuclear PGR immunostaining was undetectable in granulosa cells from shPGR-injected follicles, compared to intense staining in shScram controls. Thus, the nuclear PGR appears to mediate P action in the dominant follicle promoting ovulation in primates. In vitro and in vivo effects of PGR knockdown in LGCs also support the hypothesis that P enhances its own synthesis in the primate corpus luteum by promoting luteinization. © 2016 by the Society for the Study of Reproduction, Inc.

  1. [Receptor status (ER and PgR) determined with histochemical and biochemical methods in breast carcinoma].

    Science.gov (United States)

    Simone, G; Paradiso, A; Cirillo, R; Mangia, A; Rella, G; Wiesel, S; Petroni, S; De Benedictis, G; De Lena, M

    1991-01-01

    Recently, a method similar to ER.ICA has been proposed for the progesterone receptor (PgR) using two monoclonal antibodies, JZB39 and KD68, specific for human PgR and characterized by a molecular weight of 95 and 120 Kd, respectively. A series of 73 breast cancer patients was studied with regards to ER and PgR using both immunocytochemical (ICA) and biochemical (DCC) assays. Results showed no substantial differences between the two methods when considering common clinical-pathological parameters. Overall agreement between ICA and DCC methods was found: 79% for PgR and 78% for ER. A slight quantitative correlation was also observed between the "score values" of the ICA method and the Fmol content of ER and PgR using the Brave-Pearson test (r = 0.49 for PgR; r = 0.43 for ER). Specificity of PgR.ICA method was 77% for PgR and 72% for ER; sensitivity was 82% and 83%, respectively. The ICA method is a reliable technique to assess PgR presence as well as ER. Further studies are necessary to evaluate the prognostic role of nuclear PgR.

  2. CLASSIFICATION OF THE MGR NON-FUEL COMPONENTS DISPOSAL CONTAINER SYSTEM

    International Nuclear Information System (INIS)

    J.A. Ziegler

    1999-01-01

    The purpose of this analysis is to document the Quality Assurance (QA) classification of the Monitored Geologic Repository (MGR) non-fuel components disposal container system structures, systems and components (SSCs) performed by the MGR Safety Assurance Department. This analysis also provides the basis for revision of YMP/90-55Q, Q-List (YMP 1998). The Q-List identifies those MGR SSCs subject to the requirements of DOE/RW-0333P, ''Quality Assurance Requirements and Description'' (QARD) (DOE 1998)

  3. CLASSIFICATION OF THE MGR PERFORMANCE CONFIRMATION DATA ACQUISITION/MONITORING SYSTEM

    International Nuclear Information System (INIS)

    J.A. Ziegler

    1999-01-01

    The purpose of this analysis is to document the Quality Assurance (QA) classification of the Monitored Geologic Repository (MGR) performance confirmation data acquisition/monitoring system structures, systems and components (SSCs) performed by the MGR Safety Assurance Department. This analysis also provides the basis for revision of YMP/90-55Q, Q-List (YMF 1998). The Q-List identifies those MGR SSCs subject to the requirements of DOE/RW-0333PY ''Quality Assurance Requirements and Description'' (QARD) (DOE 1998)

  4. Development of GT-MGR plant power conversion unit design

    International Nuclear Information System (INIS)

    Kostin, V.I.; Kodochigov, N.G.; Belov, S.E.; Vasyaev, A.V.; Golovko, V.F.; Shenoj, A.

    2007-01-01

    The General Atomic Company (USA) and the Pilot Design Bureau for Machine-Building (Russia) are involved in the efforts to design the GT-MGR modular helium cooled reactor and the energy conversion unit with the direct gas turbine cycle. The reactor capacity is equal to 600 MW, it is cooled by helium under 7 MPa pressure. The energy conversion unit consists of a gas turbine, a recuperator, preliminary and intermediate coolers, a generator. The turbine shaft rotation frequency is equal to 4400 rotation/minute. One analyzed the alternate designs of the energy conversion unit to choose its configuration [ru

  5. webMGR: an online tool for the multiple genome rearrangement problem.

    Science.gov (United States)

    Lin, Chi Ho; Zhao, Hao; Lowcay, Sean Harry; Shahab, Atif; Bourque, Guillaume

    2010-02-01

    The algorithm MGR enables the reconstruction of rearrangement phylogenies based on gene or synteny block order in multiple genomes. Although MGR has been successfully applied to study the evolution of different sets of species, its utilization has been hampered by the prohibitive running time for some applications. In the current work, we have designed new heuristics that significantly speed up the tool without compromising its accuracy. Moreover, we have developed a web server (webMGR) that includes elaborate web output to facilitate navigation through the results. webMGR can be accessed via http://www.gis.a-star.edu.sg/~bourque. The source code of the improved standalone version of MGR is also freely available from the web site. Supplementary data are available at Bioinformatics online.

  6. CLASSIFICATION OF THE MGR DEFENSE HIGH-LEVEL WASTE DISPOSAL CONTAINER SYSTEM

    International Nuclear Information System (INIS)

    J.A. Ziegler

    1999-01-01

    The purpose of this analysis is to document the Quality Assurance (QA) classification of the Monitored Geologic Repository (MGR) defense high-level waste disposal container system structures, systems and components (SSCs) performed by the MGR Safety Assurance Department. This analysis also provides the basis for revision of YMP/90-55Q, Q-List (YMP 1998). The Q-List identifies those MGR SSCs subject to the requirements of DOE/RW-0333PY ''Quality Assurance Requirements and Description'' (QARD) (DOE 1998)

  7. Deletion of Proton Gradient Regulation 5 (PGR5) and PGR5-Like 1 (PGRL1) proteins promote sustainable light-driven hydrogen production in Chlamydomonas reinhardtii due to increased PSII activity under sulfur deprivation.

    Science.gov (United States)

    Steinbeck, Janina; Nikolova, Denitsa; Weingarten, Robert; Johnson, Xenie; Richaud, Pierre; Peltier, Gilles; Hermann, Marita; Magneschi, Leonardo; Hippler, Michael

    2015-01-01

    Continuous hydrogen photo-production under sulfur deprivation was studied in the Chlamydomonas reinhardtii pgr5 pgrl1 double mutant and respective single mutants. Under medium light conditions, the pgr5 exhibited the highest performance and produced about eight times more hydrogen than the wild type, making pgr5 one of the most efficient hydrogen producer reported so far. The pgr5 pgrl1 double mutant showed an increased hydrogen burst at the beginning of sulfur deprivation under high light conditions, but in this case the overall amount of hydrogen produced by pgr5 pgrl1 as well as pgr5 was diminished due to photo-inhibition and increased degradation of PSI. In contrast, the pgrl1 was effective in hydrogen production in both high and low light. Blocking photosynthetic electron transfer by DCMU stopped hydrogen production almost completely in the mutant strains, indicating that the main pathway of electrons toward enhanced hydrogen production is via linear electron transport. Indeed, PSII remained more active and stable in the pgr mutant strains as compared to the wild type. Since transition to anaerobiosis was faster and could be maintained due to an increased oxygen consumption capacity, this likely preserves PSII from photo-oxidative damage in the pgr mutants. Hence, we conclude that increased hydrogen production under sulfur deprivation in the pgr5 and pgrl1 mutants is caused by an increased stability of PSII permitting sustainable light-driven hydrogen production in Chlamydomonas reinhardtii.

  8. Posttranslational modification influences the effects of MgrA on norA expression in Staphylococcus aureus.

    Science.gov (United States)

    Truong-Bolduc, Que Chi; Ding, Yanpeng; Hooper, David C

    2008-11-01

    MgrA is a global regulator in Staphylococcus aureus. Differences in the effects of MgrA on norA expression have been reported for different strains, which varied in rsbU, a gene that affects the expression of sigB, which encodes an alternative sigma factor involved in stress responses. We hypothesized that MgrA was modified by sigB-dependent factors that affected its ability to control the expression of the norA efflux pump. Heterologously expressed MgrA purified from Escherichia coli was incubated with crude extracts (CE) from strains RN6390 (rsbU) and SH1000 (rsbU(+)) and tested for binding to the norA promoter. Purified MgrA exhibited greater binding to norA promoter DNA after being incubated with SH1000 CE than MgrA incubated with the RN6390 CE. Phosphorylation of MgrA occurring in cell extracts caused it to lose the ability to bind norA promoter DNA. Overexpression of pknB, encoding a candidate serine/threonine kinase, produced increased phospho-MgrA and led to a fivefold increase in the transcript level of norA for both RN6390 and SH1000, as well as a fourfold increase in the MICs of norfloxacin and ciprofloxacin for these two strains. The levels of expression of pknB in RN6390 and SH1000, however, indicated that additional factors related to rsbU or sigB contribute to the differential regulatory effects of MgrA on norA expression.

  9. RADIATION ACCESS ZONE AND VENTILATION CONFINEMENT ZONE CRITERIA FOR THE MGR SURFACE FACILITIES

    International Nuclear Information System (INIS)

    D. A. Padula

    2000-01-01

    The objectives of this technical report are to: (1) Establish the criteria for Radiation Access Zone (RAZ) designation. (2) Establish the criteria for the Ventilation Confinement Zone (VCZ) designation. The scope will be to formulate the RAZ and VCZ zoning designation for the Monitored Geologic Repository (MGR) surface facilities and to apply the zoning designations to the current Waste Handling Building (WHB), Waste Treatment Building (WTB), and Carrier Preparation Building (CPB) configurations

  10. 46 CFR 54.01-35 - Corrosion (modifies UG- 25).

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 2 2010-10-01 2010-10-01 false Corrosion (modifies UG- 25). 54.01-35 Section 54.01-35 Shipping COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) MARINE ENGINEERING PRESSURE VESSELS General Requirements § 54.01-35 Corrosion (modifies UG- 25). (a) Vessels or portions of vessels subject to...

  11. The Staphylococcus aureus Global Regulator MgrA Modulates Clumping and Virulence by Controlling Surface Protein Expression.

    Directory of Open Access Journals (Sweden)

    Heidi A Crosby

    2016-05-01

    Full Text Available Staphylococcus aureus is a human commensal and opportunistic pathogen that causes devastating infections in a wide range of locations within the body. One of the defining characteristics of S. aureus is its ability to form clumps in the presence of soluble fibrinogen, which likely has a protective benefit and facilitates adhesion to host tissue. We have previously shown that the ArlRS two-component regulatory system controls clumping, in part by repressing production of the large surface protein Ebh. In this work we show that ArlRS does not directly regulate Ebh, but instead ArlRS activates expression of the global regulator MgrA. Strains lacking mgrA fail to clump in the presence of fibrinogen, and clumping can be restored to an arlRS mutant by overexpressing either arlRS or mgrA, indicating that ArlRS and MgrA constitute a regulatory pathway. We used RNA-seq to show that MgrA represses ebh, as well as seven cell wall-associated proteins (SraP, Spa, FnbB, SasG, SasC, FmtB, and SdrD. EMSA analysis showed that MgrA directly represses expression of ebh and sraP. Clumping can be restored to an mgrA mutant by deleting the genes for Ebh, SraP and SasG, suggesting that increased expression of these proteins blocks clumping by steric hindrance. We show that mgrA mutants are less virulent in a rabbit model of endocarditis, and virulence can be partially restored by deleting the genes for the surface proteins ebh, sraP, and sasG. While mgrA mutants are unable to clump, they are known to have enhanced biofilm capacity. We demonstrate that this increase in biofilm formation is partially due to up-regulation of SasG, a surface protein known to promote intercellular interactions. These results confirm that ArlRS and MgrA constitute a regulatory cascade, and that they control expression of a number of genes important for virulence, including those for eight large surface proteins.

  12. MGR COMPLIANCE PROGRAM GUIDANCE PACKAGE FOR RADIATION PROTECTION EQUIPMENT, INSTRUMENTATION, AND FACILITIES

    International Nuclear Information System (INIS)

    2000-01-01

    This Compliance Program Guidance Package identifies the regulatory guidance and industry codes and standards addressing radiation protection equipment, instrumentation, and support facilities considered to be appropriate for radiation protection at the Monitored Geologic Repository (MGR). Included are considerations relevant to radiation monitoring instruments, calibration, contamination control and decontamination, respiratory protection equipment, and general radiation protection facilities. The scope of this Guidance Package does not include design guidance relevant to criticality monitoring, area radiation monitoring, effluent monitoring, and airborne radioactivity monitoring systems since they are considered to be the topics of specific design and construction requirements (i.e., ''fixed'' or ''built-in'' systems). This Guidance Package does not address radiation protection design issues; it addresses the selection and calibration of radiation monitoring instrumentation to the extent that the guidance is relevant to the operational radiation protection program. Radon and radon progeny monitoring instrumentation is not included in the Guidance Package since such naturally occurring radioactive materials do not fall within the NRC's jurisdiction at the MGR

  13. Phosphorylation of MgrA and its effect on expression of the NorA and NorB efflux pumps of Staphylococcus aureus.

    Science.gov (United States)

    Truong-Bolduc, Que Chi; Hooper, David C

    2010-05-01

    MgrA is a global regulator in Staphylococcus aureus that controls the expression of diverse genes encoding virulence factors and multidrug resistance (MDR) efflux transporters. We identified pknB, which encodes the (Ser/Thr) kinase PknB, in the S. aureus genome. PknB was able to autophosphorylate as well as phosphorylate purified MgrA. We demonstrated that rsbU, which encodes a Ser/Thr phosphatase and is involved in the activation of the SigB regulon, was able to dephosphorylate MgrA-P but not PknB-P. Serines 110 and 113 of MgrA were found to be phosphorylated, and Ala substitutions at these positions resulted in reductions in the level of phosphorylation of MgrA. DNA gel shift binding assays using norA and norB promoters showed that MgrA-P was able to bind the norB promoter but not the norA promoter, a pattern which was the reverse of that for unphosphorylated MgrA. The double mutant MgrA(S110A-S113A) bound to the norA promoter but not the norB promoter. The double mutant led to a 2-fold decrease in norA transcripts and a 2-fold decrease in the MICs of norfloxacin and ciprofloxacin in strain RN6390. Thus, phosphorylation of MgrA results in loss of binding to the norA promoter, but with a gain of the ability to bind the norB promoter. Loss of the ability to phosphorylate MgrA by Ala substitution resulted in increased repression of norA expression and in reductions in susceptibilities to NorA substrates.

  14. Triple-negative (ER, PgR, HER-2/neu breast cancer in Indian women

    Directory of Open Access Journals (Sweden)

    Vinayak W Patil

    2011-03-01

    Full Text Available Vinayak W Patil1, Rajeev Singhai1, Amit V Patil2, Prakash D Gurav21Department of Biochemistry, Grant Medical College and Sir JJ Group of Hospitals, Mumbai, India; 2Department of Surgery, Government Medical College, Miraj, IndiaAbstract: The aim of our study was to analyze triple-negative (TN breast cancer, which is defined as being negative for the estrogen receptor (ER, the progesterone receptor (PgR, and the human epidermal growth factor receptor 2 (HER-2/neu and which represents a subset of breast cancer with different biologic behavior. We investigated the clinicopathological characteristics and prognostic indicators of lymph node-negative TN breast cancer. Medical records were reviewed from patients with node-negative breast cancer who underwent curative surgery at Grant Medical College and Sir JJ Group of Hospitals, Mumbai, India, from May 2007 to October 2010. Clinicopathological variables and clinical outcomes were evaluated. Among 683 patients included, 136 had TN breast cancer and 529 had non-TN breast cancer. TN breast cancer correlated with younger age (<35 years, P = 0.003 and a higher histopathologic and nuclear grade (P < 0.001. It also correlated with a molecular profile associated with biological aggressiveness: negative for Bcl-2 expression (P < 0.001, positive for the epidermal growth factor receptor (P = 0.003, and a high level of p53 (P < 0.001 and Ki-67 expression (P < 0.00. The relapse rates during the follow-up period (median 56.8 months were 14.7% for TN breast cancer and 6.6% for non-TN breast cancer (P = 0.004. Relapse-free survival (RFS was significantly shorter among patients with TN breast cancer compared with those with non-TN breast cancer: 3.5-year RFS rate 85.5% versus 94.2%, respectively; P = 0.001. On multivariate analysis, young age, close resection margin, and triple negativity were independent predictors of shorter RFS. TN breast cancer had a higher relapse rate and more aggressive clinicopathological

  15. Challenges to and proposals for underground gas storage (UGS business in China

    Directory of Open Access Journals (Sweden)

    Gangxiong Zhang

    2017-05-01

    Full Text Available Underground gas storage (UGS is one of the major storage and peak-shaving means in the world among numerous storage ways via gas fields, small-scale LNG, etc. With the rapid development of natural gas industry in China, the seasonal peak-shaving issues are increasingly prominent, so how to achieve sustainable development of UGS business has become a major problem at present. In view of this, we studied the present status and trend of UGS development abroad and analyzed the following challenges encountered by UGS in China. (1 UGS construction falls behind the world and peak-shaving capacity is insufficient. (2 There is lack of quality gas sources for storage and the complicated geological conditions make the cost of UGS construction high. (3 UGS construction is still at the preliminary stage, so experience is not enough in safety and scientific operation and management. (4 UGS construction, management and operation are not unified as a whole, so its maximum efficiency fails to be exerted. (5 The economic benefit of UGS is difficult to be shown without independent cost accounting. Based on the experience of other countries, some proposals were put forward on UGS development under the actual present situation: to strengthen strategic UGS layout, intensify storage site screening in key areas and steadily promote UGS construction; to establish professional UGS technical and management teams and intensify the research of key technologies; and to set up a complete and rationally-distributed UGS construction, operation and management system.

  16. U-Pb ages for PGR dykes, KFP, and adjacent older leucosomic PGRs from ONKALO underground research facility, Olkiluoto, Eurajoki, SW Finland

    International Nuclear Information System (INIS)

    Maenttaeri, I.; Engstroem, J.; Lahaye, Y.; Pere, T.

    2010-06-01

    Zircon LA-MC-ICP-MS and monazite TIMS ages have been determined for three PGR dykes (A2018, A2020, and A2070) and a KFP (A2022) from the ONKALO underground research facility, Olkiluoto, Eurajoki, SW Finland. For purposes of comparison, leucosomic PGRs (A2019, A2021, and A2023) crosscut by the PGR dykes and the KFP were also dated. Minimum ages for the PGR dykes and the A2022 KFP were determined by the monazite U-Pb ages. PGR dykes reveal partially overlapping ages of 1826 ± 7 Ma (A2018), 1811 ± 5 Ma (A2020), and 1817 ± 3 Ma (A2070). Monazite age of 1808 ± 6 Ma for the KFP is coeval with the youngest PGR dyke monazite. The ∼1.81-1.80 Ga ages for the supposed PGR dyke zircon agree within the error limits with the monazite ages. For the KFP, obvious co-magmatic zircon was not identified. The metamorphic zircon rims and domains found from the PGR dykes reveal multiphase overprinting, the ages ranging from 1.86 Ga to 1.80 Ga. Subsequently, the high-U PGR dyke zircon suffered major lead loss during the Rapakivi event at 1.58 Ga and finally, a few grains show early Devonian age of ∼400 Ma. In the KFP, many structurally homogeneous zircon domains and rims plot on a ∼1.80 Ga discordia line, while the concordant data are ∼1.83 Ga. Leucosomic PGRs A2019 and A2021 crosscut by the PGR dykes enclose 1.87-1.85 Ga zircon resembling and being contemporaneous with the tonalite zircon in the Olkiluoto area. The concordia ages of 1836 ± 13 Ma (A2019) and 1807 ± 11 Ma (A2021) for the metamorphic zircon domains in the leucosomes correlate perfectly with the supposed ages of the crosscutting PGR dykes. The youngest metamorphic zircon phases in leucosome A2023 are dated at 1.82-1.80 Ga. That is in good accordance with the monazite age 1808 ± 6 Ma from the KFP A2022 crosscutting the leucosome A2023. The samples contain also abundant older inherited zircon cores and grains. Archaean ages vary from 3.1 Ga to 2.7 Ga and the older Palaeoproterozoic between 2.1 Ga and 1.9 Ga. The

  17. Archive of Geosample Data and Information from the Oregon State University (OSU) College of Earth, Ocean and Atmospheric Sciences (CEOAS) Marine Geology Repository (MGR)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — The Oregon State University Marine Geology Repository (OSU-MGR) is a partner in the Index to Marine and Lacustrine Geological Samples (IMLGS) database, contributing...

  18. Effect of Promoter Region Mutations and mgrA Overexpression on Transcription of norA, Which Encodes a Staphylococcus aureus Multidrug Efflux Transporter

    OpenAIRE

    Kaatz, Glenn W.; Thyagarajan, Rama V.; Seo, Susan M.

    2005-01-01

    NorA is a Staphylococcus aureus multidrug transporter that confers resistance to structurally distinct compounds. The MgrA global regulatory protein is reported to augment norA expression when mgrA is overexpressed from an undefined plasmid-based promoter. Further details about norA regulatory mechanisms are scant. A chromosomal norA::lacZ transcriptional fusion was constructed in different S. aureus strains, and allele replacement was used to define the relevance of promoter region sequences...

  19. ASDEX-UG. ASDEX upgrade project proposal. Phase 2

    International Nuclear Information System (INIS)

    1983-05-01

    The objective of ASDEX UG is to investigate the problems relating to tokamak divertor physics and the boundary layer of hot plasmas which cannot be covered otherwise by either ASDEX or other EUROPEAN tokamaks, including JET, but whose investigation is indispensable for NET and INTOR. The configuration of ASDEX UG is changed as compared with ASDEX due to the requirement that all poloidal field coils are located outside the toroidal field magnet. This leads to a highly elongated D-shaped plasma with an ''open'' divertor, which does not allow to close the divertor chamber by such simple means as in ASDEX. In section 2, the aims of ASDEX UG are repeated briefly and the essential features and parameters of the tokamak system are summarized. The summary includes an overview of the tokamak design, the time schedule of design and construction concluding with the estimated investment cost and manpower required. In section 3 the tokamak system components are treated. The circuits and energy supply for the different electrical components are described in section 4. Auxiliary heating requirements and methods are discussed in section 5. Section 6 presents a survey over the periphery of the tokamak system including preparation of the building and radiation shielding. Section 7 outlines the physical programme. Section 8 is devoted to diagnostics. Finally, the principal concepts for control, data acquisition and handling are outlined in section 9. (orig./AH)

  20. Changes in the ER, PgR, HER2, p53 and Ki-67 biological markers between primary and recurrent breast cancer: discordance rates and prognosis

    Directory of Open Access Journals (Sweden)

    Tashima Rumiko

    2011-10-01

    Full Text Available Abstract Background In breast cancer, ER/PgR, HER2, and Ki-67 are important biological markers for predicting prognosis and making effective treatment decisions. In addition, changes in markers due to relapse are also clinically experienced; however, the frequency and clinical significance are still not fully understood. Thus, changes in markers and their correlations with prognosis were investigated. Patients and Methods Out of the patients with relapse from 1997 to March 2011, there were 97 consecutive patients from whom the lesion was resected and evaluated by immunostaining. The biopsy sites were chest wall, lymph node, ipsilateral breast tumor recurrence, lungs, bones, ovaries and brain. The markers sought were ER, PgR, HER2, p53 and Ki-67. Results The hormone receptor positive rate from the primary tumor to recurrence decreased from 63.9% to 57.7% and from 56.7% to 43.3% for ER and PgR, respectively. Changes in the positive/negative evaluation were seen at the rate of 10.3% and 25.8% for ER and PgR, respectively. The Ki-67 index increased significantly from a mean of 29.1% at primary tumor to 36.3% at relapse. When divided into 2 groups ( Conclusion Estrogen receptor and PgR decreased while Ki-67 increased due to relapse; however, the rate of change was high for PgR and Ki-67. Change in the subtypes was seen in 25%. In addition, PgR at relapse and Ki-67 at primary tumor were significant factors for post-relapse prognosis while PgR becoming negative was a poor prognostic factor. These findings are important for making effective treatment decisions.

  1. Cascading electron and hole transfer dynamics in a CdS/CdTe core-shell sensitized with bromo-pyrogallol red (Br-PGR): slow charge recombination in type II regime.

    Science.gov (United States)

    Maity, Partha; Debnath, Tushar; Chopra, Uday; Ghosh, Hirendra Nath

    2015-02-14

    Ultrafast cascading hole and electron transfer dynamics have been demonstrated in a CdS/CdTe type II core-shell sensitized with Br-PGR using transient absorption spectroscopy and the charge recombination dynamics have been compared with those of CdS/Br-PGR composite materials. Steady state optical absorption studies suggest that Br-PGR forms strong charge transfer (CT) complexes with both the CdS QD and CdS/CdTe core-shell. Hole transfer from the photo-excited QD and QD core-shell to Br-PGR was confirmed by both steady state and time-resolved emission spectroscopy. Charge separation was also confirmed by detecting electrons in the conduction band of the QD and the cation radical of Br-PGR as measured from femtosecond transient absorption spectroscopy. Charge separation in the CdS/Br-PGR composite materials was found to take place in three different pathways, by transferring the photo-excited hole of CdS to Br-PGR, electron injection from the photo-excited Br-PGR to the CdS QD, and direct electron transfer from the HOMO of Br-PGR to the conduction band of the CdS QD. However, in the CdS/CdTe/Br-PGR system hole transfer from the photo-excited CdS to Br-PGR and electron injection from the photo-excited Br-PGR to CdS take place after cascading through the CdTe shell QD. Charge separation also takes place via direct electron transfer from the Br-PGR HOMO to the conduction band of CdS/CdTe. Charge recombination (CR) dynamics between the electron in the conduction band of the CdS QD and the Br-PGR cation radical were determined by monitoring the bleach recovery kinetics. The CR dynamics were found to be much slower in the CdS/CdTe/Br-PGR system than in the CdS/Br-PGR system. The formation of the strong CT complex and the separation of charges cascading through the CdTe shell help to slow down charge recombination in the type II regime.

  2. Noble magnetic barriers in the ASDEX UG tokamak

    Science.gov (United States)

    Ali, Halima; Punjabi, Alkesh; Vazquez, Justin

    2010-02-01

    The second-order perturbation method of creating invariant tori inside chaos in Hamiltonian systems (Ali, H.; Punjabi, A. Plasma Phys. Contr. F. 2007, 49, 1565-1582) is applied to the axially symmetric divertor experiment upgrade (ASDEX UG) tokamak to build noble irrational magnetic barriers inside chaos created by resonant magnetic perturbations (m, n)=(3, 2)+(4, 3), with m and n the poloidal and toroidal mode numbers of the Fourier expansion of the magnetic perturbation. The radial dependence of the Fourier modes is ignored. The modes are considered to be locked and have the same amplitude δ. A symplectic mathematical mapping in magnetic coordinates is used to integrate magnetic field line trajectories in the ASDEX UG. Tori with noble irrational rotational transform are the last ones to be destroyed by perturbation in Hamiltonian systems. For this reason, noble irrational magnetic barriers are built inside chaos, and the strongest noble irrational barrier is identified. Three candidate locations for the strongest noble barrier in ASDEX UG are selected. All three candidate locations are chosen to be roughly midway between the resonant rational surfaces ψ32 and ψ43. ψ is the magnetic coordinate of the flux surface. The three candidate surfaces are the noble irrational surfaces close to the surface with q value that is a mediant of q=3/2 and 4/3, q value of the physical midpoint of the two resonant surfaces, and the q value of the surface where the islands of the two perturbing modes just overlap. These q values of the candidate surfaces are denoted by q MED, q MID, and q OVERLAP. The strongest noble barrier close to q MED has the continued fraction representation (CFR) [1;2,2,1∞] and exists for δ≤2.6599×10-4; the strongest noble barrier close to q MID has CFR [1;2,2,2,1∞] and exists for δ≤4.6311×10-4; and the strongest noble barrier close to q OVERLAP has CFR [1;2,2,6,2,1∞] and exists for δ≤1.367770×10-4. From these results, the strongest

  3. Applications of Universal Grammar (UG) in the ESL/EFL Classroom

    Science.gov (United States)

    Kirkwold, Lorne O.

    2007-01-01

    The article proposes Stern's (1983) framework for classifying issues related to instruction in order to ascertain the relevance of Universal Grammar (UG) in the ESL/EFL classroom. Discussed in this article, particularly as UG pertains to them, are issues related to: (a) L1 transfer; (b) teaching rules and giving error correction versus presenting…

  4. Analytical Review of Universal Grammar (UG) Approach on Second Language Acquisition (SLA)

    Science.gov (United States)

    Irwandy

    2015-01-01

    The aim of this paper is to explore the analysis of Universal Grammar (UG) approach on Second Language Acquisition (SLA). This paper is significant as the sources for teacher or researcher of the second language since this elaboration is deeply focusing on the use of UG on SLA. The method used in this academic writing is inductive method of…

  5. 46 CFR 54.10-10 - Standard hydrostatic test (modifies UG-99).

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 2 2010-10-01 2010-10-01 false Standard hydrostatic test (modifies UG-99). 54.10-10... PRESSURE VESSELS Inspection, Reports, and Stamping § 54.10-10 Standard hydrostatic test (modifies UG-99). (a) All pressure vessels shall satisfactorily pass the hydrostatic test prescribed by this section...

  6. Predictive value and clinical utility of centrally assessed ER, PgR, and Ki-67 to select adjuvant endocrine therapy for premenopausal women with hormone receptor-positive, HER2-negative early breast cancer: TEXT and SOFT trials.

    Science.gov (United States)

    Regan, Meredith M; Pagani, Olivia; Francis, Prudence A; Fleming, Gini F; Walley, Barbara A; Kammler, Roswitha; Dell'Orto, Patrizia; Russo, Leila; Szőke, János; Doimi, Franco; Villani, Laura; Pizzolitto, Stefano; Öhlschlegel, Christian; Sessa, Fausto; Peg Cámara, Vicente; Rodríguez Peralto, José Luis; MacGrogan, Gaëtan; Colleoni, Marco; Goldhirsch, Aron; Price, Karen N; Coates, Alan S; Gelber, Richard D; Viale, Giuseppe

    2015-11-01

    The SOFT and TEXT randomized phase III trials investigated adjuvant endocrine therapies for premenopausal women with hormone receptor-positive (HR+) early breast cancer. We investigated the prognostic and predictive value of centrally assessed levels of estrogen receptor (ER), progesterone receptor (PgR), and Ki-67 expression in women with HER2-negative disease. Of 5707 women enrolled, 4115 with HER2-negative (HR+/HER2-) disease had ER, PgR, and Ki-67 centrally assessed by immunohistochemistry. Breast cancer-free interval (BCFI) was defined from randomization to first invasive local, regional, or distant recurrence or contralateral breast cancer. The prognostic and predictive values of ER, PgR and Ki-67 expression levels were assessed using Cox modeling and STEPP methodology. In this HR+/HER2- population, the median ER, PgR, and Ki-67 expressions were 95, 90, and 18 % immunostained cells. As most patients had strongly ER-positive tumors, the predictive value of ER levels could not be investigated. Lower PgR and higher Ki-67 expression were associated with reduced BCFI. There was no consistent evidence of heterogeneity of the relative treatment effects according to PgR or Ki-67 expression levels, though there was a greater 5-year absolute benefit of exemestane + ovarian function suppression (OFS) versus tamoxifen with or without OFS at lower levels of PgR and higher levels of Ki-67. Women with poor prognostic features of low PgR and/or high Ki-67 have greater absolute benefit from exemestane + OFS versus tamoxifen + OFS or tamoxifen alone, but individually PgR and Ki-67 are of limited predictive value for selecting adjuvant endocrine therapy for premenopausal women with HR+/HER2- early breast cancer.

  7. Evaluating The Effect of Melatonin on HAS2, and PGR expression, as well as Cumulus Expansion, and Fertility Potential in Mice.

    Science.gov (United States)

    Ezzati, Maryam; Roshangar, Leila; Soleimani Rad, Jafar; Karimian, Nahid

    2018-04-01

    Infertility is a worldwide health problem which affects approximately 15% of sexually active couples. One of the factors influencing the fertility is melatonin. Also, protection of oocytes and embryos from oxidative stress inducing chemicals in the culture medium is important. The aim of the present study was to investigate if melatonin could regulate hyaluronan synthase-2 (HAS2) and Progesterone receptor (PGR) expressions in the cumulus cells of mice oocytes and provide an in vitro fertilization (IVF) approach. In this experimental study, for this purpose, 30 adult female mice and 15 adult male mice were used. The female mice were superovulated using 10 U of pregnant mare serum gonadotropin (PMSG) and 24 hours later, 10 U of human chorionic gonadotropin (hCG) were injected. Next, cumulus oocyte complexes (COCs) were collected from the oviducts of the female mice by using a matrix-flushing method. The cumulus cells were cultured with melatonin 10 μM for 6 hours and for real-time reverse transcription-polymerase chain reaction (RT-PCR) was used for evaluation of HAS2 and PGR expression levels. The fertilization rate was evaluated through IVF. All the data were analyzed using a t test. The results of this study showed that HAS2 and PGR expressions in the cumulus cells of the mice receiving melatonin increased in comparison to the control groups. Also, IVF results revealed an enhancement in fertilization rate in the experimental groups compared to the control groups. To improve the oocyte quality and provide new approaches for infertility treatment, administration of melatonin as an antioxidant, showed promising results. Thus, it is concluded that fertility outcomes can be improved by melatonin it enhances PGR. Copyright© by Royan Institute. All rights reserved.

  8. Partially dissecting the steady-state electron fluxes in Photosystem I in wild-type and pgr5 and ndh mutants of Arabidopsis

    Directory of Open Access Journals (Sweden)

    Jiancun eKou

    2015-09-01

    Full Text Available Cyclic electron flux (CEF around Photosystem I (PS I is difficult to quantify. We obtained the linear electron flux (LEFO2 through both photosystems and the total electron flux through PS I (ETR1 in Arabidopsis in CO2-enriched air. DeltaFlux = ETR1 – LEFO2 is an upper estimate of CEF, which consists of two components, an antimycin A-sensitive, PGR5 (proton gradient regulation 5 protein-dependent component and an insensitive component facilitated by a chloroplastic nicotinamide adenine dinucleotide dehydrogenase-like complex (NDH. Using wild type as well as pgr5 and ndh mutants, we observed that (1 40% of the absorbed light was partitioned to PS I; (2 at high irradiance a substantial antimycin A-sensitive CEF occurred in the wild type and the ndh mutant; (3 at low irradiance a sizable antimycin A-sensitive CEF occurred in the wild type but not in the ndh mutant, suggesting an enhancing effect of NDH in low light; and (4 in the pgr5 mutant, and the wild type and ndh mutant treated with antimycin A, a residual DeltaFlux existed at high irradiance, attributable to charge recombination and/or pseudo-cyclic electron flow. Therefore, in low-light-acclimated plants exposed to high light, DeltaFlux has contributions from various paths of electron flow through PS I.

  9. Expression of PGR, HBEGF, ITGAV, ITGB3 and SPP1 genes in eutopic endometrium of infertile women with endometriosis during the implantation window: a pilot study.

    Science.gov (United States)

    Broi, Michele G Da; Rocha, Carlos V; Meola, Juliana; Martins, Wellington P; Carvalho, Filomena M; Ferriani, Rui A; Navarro, Paula A

    2017-09-01

    Alterations in endometrial receptivity may be involved in the etiopathogenesis of endometriosis-related infertility. The literature has suggested that patients with endometriosis present progestin resistance, which could affect embryo implantation. We question the presence of alterations in the expression of the progesterone receptor gene (PGR) and the genes related to endometrium-embryo interaction regulated by progesterone. This pilot study compared the expression of PGR, HBEGF, ITGAV, ITGB3, and SPP1 genes in eutopic endometrium during the implantation window (IW) in infertile women with endometriosis with that observed in the endometrium of fertile and infertile controls. In this prospective case-control study, endometrial biopsies were performed during the IW in patients aged between 18 and 45 years old, with regular cycles and without endocrine/systemic dysfunctions, divided into endometriosis (END), infertile control (IC) and fertile control (FC) groups. Total RNA extraction, cDNA synthesis, and gene expression analysis by Real-Time PCR were performed. We assessed the size of the difference that our series was powered to detect. From the 687 patients who underwent diagnostic videolaparoscopy or tubal ligation at the University Hospital, 130 were eligible. Of these, 32 had endometrial samples collected, with 17 confirmed in the IW. Fifteen samples (5 END, 5 IC and 5 FC) were analyzed. There was no significant difference in the expression of any studied gene. Our sample size allowed us to identify or discard large differences (two standard deviations) among the groups. Endometriosis doesn't cause large changes in the endometrial expression of PGR, HBEGF, ITGAV, ITGB3 and SPP1 during the IW.

  10. Putting Ug99 on the map: An update on current and future monitoring

    DEFF Research Database (Denmark)

    Hodson, D P; Nazari, K; Park, R F

    2011-01-01

    Detection of stem rust race TTKSK (Ug99) from Uganda in 1998/99 highlighted not only the extremely high vulnerability of the global wheat crop to stem rust but also a lack of adequate global systems to monitor such a threat. Progress in the development and expansion of the Global Cereal Rust...... Monitoring System (GCRMS) is described. The current situation regarding the Ug99 lineage of races is outlined and the potential for expansion into important wheat areas is considered. The GCRMS has successfully tracked the spread and changes that are occurring within the Ug99 lineage and is now well...... capacity for race analysis is seen to be critical and integration of the Global Rust Reference Centre into the stem rust monitoring network is seen as a positive development. The current acute situation with severe epidemics of stripe rust in many countries indicates a clear need for more effective global...

  11. Creation of second order magnetic barrier inside chaos created by NTMs in the ASDEX UG

    Science.gov (United States)

    Ali, Halima; Punjabi, Alkesh

    2012-10-01

    Understanding and stabilization of neoclassical tearing modes (NTM) in tokamaks is an important problem. For low temperature plasmas, tearing modes are believed to be mainly driven by current density gradient. For collisionless plasmas, even when plasma is stable to classical tearing modes, helical reduction in bootstrap current in O-point of an island can destabilize NTMs when an initial island is seeded by other global MHD instabilities or when microturbulence triggers the transition from a linear to nonlinear instability. The onset of NTMs leads to the most serious beta limit in ASDEX UG tokamak [O. Gubner et al 2005 NF 39 1321]. The important NTMs in the ASDDEX UG are (m,n)=(3,2)+(4,3)+(1,1). Realistic parameterization of these NTMs and the safety factor in ASDEX UG are given in [O. Dumbrajs et al 2005 POP 12 1107004]. We use a symplectic map in magnetic coordinates for the ASDEX UG to integrate field lines in presence of the NTMs. We add a second order control term [H. Ali and A. Punjabi 2007 PPCF 49 1565] to this ASDEX UG field line Hamiltonian to create an invariant magnetic surface inside the chaos generated by the NTMs. The relative strength, robustness, and resilience of this barrier are studied to ascertain the most desirable noble barrier in the ASDEX UG with NTMs. We present preliminary results of this work, and discuss its implications with regard to magnetic transport barriers for increasing strength of magnetic perturbations. This work is supported by the grants DE-FG02-01ER54624 and DE-FG02-04ER54793.

  12. Gold(I) Complexes with N-Donor Ligands. 2.(1) Reactions of Ammonium Salts with [Au(acac-kappaC(2))(PR(3))] To Give [Au(NH(3))L](+), [(AuL)(2)(&mgr;(2)-NH(2))](+), [(AuL)(4)(&mgr;(4)-N)](+), or [(AuL)(3)(&mgr;(3)-O)](+). A New and Facile Synthesis of [Au(NH(3))(2)](+) Salts. Crystal Structure of [{AuP(C(6)H(4)OMe-4)(3)}(3)(&mgr;(3)-O)]CF(3)SO(3).

    Science.gov (United States)

    Vicente, José; Chicote, María-Teresa; Guerrero, Rita; Jones, Peter G.; Ramírez De Arellano, M. Carmen

    1997-09-24

    The complexes [Au(acac-kappaC(2))(PR(3))] (acac = acetylacetonate, R = Ph, C(6)H(4)OMe-4) react with (NH(4))ClO(4) to give amminegold(I), [Au(NH(3))(PR(3))]ClO(4), amidogold(I), [(AuPR(3))(2)(&mgr;(2)-NH(2))]ClO(4), or nitridogold(I), [(AuPR(3))(4)(&mgr;(4)-N)]ClO(4), complexes, depending on the reaction conditions. Similarly, [Au(acac-kappaC(2))(PPh(3))] reacts with (NH(3)R')OTf (OTf = CF(3)SO(3)) (1:1) or with [H(3)N(CH(2))(2)NH(2)]OTf (1:1) to give (amine)gold(I) complexes [Au(NH(2)R')(PPh(3))]OTf (R' = Me, C(6)H(4)NO(2)-4) or [(AuPPh(3))(2){&mgr;(2)-H(2)N(CH(2))(2)NH(2)}](OTf)(2), respectively. The ammonium salts (NH(2)R'(2))OTf (R' = Et, Ph) react with [Au(acac-kappaC(2))(PR(3))] (R = Ph, C(6)H(4)OMe-4) (1:2) to give, after hydrolysis, the oxonium salts [(AuPR(3))(3)(&mgr;(3)-O)]OTf (R = Ph, C(6)H(4)OMe-4). When NH(3) is bubbled through a solution of [AuCl(tht)] (tht = tetrahydrothiophene), the complex [Au(NH(3))(2)]Cl precipitates. Addition of [Au(NH(3))(2)]Cl to a solution of AgClO(4) or TlOTf leads to the isolation of [Au(NH(3))(2)]ClO(4) or [Au(NH(3))(2)]OTf, respectively. The crystal structure of [(AuPR(3))(3)(&mgr;(3)-O)]OTf.Me(2)CO (R = C(6)H(4)OMe-4) has been determined: triclinic, space group P&onemacr;, a = 14.884(3) Å, b = 15.828(3) Å, c = 16.061(3) Å, alpha = 83.39(3) degrees, beta = 86.28(3) degrees, gamma = 65.54(3) degrees, R1 (wR2) = 0.0370 (0.0788). The [(AuPR(3))(3)(&mgr;(3)-O)](+) cation shows an essentially trigonal pyramidal array of three gold atoms and one oxygen atom with O-Au-P bond angles of ca. 175 degrees and Au.Au contacts in the range 2.9585(7)-3.0505(14) Å. These cations are linked into centrosymmetric dimers through two short Au.Au [2.9585(7), 3.0919(9) Å] contacts. The gold atoms of the dimer form a six-membered ring with a chair conformation.

  13. Targeted introgression of stem rust Ug99 resistance from wheatgrasses into pasta and bread wheat

    Science.gov (United States)

    In the past 50 years, a number of stem rust resistance (Sr) genes have been transferred from several wheat-related grasses into durum (i.e. pasta) and bread wheat through chromosome translocations and additions. To utilize these genes for controlling the Ug99 races of the stem rust pathogen, we ini...

  14. Resistance to stem rust Ug99 in six bread wheat cultivars maps to chromosome 6DS.

    Science.gov (United States)

    Lopez-Vera, Eric E; Nelson, Sarah; Singh, Ravi P; Basnet, Bhoja R; Haley, Scott D; Bhavani, Sridhar; Huerta-Espino, Julio; Xoconostle-Cazares, Beatriz G; Ruiz-Medrano, Roberto; Rouse, Matthew N; Singh, Sukhwinder

    2014-01-01

    Identified SSR markers ( Xcfd49 and Xbarc183 ) linked with stem rust resistance for efficient use in marker-assisted selection and stacking of resistance genes in wheat breeding programs. More than 80 % of the worldwide wheat (Triticum aestivum L.) area is currently sown with varieties susceptible to the Ug99 race group of stem rust fungus. However, wheat lines Niini, Tinkio, Coni, Pfunye, Blouk, and Ripper have demonstrated Ug99 resistance at the seedling and adult plant stages. We mapped stem rust resistance in populations derived from crosses of a susceptible parent with each of the resistant lines. The segregation of resistance in each population indicated the presence of a single gene. The resistance gene in Niini mapped to short arm of chromosome 6D and was flanked by SSR markers Xcfd49 at distances of 3.9 cM proximal and Xbarc183 8.4 cM distal, respectively. The chromosome location of this resistance was validated in three other populations: PBW343/Coni, PBW343/Tinkio, and Cacuke/Pfunye. Resistance initially postulated to be conferred by the SrTmp gene in Blouk and Ripper was also linked to Xcfd49 and Xbarc183 on 6DS, but it was mapped proximal to Xbarc183 at a similar position to previously mapped genes Sr42 and SrCad. Based on the variation in diagnostic marker alleles, it is possible that Niini and Pfunye may carry different resistance genes/alleles. Further studies are needed to determine the allelic relationships between various genes located on chromosome arm 6DS. Our results provide valuable molecular marker and genetic information for developing Ug99 resistant wheat varieties in diverse germplasm and using these markers to tag the resistance genes in wheat breeding.

  15. Geology of the U12n.07 UG-3 drill hole, area 12, Nevada Test Site

    International Nuclear Information System (INIS)

    Terry, S.S.; Cunningham, M.J.

    1975-11-01

    The U12n.07 UG-3 horizontal drill hole, located near the eastern edge of the center of Rainier Mesa, Nevada Test Site, was drilled to a total depth of 809 m (2,653 ft). This hole was drilled to further evaluate the tunnel-level stratigraph, and structure southwest of the U12n tunnel complex. The drill hole is collared in the middle of Tertiary tunnel bed 3A and penetrates upsection through tunnel beds 3 and 4 and terminates in subunit 4K, all of Tertiary age. Stratigraphy, structure, engineering geology, and physical properties and their relation to tunnel engineering are discussed

  16. Problems of Gas Pressure Build-up in Casing String of UGS and Gas Wells

    Directory of Open Access Journals (Sweden)

    Peter Sovius

    2006-10-01

    Full Text Available This paper consists of three basic parts. The opening part is a brief description of problems associated with the secondary untightness of UGS wells (Underground Gas Storages and gas wells generally.The main part of the paper is composed of some cases that we have met in our company. Solution proposals of various cases are also supplied in this part. Separate problem situations are described in terms of finding out an untight point and also a testing result and consequential removing of untightness.The conclusion includes knowledge summary that were taken by solution of complicatedsituations connected with well non-hermeticity.

  17. Hypermethylation pattern of ESR and PgR genes and lacking estrogen and progesterone receptors in human breast cancer tumors: ER/PR subtypes.

    Science.gov (United States)

    Pirouzpanah, Saeed; Taleban, Forough-Azam; Mehdipour, Parvin; Sabour, Siamak; Atri, Morteza

    2018-02-14

    The option of endocrine therapy in breast cancer remains conventionally promising. We aimed to investigate how accurately the pattern of hypermethylation at estrogen receptor (ESR) and progesterone receptor (PgR) genes may associate with relative expression and protein status of ER, PR and the combinative phenotype of ER/PR. In this consecutive case-series, we enrolled 139 primary diagnosed breast cancer. Methylation specific PCR was used to assess the methylation status (individual test). Tumor mRNA expression levels were evaluated using real-time RT-PCR. Immunohistochemistry data was used to present hormonal receptor status of a tumor (as test reference). Methylation at ESR1 was comparably frequent in ER-breast tumors (83.0%, PPR- conditions (Cramer's V= 0.44, PPR (77.1%, PPR expressions (55.6%, PPR- (64.4%, PPR-, the hypermethylation of PgRb seem another epigenetic signalling variable actively associate with methylated ESR1 to show lack of ER+/PR+ tumors in breast cancer.

  18. Prevalence of ERα-397 PvuII C/T, ERα-351 XbaI A/G and PGR PROGINS polymorphisms in Brazilian breast cancer-unaffected women

    Energy Technology Data Exchange (ETDEWEB)

    Giacomazzi, J.; Aguiar, E. [Programa de Pós-Graduação em Medicina: Ciências Médicas, Universidade Federal do Rio Grande do Sul (UFRGS), Porto Alegre, RS (Brazil); Laboratório de Medicina Genômica, Centro de Pesquisa Experimental, Hospital de Clínicas de Porto Alegre (HCPA), Porto Alegre, RS (Brazil); Núcleo Mama Porto Alegre, Associação Hospitalar Moinhos de Vento, Porto Alegre, RS (Brazil); Palmero, E.I. [International Agency for Research on Cancer (IARC), Lyon (France); Schmidt, A.V. [Departamento de Estatística, UFRGS, Porto Alegre, RS (Brazil); Skonieski, G.; Filho, D.D. [Núcleo Mama Porto Alegre, Associação Hospitalar Moinhos de Vento, Porto Alegre, RS (Brazil); Bock, H. [Laboratório de Identificação Genética, HCPA, Porto Alegre, RS (Brazil); Programa de Pós-Graduação em Biologia Celular e Molecular, UFRGS, Porto Alegre, RS (Brazil); Saraiva-Pereira, M.L. [Laboratório de Identificação Genética, HCPA, Porto Alegre, RS (Brazil); Programa de Pós-Graduação em Biologia Celular e Molecular, UFRGS, Porto Alegre, RS (Brazil); Departamento de Bioquímica, UFRGS, Porto Alegre, RS (Brazil); Serviço de Genética Médica, HCPA, Porto Alegre, RS (Brazil); Programa de Pós-Graduação em Genética e Biologia Molecular, UFRGS, Porto Alegre, RS (Brazil); Ewald, I.P. [Programa de Pós-Graduação em Medicina: Ciências Médicas, Universidade Federal do Rio Grande do Sul (UFRGS), Porto Alegre, RS (Brazil); Laboratório de Medicina Genômica, Centro de Pesquisa Experimental, Hospital de Clínicas de Porto Alegre (HCPA), Porto Alegre, RS (Brazil); Schuler-Faccini, L. [Serviço de Genética Médica, HCPA, Porto Alegre, RS (Brazil); Programa de Pós-Graduação em Genética e Biologia Molecular, UFRGS, Porto Alegre, RS (Brazil); Departamento de Genética, UFRGS, Porto Alegre, RS (Brazil); Camey, S.A. [Departamento de Estatística, Instituto de Matemática, UFRGS, Porto Alegre, RS (Brazil); Caleffi, M. [Núcleo Mama Porto Alegre, Associação Hospitalar Moinhos de Vento, Porto Alegre, RS (Brazil); Giugliani, R. [Programa de Pós-Graduação em Medicina: Ciências Médicas, Universidade Federal do Rio Grande do Sul (UFRGS), Porto Alegre, RS (Brazil); Laboratório de Identificação Genética, HCPA, Porto Alegre, RS (Brazil); Serviço de Genética Médica, HCPA, Porto Alegre, RS (Brazil); Programa de Pós-Graduação em Genética e Biologia Molecular, UFRGS, Porto Alegre, RS (Brazil); Departamento de Genética, UFRGS, Porto Alegre, RS (Brazil); Ashton-Prolla, P. [Programa de Pós-Graduação em Medicina: Ciências Médicas, Universidade Federal do Rio Grande do Sul (UFRGS), Porto Alegre, RS (BR); Laboratório de Medicina Genômica, Centro de Pesquisa Experimental, Hospital de Clínicas de Porto Alegre (HCPA), Porto Alegre, RS (BR); Núcleo Mama Porto Alegre, Associação Hospitalar Moinhos de Vento, Porto Alegre, RS (BR); Serviço de Genética Médica, HCPA, Porto Alegre, RS (BR); Programa de Pós-Graduação em Genética e Biologia Molecular, UFRGS, Porto Alegre, RS (BR); Departamento de Genética, UFRGS, Porto Alegre, RS (BR)

    2012-05-18

    Polymorphisms of hormone receptor genes have been linked to modifications in reproductive factors and to an increased risk of breast cancer (BC). In the present study, we have determined the allelic and genotypic frequencies of the ERα-397 PvuII C/T, ERα-351 XbaI A/G and PGR PROGINS polymorphisms and investigated their relationship with mammographic density, body mass index (BMI) and other risk factors for BC. A consecutive and unselected sample of 750 Brazilian BC-unaffected women enrolled in a mammography screening program was recruited. The distribution of PGR PROGINS genotypic frequencies was 72.5, 25.5 and 2.0% for A1A1, A1A2 and A2A2, respectively, which was equivalent to that encountered in other studies with healthy women. The distribution of ERα genotypes was: ERα-397 PvuII C/T: 32.3% TT, 47.5% TC, and 20.2% CC; ERα-351 XbaI A/G: 46.3% AA, 41.7% AG and 12.0% GG. ERα haplotypes were 53.5% PX, 14.3% Px, 0.3% pX, and 32.0% px. These were significantly different from most previously published reports worldwide (P < 0.05). Overall, the PGR PROGINS genotypes A2A2 and A1A2 were associated with fatty and moderately fatty breast tissue. The same genotypes were also associated with a high BMI in postmenopausal women. In addition, the ERα-351 XbaI GG genotype was associated with menarche ≥12 years (P = 0.02). ERα and PGR polymorphisms have a phenotypic effect and may play an important role in BC risk determination. Finally, if confirmed in BC patients, these associations could have important implications for mammographic screening and strategies and may be helpful to identify women at higher risk for the disease.

  19. Commentary: "An Evaluation of Universal Grammar and the Phonological Mind"-UG Is Still a Viable Hypothesis.

    Science.gov (United States)

    Berent, Iris

    2016-01-01

    Everett (2016b) criticizes The Phonological Mind thesis (Berent, 2013a,b) on logical, methodological and empirical grounds. Most of Everett's concerns are directed toward the hypothesis that the phonological grammar is constrained by universal grammatical (UG) principles. Contrary to Everett's logical challenges, here I show that the UG hypothesis is readily falsifiable, that universality is not inconsistent with innateness (Everett's arguments to the contrary are rooted in a basic confusion of the UG phenotype and the genotype), and that its empirical evaluation does not require a full evolutionary account of language. A detailed analysis of one case study, the syllable hierarchy, presents a specific demonstration that people have knowledge of putatively universal principles that are unattested in their language and these principles are most likely linguistic in nature. Whether Universal Grammar exists remains unknown, but Everett's arguments hardly undermine the viability of this hypothesis.

  20. Commentary: “An Evaluation of Universal Grammar and the Phonological Mind”—UG Is Still a Viable Hypothesis

    Science.gov (United States)

    Berent, Iris

    2016-01-01

    Everett (2016b) criticizes The Phonological Mind thesis (Berent, 2013a,b) on logical, methodological and empirical grounds. Most of Everett’s concerns are directed toward the hypothesis that the phonological grammar is constrained by universal grammatical (UG) principles. Contrary to Everett’s logical challenges, here I show that the UG hypothesis is readily falsifiable, that universality is not inconsistent with innateness (Everett’s arguments to the contrary are rooted in a basic confusion of the UG phenotype and the genotype), and that its empirical evaluation does not require a full evolutionary account of language. A detailed analysis of one case study, the syllable hierarchy, presents a specific demonstration that people have knowledge of putatively universal principles that are unattested in their language and these principles are most likely linguistic in nature. Whether Universal Grammar exists remains unknown, but Everett’s arguments hardly undermine the viability of this hypothesis. PMID:27471480

  1. An investigation into breast imaging as part of the undergraduate (UG) education of diagnostic radiography students in the UK

    International Nuclear Information System (INIS)

    Strudwick, R.M.; Taylor, K.

    2017-01-01

    Introduction: How mammography is incorporated into undergraduate (UG) radiography training may influence student perception of the speciality and its potential as a future career option. An overview is provided of the academic and clinical content of UG radiography courses relating to mammography across the UK. Methods: Using mixed methods and an iterative, inductive approach supplying quantitative and qualitative data, we identify any variations and discuss possible causes which may help influence future training strategies. A self-designed questionnaire containing open and closed questions was sent online using SurveyMonkey™ to course leaders of all Higher Education Institutions (HEIs) offering BSc (Hons) Diagnostic Radiography courses in the UK. Responses were analysed for trends which were further explored by semi structured telephone interviews. These were transcribed and evaluated using a thematic analysis, the themes being categorised and coded. Results: 19 of 24 (79%) HEIs responded to the questionnaire. Follow up telephone interviews were conducted with five course leaders to further explore themes. Academic teaching ranged from 3 to 25 h over the 3 year course. Compared to other specialities 10 (53%) HEIs spent less time on mammography with 12 (63%) citing HCPC standards as the reason. 11 (65%) HEIs sent students on mammography placements, 2 (12%) sent females only. Placement times ranged between 2 days and 2 weeks. Influences included availability of expert teaching and relationship with clinical departments. Conclusion: There is variation in undergraduate exposure to mammography. Students views should be sought to add validity to these findings - Highlights: • A summary of undergraduate (UG) breast imaging in the UK. • Themes around the delivery of UG breast imaging education in university and practice. • Opinions of UG course leaders and other stakeholders about UG breast imaging education. • There is a variation across UK universities in

  2. The strongest magnetic barrier in the DIII-D tokamak and comparison with the ASDEX UG

    Science.gov (United States)

    Ali, Halima; Punjabi, Alkesh

    2013-05-01

    Magnetic perturbations in tokamaks lead to the formation of magnetic islands, chaotic field lines, and the destruction of flux surfaces. Controlling or reducing transport along chaotic field lines is a key challenge in magnetically confined fusion plasmas. A local control method was proposed by Chandre et al. [Nucl. Fusion 46, 33-45 (2006)] to build barriers to magnetic field line diffusion by addition of a small second-order control term localized in the phase space to the field line Hamiltonian. Formation and existence of such magnetic barriers in Ohmically heated tokamaks (OHT), ASDEX UG and piecewise analytic DIII-D [Luxon, J.L.; Davis, L.E., Fusion Technol. 8, 441 (1985)] plasma equilibria was predicted by the authors [Ali, H.; Punjabi, A., Plasma Phys. Control. Fusion 49, 1565-1582 (2007)]. Very recently, this prediction for the DIII-D has been corroborated [Volpe, F.A., et al., Nucl. Fusion 52, 054017 (2012)] by field-line tracing calculations, using experimentally constrained Equilibrium Fit (EFIT) [Lao, et al., Nucl. Fusion 25, 1611 (1985)] DIII-D equilibria perturbed to include the vacuum field from the internal coils utilized in the experiments. This second-order approach is applied to the DIII-D tokamak to build noble irrational magnetic barriers inside the chaos created by the locked resonant magnetic perturbations (RMPs) (m, n)=(3, 1)+(4, 1), with m and n the poloidal and toroidal mode numbers of the Fourier expansion of the magnetic perturbation with amplitude δ. A piecewise, analytic, accurate, axisymmetric generating function for the trajectories of magnetic field lines in the DIII-D is constructed in magnetic coordinates from the experimental EFIT Grad-Shafranov solver [Lao, L, et al., Fusion Sci. Technol. 48, 968 (2005)] for the shot 115,467 at 3000 ms in the DIII-D. A symplectic mathematical map is used to integrate field lines in the DIII-D. A numerical algorithm [Ali, H., et al., Radiat. Eff. Def. Solids Inc. Plasma Sc. Plasma Tech. 165, 83

  3. A Novel Pentadentate Coordination Mode for the Carbonato Bridge: Synthesis, Crystal Structure, and Magnetic Behavior of (&mgr;(3)-CO(3))[Ni(3)(Medpt)(3)(NCS)(4)], a New Trinuclear Nickel(II) Carbonato-Bridged Complex with Strong Antiferromagnetic Coupling.

    Science.gov (United States)

    Escuer, Albert; Vicente, Ramon; Kumar, Sujit B.; Solans, Xavier; Font-Bardía, Mercé; Caneschi, Andrea

    1996-05-22

    The trinuclear complex (&mgr;(3)-CO(3))[Ni(3)(Medpt)(3)(NCS)(4)] was obtained by reaction of basic solutions of nickel(II), Medpt (bis(3aminopropyl)methylamine) and thiocyanate ligand with atmospheric CO(2) or by simple reaction with carbonate anion. (&mgr;(3)-CO(3))[Ni(3)(Medpt)(3)(NCS)(4)] crystallizes in the triclinic system, space group P&onemacr;, with a = 12.107(5) Å, b = 12.535(7) Å, c = 16.169(9) Å, alpha = 102.69(5) degrees, beta = 92.91(5) degrees, gamma = 118.01(4) degrees, Z = 2, and R = 0.043. The three nickel atoms are asymmetrically bridged by one pentadentate carbonato ligand, which shows a novel coordination mode. The (&mgr;(3)-CO(3))[Ni(3)(Medpt)(3)(NCS)(4)] compound shows a very strong antiferromagnetic coupling. Fit as irregular triangular arrangement gave J(1) = -88.4, J(2) = -57.7, and J(3) = -9.6 cm(-)(1), which is the strongest AF coupling observed to date for Ni(3) compounds. The magnetic behavior of the carbonato bridge is discussed.

  4. Root cause analysis of the fatigue failures of the pulsation dampers of a large underground gas storage (UGS) system

    NARCIS (Netherlands)

    Eijk, A.; Lange, D. de; Maljaars, J.; Tenbrock-Ingenhorst, A.; Gottmer, A.

    2014-01-01

    Two large identical 6-cylinder Ariel JGB/6 reciprocating compressors each of 7.5 MW, are used for an underground gas storage system (UGS) plant of RWE Gasspeicher GmbH located in Epe, Germany. The system is in operation since 2005. In 2011 several internals parts (baffle plates and baffle choke

  5. Identification and validation of single nucleotide polymorphic markers linked to Ug99 stem rust resistance in spring wheat

    Science.gov (United States)

    Wheat stem rust (Puccinia graminis f. sp. tritici Eriks. and E. Henn.) is one of the most destructive diseases world-wide. Races belonging to Ug99 (or TTKSK) continue to cause crop losses in East Africa and threaten global wheat production. Developing and deploying wheat varieties with multiple race...

  6. Genomic analysis of a novel gene conferring resistance to Ug99 stem rust in Triticum turgidum ssp. dicoccum

    Science.gov (United States)

    Wheat production is threatened by the disease stem rust, which is caused by the biotrophic fungal pathogen Puccinia graminis Pers.:Pers. f. sp. tritici (Pgt). Among all known Pgt races, TTKSK (Ug99) and TRTTF are significant threats to North American wheat production due to their virulence against f...

  7. Identification and characterization of Sr13, a tetraploid wheat gene that confers resistance to the Ug99 stem rust race group

    Science.gov (United States)

    The Puccinia graminis f. sp. tritici (Pgt) Ug99 race group is virulent to most stem rust resistance genes currently deployed in wheat and poses a serious threat to global wheat production. The durum wheat (Triticum turgidum ssp. durum) gene Sr13 confers resistance to Ug99 in addition to virulent rac...

  8. Corrosion Test Results for Inconel 600 vs Inconel-Stainless UG Bellows

    International Nuclear Information System (INIS)

    Osborne, P.E.

    2002-01-01

    The Conversion Project (CP) of the Molten Salt Reactor Experiment at Oak Ridge National Laboratory (ORNL) involves converting slightly less than 40 kg of 233 U to a stable form for safe storage. The operation is performed within a few vessels interconnected by valves and 1/2-in. metal tubing. During this conversion, a particularly toxic and corrosive by-product is formed, namely aqueous hydrofluoric acid (HF). The production of HF is a result of the hydrolysis of UF 6 and subsequent steam treatments of UO 2 F 2 . For each mole of UF 6 converted, 6 mol of HF are produced. The HF that forms during conversion combines with water to produce approximately 1.5 L of 33 wt % HF. As this mixture is transferred within the process system, the tubing and valves are exposed to high concentrations of HF in liquid and vapor form. Of particular concern in the system are the almost 30 valves that have the potential for exposure to HF. For these valves, a vendor-supplied UG valve was installed. UG valves consist of an Alloy 400 (Monel) body and stem tip and Alloy 600 (Inconel) bellows. These valves have been used under experimental conditions that simulate the CP. It has been established that they have a finite life when exposed to a HF and air environment. Most failures were seen around the flange at the bottom of the bellows, and it was suspected that this flange and the weld material were not Inconel. In December 2001, the vendor confirmed that this flange was not Inconel but instead was stainless steel 316. After discussions between the vendor and ORNL staff involved with the CP effort, it was decided that the entire wetted area of the bellows would be fabricated from Alloy 600. In March 2002, four newly fabricated bellows assemblies were received from the vendor for the purposes of corrosion testing in HF. This report presents results from the corrosion tests conducted to determine if the new design of the bellows would enhance their corrosion resistance

  9. Corrosion Test Results for Inconel 600 vs Inconel-Stainless UG Bellows

    Energy Technology Data Exchange (ETDEWEB)

    Osborne, P.E.

    2002-09-11

    The Conversion Project (CP) of the Molten Salt Reactor Experiment at Oak Ridge National Laboratory (ORNL) involves converting slightly less than 40 kg of {sup 233}U to a stable form for safe storage. The operation is performed within a few vessels interconnected by valves and 1/2-in. metal tubing. During this conversion, a particularly toxic and corrosive by-product is formed, namely aqueous hydrofluoric acid (HF). The production of HF is a result of the hydrolysis of UF{sub 6} and subsequent steam treatments of UO{sub 2}F{sub 2}. For each mole of UF{sub 6} converted, 6 mol of HF are produced. The HF that forms during conversion combines with water to produce approximately 1.5 L of 33 wt % HF. As this mixture is transferred within the process system, the tubing and valves are exposed to high concentrations of HF in liquid and vapor form. Of particular concern in the system are the almost 30 valves that have the potential for exposure to HF. For these valves, a vendor-supplied UG valve was installed. UG valves consist of an Alloy 400 (Monel) body and stem tip and Alloy 600 (Inconel) bellows. These valves have been used under experimental conditions that simulate the CP. It has been established that they have a finite life when exposed to a HF and air environment. Most failures were seen around the flange at the bottom of the bellows, and it was suspected that this flange and the weld material were not Inconel. In December 2001, the vendor confirmed that this flange was not Inconel but instead was stainless steel 316. After discussions between the vendor and ORNL staff involved with the CP effort, it was decided that the entire wetted area of the bellows would be fabricated from Alloy 600. In March 2002, four newly fabricated bellows assemblies were received from the vendor for the purposes of corrosion testing in HF. This report presents results from the corrosion tests conducted to determine if the new design of the bellows would enhance their corrosion resistance.

  10. The role of unattended ground sensors (UGS) in regional confidence building and arms control

    Energy Technology Data Exchange (ETDEWEB)

    Vannoni, M.; Duggan, R.

    1997-03-01

    Although the Cold War has ended, the world has not become more peaceful. Without the stability provided by an international system dominated by two super-powers, local conflicts are more likely to escalate. Agreements to counter destabilizing pressures in regional conflicts can benefit from the use of cooperative monitoring. Cooperative monitoring is the collecting, analyzing, and sharing of information among parties to an agreement. Ground sensor technologies can contribute to the collection of relevant information. If implemented with consideration for local conditions, cooperative monitoring can build confidence, strengthen existing agreements, and set the stage for continued progress. This presentation describes two examples: the Israeli-Egyptian Sinai agreements of the 1970s and a conceptual example for the contemporary Korean Peninsula. The Sinai was a precedent for the successful use of UGS within the context of cooperative monitoring. The Korean Peninsula is the world`s largest military confrontation. Future confidence building measures that address the security needs of both countries could decrease the danger of conflict and help create an environment for a peace agreement.

  11. Rachunek kosztów działańjako podstawa wyceny usług

    Directory of Open Access Journals (Sweden)

    Gertruda Krystyna Świderska

    2009-03-01

    Full Text Available Artykuł prezentuje wykorzystanie rachunku kosztów działań do wyceny usług na trzech rynkach podlegających centralnym regulacjom – rynku usług pocztowych, telekomunikacyjnych oraz świadczeń zdrowotnych. Doświadczenia krajów Unii Europejskiej (w tym Polski pokazują nowe obszary wykorzystania rachunku kosztów działań. Potwierdzają, że zastosowanie tego narzędzia pozwala na kontrolę kosztów ponoszonych przy świadczeniu usług oraz wycenę na podstawie rzeczywistego rachunku ekonomicznego. Takie podejście gwarantuje przejrzystość procesu wyceny na rynkach, na których odgrywa to szczególnie istotną rolę. W części pierwszej przedstawiono zarys koncepcji rachunku kosztów działań wykorzystanej w PPUP Poczta Polska. Scharakteryzowano zastosowane rozwiązanie dostosowane do specyfiki działań poczty, zawierające elementy obiektowego rachunku kosztów działań oraz rachunku kosztów działań sterowanego czasem. W części drugiej zaprezentowano zastosowanie koncepcji rachunku kosztów działań do wyceny świadczonych usług w British Telecom. Wykorzystanie właściwych nośników kosztów pozwala na prawidłowe przypisanie kosztów obiektom je generującym. W części trzeciej opisano doświadczenia krajów Unii Europejskiej w zakresie stosowania rachunku kosztów działań do wyceny świadczeń medycznych. Stanowią one przesłankę dla wdrożenia tej koncepcji do wyceny usług zdrowotnych na rynku polskim.

  12. The Development of “Eldo Ngano 1”: The World’s World’s First Ug99 Resistant Mutant Wheat Variety

    International Nuclear Information System (INIS)

    Forster, Brian P.

    2014-01-01

    The wheat black stem rust disease is a virulent race of fungus, Puccinia graminis, which affects wheat plants and is caused by a strain of fungus known as Ug99. Named for its place and year of origin, Ug99 was first discovered on wheat in Uganda in 1999. The spores of this plant disease are airborne and can be easily spread by wind. If not prevented, the disease can destroy 70 to 100 per cent of the yield of wheat crops. Annually on average 8.3 million tonnes of wheat grain is lost to this disease, costing US $1.23 billion per year. Ethiopia, Kenya and Uganda are hot spots for this disease. In 2009, growing international concern regarding the horrific impact of Ug99 on wheat led to the establishment of IAEA project INT/5/150, Responding to the Transboundary Threat of Wheat Black Stem Rust (Ug99). This project has involved over 18 countries and 5 national and international institutions, and examined possible mutation induction treatments to deal with the challenges posed by Ug99. Meetings and workshops to facilitate the project efforts have been held in Kenya and Turkey. Ug99 continues to spread globally and has now reached the Islamic Republic of Iran. There are also reports of suspected disease occurrences in Europe. It is essential that work continues on developing mutant lines for further crop protection that can be utilized worldwide to safeguard the wheat crop from this devastating disease

  13. Quantification of African cassava mosaic virus (ACMV) and East African cassava mosaic virus (EACMV-UG) in single and mixed infected Cassava (Manihot esculenta Crantz) using quantitative PCR.

    Science.gov (United States)

    Naseem, Saadia; Winter, Stephan

    2016-01-01

    The quantity of genomic DNA-A and DNA-B of African cassava mosaic virus (ACMV) and East African cassava mosaic virus Uganda (Uganda variant, EACMV-UG) was analysed using quantitative PCR to assess virus concentrations in plants from susceptible and tolerant cultivars. The concentrations of genome components in absolute and relative quantification experiments in single and mixed viral infections were determined. Virus concentration was much higher in symptomatic leaf tissues compared to non-symptomatic leaves and corresponded with the severity of disease symptoms. In general, higher titres were recorded for EACMV-UG Ca055 compared to ACMV DRC6. The quantitative assessment also showed that the distribution of both viruses in the moderately resistant cassava cv. TMS 30572 was not different from the highly susceptible cv. TME 117. Natural mixed infections with both viruses gave severe disease symptoms. Relative quantification of virus genomes in mixed infections showed higher concentrations of EACMV-UG DNA-A compared to ACMV DNA-A, but a marked reduction of EACMV-UG DNA-B. The higher concentrations of EACMV-UG DNA-B compared to EACMV DNA-A accumulation in single infections were consistent. Since DNA-B is implicated in virus cell-to-cell spread and systemic movement, the abundance of the EACMV-UG DNA-B may be an important factor driving cassava mosaic disease epidemic. Copyright © 2015 Elsevier B.V. All rights reserved.

  14. Discovery of a Novel Stem Rust Resistance Allele in Durum Wheat that Exhibits Differential Reactions to Ug99 Isolates

    Directory of Open Access Journals (Sweden)

    Jayaveeramuthu Nirmala

    2017-10-01

    Full Text Available Wheat stem rust, caused by Puccinia graminis f. sp. tritici Eriks. & E. Henn, can incur yield losses in susceptible cultivars of durum wheat, Triticum turgidum ssp. durum (Desf. Husnot. Although several durum cultivars possess the stem rust resistance gene Sr13, additional genes in durum wheat effective against emerging virulent races have not been described. Durum line 8155-B1 confers resistance against the P. graminis f. sp. tritici race TTKST, the variant race of the Ug99 race group with additional virulence to wheat stem rust resistance gene Sr24. However, 8155-B1 does not confer resistance to the first-described race in the Ug99 race group: TTKSK. We mapped a single gene conferring resistance in 8155-B1 against race TTKST, Sr8155B1, to chromosome arm 6AS by utilizing Rusty/8155-B1 and Rusty*2/8155-B1 populations and the 90K Infinium iSelect Custom bead chip supplemented by KASP assays. One marker, KASP_6AS_IWB10558, cosegregated with Sr8155B1 in both populations and correctly predicted Sr8155B1 presence or absence in 11 durum cultivars tested. We confirmed the presence of Sr8155B1 in cultivar Mountrail by mapping in the population Choteau/Mountrail. The marker developed in this study could be used to predict the presence of resistance to race TTKST in uncharacterized durum breeding lines, and also to combine Sr8155B1 with resistance genes effective to Ug99 such as Sr13. The map location of Sr8155B1 cannot rule out the possibility that this gene is an allele at the Sr8 locus. However, race specificity indicates that Sr8155B1 is different from the known alleles Sr8a and Sr8b.

  15. Multihospital Occurrence of Pan-Resistant Klebsiella pneumoniae Sequence Type 147 with an ISEcp1-Directed blaOXA-181 Insertion in the mgrB Gene in the United Arab Emirates.

    Science.gov (United States)

    Sonnevend, Ágnes; Ghazawi, Akela; Hashmey, Rayhan; Haidermota, Aliasgher; Girgis, Safinaz; Alfaresi, Mubarak; Omar, Mohammed; Paterson, David L; Zowawi, Hosam M; Pál, Tibor

    2017-07-01

    The emergence of pan-resistant Klebsiella pneumoniae strains is an increasing concern. In the present study, we describe a cluster of 9 pan-resistant K. pneumoniae sequence type 147 (ST147) isolates encountered in 4 patients over nearly 1 year in 3 hospitals of the United Arab Emirates (UAE). The isolates exhibited highly similar genotypes. All produced chromosomally encoded OXA-181, and the majority also produced the NDM-5 carbapenemase. As with the previously described single isolate from the UAE, MS6671, the mgrB was disrupted by a functional, IS Ecp1 -driven bla OXA-181 insertion causing resistance to carbapenems. The mutation was successfully complemented with an intact mgrB gene, indicating that it was responsible for colistin resistance. bla NDM-5 was located within a resistance island of an approximately 100-kb IncFII plasmid carrying ermB , mph (A), bla TEM-1B , rmtB , bla NDM-5 , sul1 , aadA2 , and dfrA12 resistance genes. Sequencing this plasmid (pABC143-NDM) revealed that its backbone was nearly identical to that of plasmid pMS6671E from which several resistance genes, including bla NDM-5 , had been deleted. More extensive similarities of the backbone and the resistance island were found between pABC143C-NDM and the bla NDM-5 -carrying IncFII plasmids of two K. pneumoniae ST147 isolates from South Korea, one of which was colistin resistant, and both also produced OXA-181. Notably, one of these strains was isolated from a patient transferred from the UAE. Our data show that this pan-resistant clone has an alarming capacity to maintain itself over an extended period of time and is even likely to be transmitted internationally. Copyright © 2017 American Society for Microbiology.

  16. New Seeds are Resistant to Wheat Stem Rust (Ug99) Multinational Programme Supported by FAO and IAEA

    International Nuclear Information System (INIS)

    2013-01-01

    Full text: A multinational effort supported by the International Atomic Energy Agency and the U.N. Food and Agriculture Organization marked a key milestone this week when a Kenyan university debuted two new varieties of disease-resistant wheat to the nation's farmers. Over the past two days, thousands of Kenyan farmers have visited Eldoret University in western Kenya for a two-day agriculture fair highlighting the latest farming technologies. Supporting the development of the new varieties were the IAEA's Technical Cooperation Department and the Joint FAO/IAEA Programme of Nuclear Techniques in Food and Agriculture. They manage an interregional Technical Cooperation project to develop varieties of wheat that are resistant to a devastating type of fungus, causing a disease known as wheat stem rust. Wheat stem rust under control for over 30 years, but a resurgence of the disease was discovered in 1999 in Uganda that swiftly spread to neighbouring Kenya. The wheat stem rust, caused by the strain of the fungus known as Ug99, named after its place and year of origin, has since spread to Iran, Yemen and South Africa and threatens crops as far away as India as spores are carried by wind. Parasitic rusts threaten global wheat production, reducing plant growth and crop yields. The disease can destroy up to 70-100 percent of the yield of wheat crop if not prevented. 'Improving food security in developing countries through the use of nuclear techniques is an important priority of the IAEA', said IAEA Director General Yukiya Amano. 'I am pleased that we have been able to make an important contribution to fighting wheat rust'. 'Wheat rusts, particularly the Ug99 strain, are a major threat to food security because rust epidemics can result in devastating yield losses. This international project involving affected countries, plant scientists and breeders and international organizations is a major breakthrough. It clearly shows the benefits of FAO/IAEA collaboration and that

  17. Mapping resistance to the Ug99 race group of the stem rust pathogen in a spring wheat landrace.

    Science.gov (United States)

    Babiker, E M; Gordon, T C; Chao, S; Newcomb, M; Rouse, M N; Jin, Y; Wanyera, R; Acevedo, M; Brown-Guedira, G; Williamson, S; Bonman, J M

    2015-04-01

    A new gene for Ug99 resistance from wheat landrace PI 374670 was detected on the long arm of chromosome 7A. Wheat landrace PI 374670 has seedling and field resistance to stem rust caused by Puccinia graminis f. sp tritici Eriks. & E. Henn (Pgt) race TTKSK. To elucidate the inheritance of resistance, 216 BC1F2 families, 192 double haploid (DH) lines, and 185 recombinant inbred lines (RILs) were developed by crossing PI 374670 and the susceptible line LMPG-6. The parents and progeny were evaluated for seedling resistance to Pgt races TTKSK, MCCFC, and TPMKC. The DH lines were tested in field stem rust nurseries in Kenya and Ethiopia. The DH lines were genotyped with the 90K wheat iSelect SNP genotyping platform. Goodness-of-fit tests indicated that a single dominant gene in PI 374670 conditioned seedling resistance to the three Pgt races. The seedling resistance locus mapped to the long arm of chromosome 7A and this result was verified in the RIL population screened with the flanking SNP markers using KASP assays. In the same region, a major QTL for field resistance was detected in a 7.7 cM interval and explained 34-54 and 29-36% of the variation in Kenya and Ethiopia, respectively. Results from tests with specific Pgt races and the csIH81 marker showed that the resistance was not due to Sr22. Thus, a new stem rust resistance gene or allele, either closely linked or allelic to Sr15, is responsible for the seedling and field resistance of PI 374670 to Ug99.

  18. Underground gas storage Uelsen: Findings from planning, building and commissioning the surface buildings and structures; Untertagegasspeicher (UGS) Uelsen: Erkenntnisse aus Planung, Bau und Inbetriebnahme der obertaegigen Anlagen

    Energy Technology Data Exchange (ETDEWEB)

    Focke, H.; Brueggmann, R.; Mende, F.; Steinkraus, D.; Wauer, R. [BEB Erdgas und Erdoel GmbH, Hannover (Germany)

    1998-12-31

    The article describes the concepts of the plants and equipment and the specific features of the underground storage at Uelsen. The underground storage will be purpose-built as an H-gas storage in a nearly depleted sandstone deposit. At a nominal deliverability of 250.000 cubic m/h (Vn) the storage at Uelsen has more potential for expansion. This potential was taken into account by designing appropriate pressure stages, capacities, performance characteristics and space. (orig.). [Deutsch] Die nachfolgende Veroeffentlichung stellt das anlagentechnische Grundkonzept und die spezifischen Besonderheiten des UGS Uelsen dar. Der im suedwestlichen Niedersachsen als H-Gasspeicher in einer nahezu ausgefoerderten Buntsandsteinlagerstaette eingerichtete UGS Uelsen wird in mehreren Ausbaustufen bedarfsgerecht fertiggestellt. Bei einer Nennentnahmekapazitaet von 450.000 m{sup 3}/h (Vn) und einer Nenninjektionsleistung von 250.000 m{sup 3}/h (Vn) weist der UGS Uelsen noch weiteres Potential fuer Erweiterungen auf. Dieses Ausbaupotential wurde bei der Planung und dem Bau der bestehenden Anlagen durch Festlegung entsprechender Druckstufen, Kapazitaeten, Leistungsgroessen und Platzanordnungen beruecksichtigt. (orig.)

  19. Creation of a magnetic barrier at a noble q close to physical midpoint between two resonant surfaces in the ASDEX UG tokamak

    Science.gov (United States)

    Vazquez, Justin; Ali, Halima; Punjabi, Alkesh

    2009-11-01

    Ciraolo, Vittot and Chandre method of building invariant manifolds inside chaos in Hamiltonian systems [Ali H. and Punjabi A, Plasma Phys. Control. Fusion, 49, 1565--1582 (2007)] is used in the ASDEX UG tokamak. In this method, a second order perturbation is added to the perturbed Hamiltonian [op cit]. It creates an invariant torus inside the chaos, and reduces the plasma transport. The perturbation that is added to the equilibrium Hamiltonian is at least an order of magnitude smaller than the perturbation that causes chaos. This additional term has a finite, limited number of Fourier modes. Resonant magnetic perturbations (m,n) = (3,2)+(4,3) are added to the field line Hamiltonian for the ASDEX UG. An area-preserving map for the field line trajectories in the ASDEX UG is used. The common amplitude δ of these modes that gives complete chaos between the resonant surfaces ψ43 and ψ32 is determined. A magnetic barrier is built at a surface with noble q that is very nearly equals to the q at the physical midpoint between the two resonant surfaces. The maximum amplitude of magnetic perturbation for which this barrier can be sustained is determined. This work is supported by US Department of Energy grants DE-FG02-07ER54937, DE-FG02-01ER54624 and DE-FG02-04ER54793.

  20. Advanced MicroObserver UGS integration with and cueing of the BattleHawk squad level loitering munition and UAV

    Science.gov (United States)

    Steadman, Bob; Finklea, John; Kershaw, James; Loughman, Cathy; Shaffner, Patti; Frost, Dean; Deller, Sean

    2014-06-01

    Textron's Advanced MicroObserver(R) is a next generation remote unattended ground sensor system (UGS) for border security, infrastructure protection, and small combat unit security. The original MicroObserver(R) is a sophisticated seismic sensor system with multi-node fusion that supports target tracking. This system has been deployed in combat theaters. The system's seismic sensor nodes are uniquely able to be completely buried (including antennas) for optimal covertness. The advanced version adds a wireless day/night Electro-Optic Infrared (EOIR) system, cued by seismic tracking, with sophisticated target discrimination and automatic frame capture features. Also new is a field deployable Gateway configurable with a variety of radio systems and flexible networking, an important upgrade that enabled the research described herein. BattleHawkTM is a small tube launched Unmanned Air Vehicle (UAV) with a warhead. Using transmitted video from its EOIR subsystem an operator can search for and acquire a target day or night, select a target for attack, and execute terminal dive to destroy the target. It is designed as a lightweight squad level asset carried by an individual infantryman. Although BattleHawk has the best loiter time in its class, it's still relatively short compared to large UAVs. Also it's a one-shot asset in its munition configuration. Therefore Textron Defense Systems conducted research, funded internally, to determine if there was military utility in having the highly persistent MicroObserver(R) system cue BattleHawk's launch and vector it to beyond visual range targets for engagement. This paper describes that research; the system configuration implemented, and the results of field testing that was performed on a government range early in 2013. On the integrated system that was implemented, MicroObserver(R) seismic detections activated that system's camera which then automatically captured images of the target. The geo-referenced and time-tagged Micro

  1. Mononuclear Amido and Binuclear Imido Zirconium Complexes Supported by Dibenzotetraaza[14]annulene Ligands. X-ray Structure of [(Me(4)taa)Zr(&mgr;-NR)(2)Zr(NHR)(2)] (R = Bu(t) or 2,6-C(6)H(3)Me(2)).

    Science.gov (United States)

    Nikonov, Georgii I.; Blake, Alexander J.; Mountford, Philip

    1997-03-12

    Reaction of 2 equiv of Li[NH-2,6-C(6)H(3)R(2)] with [(Me(4)taa)ZrCl(2)] (Me(4)taaH(2) = tetramethyldibenzotetraaza[14]annulene) gives the bis(amido) derivatives [(Me(4)taa)Zr(NH-2,6-C(6)H(3)R(2))(2)] [R = Pr(i) (1) and Me (2)]. Addition of Me(4)taaH(2) to [Zr(N-2,6-C(6)H(3)Pr(i)(2))(NH-2,6-C(6)H(3)Pr(i)(2))(2)(py)(2)] also affords 1. The reaction of 2 equiv of aryl or alkyl amines H(2)NR with the bis(alkyl) complex [(Me(4)taa)Zr(CH(2)SiMe(3))(2)] is the most versatile method for preparing [(Me(4)taa)Zr(NHR)(2)] (R = 2,6-C(6)H(3)Pr(i)(2), 2,6-C(6)H(3)Me(2), Ph, or Bu(t)). Reaction of 1 equiv of Me(4)taaH(2) with the binuclear complexes [(Bu(t)NH)(2)Zr(&mgr;-NBu(t))(2)Zr(NHBu(t))(2)] or [(py)(HN-2,6-C(6)H(3)Me(2))(2)Zr(&mgr;-N-2,6-C(6)H(3)Me(2))(2)Zr(NH-2,6-C(6)H(3)Me(2))(2)(py)] gives the asymmetrically substituted derivatives [(Me(4)taa)Zr(&mgr;-NR)(2)Zr(NHR)(2)] [R = Bu(t) (6) or 2,6-C(6)H(3)Me(2) (8)], which have been crystallographically characterized.

  2. Perswazyjność komunikatów reklamowych w Internecie na podstawie analizy usług finansowych SKOK-ów

    OpenAIRE

    Idzik, Beata

    2014-01-01

    Praca jest wynikiem kilkuletnich obserwacji praktycznej strony funkcjonowania reklamy w zakresie usług finansowych. Autorka starała się oddać wyraz swojemu zainteresowaniu psychologią konsumenta, marketingiem w sektorze finansowym a także fascynacji możliwościom, jakie stwarzają w tym zakresie nowe technologie oparte na Internecie. Praca ma charakter teoretyczno - badawczy. W założeniach metodologicznych sformułowano problem badawczy, cele oraz cztery hipotezy badawcze, które poddano wery...

  3. Wpływ informatyzacji Biblioteki Uniwersyteckiej w Poznaniu na zmiany organizacyjne i rozwój usług bibliotecznych

    Directory of Open Access Journals (Sweden)

    Piotr Karwasiński

    2015-12-01

    Full Text Available W artykule omówiono zagadnienia związane z procesami informatyzacji Biblioteki Uniwersyteckiej w Poznaniu. W celu dokładnego scharakteryzowania przemian, prócz rysu historycznego, przedstawiono obszary, które wyraźnie poprawiły jakość pracy personelu i obsługę czytelników oraz przyczyniły się do poznania, upowszechniania i wdrażania nowoczesnych rozwiązań technologicznych. Zaprezentowano proces zmian w zakresie funkcjonowania systemu biblioteczno-informacyjnego Horizon i współpracy z narodowym katalogiem centralnym NUKAT. Opisano etapy rozwoju elektronicznej przestrzeni informacyjnej, w tym budowania elektronicznych zasobów wiedzy i tworzenia narzędzi do ich obsługi i wykorzystania w procesach wyszukiwania źródeł informacji. Zaprezentowano Bibliotekę Uniwersytecką jako partnera w aranżowaniu instytucjonalnych platform cyfrowych do deponowania i udostępniania dorobku intelektualnego społeczności naukowej Uniwersytetu im. Adama Mickiewicza w Poznaniu. Wskazano także funkcjonalność zaprojektowanych i wdrożonych innowacyjnych usług wirtualnych pakietu Libsmart, optymalizujących funkcjonowanie Biblioteki Uniwersyteckiej.

  4. Molecular Cytogenetic Characterization of two Triticum-Secale-Thinopyrum Trigeneric Hybrids Exhibiting Superior Resistance to Fusarium Head Blight, Leaf Rust, and Stem Rust Race Ug99.

    Science.gov (United States)

    Dai, Yi; Duan, Yamei; Liu, Huiping; Chi, Dawn; Cao, Wenguang; Xue, Allen; Gao, Yong; Fedak, George; Chen, Jianmin

    2017-01-01

    Fusarium head blight (FHB), leaf rust, and stem rust are the most destructive fungal diseases in current world wheat production. The diploid wheatgrass, Thinopyrum elongatum (Host) Dewey (2 n = 2 x = 14, EE) is an excellent source of disease resistance genes. Two new Triticum-Secale-Thinopyrum trigeneric hybrids were derived from a cross between a hexaploid triticale (X Triticosecale Wittmack, 2 n = 6 x = 42, AABBRR) and a hexaploid Triticum trititrigia (2 n = 6 x = 42, AABBEE), were produced and analyzed using genomic in situ hybridization and molecular markers. The results indicated that line RE21 contained 14 A-chromosomes, 14 B-chromosomes, three pairs of R-chromosomes (4R, 6R, and 7R), and four pairs of E-chromosomes (1E, 2E, 3E, and 5E) for a total chromosome number of 2 n = 42. Line RE62 contained 14 A-chromosomes, 14 B-chromosomes, six pairs of R-chromosomes, and one pair of translocation chromosomes between chromosome 5R and 5E, for a total chromosome number of 2 n = 42. At the seedling and adult growth stages under greenhouse conditions, line RE21 showed high levels of resistance to FHB, leaf rust, and stem rust race Ug99, and line RE62 was highly resistant to leaf rust and stem rust race Ug99. These two lines (RE21 and RE62) display superior disease resistance characteristics and have the potential to be utilized as valuable germplasm sources for future wheat improvement.

  5. A novel Robertsonian translocation event leads to transfer of a stem rust resistance gene (Sr52) effective against race Ug99 from Dasypyrum villosum into bread wheat.

    Science.gov (United States)

    Qi, L L; Pumphrey, M O; Friebe, Bernd; Zhang, P; Qian, C; Bowden, R L; Rouse, M N; Jin, Y; Gill, B S

    2011-06-01

    Stem rust (Puccinia graminis f. sp. tritici Eriks. & E. Henn.) (the causal agent of wheat stem rust) race Ug99 (also designated TTKSK) and its derivatives have defeated several important stem rust resistance genes widely used in wheat (Triticum aestivum L.) production, rendering much of the worldwide wheat acreage susceptible. In order to identify new resistance sources, a large collection of wheat relatives and genetic stocks maintained at the Wheat Genetic and Genomic Resources Center was screened. The results revealed that most accessions of the diploid relative Dasypyrum villosum (L.) Candargy were highly resistant. The screening of a set of wheat-D. villosum chromosome addition lines revealed that the wheat-D. villosum disomic addition line DA6V#3 was moderately resistant to race Ug99. The objective of the present study was to produce and characterize compensating wheat-D. villosum whole arm Robertsonian translocations (RobTs) involving chromosomes 6D of wheat and 6V#3 of D. villosum through the mechanism of centric breakage-fusion. Seven 6V#3-specific EST-STS markers were developed for screening F(2) progeny derived from plants double-monosomic for chromosomes 6D and 6V#3. Surprisingly, although 6D was the target chromosome, all recovered RobTs involved chromosome 6A implying a novel mechanism for the origin of RobTs. Homozygous translocations (T6AS·6V#3L and T6AL·6V#3S) with good plant vigor and full fertility were selected from F(3) families. A stem rust resistance gene was mapped to the long arm 6V#3L in T6AS·6V#3L and was designated as Sr52. Sr52 is temperature-sensitive and is most effective at 16°C, partially effective at 24°C, and ineffective at 28°C. The T6AS·6V#3L stock is a new source of resistance to Ug99, is cytogenetically stable, and may be useful in wheat improvement.

  6. Repair of U/G and U/A in DNA by UNG2-associated repair complexes takes place predominantly by short-patch repair both in proliferating and growth-arrested cells

    DEFF Research Database (Denmark)

    Akbari, Mansour; Otterlei, Marit; Pena Diaz, Javier

    2004-01-01

    Nuclear uracil-DNA glycosylase UNG2 has an established role in repair of U/A pairs resulting from misincorporation of dUMP during replication. In antigen-stimulated B-lymphocytes UNG2 removes uracil from U/G mispairs as part of somatic hypermutation and class switch recombination processes. Using......, PCNA and DNA ligase, the latter detected as activity. Short-patch repair was the predominant mechanism both in extracts and UNG2-ARC from proliferating and less BER-proficient growth-arrested cells. Repair of U/G mispairs and U/A pairs was completely inhibited by neutralizing UNG...

  7. Zasady ujawniania aktywów biologicznychw sprawozdaniach finansowych jednostek rolniczychwedług Międzynarodowych StandardówSprawozdawczości Finansowej

    Directory of Open Access Journals (Sweden)

    Teresa Kiziukiewicz

    2009-03-01

    Full Text Available Charakterystycznym dla przedsiębiorstw rolniczych składnikiem aktywów są aktywa biologiczne. Wyróżnia je fakt podlegania przemianie biologicznej, wskutek której przekształcają się one w produkty rolnicze lub inne aktywa biologiczne. W związku z tą specyfiką powstaje problem odpowiedniej prezentacji informacji o nich. W artykule są przedstawione zasady i zakres ujawnień o aktywach biologicznych w sprawozdaniu finansowym i dołączanych do niego raportach szczegółowych, ze szczególnym uwzględnieniem problemów wyceny według wartości godziwej.

  8. Identification and mapping of Sr46 from Aegilops tauschii accession CIae 25 conferring resistance to race TTKSK (Ug99) of wheat stem rust pathogen.

    Science.gov (United States)

    Yu, Guotai; Zhang, Qijun; Friesen, Timothy L; Rouse, Matthew N; Jin, Yue; Zhong, Shaobin; Rasmussen, Jack B; Lagudah, Evans S; Xu, Steven S

    2015-03-01

    Mapping studies confirm that resistance to Ug99 race of stem rust pathogen in Aegilops tauschii accession Clae 25 is conditioned by Sr46 and markers linked to the gene were developed for marker-assisted selection. The race TTKSK (Ug99) of Puccinia graminis f. sp. tritici, the causal pathogen for wheat stem rust, is considered as a major threat to global wheat production. To address this threat, researchers across the world have been devoted to identifying TTKSK-resistant genes. Here, we report the identification and mapping of a stem rust resistance gene in Aegilops tauschii accession CIae 25 that confers resistance to TTKSK and the development of molecular markers for the gene. An F2 population of 710 plants from an Ae. tauschii cross CIae 25 × AL8/78 were first evaluated against race TPMKC. A set of 14 resistant and 116 susceptible F2:3 families from the F2 plants were then evaluated for their reactions to TTKSK. Based on the tests, 179 homozygous susceptible F2 plants were selected as the mapping population to identify the simple sequence repeat (SSR) and sequence tagged site (STS) markers linked to the gene by bulk segregant analysis. A dominant stem rust resistance gene was identified and mapped with 16 SSR and five new STS markers to the deletion bin 2DS5-0.47-1.00 of chromosome arm 2DS in which Sr46 was located. Molecular marker and stem rust tests on CIae 25 and two Ae. tauschii accessions carrying Sr46 confirmed that the gene in CIae 25 is Sr46. This study also demonstrated that Sr46 is temperature-sensitive being less effective at low temperatures. The marker validation indicated that two closely linked markers Xgwm210 and Xwmc111 can be used for marker-assisted selection of Sr46 in wheat breeding programs.

  9. Molecular Cytogenetic Characterization of two Triticum–Secale–Thinopyrum Trigeneric Hybrids Exhibiting Superior Resistance to Fusarium Head Blight, Leaf Rust, and Stem Rust Race Ug99

    Directory of Open Access Journals (Sweden)

    Yi Dai

    2017-05-01

    Full Text Available Fusarium head blight (FHB, leaf rust, and stem rust are the most destructive fungal diseases in current world wheat production. The diploid wheatgrass, Thinopyrum elongatum (Host Dewey (2n = 2x = 14, EE is an excellent source of disease resistance genes. Two new Triticum–Secale–Thinopyrum trigeneric hybrids were derived from a cross between a hexaploid triticale (X Triticosecale Wittmack, 2n = 6x = 42, AABBRR and a hexaploid Triticum trititrigia (2n = 6x = 42, AABBEE, were produced and analyzed using genomic in situ hybridization and molecular markers. The results indicated that line RE21 contained 14 A-chromosomes, 14 B-chromosomes, three pairs of R-chromosomes (4R, 6R, and 7R, and four pairs of E-chromosomes (1E, 2E, 3E, and 5E for a total chromosome number of 2n = 42. Line RE62 contained 14 A-chromosomes, 14 B-chromosomes, six pairs of R-chromosomes, and one pair of translocation chromosomes between chromosome 5R and 5E, for a total chromosome number of 2n = 42. At the seedling and adult growth stages under greenhouse conditions, line RE21 showed high levels of resistance to FHB, leaf rust, and stem rust race Ug99, and line RE62 was highly resistant to leaf rust and stem rust race Ug99. These two lines (RE21 and RE62 display superior disease resistance characteristics and have the potential to be utilized as valuable germplasm sources for future wheat improvement.

  10. ER, PgR, Ki67, p27Kip1, and histological grade as predictors of pathological complete response in patients with HER2-positive breast cancer receiving neoadjuvant chemotherapy using taxanes followed by fluorouracil, epirubicin, and cyclophosphamide concomitant with trastuzumab

    International Nuclear Information System (INIS)

    Kurozumi, Sasagu; Inoue, Kenichi; Takei, Hiroyuki; Matsumoto, Hiroshi; Kurosumi, Masafumi; Horiguchi, Jun; Takeyoshi, Izumi; Oyama, Tetsunari

    2015-01-01

    Neoadjuvant chemotherapy (NAC) with taxanes followed by fluorouracil, epirubicin, and cyclophosphamide (FEC), and concurrent trastuzumab is a potent regimen for HER2 over-expressing breast cancer. A high pathological complete response (pCR) rate has been achieved using this regimen; however, the predictive factors and prognostic effects of pCR currently remain unclear. In the present study, we determined whether pCR was related to histological grade (HG) and several biological factors including p27 Kip1 . We also assessed the prognosis of the pCR and non-pCR groups, and expected differences between those positive and negative for lymph node metastasis after chemotherapy. A total of 129 Japanese women with HER2-positive invasive breast cancer received either paclitaxel or docetaxel followed by FEC, with the concomitant administration of trastuzumab. The statuses of HG, ER, PgR, Ki67, and p27 Kip1 were evaluated to determine their relationship with pCR. Relapse-free survival (RFS) and overall survival (OS) were also analyzed for their relationship with pCR and pathological nodal involvement. pCR was obtained in 84 out of 129 patients and the pCR rate was 65.1 %. The pCR rates related to 5 factors were as follows: HG (grade 3, 70.0 % vs. grades 1–2, 36.8 %), ER (negative, 78.6 % vs. positive, 40.0 %), PgR (negative, 75.3 % vs. positive, 38.9 %), Ki67 (high, 72.0 % vs. low, 47.2 %), and p27 Kip1 (low, 71.0 % vs. high, 50.0 %). RFS was significantly better in the pCR group than in the non-pCR group (p = 0.018). Patients with remaining nodal disease in the pCR group had worse OS (p = 0.0002). High-HG, low-ER, low-PgR, high-Ki67, and low-p27 Kip1 were identified as predictive factors of pCR in NAC with trastuzumab, while pCR and negative nodes were predictive of better survivals. The online version of this article (doi:10.1186/s12885-015-1641-y) contains supplementary material, which is available to authorized users

  11. Technical validation of an RT-qPCR in vitro diagnostic test system for the determination of breast cancer molecular subtypes by quantification of ERBB2, ESR1, PGR and MKI67 mRNA levels from formalin-fixed paraffin-embedded breast tumor specimens.

    Science.gov (United States)

    Laible, Mark; Schlombs, Kornelia; Kaiser, Katharina; Veltrup, Elke; Herlein, Stefanie; Lakis, Sotiris; Stöhr, Robert; Eidt, Sebastian; Hartmann, Arndt; Wirtz, Ralph M; Sahin, Ugur

    2016-07-07

    MammaTyper is a novel CE-marked in vitro diagnostic RT-qPCR assay which assigns routinely processed breast cancer specimens into the molecular subtypes Luminal A-like, Luminal B-like (HER2 positive or negative), HER2 positive (non-luminal) and Triple negative (ductal) according to the mRNA expression of ERBB2, ESR1, PGR and MKI67 and the St Gallen consensus surrogate clinical definition. Until now and regarding formalin-fixed, paraffin-embedded material (FFPE), this has been a task mostly accomplished by immunohistochemistry (IHC). However the discrepancy rates of IHC for the four breast cancer biomarkers are frequently under debate, especially for Ki-67 which carries the highest degree of inter- and even intra-observer variability. Herein we describe a series of studies in FFPE specimens which aim to fully validate the analytical performance of the MammaTyper assay, including the site to site reproducibility of the individual marker measurements. Tumor RNA was extracted with the novel RNXtract RNA extraction kit. Synthetic RNA was used to assess the sensitivity of the RNXtract kit. DNA and RNA specific qPCR assays were used so as to determine analyte specificity of RNXtract. For the assessment of limit of blank, limit of detection, analytical measurement range and PCR efficiency of the MammaTyper kit serial dilutions of samples were used. Analytical precision studies of MammaTyper were built around two different real time PCR platforms and involved breast tumor samples belonging to different subtypes analyzed across multiple sites and under various stipulated conditions. The MammaTyper assay robustness was tested against RNA input variations, alternative extraction methods and tumor cell content. Individual assays were linear up to at least 32.33 and 33.56 Cqs (quantification cycles) for the two qPCR platforms tested. PCR efficiency ranged from 99 to 109 %. In qPCR platform 1, estimates for assay specific inter-site standard deviations (SD) were between 0.14 and

  12. Technical validation of an RT-qPCR in vitro diagnostic test system for the determination of breast cancer molecular subtypes by quantification of ERBB2, ESR1, PGR and MKI67 mRNA levels from formalin-fixed paraffin-embedded breast tumor specimens

    International Nuclear Information System (INIS)

    Laible, Mark; Schlombs, Kornelia; Kaiser, Katharina; Veltrup, Elke; Herlein, Stefanie; Lakis, Sotiris; Stöhr, Robert; Eidt, Sebastian; Hartmann, Arndt; Wirtz, Ralph M.; Sahin, Ugur

    2016-01-01

    MammaTyper is a novel CE-marked in vitro diagnostic RT-qPCR assay which assigns routinely processed breast cancer specimens into the molecular subtypes Luminal A-like, Luminal B-like (HER2 positive or negative), HER2 positive (non-luminal) and Triple negative (ductal) according to the mRNA expression of ERBB2, ESR1, PGR and MKI67 and the St Gallen consensus surrogate clinical definition. Until now and regarding formalin-fixed, paraffin-embedded material (FFPE), this has been a task mostly accomplished by immunohistochemistry (IHC). However the discrepancy rates of IHC for the four breast cancer biomarkers are frequently under debate, especially for Ki-67 which carries the highest degree of inter- and even intra-observer variability. Herein we describe a series of studies in FFPE specimens which aim to fully validate the analytical performance of the MammaTyper assay, including the site to site reproducibility of the individual marker measurements. Tumor RNA was extracted with the novel RNXtract RNA extraction kit. Synthetic RNA was used to assess the sensitivity of the RNXtract kit. DNA and RNA specific qPCR assays were used so as to determine analyte specificity of RNXtract. For the assessment of limit of blank, limit of detection, analytical measurement range and PCR efficiency of the MammaTyper kit serial dilutions of samples were used. Analytical precision studies of MammaTyper were built around two different real time PCR platforms and involved breast tumor samples belonging to different subtypes analyzed across multiple sites and under various stipulated conditions. The MammaTyper assay robustness was tested against RNA input variations, alternative extraction methods and tumor cell content. Individual assays were linear up to at least 32.33 and 33.56 Cqs (quantification cycles) for the two qPCR platforms tested. PCR efficiency ranged from 99 to 109 %. In qPCR platform 1, estimates for assay specific inter-site standard deviations (SD) were between 0.14 and 0

  13. Oil use of the effluent plant ETEO (Effluent Station of Oil Treatment) as combustible for generation of energy in the power plant UG-50Hz; Utulizacao de oleo da ETEO (Estacao de Tratamento de Efluentes Oleosos) para geracao de energia na UG-50Hz

    Energy Technology Data Exchange (ETDEWEB)

    Souza, Jose Francisco de; Nascimento, Jose Maria do; Silva, Luiz Antonio da; Salazar, Marcos Vinicios; Baptista, Reinaldo Lopes; Barros, Sueli Aguiar [Companhia Siderurgica Nacional (CSN), Volta Redonda, RJ (Brazil)

    2009-11-01

    The areas of finishing products of CSN Steel Plant generate contaminated effluents with oil and grease , that are treated in ETEO (Effluent Station of Oil Treatment). In this plant, the oil is processed to be sold for the consuming market. However, some seasons of the year, the market does not absorb the oil, and CSN is obliged to defray the burning of this oil, to not interrupt the productive process and cause an environmental impact. Because of this situation, we search alternatives for the viable use of this oil inside CSN steel plant, taking care for the security of the processes and the impact to the environment. This paper describes the details of the work and the implantation of the burning of this oil of the ETEO with BPF oil (type of petrochemical oil) as combustible in the boiler 7 of the power plant UG 50 Hz. For the implantation of this project, operational contingencies of security for equipment was prepared . Moreover, the work included chemical analyses of the oil and the conditions of the boiler using this mixing of oils. The reached results demonstrate the total viability of this project and it was proved another alternative of the use of this residue, with reduction of the fuel costs , steam costs and the electric energy generated in the power plant of CSN. (author)

  14. Wybrane problemy koncentracji i centralizacji ziemi w PGR w Polsce

    OpenAIRE

    Ławniczak, Irena

    1988-01-01

    The subject-matter of the article is to present the process of concentration, déconcentration and centralization of land in the state sector of Polish agriculture in years 1950 - 1984. In turn, the purpose of the work is to find whether those processes were an objective phenomenon resulting from the level of development of production forces or — to the contrary — whether they were a consequence of administrative and political decisions made by central economic authorities and ...

  15. P.G.R. de Villiers Dedication – A tribute

    African Journals Online (AJOL)

    has been the Executive Director of the Centre for Christian Spirituality and Ethics since 1990 and has ... with Greek and Hebrew as majors, Philosophy, Psychology, Latin and .... Supervised master's and doctoral theses at the Universities of.

  16. Effect of high-dose ginsenoside complex (UG0712 supplementation on physical performance of healthy adults during a 12-week supervised exercise program: A randomized placebo-controlled clinical trial

    Directory of Open Access Journals (Sweden)

    Eon Sook Lee

    2018-04-01

    Full Text Available Background: Ginseng has been used as an ergogenic agent, although evidence for its effectiveness is weak. A randomized, double-blind, placebo-controlled clinical trial was conducted to evaluate the effect of a ginsenoside complex (UG0712 on changes in exercise performance. Methods: Sedentary individuals (n=117 were randomly assigned into one of three groups: low-dose ginsenoside supplementation (100 mg/d, n=39, high-dose ginsenoside supplementation (500 mg/d, n=39, or a placebo group (500 mg/d, n=39. All participants underwent a supervised 12-wk aerobic and resistance exercise training course. To assess the effects of supplementation on physical performance, maximal oxygen consumption (VO2max, anaerobic threshold (AT, lactic acid, and muscle strength of the dominant knee were measured at baseline, every visit, and after the training program. Results: Both ginsenoside groups showed significant increases in VO2max and muscular strength during exercise training. There were no definite changes in AT and lactic acid levels over time. After exercise training, there were definite differences in the VO2max (28.64.9 to 33.7±4.9 ml/kg/min in high-dose group vs. 30.4±6.7 to 32.8±6.6 ml/kg/min in placebo, p=0.029 and AT (19.3±4.2 to 20.9±3.5 ml/kg/min in high-dose group vs. 20.0±5.1 to 20.0±4.9 ml/kg/min in placebo, p=0.038 between the high-dose ginsenoside and placebo groups. However, there was no difference in VO2max between the low-dose ginsenoside and placebo groups (p=0.254. There were no differences in muscular strength during exercise training among the three groups. Conclusion: High-dose ginsenoside supplementation (UG0712 augmented the improvement of aerobic capacity by exercise training. Keywords: cardiopulmonary exercise test, ginsenoside, Panax ginseng, randomized controlled trial

  17. Porównywalność w czasie informacji o wynikach działalności społecznie odpowiedzialnej firm raportujących według zasad GRI

    Directory of Open Access Journals (Sweden)

    Halina Waniak-Michalak

    2017-06-01

    Full Text Available Porównywalność w czasie informacji o wynikach działalności społecznie odpowiedzialnej firm raportujących według zasad GRI The involvement of corporations in corporate social responsibility (CSR activities with respect for work- ers' rights and ethical principles brings tangible benefits to the enterprise. CSR activities can therefore be considered as an investment, the effects of which should be measured. CSR benefits derive from im- proved assessment of the corporation by the stakeholders and increased social trust. However, in order to achieve the desired results of CSR activities, it is necessary to provide adequate information to customers, employees and owners. Moreover, the measurement of CSR results is necessary to determine the effec- tiveness of the actions taken. The aim of the article was to answer the question if companies present the same measures in successive CSR reports and whether it is possible to compare the CSR activity results for successive years. Examination of 31 CSR reports for two consecutive editions of the reporting showed that companies change the number and type of disclosed measures.

  18. Language specific bootstraps for UG categories

    NARCIS (Netherlands)

    van Kampen, N.J.

    2005-01-01

    This paper argues that the universal categories N/V are not applied to content words before the grammatical markings for reference D(eterminers) and predication I(nflection) have been acquired (van Kampen, 1997, contra Pinker, 1984). Child grammar starts as proto-grammar with language-specific

  19. Email: pattuquayefio@ug.edu.gh

    African Journals Online (AJOL)

    Apusigah

    making. ... study, the article hints at possible implications of the co-optation of human ... shortage, health challenges such as the Human Immunodeficiency Virus (HIV), and the causes ... appropriate framework for considering such challenges.

  20. Op-Ug TD Optimizer Tool Based on Matlab Code to Find Transition Depth From Open Pit to Block Caving / Narzędzie Optymalizacyjne Oparte O Kod Matlab Wykorzystane Do Określania Głębokości Przejściowej Od Wydobycia Odkrywkowego Do Wybierania Komorami

    Science.gov (United States)

    Bakhtavar, E.

    2015-09-01

    In this study, transition from open pit to block caving has been considered as a challenging problem. For this purpose, the linear integer programing code of Matlab was initially developed on the basis of the binary integer model proposed by Bakhtavar et al (2012). Then a program based on graphical user interface (GUI) was set up and named "Op-Ug TD Optimizer". It is a beneficial tool for simple application of the model in all situations where open pit is considered together with block caving method for mining an ore deposit. Finally, Op-Ug TD Optimizer has been explained step by step through solving the transition from open pit to block caving problem of a case ore deposit. W pracy tej rozważano skomplikowane zagadnienie przejścia od wybierania odkrywkowego do komorowego. W tym celu opracowano kod programowania liniowego w środowisku MATLAB w oparciu o model liczb binarnych zaproponowany przez Bakhtavara (2012). Następnie opracowano program z wykorzystujący graficzny interfejs użytkownika o nazwie Optymalizator Op-Ug TD. Jest to niezwykle cenne narzędzie umożliwiające stosowanie modelu dla wszystkich warunków w sytuacjach gdy rozważamy prowadzenie wydobycia metodą odkrywkową oraz wydobycie komorowe przy eksploatacji złóż rud żelaza. W końcowej części pracy podano szczegółową instrukcję stosowanie programu Optymalizator na przedstawionym przykładzie przejścia od wydobycia rud żelaza metodami odkrywkowymi poprzez wydobycie komorami.

  1. Wpływy polskie w jidysz według "History of the Yiddish Language" Maxa Weinreicha – przegląd i próby weryfikacji

    Directory of Open Access Journals (Sweden)

    Michał Gajek

    2016-12-01

    Full Text Available Polish influence on Yiddish as described in Max Weinreich’s History of the Yiddish Language – overview and attempts at verification The Article concentrates on the findings regarding Slavic influence on Yiddish, described in the newest English-language edition of Max Weinreich’s History of the Yiddish Language – a canonical title for modern Yiddish studies. Its first task is to acquaint Polish readers with M. Weinreich’s propositions and findings on the general character of Polish-Yiddish and Slavic-Yiddish language contact. This will also be taken as an opportunity to briefly review the research on this subject conducted by Polish scholars. Additionally, the article will elaborate (albeit not exhaustively on the attempts to question and verify M. Weinreich’s theories which may prove interesting from the point of view of Slavic studies. Its second, equally important task is to describe chosen examples of the results of Slavic influence, in which Polish played a significant role, as they present themselves in the lexicon, morphology, word formation and syntax of Yiddish.   Wpływy polskie w jidysz według History of the Yiddish Language Maxa Weinreicha – przegląd i próby weryfikacji Artykuł skupia się na ustaleniach na temat wpływów słowiańskich w jidysz, zawartych w najnowszym, anglojęzycznym wydaniu pracy Maxa Weinreicha pt. History of the Yiddish Language, mającej status pozycji kanonicznej współczesnej jidyszystyki. Jego pierwszym celem jest przybliżenie polskiemu czytelnikowi tez i ustaleń M. Weinreicha, dotyczących ogólnego charakteru językowych kontaktów polsko- i słowiańsko-żydowskich. Przy tej okazji uwzględnione zostaną informacje na temat badań, jakie do tej pory poczynili w tej materii językoznawcy polscy. Ponadto (niewyczerpująco poruszona zostanie kwestia prób weryfikacji i podważenia jego twierdzeń, interesująca z punktu widzenia slawistyki. Drugim, nie mniej wa

  2. Estimation of PGR Induced Absolute Gravity Changes at Greenland GNET Stations

    DEFF Research Database (Denmark)

    Nielsen, Emil; Strykowski, Gabriel; Forsberg, René

    2011-01-01

    An important subject in the climate debate is the study of the major ice sheets mass balance. Knowledge of the mass balance provides understanding of changes in the relative sea-level (RSL). Several methods are used for mass balance studies but they are associated with large uncertainties. One re...

  3. Aplication Of PGR IAA And Kinetin On Rubber Clones To Accelarate Mature Tapping

    Directory of Open Access Journals (Sweden)

    Try Koryati

    2017-09-01

    Full Text Available This study aims to determine the most appropriate concentration of IAA hormones Kinetin on rubber clones to accelerate the mature tapping. Experiments have been carried out in Karang Inong Plantation PTP N I Langsa East Aceh. This study is arranged in two factors of Nested Design. Clones factor is consisted of 5 level and IAA hormon Kinetin factor has 7 levels. The results showed that the concentration of IAA hormones Kinetin is different to each clone to accelerate mature tapping. Application of IAA hormone Kinetin significantly affect the parameters of girth bark thickness number of latex vessels latex vessel diameter leaf area and the amount of chlorophyll. Application of IAA 600ppm Kinetin 60 ppm H6 show the largest increase on the girth. Clone treatment is also has significant effect on all parameters but the largest girth found in clones PB 330 and IRR 5. Combination of Clones with IAA hormone Kinetin significantly affects the bark thickness the number of latex vessels and latex vessel diameter. Application of IAA 400 ppm Kinetin 60 ppm has no significant effect on girth but able to accelerate the mature tapping particularly for clones PB 330 and IRR5 K2H4 and K5H4 as indicated by girth size namely 48.15 cm and 48.20 cm respectively at planting age 46 months.

  4. Language: UG or not to be, that is the question.

    Science.gov (United States)

    Bolhuis, Johan J; Tattersall, Ian; Chomsky, Noam; Berwick, Robert C

    2015-02-01

    Language is not the same as speech or communication; rather, it is a computational cognitive system. It has appeared very recently, consistent with a minimalist view of language's hierarchical syntactic structure.

  5. UG311, An Oncofetal Marker Lost with Prostate Cancer Progression

    Science.gov (United States)

    2001-04-01

    resulted in neonatal lethality and further exacerbation of the dwarfism to about 30% of control size [28]. By contrast, the overexpression of GH or IGF-1...inhibitory as retinoic acid (RA) treatment initiates rapid degradation of IGFBP-2 and an increased synthesis of IGF-2 [127]. As RA promotes cell growth both...upregulation of IGFBP-2 mRNA in response to low dose androgen treatment in the LNCaP human prostate cancer cell line. It is not clear 19 whether this is

  6. Stworzenie świata według Leibniza

    Directory of Open Access Journals (Sweden)

    Michał Heller

    2008-06-01

    Full Text Available Leibniz's idea of creation is best epitomized by a note written by him on the margin of his work entitled 'Dialogus'. The note reads:'When God thinks things through and calculates, the world is made'. Simple calculations are almost mechanical. The true mathematical thinking begins when one is confronted with a problem that has to be solved, when starting from the known mathematical structure one has to construct a new structure, to comprehend its intricacies, the ways of its functioning, and its connections with other mathematical structures. And when one successfully applies the new mathematical structure to a physical theory, the new world is made. This was Leibniz's experience when he was discovering calculus and tried to apply it to mechanical problems. Leibniz's doctrine that our world is the best of all possible words is often ridiculed, but this attitude is the result of a very superficial reading of Leibniz's texts. In fact, God's calculations to choose the best possible world are similar to solving the variational problem in mathematics. Leibniz claims that in mathematical reasoning if there is neither 'maximum' nor 'minimum' nothing can happen. Similarly, if there were no world better that other possible worlds, God's wisdom would have not been able to create anything. Some consequences of this doctrine, concerning the nature of space, time and causality, are also considered.

  7. Module Cluster: UG - 001.00 (GSC) Urban Geography.

    Science.gov (United States)

    Currier, Wade R.

    This is one of several module clusters developed for the Camden Teacher Corps project. This module cluster is designed to introduce students to urban studies through the application of a geographic approach. Although geography shares with other social sciences many concepts and methods, it has contributed a distinctive set of viewpoints and a…

  8. Language: UG or not to be, that is the question.

    Directory of Open Access Journals (Sweden)

    Johan J Bolhuis

    2015-02-01

    Full Text Available Language is not the same as speech or communication; rather, it is a computational cognitive system. It has appeared very recently, consistent with a minimalist view of language's hierarchical syntactic structure.

  9. Language : UG or not to be, that is the question

    NARCIS (Netherlands)

    Bolhuis, Johan J; Tattersall, Ian; Chomsky, Noam; Berwick, Robert C

    Language is not the same as speech or communication; rather, it is a computational cognitive system. It has appeared very recently, consistent with a minimalist view of language's hierarchical syntactic structure.

  10. Homocysteine-lowering effect of 500 ug folic acid every other day versus 250 ug/day

    NARCIS (Netherlands)

    Brouwer, I.A.; Rooij, van I.A.L.M.; Dusseldorp, van M.; Thomas, C.M.G.; Blom, H.J.; Hautvast, J.G.A.J.; Eskes, T.K.A.B.

    2000-01-01

    Elevated plasma total homocysteine (tHcy) concentrations are a risk factor for neural tube defects and vascular diseases. Supplementation with folic acid decreases tHcy. We investigated whether supplementation with 500 ?g folic acid every other day is as effective in lowering tHcy as 250 ?g folic

  11. Suppressive effects of Calendula micrantha essential oil and gibberelic acid (PGR) on repro ductive potential of the Mediterranean fruit fly Ceratitis capitata Wied. (Diptera: Tephritidae).

    Science.gov (United States)

    Hussein, Karam T

    2005-08-01

    The volatile oil of Calendula micrtantha plant was extracted and the components were identified by Gc/Ms. Adulticidal efficiency of the volatile oil and gibberelic acid "plant growth promoting hormone" as well as their mixture was assessed against the Mediterranean fruit fly Ceratitis capitata. The result showed that the two compounds capable have characteristic resembling to insect juvenile hormones and have suppressive effect on reproductive potential. They induced the significant disturbances in the ovarian protein fraction and the amino acids patterns.

  12. Rola negacji w opisie świata według arystotelesowskiej Metafizyki

    Directory of Open Access Journals (Sweden)

    Jan BIGAJ

    2012-12-01

    Full Text Available The notions of „being” and „non-being” have entered philosophical language, forming thebasis of ontology and meontology, as the counterparts of the Greek expressions to o]n and tomh o]n (nominalised forms, affirmative and negative, of the participle of the verb ei=nai.Originally, however, these expressions did not have any objectifying meaning, but played therole of meta-language names, representing the copula ei=nai in all its forms, most generallyin its affirmative and negative forms. The copula itself, which in later philosophy took on theexistential meaning, had functioned only as a semantically empty connective of predicates.Over time the participle o]n has been used as a universal name of all predicates.The above-mentioned expressions became central in Greek philosophical terminologythanks to the debates, initiated by Parmenides, on the role of negation in the description of theworld. Parmenides himself proposed a complete excision of negative sentences as describing byelimination, and created a positive-monistic system which abandoned multiplicity, divisibility,and variability. Later philosophers defended negation, fighting back against the paradoxesformulated by the Eleatics and later by the Sophists.Plato observed that without negation it is impossible to describe the multiplicity of things.He also distinguished a relative negation which does not eliminate anything but makes it possibleto confront some things with others. According to the atomists, the divisibility of physicalthings forces us to accept that they consist of a positive element in the form of an impenetrablebody, and of another element lacking any characteristics, i.e. the void. Finally, Aristotle, whenanalysing the process of change, justified the consistency of the statement that something comesout of “not being” and “being”, under the assumption that the former is understood as beingactual, and the latter as being potential. In all these conceptions there is nothing non-existent,there are only proposals of how to identify the aspects of reality whose explanation justifiesthe use of negation.The affirmative and negative forms of the above expressions have also provoked reflectionon the problem of truth and falsity. It has been observed that they are used in everyday language not only to state an agreement or disagreement with the actual facts of the matter, but also toaffirm or deny something.

  13. Gender Studies Course at UG/PG Levels and Gender Awareness Training to Teachers

    Science.gov (United States)

    Kuruvilla, Moly

    2014-01-01

    While the UGC is committed to the cause of promoting gender equity through higher education and is in the process of reviewing the existing arrangements in the campuses of higher learning to ensure the freedom, safety and security of girls and women, the proactive role of teachers in solving the problems of gender based violence and other…

  14. Inheritance of resistance to Ug99 stem rust pathogen in selected ...

    African Journals Online (AJOL)

    13 × 08-UT-86 (χ2 0.05 = 0.480, P ≥ 0.488), HKBL-1385-13 × 09-N2-19 (χ2 0.05 = 0.641, P ≥ 0.424), ND2649 × 09-AB-78 (χ2 0.05 = 1.05, P ≥ 0.309) and ND25882 × 09-AB-78 (χ2 0.05 = 3.599, P ≥ 0.058) exhibited Mendelian segregation ...

  15. Sequencing Ug99 and Other Stem Rust Races: Progress and Results

    Science.gov (United States)

    Over the last decade a number of different molecular methods have been used to characterize genetic diversity in Puccinia graminis. Multilocus DNA fingerprinting methods (AFLPs, RAPDs, SAMs and S-SAPs) have proven to be useful, but limited to phenotypic analysis due to the dikaryotic nature of rust ...

  16. Somatic recombination in wheat stem rust leads to virulence for Ug99-effective SR50 resistance

    Science.gov (United States)

    Race-specific resistance genes protect much of the global wheat crop from stem rust disease caused by Puccinia graminis f. sp. tritici (Pgt), but often break down due to evolution of new virulent pathogen races. To understand the molecular mechanisms of virulence evolution in Pgt we identified the p...

  17. Odnowa filozofii według Hilarego Putnama (Hilary Putnam's Renewal of Philosophy

    Directory of Open Access Journals (Sweden)

    Tadeusz Szubka

    2011-09-01

    Full Text Available Hilary Putnam is widely considered as one of the most distinguished and important philosophers in the analytic tradition of the last fifty years. However, in his most recent publications he has started to emphasize various shortcomings and limitations of that powerful tradition, connected especially with its scientism andnaturalism. He has also insisted that what we really need is a serious renewal and transformation of philosophy, drawing upon other philosophical traditions, including pragmatism. We should realize that although philosophy overlaps in some parts with science, it cannot be turned into a science. It is a humanistic enterprise havingtwo dimensions, theoretical and moral, and it is unfortunate when we tend to forget about either of them.

  18. Analytical study on U/G coal mine CPT and inferences

    Energy Technology Data Exchange (ETDEWEB)

    Dey, N.C.; Mukhopadhyay, S. [Bengal Engineering College, Howrath (India). Dept. of Mining and Geology

    1999-08-01

    The analytical aspects of underground CPT (coal mine cost per tonne), which varies from mine to mine due to the different weightages of various contributing factors, are described. The CPT is not only dictated by the increasing wages but also by the availability of man-hour and accountability of machine utilization. An optimal blend of labour-intensive and machine-intensive methods involving least investment and operating cost, is a challenge for the coal industry. Technology upgradation and implementation, higher skill and morale, excellence in planning and monitoring, optimization in capacity utilization, and better consumer acceptability of coal will consistently improve the financial health of the coal mining sector. Other factors which will help improve the financial health of coal mining industries are (1) cost propaganda like safety week celebration; (2) cost consciousness at all levels; (3) noticeboard comprising the cost of man-hour and machine- hour; (4) no idle time for men as well as machine; (5) care to increase the life of machines; (6) scope of target amendment in a year; (7) prior to introducing costly machines, due weightage to be given on coal grade, mine life, geo-mining conditions; and (8) award to most economic mine and punishment to others rated below the BEP (break- even point). 2 refs., 3 figs.

  19. Reliable discrimination of high explosive and chemical/biological artillery using acoustic UGS

    Science.gov (United States)

    Hohil, Myron E.; Desai, Sachi

    2005-10-01

    The Army is currently developing acoustic overwatch sensor systems that will provide extended range surveillance, detection, and identification for force protection and tactical security on the battlefield. A network of such sensors remotely deployed in conjunction with a central processing node (or gateway) will provide early warning and assessment of enemy threats, near real-time situational awareness to commanders, and may reduce potential hazards to the soldier. In contrast, the current detection of chemical/biological (CB) agents expelled into a battlefield environment is limited to the response of chemical sensors that must be located within close proximity to the CB agent. Since chemical sensors detect hazardous agents through contact, the sensor range to an airburst is the key-limiting factor in identifying a potential CB weapon attack. The associated sensor reporting latencies must be minimized to give sufficient preparation time to field commanders, who must assess if an attack is about to occur, has occurred, or if occurred, the type of agent that soldiers might be exposed to. The long-range propagation of acoustic blast waves from heavy artillery blasts, which are typical in a battlefield environment, introduces a feature for using acoustics and other disparate sensor technologies for the early detection and identification of CB threats. Employing disparate sensor technologies implies that warning of a potential CB attack can be provided to the solider more rapidly and from a safer distance when compared to that which conventional methods allow. This capability facilitates the necessity of classifying the types of rounds that have burst in a specified region in order to give both warning and provide identification of CB agents found in the area. In this paper, feature extraction methods based on the discrete wavelet transform (DWT) and multiresolution analysis facilitate the development of a robust classification algorithm that affords reliable discrimination between conventional and simulated chemical/biological artillery rounds using acoustic signals produced during detonation. Distinct characteristics arise within the different airburst signatures because high explosive warheads emphasize concussive and shrapnel effects, while chemical/biological warheads are designed to disperse their contents over large areas, therefore employing a slower burning, less intense explosive to mix and spread their contents. The ensuing blast waves are readily characterized by variations in the corresponding peak pressure and rise time of the blast, differences in the ratio of positive pressure amplitude to the negative amplitude, and variations in the overall duration of the resulting waveform. We show that, highly reliable discrimination (> 98%) between conventional and potentially chemical/biological artillery is achieved at ranges exceeding 3km. A feedforward neural network classifier, trained on a feature space derived from the distribution of wavelet coefficients found within different levels of the multiresolution decomposition yields.

  20. Remotely sensing the thickness of the bushveld complex UG2 platinum reef using borehole rada.

    CSIR Research Space (South Africa)

    Simmat, CM

    2006-03-01

    Full Text Available The planar, 80 cm thick, lousy dielectric reefs of the Bushveld are embedded in rocks that are almost transparent at ground penetrating radar frequencies of 10–125 MHz. Pothole sensing practices are based largely on using borehole radars to observe...

  1. Kontemplacja i ekspresja – Śakuntala Kalidasy według Jerzego Grotowskiego

    OpenAIRE

    Kołdrzak, Elżbieta

    2012-01-01

    Zrealizowana przez Jerzego Grotowskiego w Teatrze 13 Rzędów, już ponad 50 lat temu, Śakuntala Kalidasy przeszła do historii nie tylko jako kolejna z zachodnich scenicznych wersji tego słynnego dramatu indyjskiego, ale przede wszystkim jako wyznacznik poszukiwań teatralnych oraz poszukiwań nowego paradygmatu techniki aktorskiej prowadzonych przez zespół Grotowskiego. Zarówno sposób opracowania oryginalnego tekstu Kalidasy (Prolog zawierający mantry śiwaickie, redukcja akcji do w...

  2. Etiologia, objawy i leczenie infekcyjnego zapalenia wsierdzia według aktualnych wytycznych Europejskiego Towarzystwa Kardiologicznego

    Directory of Open Access Journals (Sweden)

    Anna Adamska-Wełnicka

    2013-04-01

    Full Text Available Infekcyjne zapalenie wsierdzia (IZW cechuje niejednorodny obraz kliniczny, z pogranicza przewlekłych, nie‑ sprecyzowanych chorób infekcyjnych, autoimmunologicznych, reumatologicznych oraz nowotworowych. Szybka diagnostyka i włączenie leczenia celowanego IZW są konieczne z uwagi na poważne rokowanie i bez‑ pośrednie zagrożenie życia pacjenta. W procesie IZW w obrębie zastawek serca tworzą się konglomeraty bak‑ terii, komórek zapalnych, płytek krwi i włóknika, zwane wegetacjami. Dotyczą najczęściej zastawek lewej strony serca. Wegetacje doprowadzają do miejscowej destrukcji wsierdzia oraz stanowią źródło zatorowości obwo‑ dowej. Najczęstszym objawem IZW jest gorączka, natomiast w badaniu przedmiotowym zwraca uwagę nowy szmer wysłuchiwany nad sercem, świadczący o uszkodzeniu zastawek lub nici ścięgnistych. Zdarza się, że pierwszym symptomem choroby są zaburzenia neurologiczne spowodowane udarem mózgu powstałym w mechanizmie zatorowym. W ostatnim czasie wzrasta liczba zachorowań na IZW związanych ze stosowa‑ nymi procedurami inwazyjnymi wewnątrzsercowymi z implantacją sztucznych zastawek oraz elektrod. Szczególną grupę chorych stanowią również narkomani, u których najczęściej dochodzi do zajęcia zastawek prawej strony serca. Głównym czynnikiem etiologicznym zapalenia wsierdzia są bakterie, wśród nich obecnie dominują zakażenia gronkowcowe. Rozpoznanie choroby opiera się na danych klinicznych, obrazie echokar‑ diograficznym oraz badaniach bakteriologicznych krwi. Leczeniem przyczynowym IZW jest antybiotykotera‑ pia wielolekowa prowadzona w warunkach szpitalnych. Konieczne jest ścisłe monitorowanie choroby i roz‑ ważenie wskazań do leczenia kardiochirurgicznego. Istotnym zagadnieniem są również metody zapobiegania zakażeniom wsierdzia. Zasady profilaktyki IZW na przestrzeni ostatnich lat uległy znacznym modyfikacjom. Infekcyjne zapalenie wsierdzia wciąż pozostaje chorobą o poważnym rokowaniu, niejednokrotnie kończącą się zgonem pacjenta, a podstawowa wiedza o tym schorzeniu wydaje się niezbędna dla każdego lekarza.

  3. Garrison Dam/Lake Sakakawea Master Plan with Integrated Programmatic Environmental Assessment, Missouri River, Montana: Update of Design Memorandum MGR-107D

    Science.gov (United States)

    2007-12-14

    Toxicodendron radicans), wild strawberry ( Fragaria virginiana), violets (Oxalis violacea), and wild parsley (Lomatium orientale) fill in the...prairie rattlesnakes (Crotalus viridis ), yellowbelly racers (Coluber constrictor), western hognose snake (Heterdon nasicus), and smooth green snakes

  4. for indoor residuAl sprAying in rAkAi district, ugAndA

    African Journals Online (AJOL)

    2011-11-11

    Nov 11, 2011 ... for irs and factors associated with willingness to accept use of ddt. Results: ... system alone (1) accounting for 30 to 50 percent of outpatient ... 9 to 14 percent of inpatient deaths; making Uganda ... a long residual effect and has lower operational cost .... reasons for their decision: fear of health effects from.

  5. Handling the problem of the brine tubing bend on the basis of experiences gained during UGS - Mogilno construction

    International Nuclear Information System (INIS)

    Zola, P.; Skwarczynski, S.

    2005-01-01

    In the article problems of brine tubing bending and bent string cutting methods in the well conditions has been described. Implementation of safety joint in the brine string as an alternative solution that eliminates the need of cutting has been presented as well. (authors)

  6. Odmiany rozumu ludzkiego według Emila Ciorana [Types on human reason according to Emil Cioran

    Directory of Open Access Journals (Sweden)

    Paweł Wójs

    2014-12-01

    Full Text Available Scattered remarks on different types of reason can be found in Emil Cioran’s books. In the here presented essay it was shown that all the distinguished varieties of reason are connected to each other and it is possible to talk about emerging of another type from the previous one. These types are: naïve reason, rationalistic reason, negating reason, doubtful reason and expanded reason. Naïve reason is the one that serves life without self-consciousness. Rationalistic reason makes decrees on reality. In his critical remarks Cioran describes rationalistic reason as being dangerous. Two other types of reason are the negating and the doubtful one. Cioran proves that affirmation leads human beings to giving up themselves and that liberation always comes through constant fight for negation. Negating reason is always turned towards something external to itself. Doubtful reason goes much further by actually turning against itself, it is in constant struggle against itself. Cioran describes this process as separating the reason and standing face to face with yourself. Therefore he is aware that only the reason itself can become a judge of reason. The fifth type of reason which can be distinguished in Cioran’s philosophy might be called the extended reason as it is a demand for unfolding the reason. When one realizes that there is nothing permanent in the world and cognition can’t bring any permanent results either, the reason according to Cioran might become active again by turning back towards reality – however without any further dogma of objective truth – and by using “flowing” ideas it can unite with reality.

  7. Discovery of a novel stem rust resistance allele in durum wheat that exhibits differential reactions to Ug99 isolates

    Science.gov (United States)

    Wheat stem rust, caused by Puccinia graminis f. sp. tritici Erikss. & E. Henn, can incur yield losses on susceptible cultivars of durum wheat, Triticum turgidum ssp. durum (Desf.) Husnot. Though several durum cultivars possess the stem rust resistance gene Sr13, additional genes in durum wheat effec...

  8. Jakość usług sportowo-rekreacyjnych = The quality of sport-recreation services

    Directory of Open Access Journals (Sweden)

    Agnieszka Widawska-Stanisz

    2015-11-01

    Abstract There is a description of sport- recreation services and their quality presented in this article. The most important factors determining the high quality of providing services and the meaning of quality standards in the process of providing sport- recreation services are shown. There are some research results conducted among residents of Silesia province on the offers of sport – recreation companies and the qualities of their services.       Key words: the quality of services, sport- recreation services, purchaser.

  9. Filozofia informatyki – młoda dyscyplina z długą historią

    Directory of Open Access Journals (Sweden)

    Paweł Polak

    2016-12-01

    Full Text Available In this publication R. Murawski's anthology of philosophy of computing was reviewed. This review shows that this branch of philosophy is considered as quite new, but it has a long history. Murawski's book is a very good introduction to philosophy of computing - both for IT professionals and students of philosophy.

  10. 46 CFR 54.15-15 - Relief devices for unfired steam boilers, evaporators, and heat exchangers (modifies UG-126).

    Science.gov (United States)

    2010-10-01

    ... atmospheric type designed for vapor discharge direct to a distiller with no shutoff valve in the discharge line. The distiller connected to atmospheric evaporators shall be fitted with a vent to prevent a...

  11. The State of the Art Ten Years After a State of the Art

    DEFF Research Database (Denmark)

    Sturm, Bob L.

    2014-01-01

    A decade has passed since the first review of research on a ``flagship application" of music information retrieval (MIR): the problem of music genre recognition (MGR). During this time, about 500 works addressing MGR have been published, and at least 10 campaigns have been run to evaluate MGR sys......, the problems of validity in evaluation also affect research in music emotion recognition and autotagging. We conclude by discussing the implications of our work for MGR and MIR in the next ten years....

  12. Čeština známá i neznámá - zemče, čugárek, strboulí.

    Czech Academy of Sciences Publication Activity Database

    Ireinová, Martina

    Č. 10 (2017), s. 8-8 Institutional support: RVO:68378092 Keywords : Czech Linguistic Atlas * dialectology * Czech dialects * Dictionary of Czech Dialects Subject RIV: AI - Linguistics OBOR OECD: Linguistics www.brno-komín.cz/kominsky.zpravodaj

  13. Całościowa ocena przewlekłej obturacyjnej choroby płuc według raportu GOLD 2011

    Directory of Open Access Journals (Sweden)

    Iwona Grzelewska-Rzymowska

    2013-06-01

    Full Text Available Autorzy omawiają nowe podejście do przewlekłej obturacyjnej choroby płuc, przedstawione w raporcie GOLD 2011. Przewlekła obturacyjna choroba płuc jest ogólnoświatowym problemem zdrowotnym. Badanie BOLD ujawniło, że rozpowszechnienie choroby jest różne w poszczególnych krajach i będzie czwartą przy‑ czyną zgonów w 2030 roku. Główną przyczyną przewlekłej obturacyjnej choroby płuc jest nałóg palenia tytoniu. Raport GOLD 2011 zaleca, aby postawienie diagnozy rozważyć, jeśli pacjent prezentuje takie obja‑ wy, jak: duszność, kaszel i odkrztuszanie wydzieliny z ekspozycją na czynniki ryzyka oraz z obecnością obtu‑ racji potwierdzonej wartością FEV1/ FVC < 0,70. Wskaźnik FEV1 okazał się niedostatecznym deskryptorem wpływu przewlekłej obturacyjnej choroby płuc na pacjenta. Jest to choroba złożona i różnorodna, zbadanie jej wpływu na zdrowie pacjenta wymaga walidowanych testów, takich jak BODE, ADO, DOSE. Raport GOLD 2011 zaleca stosowanie dwóch walidowanych testów: mMRC i CAT. Wskaźniki wentylacyjne są skla‑ syfikowane jako GOLD 1 i 2 (zaburzenia łagodne i umiarkowane oraz GOLD 3 i 4 (zaburzenia ciężkie i bar‑ dzo ciężkie. Zaostrzenia przewlekłej obturacyjnej choroby płuc są ustalane na podstawie wywiadu lub war‑ tości FEV1. Ostatecznie pacjentów można zakwalifikować do kategorii A, B, C lub D. Leczenie farmakologiczne powinno być ustalane po dokonaniu zindywidualizowanej oceny.

  14. Gruźlica – od diagnostyki do leczenia według standardów dla krajów Unii Europejskiej

    Directory of Open Access Journals (Sweden)

    Iwona Grzelewska-Rzymowska

    2013-09-01

    Full Text Available Autorzy przedstawiają dane epidemiologiczne odnoszące się do gruźlicy w niektórych krajach, w tym w Polsce. Gruźlica ciągle pozostaje priorytetowym wyzwaniem dla zdrowia publicznego. Obecnie stosowana chemioterapia jest skuteczna, ale długotrwała i kompleksowa. Poważny problem stanowią szczepy Mycobacterium tuberculosis oporne na leki przeciwprątkowe, szczególnie szczepy oporne na wiele leków (MDR-TB i te o rozszerzonej opor‑ ności (XDR-TB, oraz zakażenia HIV wśród chorych na gruźlicę. W październiku 2011 roku zostały sfinalizowane standardy dotyczące gruźlicy dla krajów Unii Europejskiej (European Union Standards for Tuberculosis Care, ESTC. Dokument ten pozostaje w zgodzie z definicjami i rekomendacjami WHO. ESTC składają się z czterech sekcji: diagnozowanie, leczenie, HIV i choroby współistniejące, zdrowie publiczne, które korespondują z Między‑ narodowymi Standardami Opieki nad Chorymi na Gruźlicę (ISTC z 2009 roku. W 2013 roku zostały opubliko‑ wane polskie rekomendacje. Autorzy komentują wszystkie odnoszące się do gruźlicy rekomendacje. Przedstawio‑ no objawy kliniczne gruźlicy i wybrane problemy gruźlicy utajonej (latent tuberculosis. Próbki wydzieliny oskrzelowej powinny być poddane badaniu mikroskopowemu, hodowli i testom lekowraźliwości. WHO rekomen‑ duje szybki test molekularny, który należy wykonać w dniu bakteriologicznej diagnozy gruźlicy. Wszyscy chorzy (w tym osoby zakażone HIV, którzy nie byli wcześniej leczeni i u których nie występują czynniki ryzyka oporności na leki, powinni otrzymywać przez 2 miesiące izoniazyd, ryfampicynę, pirazynamid i etambutol, a przez 4 miesiące izoniazyd i ryfampicynę. Niektóre standardy odnoszą się do gruźlicy dziecięcej. Infekcja wywołana przez Mycobacterium tuberculosis powinna zostać wykryta za pomocą testu tuberkulinowego lub testu uwalniania interferonu gamma (IGRA. Dzieci poniżej 5. roku życia i osoby zakażone HIV, u których stwierdzono gruźlicę utajoną, należy leczyć izoniazydem, jeśli nie stwierdza się u nich aktywnej gruźlicy.

  15. Classification of agricultural assets on the international accounting standard 41 Agriculture Klasyfikacja aktywów pochodzenia rolniczego według MSR 41 Rolnictwo

    Directory of Open Access Journals (Sweden)

    Dorota Czerwińska-Kayzer

    2011-12-01

    Full Text Available Agricultural activity is characterised by dissimilarity and complexity of economic events. Therefore, the assets related to agricultural activity, should be properly classified, as it affects the method of valuation and the company assessment. In the article the classification of agricultural assets has been presented in respect of IAS/IFRS 41 Agriculture.

  16. Raportowanie banków na temat zrównoważonego rozwoju według standardów Global Reporting Initiative

    Directory of Open Access Journals (Sweden)

    Ana Novokmet

    2016-09-01

    Full Text Available Rachunkowość zrównoważonego rozwoju, z jej ostatecznym produktem – raportami społecznej odpo-wiedzialności, jest nową dziedziną rachunkowości i koncentruje się na ocenie i monitorowaniu działań w zakresie zarządzania firmą, ochrony środowiska i integracji społecznej oraz interakcji z otoczeniem. Wśród kilku standardowych ram, firmy na całym świecie często wybierają wytyczne Sustainability Re-porting Global Reporting Initiative (GRI. Od roku 2000 wytyczne GRI ewoluowały i obecnie jest do-stępna czwarta ich generacja. Celem tego artykułu jest ocena raportowania społecznego w ramach zinte-growanych raportów w sektorze bankowym na przykładzie UniCredit Group, która działa w 15 krajach. Raportowanie zrównoważonego rozwoju stanie się obowiązkowe w Unii Europejskiej dla dużych firm, notowanych na giełdach spółek i jednostek interesu publicznego (na przykład banków ze średnim za-trudnieniem co najmniej 500 pracowników, począwszy od roku 2018 (dla działalności w 2017 r.. Wniniejszym artykule skoncentrowano się na krytycznej analizie treści raportu społecznego banku.

  17. Informatics Tools and Methods to Enhance U.S. Cancer Surveillance Research, UG3/UH3 | Informatics Technology for Cancer Research (ITCR)

    Science.gov (United States)

    The goal of this Funding Opportunity Announcement (FOA) is to advance surveillance science by supporting the development of new and innovative tools and methods for more efficient, detailed, timely, and accurate data collection by cancer registries. Specifically, the FOA seeks applications for projects to develop, adapt, apply, scale-up, and validate tools and methods to improve the collection and integration cancer registry data and to expand the data items collected. Population-based central cancer registries (a partnership must involve at least two different registries).

  18. Badania wartości ekonomicznej usług biblioteczno-informacyjnych i ich wpływu na otoczenie

    Directory of Open Access Journals (Sweden)

    Ewa Głowacka

    2011-01-01

    Full Text Available Biblioteki pełnią różnorodne funkcje we współczesnym otoczeniu społecznym. Uczestniczą w tworzeniu kapitału intelektualnego i społecznego, wpływają na wzrost korzyści ekonomicznych użytkowników i całego społeczeństwa. W artykule omówiono główne podejścia i metody badawcze w zakresie oceny korzyści ekonomicznych płynących z funkcjonowania bibliotek. Skupiono się na metodzie analizy kosztów w stosunku do korzyści (ang. CBA – cost-benefit analysis, metodzie analizy warunkowej (ang. CVM – contigent valuation method, określaniu wartości dodanej dla użytkownika (ang. consumer surplus method i metodologii oceny stopy wzrostu z inwestycji (ang. ROI – return of investment. Przeanalizowano również różne projekty badań prowadzone na świecie w tym zakresie.

  19. Registration of 'Linkert' spring wheat with good straw strength and field resistance to the Ug99 family of stem rust races

    Science.gov (United States)

    Straw strength is one of the most important criteria for spring wheat cultivar selection in the north central U.S. ‘Linkert’ (PI 672164) hard red spring wheat was released by the University of Minnesota Agricultural Experiment Station in 2013 and has very good straw strength, high grain protein con...

  20. First Report of the Ug99 race group of Wheat Stem Rust, Puccinia graminis f. sp. tritici, in Egypt in 2014

    DEFF Research Database (Denmark)

    Patpour, Mehran; Hovmøller, Mogens; Shahin, Atef

    2016-01-01

    , Kenya, Ethiopia, Sudan, Tanzania, Eritrea, Rwanda, South Africa, Zimbabwe, Mozambique, Yemen, and Iran (Patpour et al. 2015). In the 2014 crop season, the presence of virulence to Sr31 in Egypt was suspected based on preliminary field observations of high infection on sources of Sr31 planted...

  1. https://drive.google.com/file/d/138qVlHQbLvtZ8WhmKIoUgBQATnzNXztg/view

    Directory of Open Access Journals (Sweden)

    Zenia Isabel Castro-Borunda

    2017-07-01

    Full Text Available The objective of this research was to know the viability of project investment evaluation using a simulation strategy for financial projection, which incorporates quantitative primary data to go through the evaluation process and extract financial indicators for decision making and give an opinion which serves for obtaining a credit; the recent investigation was applied to students of Mexico National Technological Institue (TecNM, specifically at the campus (ITLM, in Los Mochis, Sinaloa in the course of Formulation and Evaluation of Investment Projects which belongs to the bachelor’s Degree in Business Administration. For this effect it’s important to give feedback that at present any company that needs to use a bank and not bank source of financing requires an investment project; this is the importance of this topic, for its relevance and opportunity; the loan institutions demand formality and presentation in the project for obtaining a credit, combined with the innovative or important of the business idea, this turns out to be a highly positive binomial, allowing that the small and medium enterprises (SMEs participate for getting a financial source for their business; depending the case, the companies could be in the stage of growth or in the stage of maturity, but the needs will be the same: they require cash flow to correct some specific needs and it only will be able by obtaining a credit from a bank or a government institution, such as the “Fideicomiso de Riesgo Compratido FIRCO” (Shared Risk Trust, “Fideicomiso instituido en Relación a la Agricultura FIRA” (Institutional Trust Regarding Agriculture, “Secretaría de Economía SE” (Ministry of Economy, “Secretaría de Agricultura y Ganadería, Desarrollo Rural, Pesca y Alimentación SAGARPA” (Ministry of Agriculture and Livestock, Rural Development, Fishing and Feeding, among others; these institutions guide in their varied programs to these companies in the process of consolidation or growth, but they require that their participation can be taken to develop and evaluate an investment to know their viability.

  2. Deep ancestry of programmed genome rearrangement in lampreys.

    Science.gov (United States)

    Timoshevskiy, Vladimir A; Lampman, Ralph T; Hess, Jon E; Porter, Laurie L; Smith, Jeramiah J

    2017-09-01

    In most multicellular organisms, the structure and content of the genome is rigorously maintained over the course of development. However some species have evolved genome biologies that permit, or require, developmentally regulated changes in the physical structure and content of the genome (programmed genome rearrangement: PGR). Relatively few vertebrates are known to undergo PGR, although all agnathans surveyed to date (several hagfish and one lamprey: Petromyzon marinus) show evidence of large scale PGR. To further resolve the ancestry of PGR within vertebrates, we developed probes that allow simultaneous tracking of nearly all sequences eliminated by PGR in P. marinus and a second lamprey species (Entosphenus tridentatus). These comparative analyses reveal conserved subcellular structures (lagging chromatin and micronuclei) associated with PGR and provide the first comparative embryological evidence in support of the idea that PGR represents an ancient and evolutionarily stable strategy for regulating inherent developmental/genetic conflicts between germline and soma. Copyright © 2017 Elsevier Inc. All rights reserved.

  3. Diuron treatment reveals the different roles of two cyclic electron transfer pathways in photosystem II in Arabidopsis thaliana.

    Science.gov (United States)

    Jin, Yujian; Chen, Si; Fan, Xiaoji; Song, Hao; Li, Xingxing; Xu, Jiahui; Qian, Haifeng

    2017-04-01

    Three ecotypes of Arabidopsis thaliana, ecotype Columbia (Wild type, Wt) and two mutants (pgr5 and ndf4), were used to evaluate the effects of diuron on photosynthetic activity of A. thaliana. It was found that diuron adversely affected the fresh weight and chlorophyll content of the plants. Chlorophyll fluorescence studies determined that the pgr5 mutant was more sensitive to diuron than Wt and the ndf4 mutant. Gene expression analysis revealed different roles for the two cyclic electron transfer (CET) pathways, NAD(P)H dehydrogenase (NDH) and proton gradient regulation (PGR5) pathways, in the plant after diuron treatment. For example, a gene in the NDH pathway, lhca5, was activated in the low dose (LD) group in the pgr5 mutant, but was down-regulated in the moderate dose (MD) group, along with two other NDH-related genes (ppl2 and ndhH). In the PGR5 pathway, the pgr5 gene was functional under conditions of increased stress (MD group), and was up-regulated to a greater extent in the ndf4 mutant than that in the Wt and pgr5 mutant. Our results suggest that the PGR5 pathway in plants is more important than the NDH pathway during resistance to environmental stress. Deficiencies in the PGR5 pathway could not be counteracted by the NDH pathway, but deficiencies in the NDH pathway could be overcome by stimulating PGR5. Copyright © 2016 Elsevier B.V. All rights reserved.

  4. Distance matters. Assessing socioeconomic impacts of the Dukovany nuclear power plant in the Czech Republic: Local perceptions and statistical evidence

    Czech Academy of Sciences Publication Activity Database

    Frantál, Bohumil; Malý, Jiří; Ouředníček, M.; Nemeškal, J.

    2016-01-01

    Roč. 24, č. 1 (2016), s. 2-13 ISSN 1210-8812 R&D Projects: GA MŠk(CZ) EE2.3.20.0025 Institutional support: RVO:68145535 Keywords : nuclear power plant impacts * spatial analysis * risk perceptions Subject RIV: DE - Earth Magnetism, Geodesy, Geography Impact factor: 2.149, year: 2016 http://www.degruyter.com/view/j/mgr.2016.24.issue-1/mgr-2016-0001/mgr-2016-0001.xml?format=INT

  5. Dicty_cDB: SHL207 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available GYSLNNNFYISETPFSLASTTHIDKTFISTNKE AIIVDTIKKAEDGTSFVVRVYESFGGATTFNFTSSILPIPFKSIIECNGLEEVNQSSKSY KFNDTIKINPFEIKTFRFISN*klkiklinky...DTIKINPFEIKTFRFISN*klkiklinkyknkf Translated Amino Acid sequence (All Frames) Frame A: ---*hklgfrki*scrt*mgr...ASTTHIDKTFISTNKE AIIVDTIKKAEDGTSFVVRVYESFGGATTFNFTSSILPIPFKSIIECNGLEEVNQSSKSY KFN

  6. Regional Income Inequalities In Poland And Italy / Rozkład Nierówności Według Regionów w Polsce i We Włoszech

    Directory of Open Access Journals (Sweden)

    Jędrzejczak Alina

    2015-12-01

    Full Text Available Redukcja różnic między regionami Europy była głównym celem polityki “zrównoważonego rozwoju”, której założenia znalazły się już w tzw. Traktatach Rzymskich (1957. Postępujący proces integracji europejskiej tworzył wciąż nowe instrumenty i inicjatywy (tzw. mechanizmy solidarności, wyrażające dążenie do niwelowania ekonomicznej i społecznej nierównowagi między regionami. Okazało się jednak, że różnice między regionami biednymi i bogatymi w wielu krajach wcale się nie zmniejszają, a spowolnienie gospodarcze spowodowało odwrócenie pozytywnych tendencji nawet w krajach relatywnie najbardziej rozwiniętych.

  7. Zagraniczne kontakty oraz ich rola w podnoszeniu jakości usług i budowaniu wizerunku biblioteki akademickiej. Doświadczenia Biblioteki Głównej Uniwersytetu Pedagogicznego im. KEN w Krakowie w latach 2010-2016

    Directory of Open Access Journals (Sweden)

    Błach Marzena

    2017-06-01

    Full Text Available The aim of the article is to draw attention to the role of contacts with foreign institutions in the process of improving services and building the image of an academic library. Experiences of the Main Library of the Pedagogical University in Cracow show a positive influence of participation in the Erasmus programme on the professional activity (increased number of foreign interlibrary transactions and scientific studies (reports and articles, conference papers, seminars of librarians. The article discusses the cooperation of the PU Main Library with foreign institutions in the years 2010-2016, conducted within the framework of the Erasmus programme and Interlibrary Loan. Statistical data illustrate the intensity of Erasmus and interlibrary contacts. Also, based on the experience of a Main Library employee participating in the International Librarians Network, library networking forms are described.

  8. Wymagania informacyjne użytkowników bibliotek akademickich XXI wieku: LibQUAL+TM jako narzędzie pomiaru jakości usług bibliotecznych

    OpenAIRE

    Jankowska, Maria Anna

    2006-01-01

    Google Scholar, Amazon.com, Flickr, MySpace, social networking, open access, and easy retrieval of electronic resources and services create higher user expectations toward academic library collections and services. �In this competitive environment of content providers and users’ growing expectations, academic libraries face a difficult task in providing the most satisfying ways of delivering content and services to their patrons. To what extend should libraries recognize the users’ informatio...

  9. Idea państwa według minarchistów i anarchokapitalistów [Idea of the State from the Perspective of Minarchists and Anarcho-capitalists

    Directory of Open Access Journals (Sweden)

    Hubert Staskiewicz

    2013-03-01

    Full Text Available This scientific article treats of libertarianism. Its fundamental premises are: conception of self-ownership, non-aggression axiom, proprietorship, free market, ‘no victim,no crime’ rule, aversion to the state institutions. The existence of libertarianism itselfis the most prominent subject of dispute between its two currents: minarchism andanarcho-capitalism. The adherents of the doctrine of minimal statism were FriedrichA. von Hayek and Milton Friedman, while Murray N. Rothbard and Hans-HermannHoppe were the followers of the free-market anarchy. The traditional, one-dimensional division into the left and right wing is not sufficient for the libertarianism tofind its place on the political scene. It is multidimensionality that characterises thelibertarian thought.

  10. Emergence of virulence to SrTmp in the Ug99 race group of wheat stem rust, Puccinia graminis f. sp. tritici, in Africa

    DEFF Research Database (Denmark)

    Patpour, M.; Hovmøller, M. S.; Justesen, A. F.

    2016-01-01

    of wheat fields in Africa (Kenya, 9; Uganda, 28; Rwanda, 41; and Egypt, 6) were sent to the Global Rust Reference Center (GRRC, Denmark) for race analysis. Puccinia graminis f. sp. tritici (Pgt) samples were recovered on cv. Morocco, and resulting urediniospores of 53 single-pustule isolates were......Tmp) to confirm their virulence/avirulence combinations to Sr24, Sr31, Sr36, and SrTmp. Race TTKTK was also detected at two locations in Uganda (Rubaya and Muko in Kabale region) and at five locations in Rwanda (Kinigi, Rwerere, Rufungo, Gatebe, and Kamenyo). Three isolates derived from stem rust samples...

  11. Music genre recognition with risk and rejection

    DEFF Research Database (Denmark)

    Sturm, Bob L.

    2013-01-01

    We explore risk and rejection for music genre recognition (MGR) within the minimum risk framework of Bayesian classification. In this way, we attempt to give an MGR system knowledge that some misclassifications are worse than others, and that deferring classification to an expert may be a better...

  12. A Survey of Evaluation in Music Genre Recognition

    DEFF Research Database (Denmark)

    Sturm, Bob L.

    2012-01-01

    Much work is focused upon music genre recognition (MGR) from audio recordings, symbolic data, and other modalities. While reviews have been written of some of this work before, no survey has been made of the approaches to evaluating approaches to MGR. This paper compiles a bibliography of work...

  13. Remodeling of the Cervix and Parturition in Mice Lacking the Progesterone Receptor B Isoform1

    Science.gov (United States)

    Yellon, Steven M.; Oshiro, Bryan T.; Chhaya, Tejas Y.; Lechuga, Thomas J.; Dias, Rejane M.; Burns, Alexandra E.; Force, Lindsey; Apostolakis, Ede M.

    2011-01-01

    Withdrawal of progestational support for pregnancy is part of the final common pathways for parturition, but the role of nuclear progesterone receptor (PGR) isoforms in this process is not known. To determine if the PGR-B isoform participates in cervical remodeling at term, cervices were obtained from mice lacking PGR-B (PGR-BKO) and from wild-type (WT) controls before or after birth. PGR-BKO mice gave birth to viable pups at the same time as WT controls during the early morning of Day 19 postbreeding. Morphological analyses indicated that by the day before birth, cervices from PGR-BKO and WT mice had increased in size, with fewer cell nuclei/area as well as diminished collagen content and structure, as evidenced by optical density of picrosirius red-stained sections, compared to cervices from nonpregnant mice. Moreover, increased numbers of resident macrophages, but not neutrophils, were found in the prepartum cervix of PGR-BKO compared to nonpregnant mice, parallel to findings in WT mice. These results suggest that PGR-B does not contribute to the growth or degradation of the extracellular matrix or proinflammatory processes associated with recruitment of macrophages in the cervix leading up to birth. Rather, other receptors may contribute to the progesterone-dependent mechanism that promotes remodeling of the cervix during pregnancy and in the proinflammatory process associated with ripening before parturition. PMID:21613631

  14. Glycaemic Response to some Commonly Eaten Fruits in Type 2 ...

    African Journals Online (AJOL)

    Background: It is not known which of the commonly consumed fruits in Nigeria are suitable for persons with diabetes mellitus especially with regards to the attendant plasma glucose response (PGR) to consumption of such fruits. Objectives: To determine and compare the PGR to commonly eaten fruits in patients with ...

  15. The GRIN-Global Information Management System – Public Interface Demonstration and Input Opportunity

    Science.gov (United States)

    The GRIN-Global (GG) Information Management System, under development for the past three years, provides the world's crop genebanks and plant genetic resource (PGR) users with a powerful, flexible, easy-to-use PGR information management system. Developed jointly by the USDA Agricultural Research Ser...

  16. The GRIN-Global Information Management System – A Preview and Opportunity for Public User Input

    Science.gov (United States)

    The GRIN-Global Information Management System, under development for the past two years, will provide the world's crop genebanks and plant genetic resource (PGR) users with a powerful, flexible, easy-to-use PGR information management system. Developed jointly by the USDA Agricultural Research Servi...

  17. GRIN-Global: An International Project to Develop a Global Plant Genebank Information Management System

    Science.gov (United States)

    The mission of the GRIN-Global Project is to create a new, scalable version of the Germplasm Resource Information System (GRIN) to provide the world’s crop genebanks with a powerful, flexible, easy-to-use plant genetic resource (PGR) information management system. The system will help safeguard PGR ...

  18. Role of plant growth regulators and a saprobic fungus in enhancement of metal phytoextraction potential and stress alleviation in pearl millet.

    Science.gov (United States)

    Firdaus-e-Bareen; Shafiq, Muhammad; Jamil, Sidra

    2012-10-30

    "Assisted phytoextraction" involving application of chemical additives such as plant growth regulators (PGRs) has become a trend in phytoremediation technology. This study identifies a cost-effective, naturally available crude PGR (PGR1) that produces the same effects as the commercial PGR (PGR2), increasing metal uptake by plants and the reduction of metal stress. Assisted phytoextraction by pearl millet (Pennisetum glaucum) from a multi-metal (Cd, Cr, Cu, Fe, Na and Zn) contaminated soil medium with tannery solid waste (TSW) soil amendments of 5 and 10%, was evaluated in a full-factorial pot trial with PGR1, PGR2 and Trichoderma pseudokoningii as factors. The effects of these phytoextraction assistants were measured through dry biomass production, heavy metal uptake, stress tolerance enzymes catalase (CAT) and superoxide dismutase (SOD), soluble protein content of plant, and phytoextraction efficiency. Dry biomass and multi-metal accumulation were the highest in the soil treatments with a combined application of PGR1, PGR2 and T. pseudokoningii and the lowest in the control. The soluble protein contents and the SOD and CAT values were the highest in the 10% TSW treatment provided with PGR2+T. pseudokoningii, while the lowest were in the control. Thus, application of crude PGR in combination with other phytoextraction assistants can increase biomass production as well as multi-metal accumulation in plants. However, the biochemical properties of the plant depend on the level of TSW stress in the soil treatment as well as the type of phytoextraction assistants. Copyright © 2012 Elsevier B.V. All rights reserved.

  19. Effect of magnetic reconnection in stellar plasma

    Science.gov (United States)

    Hammoud, M.; El Eid, M.; Darwish, M.

    2017-06-01

    An important phenomenon in Astrophysics is the process of magnetic reconnection (MGR), which is envisaged to understand the solar flares, coronal mass ejection, interaction of the solar wind with the Earth’s magnetic field (so called geomagnetic storm) and other phenomena. In addition, it plays a role in the formation of stars. MGR involves topological change of a set of magnetic field lines leading to a new equilibrium configuration of lower magnetic energy. The MGR is basically described in the framework of the Maxwell’s equations linked to Navier-Stockes equations. Nevertheless, many details are still not understood. In this paper, we investigate the MGR process in the framework of the Magnetohydrodynamic (MHD) model of a single conducting fluid using a modern powerful computational tool (OpenFOAM). We will show that the MGR process takes place only if resistivity exists. However, despite the high conductivity of the plasma, resistivity becomes effective in a very thin layer generating sharp gradients of the magnetic field, and thus accelerating the reconnection process. The net effect of MGR is that magnetic energy is converted into thermal and kinetic energies leading to heating and acceleration of charged particles. The Sun’s coronal ejection is an example of the MGR process.

  20. Hypocholesterolemic Response to Karaya Saponin and Rhodobacter capsulatus in Broiler Chickens

    OpenAIRE

    Afrose, Sadia; Hossain, Md. Sharoare; Maki, Takaaki; Tsujii, Hirotada

    2010-01-01

    Dietary karaya saponin and Rhodobacter capsulatus (R. capsulatus) are known to have hypocholesterolemic actions, as reported in our previous studies. This study examined possible synergistic hypocholesterolemic effects of karaya saponin and R. capsulatus in broilers. A total of 150 broilers were allocated into 10 treatments: control, saponin 25 mg, saponin 50 mg, saponin 75 mg, saponin 25 mg+R. capsulatus 0.2 g, saponin 25 mg+R. capsulatus 0.4 g, saponin 50 mg+R. capsulatus 0.2 g, saponin 50 ...

  1. The GTZAN dataset

    DEFF Research Database (Denmark)

    Sturm, Bob L.

    2013-01-01

    The GTZAN dataset appears in at least 100 published works, and is the most-used public dataset for evaluation in machine listening research for music genre recognition (MGR). Our recent work, however, shows GTZAN has several faults (repetitions, mislabelings, and distortions), which challenge...... of GTZAN, and provide a catalog of its faults. We review how GTZAN has been used in MGR research, and find few indications that its faults have been known and considered. Finally, we rigorously study the effects of its faults on evaluating five different MGR systems. The lesson is not to banish GTZAN...

  2. Waste Handling Equipment Development Test and Evaluation Study

    International Nuclear Information System (INIS)

    R.L. Tome

    1998-01-01

    The purpose of this study is to identify candidate Monitored Geologic Repository (MGR) surface waste handling equipment for development testing. This study will also identify strategies for performing the development tests. Development testing shall be implemented to support detail design and reduce design risks. Development testing shall be conducted to confirm design concepts, evaluate alternative design concepts, show the availability of needed technology, and provide design documentation. The candidate equipment will be selected from MGR surface waste handling equipment that is the responsibility of the Management and Operating Contractor (M and O) Surface Design Department. The equipment identified in this study is based on Viability Assessment (VA) design. The ''Monitored Geologic Repository Test and Evaluation Plan'' (MGR T and EP), Reference 5.1, was used as a basis for this study. The MGR T and EP reflects the extent of test planning and analysis that can be conducted, given the current status of the MGR requirements and latest VA design information. The MGR T and EP supports the appropriate sections in the license application (LA) in accordance with 10 CFR 60.2 1(c)(14). The MGR T and EP describes the following test activities: site characterization to confirm, by test and analysis, the suitability of the Yucca Mountain site for housing a geologic repository; development testing to investigate and document design concepts to reduce risk; qualification testing to verify equipment compliance with design requirements, specifications, and regulatory requirements; system testing to validate compliance with MGR requirements, which include the receipt, handling, retrieval, and disposal of waste; periodic performance testing to verify preclosure requirements and to demonstrate safe and reliable MGR operation; and performance confirmation modeling, testing, and analysis to verify adherence to postclosure regulatory requirements. Development test activities can be

  3. Uterine progesterone signaling is a target for metformin therapy in PCOS-like rats.

    Science.gov (United States)

    Hu, Min; Zhang, Yuehui; Feng, Jiaxing; Xu, Xue; Zhang, Jiao; Zhao, Wei; Guo, Xiaozhu; Li, Juan; Vestin, Edvin; Cui, Peng; Li, Xin; Wu, Xiao-Ke; Brännström, Mats; Shao, Linus R; Billig, Håkan

    2018-05-01

    Impaired progesterone (P4) signaling is linked to endometrial dysfunction and infertility in women with polycystic ovary syndrome (PCOS). Here, we report for the first time that elevated expression of progesterone receptor (PGR) isoforms A and B parallels increased estrogen receptor (ER) expression in PCOS-like rat uteri. The aberrant PGR-targeted gene expression in PCOS-like rats before and after implantation overlaps with dysregulated expression of Fkbp52 and Ncoa2 , two genes that contribute to the development of uterine P4 resistance. In vivo and in vitro studies of the effects of metformin on the regulation of the uterine P4 signaling pathway under PCOS conditions showed that metformin directly inhibits the expression of PGR and ER along with the regulation of several genes that are targeted dependently or independently of PGR-mediated uterine implantation. Functionally, metformin treatment corrected the abnormal expression of cell-specific PGR and ER and some PGR-target genes in PCOS-like rats with implantation. Additionally, we documented how metformin contributes to the regulation of the PGR-associated MAPK/ERK/p38 signaling pathway in the PCOS-like rat uterus. Our data provide novel insights into how metformin therapy regulates uterine P4 signaling molecules under PCOS conditions. © 2018 Society for Endocrinology.

  4. Influence of Plant Growth Retardants on Quality of Codonopsis Radix

    Directory of Open Access Journals (Sweden)

    Yinyin Liao

    2017-10-01

    Full Text Available Plant growth retardant (PGR refers to organics that can inhibit the cell division of plant stem tip sub-apical meristem cells or primordial meristem cell. They are widely used in the cultivation of rhizomatous functional plants; such as Codonopsis Radix, that is a famous Chinese traditional herb. However, it is still unclear whether PGR affects the medicinal quality of C. Radix. In the present study, amino acid analyses, targeted and non-targeted analyses by ultra-performance liquid chromatography combined with time-of-flight mass spectrometry (UPLC-TOF-MS and gas chromatography-MS were used to analyze and compare the composition of untreated C. Radix and C. Radix treated with PGR. The contents of two key bioactive compounds, lobetyolin and atractylenolide III, were not affected by PGR treatment. The amounts of polysaccharides and some internal volatiles were significantly decreased by PGR treatment; while the free amino acids content was generally increased. Fifteen metabolites whose abundance were affected by PGR treatment were identified by UPLC-TOF-MS. Five of the up-regulated compounds have been reported to show immune activity, which might contribute to the healing efficacy (“buqi” of C. Radix. The results of this study showed that treatment of C. Radix with PGR during cultivation has economic benefits and affected some main bioactive compounds in C. Radix.

  5. Mechanism of pyrogallol red oxidation induced by free radicals and reactive oxidant species. A kinetic and spectroelectrochemistry study.

    Science.gov (United States)

    Atala, E; Velásquez, G; Vergara, C; Mardones, C; Reyes, J; Tapia, R A; Quina, F; Mendes, M A; Speisky, H; Lissi, E; Ureta-Zañartu, M S; Aspée, A; López-Alarcón, C

    2013-05-02

    Pyrogallol red (PGR) presents high reactivity toward reactive (radical and nonradical) species (RS). This property of PGR, together with its characteristic spectroscopic absorption in the visible region, has allowed developing methodologies aimed at evaluating the antioxidant capacity of foods, beverages, and human fluids. These methods are based on the evaluation of the consumption of PGR induced by RS and its inhibition by antioxidants. However, at present, there are no reports regarding the degradation mechanism of PGR, limiting the extrapolation to how antioxidants behave in different systems comprising different RS. In the present study, we evaluate the kinetics of PGR consumption promoted by different RS (peroxyl radicals, peroxynitrite, nitrogen dioxide, and hypochlorite) using spectroscopic techniques and detection of product by HPLC mass spectrometry. The same pattern of oxidation and spectroscopic properties of the products is observed, independently of the RS employed. Mass analysis indicates the formation of only one product identified as a quinone derivative, excluding the formation of peroxides or hydroperoxides and/or chlorinated compounds, in agreement with FOX's assays and oxygen consumption experiments. Cyclic voltammetry, carried out at different pH's, shows an irreversible oxidation of PGR, indicating the initial formation of a phenoxy radical and a second charge transfer reaction generating an ortho-quinone derivative. Spectroelectrochemical oxidation of PGR shows oxidation products with identical UV-visible absorption properties to those observed in RS-induced oxidation.

  6. Coordinated Regulation Among Progesterone, Prostaglandins, and EGF-Like Factors in Human Ovulatory Follicles.

    Science.gov (United States)

    Choi, Yohan; Wilson, Kalin; Hannon, Patrick R; Rosewell, Katherine L; Brännström, Mats; Akin, James W; Curry, Thomas E; Jo, Misung

    2017-06-01

    In animal models, the luteinizing hormone surge increases progesterone (P4) and progesterone receptor (PGR), prostaglandins (PTGs), and epidermal growth factor (EGF)-like factors that play essential roles in ovulation. However, little is known about the expression, regulation, and function of these key ovulatory mediators in humans. To determine when and how these key ovulatory mediators are induced after the luteinizing hormone surge in human ovaries. Timed periovulatory follicles were obtained from cycling women. Granulosa/lutein cells were collected from in vitro fertilization patients. The in vivo and in vitro expression of PGR, PTG synthases and transporters, and EGF-like factors were examined at the level of messenger RNA and protein. PGR binding to specific genes was assessed. P4 and PTGs in conditioned media were measured. PGR, PTGS2, and AREG expressions dramatically increased in ovulatory follicles at 12 to 18 hours after human chorionic gonadotropin (hCG). In human granulosa/lutein cell cultures, hCG increased P4 and PTG production and the expression of PGR, specific PTG synthases and transporters, and EGF-like factors, mimicking in vivo expression patterns. Inhibitors for P4/PGR and EGF-signaling pathways reduced hCG-induced increases in PTG production and the expression of EGF-like factors. PGR bound to the PTGS2, PTGES, and SLCO2A1 genes. This report demonstrated the time-dependent induction of PGR, AREG, and PTGS2 in human periovulatory follicles. In vitro studies indicated that collaborative actions of P4/PGR and EGF signaling are required for hCG-induced increases in PTG production and potentiation of EGF signaling in human periovulatory granulosa cells. Copyright © 2017 Endocrine Society

  7. Sonography and CT findings in perigraft reactions after surgical implantation of vascular prostheses

    International Nuclear Information System (INIS)

    Scherer, G.; Roeren, T.; Paetz, B.; Hupp, T.; Kauffmann, G.W.

    1995-01-01

    Between January 1988 and January 1994, 24 patients with heterologeous vascular bypasses were examined with suspected diagnosis of a perigraft reaction (PGR). All patients were subjected to ultrasound and CT. PGR ist defined as a sterile inflammation along the course of a vascular prosthesis. The typical clinical presentation is a fluctuating tumour with a localised painless swelling. In all cases liquid formations could be confirmed by diagnostic imaging procedures; signs of infection could be excluded. The synopsis of the clinical presentation, the time interval after implantation of the prosthetic material and the signs of sonography and CT can reliably exclude infection of the prosthesis and confirm the diagnosis of a PGR. (orig.) [de

  8. String theory: A brand new theory that claims to explain everything in existence

    International Nuclear Information System (INIS)

    Pal, P.B.

    1988-01-01

    Background of the origin of the string theories which have shown possibilities of unifying all four basic forces including gravity is described and the concepts behind these theories are explained for the layman. (M.G.R.)

  9. A preliminary survey and analysis of the spatial distribution of ...

    African Journals Online (AJOL)

    The spatial distribution of aquatic macroinvertebrates in the Okavango River Delta, ... seasonally-flooded pools and temporary rain-filled pools in MGR and CI. ... biodiversity of the Okavango Delta, thereby contributing to its conservation.

  10. Evaluating music emotion recognition

    DEFF Research Database (Denmark)

    Sturm, Bob L.

    2013-01-01

    A fundamental problem with nearly all work in music genre recognition (MGR)is that evaluation lacks validity with respect to the principal goals of MGR. This problem also occurs in the evaluation of music emotion recognition (MER). Standard approaches to evaluation, though easy to implement, do...... not reliably differentiate between recognizing genre or emotion from music, or by virtue of confounding factors in signals (e.g., equalization). We demonstrate such problems for evaluating an MER system, and conclude with recommendations....

  11. Evaluating music emotion recognition:Lessons from music genre recognition?

    OpenAIRE

    Sturm, Bob L.

    2013-01-01

    A fundamental problem with nearly all work in music genre recognition (MGR)is that evaluation lacks validity with respect to the principal goals of MGR. This problem also occurs in the evaluation of music emotion recognition (MER). Standard approaches to evaluation, though easy to implement, do not reliably differentiate between recognizing genre or emotion from music, or by virtue of confounding factors in signals (e.g., equalization). We demonstrate such problems for evaluating an MER syste...

  12. Mass relation for neutrinos

    Science.gov (United States)

    Babu; Barr

    2000-08-07

    A generalization of the well-known Georgi-Jarlskog relation (m(&mgr;)/m(tau)) = 3(m(s)/m(b)) to neutrinos is found in the context of SO(10). This new relation is (m(nu(&mgr;))/m(nu(tau))) = 16(m(c)/m(t)), which is consistent with present data, assuming the Mikheyev-Smirnov-Wolfenstein solution to the solar neutrino problem.

  13. Effect of benzylaminopurine (BAP) pulsing on in vitro shoot ...

    African Journals Online (AJOL)

    user

    2011-03-28

    Mar 28, 2011 ... Research Cluster, Faculty of Science, University Malaya, 50603 Kuala Lumpur, Malaysia. Accepted 12 ... number of bud formation in shoot cultures of Musa acuminata cv. ... In tissue culture, plant growth regulators (PGR) are.

  14. Estrogen receptor, progesterone receptor, HER-2, and response to postmastectomy radiotherapy in high-risk breast cancer: The Danish Breast Cancer Cooperative Group

    DEFF Research Database (Denmark)

    Kyndi, M.; Sorensen, F.B.; Overgaard, M.

    2008-01-01

    . End points were locoregional recurrence as isolated first event, distant metastases, and overall survival. For statistical analyses four subgroups were constructed from hormonal receptors (Rec). Rec+ was defined as ER+ and/or PgR+. Rec- as both ER- and PgR-. The four subgroups were Rec+/HER-2-, Rec......+/HER-2+, Rec-/HER-2- (triple negative), and Rec-/HER-2+. Results A significantly improved overall survival after PMRT was seen only among patients characterized by good prognostic markers such as hormonal receptor-positive and HER-2- patients (including the two Rec+ subtypes). No significant overall...... after PMRT were found for ER- and PgR- tumors compared with the ER+ and PgR+ tumors (P = .003 and 04, respectively), and for the triple-negative (P = .02), and the Rec-/HER-2+ subtypes (P = .003) compared with the Rec-/HER-2- subtype. Conclusion Hormonal receptor status, HER-2, and the constructed...

  15. An Improved Path-Generating Regulator for Two-Wheeled Robots to Track the Circle/Arc Passage

    Directory of Open Access Journals (Sweden)

    Jun Dai

    2014-01-01

    Full Text Available The improved path-generating regulator (PGR is proposed to path track the circle/arc passage for two-wheeled robots. The PGR, which is a control method for robots so as to orient its heading toward the tangential direction of one of the curves belonging to the family of path functions, is applied to navigation problem originally. Driving environments for robots are usually roads, streets, paths, passages, and ridges. These tracks can be seen as they consist of straight lines and arcs. In the case of small interval, arc can be regarded as straight line approximately; therefore we extended the PGR to drive the robot move along circle/arc passage based on the theory that PGR to track the straight passage. In addition, the adjustable look-ahead method is proposed to improve the robot trajectory convergence property to the target circle/arc. The effectiveness is proved through MATLAB simulations on both the comparisons with the PGR and the improved PGR with adjustable look-ahead method. The results of numerical simulations show that the adjustable look-ahead method has better convergence property and stronger capacity of resisting disturbance.

  16. High rabbit abundance proves detrimental to the population growth rate in European rabbit (Oryctolagus cuniculus L. extensive breeding enclosures

    Directory of Open Access Journals (Sweden)

    L. Ruiz-Aizpurua

    2014-09-01

    Full Text Available The European rabbit (Oryctolagus cuniculus L. is a key prey species in Mediterranean ecosystems that has declined in its natural ranges as a result of diseases and loss of habitat. This situation has led to the production of wild rabbits in enclosures in which they can acclimate and breed. The efficiency of these enclosures as extensive breeding systems is defined by their population growth rate (PGR. The aim of this study is to analyse the effect of rabbit abundance on the PGR. This has been done by creating general linear models to explain autumn and spring PGR with the use of rabbit abundance estimates, enclosure size, aerial predation and previous PGR as possible explanatory variables. Rabbit abundance and enclosure size negatively affected the autumn PGR, while only rabbit abundance affected the spring PGR in the best-fit models. It is suggested that maintaining rabbit densities at fewer than 30 rabbits per hectare might help to optimise the efficiency inside enclosures.

  17. Gene : CBRC-MMUS-09-0002 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available 152306 /ug=Mm.330279 /len=4633 1e-136 70% MIFTFLAIFHVLKCVFLIFSDFQFSRHIPGPTVCISHFSRFSVISSFFKLSSGCFSFSMIFTFLAI...FHVPQWTFLNFPPFSVFLAIFHVLKCVFLIFRDFQFSCYIPSPTVCISHFSRFSVILSFFNLSTACFSFSMIFSFLAIFHVLQWKFLYFPTFSVFLAIFHVLKCVFLIFRVFQVSRHIPGPTVCISH...FSRFSVILSFFKLSSGCFSFSLIFSFLAIFHVLQWTFLNFPPFSVFLAIFHVLKCVFLIFSDFQFSRHIPGPTVCISHFFRFFSDFVIFHVVKWMFLIFHDFHFSCHISCPKVCISHFQ ...

  18. Gene : CBRC-MMUS-09-0003 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available 152306 /ug=Mm.330279 /len=4633 1e-103 84% MIFSFLAIFHVLQWTFLNFPPFSVFLAIFHVLKCVFLIFRDFQFSCHIPGPTVCISHFSRFSLILS...LFKLSTACFSFSMIFNFLAIFHVLQWKFLYFPTFSVFLAIFHVLKCVFLIFRVFQVSRHIPGPTVCISHFSRFSVILSFFKLSSGCFSFSLIFSFLAIFHVLLWTFLNFPPFSVFLAIFHVLKCVFLIFSDFQFSRNIPGPTVCISHFP ...

  19. Gene : CBRC-XTRO-01-2123 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available /gi=116487409 /ug=Str.18760 /len=4829 9e-15 26% MICISHIYCTSVRDPTGPPILLHPQTLGIMICISH...IYCTSVRGPTGPPILLHPQTLGIMICISHIYCTSVRDPTGPPILLHPQTLGIMICISHIYCTSVRDPTGPPILLHPQTLGIMICISHIYCTSVRDPTGPPILLHPQTLGIMICISH...IYCTSVRDPTGPPILLHPQTLGIMICISHIYCTSVRDPTGPPILLHPQTLGIMNSTAQMLWGRAWGGRENFPSFLRIKVFPLETGGRACESHVVPTEHLPQPQ ...

  20. Gene : CBRC-MMUS-09-0000 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available 152306 /ug=Mm.330279 /len=4633 1e-121 83% MIFSFLAIFKVLQWTFLNFRPLSVFLAIFHVPKCVLLIFRDFQFPRHILGPTVCISHFSGFSVISS...FFKSSSGCFSFSMIFSFLAIFHVLQWTFLNFPTFSVFLAIFHVLKCVFLIFSDFQFSRHIPGPTVCISHFSRFSVISSFFKLSSGCFSFFMIFSFLAIFHVPQWTFLN...VPPFSVFLAIFHVLKCVFLIFRDFQFSCYIPSPTVCISHFSRFSVIFSFFNLSTACFSFSMIFSFLAIFQVLQCAFLIFHVFQ ...

  1. Gene : CBRC-MMUS-09-0004 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available 4152306 /ug=Mm.330279 /len=4633 1e-108 87% MIFSFLAIFKVLQWTFLNFRPLSVFLAIFHVPKCVLLIFRDFQFPRHILGPTVCISHFSGFSVIS...SFFKSSSGCFSFSMIFSFLAIFHVLQWTFLNFPPFSVFLAIFHVLKCVFLIFSDFQFSRHIPGPTVCISHFSRFSVISSFFKLSSGCFSFSMIFSFLAIFHVPQWTFLNFPPFSVFLAIFHVLKCVFLIFRDFQFSCYIPSPTVCISHFSRF ...

  2. Gene : CBRC-MMUS-23-0035 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available 152306 /ug=Mm.330279 /len=4633 3e-71 52% MIFSFLAIFHVKQWTYLNVLSFSVFLVIFHVIKCIFLIFRDSQVSRHISGHRVCISHFSRFSVILSF...FKSSCGCFSFSKIFSFLAIFHVLQWTFLNSPHISVFLAIFHIIKCVFLIFRDFQFSRHIPGPTLCISHFPCFSVIHYIFIGLQCVSHFPRFSVFLTYSGSYSVCVSFS...TFFSLPAIFQILQCAYLIFQVSLNVPRHIPISTVCVPHFQIFLVFLPYSYAFHIFDVFHFSPHILGPTVCVCLLYHIFHHSCNIPGPTECISHLSIFFSASCHM ...

  3. Gene : CBRC-MMUS-09-0001 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available 4152306 /ug=Mm.330279 /len=4633 1e-115 71% MIFSFLAIFKVLQWTFLNFRPLSVFLAIFHVPKCVLLIFRDFQFPRHILGPTVCISHFSGFSVIS...SFFKSSSGCFSFSMIFSFLAIFHVLQWTFLNFPPFSVFLAIFHVLKCVFLIFSDFQFSRHIPGPTVCISHFSRFSVILSFFKLSSGCFSFSLIFSFLAIFHVLQWTFL...NFPPFSVFLAIFHVLKCVFLIFSDFQFSRHIPGPTVCISHFFRFFSDFVIFHVVKWMFLIFHDFHFSCHISCPKVCISHFQ ...

  4. Gene : CBRC-XTRO-01-1571 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available gi=74306002 /ug=Str.68514 /len=887 2e-11 37% MHLVLRHPVLRHPVLRHPVLRHPVLLHPVLRHPVLLHPVLLHLVLLHPVLLHLVLRHPV...LRHPVLRHPVLRHLVLLHLVLLHLVLRHPVLRHPVLRHLVLLHLVLLHLVLLHPVLLHPVLLHPVLRHLVLLHLVLLHLVLRHPVLRHPV...LRHLVLLHLVLLHLVLLHLVLLHPVLRHPVLLHLVLLHLVLWHPVLPCRSARGSVVRKLIHCCIYHKIALVM ...

  5. Gene : CBRC-PMAR-01-0559 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available 9 /gi=114310048 /ug=Pma.7703 /len=689 1e-04 33% MSTSLLDFCMCWCGLSPLACLLHVFLCPNLHLPVCFTCLYGLSPLVCLLHVSLWPISTCL...PASRVSMAYLHLPACFTCLYGLSPLACLLHVFLWPISTCLPASRVSMAYLHLPACFTCLYGLISTCLPASRVSMAYLHLPACFTCLYGLSPLVCLLHVSLWPISTC...LPASRVSMSYLHLSACFTCLYGLISTCLPASRVSMGYLHLPACFTCLYCLIFTCLPASRVSMACLHLSACLPHLSV ...

  6. Gene : CBRC-CINT-01-0198 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available gi=24256529 /ug=Cin.19191 /len=800 2.9 30% MELDHIVLVLGNILQMVVEQPFLQLVRRCQRMELDHIV...LVLGNILQMVVEQPFLQLVRRCQRMELDHIVLVLGNILQMVVEQLLQQLERRCQRMELDHIVLVLGNILQMVVEQPFLQLVRRCQRMELDHIVLVLGNILLMVVEQPFLQLVRRCQRMELDHI...VLVLGNILQMVVEQPFLQLVRRCQRMELDHIVLVLGNILLQMVVEQPFLQLVRRCQRMELDHIVLVLGNILQMVVEQPFLQLVRRYQRMELDHIVLVLGKCVSRWLWTNAFRGGITTSMQGSGENFLLGER ...

  7. Factors Associated with Redundant Sigmoid Colon at Mulago ...

    African Journals Online (AJOL)

    jen

    economic factors between 68 patients .... 50,000 Uganda shillings (Ug. Shs) compared to only 19.9% of the controls (1 US $ = Ug shs 1500). ... the majority of the affected patients in this study had a family income of below 50,000 Ug. shs per month.

  8. Deep-sea genetic resources: New frontiers for science and stewardship in areas beyond national jurisdiction

    Science.gov (United States)

    Harden-Davies, Harriet

    2017-03-01

    The deep-sea is a large source of marine genetic resources (MGR), which have many potential uses and are a growing area of research. Much of the deep-sea lies in areas beyond national jurisdiction (ABNJ), including 65% of the global ocean. MGR in ABNJ occupy a significant gap in the international legal framework. Access and benefit sharing of MGR is a key issue in the development of a new international legally-binding instrument under the United Nations Convention on the Law of the Sea (UNCLOS) for the conservation and sustainable use of marine biological diversity in ABNJ. This paper examines how this is relevant to deep-sea scientific research and identifies emerging challenges and opportunities. There is no internationally agreed definition of MGR, however, deep-sea genetic resources could incorporate any biological material including genes, proteins and natural products. Deep-sea scientific research is the key actor accessing MGR in ABNJ and sharing benefits such as data, samples and knowledge. UNCLOS provides the international legal framework for marine scientific research, international science cooperation, capacity building and marine technology transfer. Enhanced implementation could support access and benefit sharing of MGR in ABNJ. Deep-sea scientific researchers could play an important role in informing practical new governance solutions for access and benefit sharing of MGR that promote scientific research in ABNJ and support deep-sea stewardship. Advancing knowledge of deep-sea biodiversity in ABNJ, enhancing open-access to data and samples, standardisation and international marine science cooperation are significant potential opportunity areas.

  9. Clinicopathologic Characteristics of Oestrogen Receptor-Positive/Progesterone Receptor-Negative/Her2-Negative Breast Cancer According to a Novel Definition of Negative Progesterone Receptor Status: A Large Population-Based Study from China.

    Directory of Open Access Journals (Sweden)

    An-qi Li

    Full Text Available A lack of progesterone receptor (PgR expression in oestrogen receptor-positive (ER+ tumours is associated with worse survival. PgR status is usually defined as positive or negative using 1% positive nuclei as a cut-off point. In this study, we aimed to assess the clinicopathologic characteristics of ER+/PgR-/HER2- tumours by comparing them with ER+/PgR+/HER2- tumours using a PgR cut-off point of 20% as a divisive criterion.We analysed 1,522 patients with primary breast cancer who had undergone surgery at the Cancer Center of Fudan University between 2012 and 2014. Age, grade, tumour size, lymph node status and lymphovascular invasion were assessed. Multinomial logistic regression, linear regression and chi-square test models were applied to assess associations between ER, PR and clinical features.ER+/PgR-/HER2- tumours showed poorer clinicopathologic characteristics relative to ER+/PgR+/HER2- tumours using a PgR threshold of 20% instead of 1%. The clinicopathologic characteristics did not differ between tumours with purely negative PgR expression and tumours with a PgR percentage ranging from 1% to 19%. The prognostic significance of PR expression appeared more pronounced in patients under a high Ki-67 status than those under a low Ki-67 status.Based on these findings, we propose the use of a novel threshold of 20% to define PgR status. Nevertheless, the impact of this new criterion on patient management and clinical treatment requires additional study.

  10. Wildlife resource utilisation at Moremi Game Reserve and Khwai community area in the Okavango Delta, Botswana.

    Science.gov (United States)

    Mbaiwa, Joseph E

    2005-10-01

    This paper uses the concept of sustainable development to examine the utilisation of wildlife resources at Moremi Game Reserve (MGR) and Khwai community area (NG 18/19) in the Okavango Delta, Botswana. Using both secondary and primary data sources, results show that the establishment of MGR in 1963 led to the displacement of Khwai residents from their land; affected Basarwa's hunting and gathering economy; marked the beginning of resource conflicts between Khwai residents and wildlife managers; and, led to the development of negative attitudes of Khwai residents towards wildlife conservation. Since the late 1980s, a predominantly foreign owned tourism industry developed in and around MGR, however, Khwai residents derive insignificant benefits from it and hence resource conflicts increased. In an attempt to address problems of resource conflicts and promote sustainable wildlife utilisation, the Botswana Government adopted the Community-Based Natural Resource Management (CBNRM) programme, which started operating at Khwai village in 2000. The CBNRM programme promotes local participation in natural resource management and rural development through tourism. It is beginning to have benefits to Khwai residents such as income generation, employment opportunities and local participation in wildlife management. These benefits from CBNRM are thus having an impact in the development of positive attitudes of Khwai residents towards wildlife conservation and tourism development. This paper argues that if extended to MGR, CBNRM has the potential of minimising wildlife conflicts between Khwai residents and the wildlife-tourism sectors. This approach may in the process promote the sustainable wildlife use in and around MGR.

  11. Green justice in the city

    DEFF Research Database (Denmark)

    Rutt, Rebecca Leigh; Gulsrud, Natalie Marie

    2016-01-01

    tIn this short communication, we discuss European urban green space (UGS) research from an environ-mental justice perspective. We show that European UGS scholarship primarily focuses on functionalvalues and managerial aspects of UGS, while paying less attention to equity in the enjoyment of andde...... of anddecision-making around UGS. On this basis we discuss potentials for European urban green space researchto take up a more explicit environmental justice framing to shed much-needed light on injustices inEuropean cities and inspire change in policy and practice.......tIn this short communication, we discuss European urban green space (UGS) research from an environ-mental justice perspective. We show that European UGS scholarship primarily focuses on functionalvalues and managerial aspects of UGS, while paying less attention to equity in the enjoyment...

  12. Application of instrumental neutron activation analysis to assess dietary intake of selenium in Korean adults from meat and eggs

    International Nuclear Information System (INIS)

    Moon, Jong-Hwa; Kim, Sun-Ha; Chung, Yong-Sam; Lee, Ok-Hee

    2013-01-01

    Selenium is a key constituent of enzyme in glutathione peroxidase, which is effective in decreasing various types of oxidative stress, Thus, the adequacy of selenium intake is very important in decreasing the risks of various degenerating diseases such as cardiovascular disease, or certain cancers. Lately, the intake of animal foods is increasing among Koreans owing to a dietary transition toward a western style. This study was conducted to measure the selenium content in meat and eggs, and then assessed the selenium intake from these foods. Forty frequently eaten items among meat and eggs were analyzed using an Instrumental Neutron Activation Analysis. The selenium content in 100g of raw meat and eggs ranged from 8.1ug to 50.9ug. In particular, 100g of beef contained 12.4ug to 50.9ug of selenium; pork, 11.2ug to 22.6ug chicken, 10.2ug to 13.7ug and eggs, 28.6ug to 43.0ug. Thus, beef viscera and chicken eggs contain the highest amounts of selenium among these groups. 100g of Pork belly, the most frequently eaten meat type among Koreans, contains 14.6ug of selenium. An evaluation of dietary selenium intake shows that the total selenium supply from meats and eggs was 28.4ug/day and 27.5 ug/day in adult men and women, respectively. These are over one-half of the Korean RNI (Recommended Daily Intake) of 55ug/day. (author)

  13. Use of Ion-Channel Modulating Agents to Study Cyanobacterial Na+ - K+ Fluxes

    Directory of Open Access Journals (Sweden)

    Pomati Francesco

    2004-01-01

    Full Text Available Here we describe an experimental design aimed to investigate changes in total cellular levels of Na+ and K+ ions in cultures of freshwater filamentous cyanobacteria. Ion concentrations were measured in whole cells by flame photometry. Cellular Na+ levels increased exponentially with rising alkalinity, with K+ levels being maximal for optimal growth pH (~8. At standardized pH conditions, the increase in cellular Na+, as induced by NaCl at 10 mM, was coupled by the two sodium channel-modulating agents lidocaine hydrochloride at 1 &mgr;M and veratridine at 100 &mgr;M. Both the channel-blockers amiloride (1 mM and saxitoxin (1 &mgr;M, decreased cell-bound Na+ and K+ levels. Results presented demonstrate the robustness of well-defined channel blockers and channel-activators in the study of cyanobacterial Na+- K+ fluxes.

  14. Blockage of progestin physiology disrupts ovarian differentiation in XX Nile tilapia (Oreochromis niloticus)

    International Nuclear Information System (INIS)

    Zhou, Linyan; Luo, Feng; Fang, Xuelian; Charkraborty, Tapas; Wu, Limin; Wei, Jing; Wang, Deshou

    2016-01-01

    Previous studies indicated that maturation inducing hormone, 17α, 20β-Dihydroxy-4-pregnen-3-one (DHP), probably through nuclear progestin receptor (Pgr), might be involved in spermatogenesis and oogenesis in fish. To further elucidate DHP actions in teleostean ovarian differentiation, we analyzed the expression of pgr in the ovary of Nile tilapia (Oreochromis niloticus), and performed RU486 (a synthetic Pgr antagonist) treatment in XX fish from 5 days after hatching (dah) to 120dah. Tilapia Pgr was abundantly expressed in the follicular cells surrounding oocytes at 30 and 90dah. Continuous RU486 treatment led to the blockage of oogenesis and masculinization of somatic cells in XX fish. Termination of RU486 treatment and maintenance in normal condition resulted in testicular differentiation, and estrogen compensation in RU486-treated XX fish successfully restored oogenesis. In RU486-treated XX fish, transcript levels of female dominant genes were significantly reduced, while male-biased genes were evidently augmented. Meanwhile, both germ cell mitotic and meiotic markers were substantially reduced. Consistently, estrogen production levels were significantly declined in RU486-treated XX fish. Taken together, our data further proved that DHP, possibly through Pgr, might be essential in the ovarian differentiation and estrogen production in fish. - Highlights: • DHP plays a critical role in early stage oogenesis of XX tilapia. • Blockage of DHP actions by RU486 treatment led to masculinization and/or sex reversal in XX tilapia. • Both DHP and estrogen are indispensable for ovarian differentiation.

  15. Plant Genetic Resources: Selected Issues from Genetic Erosion to Genetic Engineering

    Directory of Open Access Journals (Sweden)

    Karl Hammer

    2008-04-01

    Full Text Available Plant Genetic Resources (PGR continue to play an important role in the development of agriculture. The following aspects receive a special consideration:1. Definition. The term was coined in 1970. The genepool concept served as an important tool in the further development. Different approaches are discussed.2. Values of Genetic Resources. A short introduction is highlighting this problem and stressing the economic usfulness of PGR.3. Genetic Erosion. Already observed by E. Baur in 1914, this is now a key issue within PGR. The case studies cited include Ethiopia, Italy, China, S Korea, Greece and S. Africa. Modern approaches concentrate on allelic changes in varieties over time but neglect the landraces. The causes and consequences of genetic erosion are discussed.4. Genetic Resources Conservation. Because of genetic erosion there is a need for conservation. PGR should be consigned to the appropriate method of conservation (ex situ, in situ, on-farm according to the scientific basis of biodiversity (genetic diversity, species diversity, ecosystem diversity and the evolutionary status of plants (cultivated plants, weeds, related wild plants (crop wild relatives.5. GMO. The impact of genetically engineered plants on genetic diversity is discussed.6. The Conclusions and Recommendations stress the importance of PGR. Their conservation and use are urgent necessities for the present development and future survival of mankind.

  16. Blockage of progestin physiology disrupts ovarian differentiation in XX Nile tilapia (Oreochromis niloticus)

    Energy Technology Data Exchange (ETDEWEB)

    Zhou, Linyan; Luo, Feng; Fang, Xuelian [Key Laboratory of Freshwater Fish Reproduction and Development (Ministry of Education), Key Laboratory of Aquatic Science of Chongqing, School of Life Sciences, Southwest University, Chongqing, 400715 (China); Charkraborty, Tapas [South Ehime Fisheries Research Center, Ehime University, Ainan, 798-4206 (Japan); Wu, Limin; Wei, Jing [Key Laboratory of Freshwater Fish Reproduction and Development (Ministry of Education), Key Laboratory of Aquatic Science of Chongqing, School of Life Sciences, Southwest University, Chongqing, 400715 (China); Wang, Deshou, E-mail: wdeshou@swu.edu.cn [Key Laboratory of Freshwater Fish Reproduction and Development (Ministry of Education), Key Laboratory of Aquatic Science of Chongqing, School of Life Sciences, Southwest University, Chongqing, 400715 (China)

    2016-04-22

    Previous studies indicated that maturation inducing hormone, 17α, 20β-Dihydroxy-4-pregnen-3-one (DHP), probably through nuclear progestin receptor (Pgr), might be involved in spermatogenesis and oogenesis in fish. To further elucidate DHP actions in teleostean ovarian differentiation, we analyzed the expression of pgr in the ovary of Nile tilapia (Oreochromis niloticus), and performed RU486 (a synthetic Pgr antagonist) treatment in XX fish from 5 days after hatching (dah) to 120dah. Tilapia Pgr was abundantly expressed in the follicular cells surrounding oocytes at 30 and 90dah. Continuous RU486 treatment led to the blockage of oogenesis and masculinization of somatic cells in XX fish. Termination of RU486 treatment and maintenance in normal condition resulted in testicular differentiation, and estrogen compensation in RU486-treated XX fish successfully restored oogenesis. In RU486-treated XX fish, transcript levels of female dominant genes were significantly reduced, while male-biased genes were evidently augmented. Meanwhile, both germ cell mitotic and meiotic markers were substantially reduced. Consistently, estrogen production levels were significantly declined in RU486-treated XX fish. Taken together, our data further proved that DHP, possibly through Pgr, might be essential in the ovarian differentiation and estrogen production in fish. - Highlights: • DHP plays a critical role in early stage oogenesis of XX tilapia. • Blockage of DHP actions by RU486 treatment led to masculinization and/or sex reversal in XX tilapia. • Both DHP and estrogen are indispensable for ovarian differentiation.

  17. Distinct functions and regulation of epithelial progesterone receptor in the mouse cervix, vagina, and uterus.

    Science.gov (United States)

    Mehta, Fabiola F; Son, Jieun; Hewitt, Sylvia C; Jang, Eunjung; Lydon, John P; Korach, Kenneth S; Chung, Sang-Hyuk

    2016-04-05

    While the function of progesterone receptor (PR) has been studied in the mouse vagina and uterus, its regulation and function in the cervix has not been described. We selectively deleted epithelial PR in the female reproductive tracts using the Cre/LoxP recombination system. We found that epithelial PR was required for induction of apoptosis and suppression of cell proliferation by progesterone (P4) in the cervical and vaginal epithelium. We also found that epithelial PR was dispensable for P4 to suppress apoptosis and proliferation in the uterine epithelium. PR is encoded by the Pgr gene, which is regulated by estrogen receptor α (ERα) in the female reproductive tracts. Using knock-in mouse models expressing ERα mutants, we determined that the DNA-binding domain (DBD) and AF2 domain of ERα were required for upregulation of Pgr in the cervix and vagina as well as the uterine stroma. The ERα AF1 domain was required for upregulation of Pgr in the vaginal stroma and epithelium and cervical epithelium, but not in the uterine and cervical stroma. ERα DBD, AF1, and AF2 were required for suppression of Pgr in the uterine epithelium, which was mediated by stromal ERα. Epithelial ERα was responsible for upregulation of epithelial Pgr in the cervix and vagina. Our results indicate that regulation and functions of epithelial PR are different in the cervix, vagina, and uterus.

  18. Evaluación de la susceptibilidad antimicrobiana de cepas de Salmonella spp. aisladas del beneficio porcino en Colombia / Evaluation of antimicrobial susceptibility of Salmonella spp. strains isolated from pork carcasses on Colombia

    Directory of Open Access Journals (Sweden)

    Paula M. Bermúdez D

    2014-01-01

    Full Text Available Objetivo: el estudio buscó establecer patrones de resistencia antimicrobiana de 155 cepas de Salmonella spp., aisladas de la superficie de canales de cerdo, procedentes de plantas de beneficio en Colombia. Metodología: mediante el método de difusión en disco (Bauer et. Kirby, 1966 se evaluaron nueve antimicrobianos: Amoxicilina y ácido clavulánico (30 ug, Ampicilina (10 ug, Ceftiofur (30 ug, Ciprofloxacina (5 ug, Cloranfenicol (30 ug, Florfenicol (30 ug, Gentamicina (10 ug, Sulfadiazina y Trimetoprim (25 ug y Tetraciclina (30 ug. Resultados: los resultados confirmaron la presencia de cepas multiresistentes de Salmonella spp. de origen porcino, mostrando 30 patrones diferentes de multiresistencia; el más común fue Ampicilina, Amoxicilina, Cloranfenicol, Florfenicol y Tetraciclina en el 16,77% (n=26 de las cepas. Tetraciclina y Florfenicol fueron los antimicrobianos menos efectivos en el 94,84% (n=147 y 47,74% (n=74 de cepas resistentes, respectivamente. Discusión: se deben consolidar los sistemas de monitoreo, y de vigilancia y control de las resistencias antimicrobianas para prevenir, con un enfoque de cadena productiva, la diseminación de cepas multiresistentes en alimentos de origen animal, como parte integral del sistema de gestión de inocuidad de los alimentos en Colombia. - Objetivo: el estudio buscó establecer patrones de resistencia antimicrobiana de 155 cepas de Salmonella spp., aisladas de la superficie de canales de cerdo, procedentes de plantas de beneficio en Colombia. Metodología: mediante el método de difusión en disco (Bauer et. Kirby, 1966 se evaluaron nueve antimicrobianos: Amoxicilina y ácido clavulánico (30 ug, Ampicilina (10 ug, Ceftiofur (30 ug, Ciprofloxacina (5 ug, Cloranfenicol (30 ug, Florfenicol (30 ug, Gentamicina (10 ug, Sulfadiazina y Trimetoprim (25 ug y Tetraciclina (30 ug. Resultados: los resultados confirmaron la presencia de cepas multiresistentes de Salmonella spp. de origen porcino, mostrando

  19. Preliminary risk assessment for nuclear waste disposal in space. Volume I. Executive summary of technical report

    International Nuclear Information System (INIS)

    Rice, E.E.; Denning, R.S.; Friedlander, A.L.

    1982-01-01

    Three major conclusions come from this preliminary risk assessment of nuclear waste disposal in space. Preliminary estimates of space disposal risk are low, even with the estimated uncertainty bounds. If calculated mined geologic repository (MGR) release risks remain low, and the EPA requirements continue to be met, then no additional space disposal study effort is warranted. If risks perceived by the public are significant in the acceptance of mined geologic repositories, then consideration of space disposal as an MGR complement is warranted. As a result of this study, the following recommendations are made to NASA and the US DOE: During the continued evaluation of the mined geologic repository risk over the years ahead by DOE, if any significant increase in the calculated health risk is predicted for the MGR, then space disposal should be reevaluated at that time. The risks perceived by the public for the MGR should be evaluated on a broad basis by an independent organization to evaluate acceptance. If, in the future, MGR risks are found to be significant due to some presently unknown technical or social factor, and space disposal is selected as an alternative that may be useful in mitigating the risks, then the following space disposal study activities are recommended: improvement in chemical processing technology for wastes; payload accident response analysis; risk uncertainty analysis for both MGR and space disposal; health risk modeling that includes pathway and dose estimates; space disposal cost modeling; assessment of space disposal perceived (by public) risk benefit; and space systems analysis supporting risk and cost modeling

  20. MONITORED GEOLOGIC REPOSITORY LIFE CYCLE COST ESTIMATE ASSUMPTIONS DOCUMENT

    International Nuclear Information System (INIS)

    R.E. Sweeney

    2001-01-01

    The purpose of this assumptions document is to provide general scope, strategy, technical basis, schedule and cost assumptions for the Monitored Geologic Repository (MGR) life cycle cost (LCC) estimate and schedule update incorporating information from the Viability Assessment (VA) , License Application Design Selection (LADS), 1999 Update to the Total System Life Cycle Cost (TSLCC) estimate and from other related and updated information. This document is intended to generally follow the assumptions outlined in the previous MGR cost estimates and as further prescribed by DOE guidance

  1. Raport z badania 2016. Specjalne Strefy Ekonomiczne w Polsce w oczach przedsiębiorców i pracowników samorządów

    OpenAIRE

    Pastusiak, Radosław; Jasiniak, Magdalena; Keller, Jakub; Krzeczewski, Bartłomiej

    2016-01-01

    Niniejszy raport prezentuje wyniki projektu realizowanego w ramach projektu badawczego nr UMO-2013/09/B/HS4/, pt. Efektywność Specjalnych Stref Ekonomicznych, przez zespół Katedry Finansów Korporacji, Wydział Ekonomiczno-Socjologiczny Uniwersytetu Łódzkiego, pod kierownictwem dr hab. Radosława Pastusiaka, prof. nadzw. UŁ. w składzie: dr Magdalena Jasiniak, mgr Jakub Keller, mgr Bartłomiej Krzeczewski. Zasadniczym celem badania było określenie efektywności funkcjonowania Specjalnych Stref Ekon...

  2. 2005 9th Annual Army Small Business Conference

    Science.gov (United States)

    2005-11-03

    Risk Exposure • Reduces Transition Cost • Alternative for Customer • Buyer/Seller Transition • Novations • Reduces Exit Cost • Stepping Stone Teaming...PRIME FINANCE PROCUREMENT A D M IN ISTR A TIVE T E C H N I C A L DCAA DCMA AMC COMMODITY -AQ Center -Program Mgr -Item Matl Mgr SME -Acct -Legal -HR...concrete and brick walls, and light armored vehicles. Combat Proven in Afghanistan and Iraq “SMAW-D IS AN AWESOME WEAPON!” “MY ONLY REGRET IS THAT WE

  3. Monitored Geologic Repository Life Cycle Cost Estimate Assumptions Document

    International Nuclear Information System (INIS)

    Sweeney, R.

    2000-01-01

    The purpose of this assumptions document is to provide general scope, strategy, technical basis, schedule and cost assumptions for the Monitored Geologic Repository (MGR) life cycle cost estimate and schedule update incorporating information from the Viability Assessment (VA), License Application Design Selection (LADS), 1999 Update to the Total System Life Cycle Cost (TSLCC) estimate and from other related and updated information. This document is intended to generally follow the assumptions outlined in the previous MGR cost estimates and as further prescribed by DOE guidance

  4. Five polymorphisms and breast cancer risk: results from the Breast Cancer Association Consortium

    DEFF Research Database (Denmark)

    Gaudet, Mia M; Milne, Roger L; Cox, Angela

    2009-01-01

    -study heterogeneity for associations with risk for single-nucleotide polymorphisms (SNP) in CASP10, PGR, and BID. Estimates were imprecise for women of Asian and African descent due to small numbers and lower minor allele frequencies (with the exception of BID SNP). The ORs for each copy of the minor allele were...... to invasive breast cancer risk overall in women of European descent: ECCR4 per-allele OR (95% CI) = 0.99 (0.97-1.02), minor allele frequency = 27.5%; TNF 1.00 (0.95-1.06), 5.0%; CASP10 1.02 (0.98-1.07), 6.5%; PGR 1.02 (0.99-1.06), 15.3%; and BID 0.98 (0.86-1.12), 1.7%. However, we observed significant between...... rs744154, TNF rs361525, CASP10 rs13010627, PGR rs1042838, and BID rs8190315 genotypes among women of European descent....

  5. An Epidemiologic Study of Genetic Variation in Hormonal Pathways in Relation to the Effect of Hormone Replacement Therapy on Breast Cancer Risk

    Science.gov (United States)

    2008-10-01

    PGR gene to be associated with breast cancer. Using long-range PCR techniques to sequence exons 1 and 2 of PGR, and a Solexa chip from Illumina...specific histologic types associated with single SNPs in PGR, AKR1C1, AKR1C2, AKR1C3, SRD5A1, SRD5A2 and CYP3A4 Breast caner overall Ductal Lobular...1.3 0.96 T/T 92 (9.1) 120 (9.6) 1.1 0.8 1.4 72 (9.5) 1.1 0.8 1.5 27 (9.7) 1.0 0.6 1.7 0.93 CYP3A4 rs12333983 T/T 791 (77.8) 985

  6. Ocena potrzeb zdrowotnych nauczycieli szkół średnich w kontekście zagrożeń zdrowia związanych z miejscem pracy = Assessment of the health needs of secondary school teachers in the context of health risks at the workplace

    Directory of Open Access Journals (Sweden)

    Katarzyna Wodzyńska

    2016-05-01

    2Szkoła Główna Handlowa, Kolegium Ekonomiczno-Społeczne, ul. Wiśniowa 41, 02-520 Warszawa   mgr Katarzyna Wodzyńska mgr Joanna Skonieczna dr n. med. Dominik Olejniczak dr n. o zdr. Urszula Religioni   Słowa kluczowe: potrzeba zdrowotna, nauczyciele, promocja zdrowia, miejsce pracy Key words: need care, teachers, health promotion, workplace   Streszczenie Wstęp Nauczyciel w swoim zawodzie narażony jest na wiele niekorzystnych czynników. Miejsce pracy oraz warunki jakie w nim panują, w znacznym stopniu wpływają na zdrowie i samopoczucie. Odpowiednia ergonomia stanowiska pracy jest w tej kwestii bardzo istotna. Głównym celem pracy jest zbadanie i ocena potrzeb zdrowotnych nauczycieli, które są związane z charakterem, miejscem wykonywanej  pracy oraz występujących w niej zagrożeń zdrowia. Materiał i metody W przeprowadzonym badaniu ankietowym, dotyczącym wykonywania zawodu nauczyciela wzięło udział 283 nauczycieli z dwunastu  szkół średnich znajdujących się na terenie województwa mazowieckiego. Wypełniony przez nauczycieli kwestionariusz składał się z 21 pytań dotyczących zagadnień związanych z wykonywaniem zawodu. Uzyskane wyniki poddano analizie statystycznej z wykorzystaniem testu Chi2 Pearsona oraz R Spearmana. Za istotne różnice uznano te, dla których prawdopodobieństwo p<0.05. Wyniki Blisko połowa respondentów wskazała, że praca ma istotny wpływ na zdrowie. Według 20,5% badanych wykonywany zawód w średnim stopniu wpływa na stan zdrowia, zaś 18% wszystkich respondentów uważa, że udział czynników pracy w ogólnym samopoczuciu jest niewielki. Zmęczenie jest jedną z najczęstszych dolegliwości wśród nauczycieli. 18,1% badanych deklaruje że odczuwa je codziennie, zaś u 39,7% respondentów występuje ono często, bo 2-3 razy w tygodniu. Wnioski Uzyskane wyniki pozwalają wyciągnąć wniosek, iż nauczyciele mają świadomość wpływu pracy na zdrowie, jak również są świadomi dolegliwo

  7. Effect of two different plant growth regulators on production traits of sunflower

    Directory of Open Access Journals (Sweden)

    Dávid ERNST

    2016-12-01

    Full Text Available The plant growth regulators (PGR are an organic compounds that modify plant physiological processes. PGR applied to the field crops promotes photosynthesis, stimulates plant growth, improves flowering and protects plants against unfavourable year weather conditions. Listed is an assumption to the yield of high quality. The effects of year weather conditions, biological material (hybrids and foliar application of two different PGR (Terra-Sorb® Foliar – containing free amino acids and Unicum® – containing Abiestins® on the yield-forming parameters, seed yield and the oil content in seeds of three selected hybrids of sunflower (NK Brio, NK Neoma, NK Ferti were studied in this paper. The field poly-factorial experiments were realized during two growing seasons of 2012 and 2013. The experimental area is situated in the maize-growing region (climatic region: warm; climatic sub-region: mild dry or dry; climatic zone: warm and dry, with mild winter and long sunshine and soil is silt loam Haplic Luvisol. The climatic conditions in chosen experimental years were different in quantities and distribution of precipitation at main growth period of sunflower plants (June to August and allows evaluating the yield stability between used hybrids and foliar treatments. The results showed that the application of selected PGR has contributed to an increase of sunflower seed yield, mainly through increase the weight of thousand seeds (rp = 0.761; P < 0.001. Similarly, oil content in seeds was significantly higher in treatments with PGR, especially with preparation Terra-Sorb® Foliar containing free amino acids. The study describes the relationship between quality (oil content in seeds and quantity (seed yield of sunflower production (rp = ‒0.41; P < 0.01. Results showed that PGR can be an important rationalization tool of the sunflower cultivation technology.

  8. A cognitively plausible model for grammar induction

    Directory of Open Access Journals (Sweden)

    Roni Katzir

    2015-01-01

    Full Text Available This paper aims to bring theoretical linguistics and cognition-general theories of learning into closer contact. I argue that linguists' notions of rich UGs are well-founded, but that cognition-general learning approaches are viable as well and that the two can and should co-exist and support each other. Specifically, I use the observation that any theory of UG provides a learning criterion -- the total memory space used to store a grammar and its encoding of the input -- that supports learning according to the principle of Minimum Description-Length. This mapping from UGs to learners maintains a minimal ontological commitment: the learner for a particular UG uses only what is already required to account for linguistic competence in adults. I suggest that such learners should be our null hypothesis regarding the child's learning mechanism, and that furthermore, the mapping from theories of UG to learners provides a framework for comparing theories of UG.

  9. In Situ Bioremediation of Chlorinated Solvent Source Areas with Enhanced Mass Transfer

    Science.gov (United States)

    2008-09-01

    three-dimensional view with iso -surface of LIF counts • GMS support files needed to operate GMS (for example, bor, .map, .mat, .img, .mat, and .sol...DCE (ug/L) trans-DCE (ug/L) VC (ug/L) Ethane (ug/L) Ethene (ug/L) Chloride (ug/L) 5C2C43 11/9/2005 440 J,B,D 27000 D 0 540 D 4.0 J 8.6 J...0.43 J 0.64 J 2C2D21 7/18/2005 29000 D 2C2D22 7/19/2005 530 J, D 30000 B, D, E 0 0 0 0 2C2D22 7/19/2005 27000 D 2C2D23 7/20/2005 180 J

  10. Thermoelectric properties of unoxidized graphene/Bi{sub 2}Te{sub 2.7}Se{sub 0.3} composites synthesized by exfoliation/re-assembly method

    Energy Technology Data Exchange (ETDEWEB)

    Kim, Jin Il; Lee, Eun Sil; Kim, Jong-Young [Icheon Branch, Korea Institute of Ceramic Engineering and Technology, Gyeonggi-do (Korea, Republic of); Choi, Soon-Mok [School of Energy, Materials and Chemical Engineering, Korea University of Technology and Education, Cheonan (Korea, Republic of); Lee, Kyu Hyoung [Materials R and D Center, Samsung Advanced Institute of Technology, Yongin (Korea, Republic of); Seo, Won-Seon [Energy and Environmental Division, Korea Institute of Ceramic Engineering and Technology, Seoul (Korea, Republic of)

    2014-04-15

    Nanocomposites of n-type thermoelectric Bi{sub 2}Te{sub 2.7}Se{sub 0.3} (BTS) and unoxidized graphene (UG) were prepared from the exfoliated BTS and UG nanoplatelets. Polycrystalline BTS ingots were exfoliated into nanoscroll-type crystals by chemical exfoliation, and were re-assembled with UG nanoplatelets. The composites were chemically reduced by hydrazine hydrate and sintered by a spark-plasma-sintering method. The thermoelectric properties of the sintered composites were evaluated and exhibited decreased carrier concentration and increased thermal conductivity due to the embedded graphene. The peak ZT values for the UG/BTS-US and UG/BTS-EX composites were ∝0.8 at the UG concentration of 0.05 wt%. (copyright 2014 WILEY-VCH Verlag GmbH and Co. KGaA, Weinheim) (orig.)

  11. Bedrock displacements in Greenland manifest ice mass variations, climate cycles and climate change

    DEFF Research Database (Denmark)

    Bevis, Michael; Wahr, John; Khan, Shfaqat Abbas

    2012-01-01

    for by an annual oscillation superimposed on a sustained trend. The oscillation is driven by earth’s elastic response to seasonal variations in ice mass and air mass (i.e., atmospheric pressure). Observed vertical velocities are higher and often much higher than predicted rates of postglacial rebound (PGR......), implying that uplift is usually dominated by the solid earth’s instantaneous elastic response to contemporary losses in ice mass rather than PGR. Superimposed on longer-term trends, an anomalous ‘pulse’ of uplift accumulated at many GNET stations during an approximate six-month period in 2010...

  12. Expression of progesterone receptor protein in the ovine uterus during the estrous cycle: Effects of nutrition, arginine and FSH.

    Science.gov (United States)

    Grazul-Bilska, Anna T; Thammasiri, Jiratti; Kraisoon, Aree; Reyaz, Arshi; Bass, Casie S; Kaminski, Samantha L; Navanukraw, Chainarong; Redmer, Dale A

    2018-03-01

    To evaluate expression of progesterone receptor (PGR) AB in follicle stimulating hormone (FSH)-treated or non-treated sheep administered with arginine (Arg) or saline (Sal) fed a control (C), excess (O) or restricted (U) diet, uterine tissues were collected at the early, mid and/or late luteal phases. In exp. 1, ewes from each diet were randomly assigned to one of two treatments, Arg or Sal administration three times daily from day 0 of the first estrous cycle until uterine tissue collection. In exp. 2, ewes were injected twice daily with FSH on days 13-15 of the first estrous cycle. Uterine tissues were immunostained to detect PGR followed by image analysis. PGR were detected in luminal epithelium (LE), endometrial glands (EG), endometrial stroma (ES), myometrium (Myo), and endometrial and myometrial blood vessels. The percentage of PR-positive cells and/or intensity of staining were affected by phase of the estrous cycle, plane of nutrition, and/or FSH but not by Arg. In exp. 1, percentage of PGR-positive cells in LE and EG but not in ES and Myo was greater at the early and mid than late luteal phase, was not affected by plane of nutrition, and was similar in LE and EG. Intensity of staining was affected by phase of the estrous cycle and plane of nutrition in LE, EG and Myo, and was the greatest in LE, less in EG, and least in ES and Myo. In exp. 2, percentage of PGR-positive cells in LE, EG, ES and Myo was affected by phase of the estrous cycle, but not by plane of nutrition; was greater at the early than mid luteal phase; and was greatest in LE and EG, less in luminal (superficial) ES and Myo and least in deep ES. Intensity of staining was affected by phase of the estrous cycle and plane of nutrition in all compartments but ES, and was the greatest in LE and luminal EG, less in deep EG, and least in ES and Myo. Comparison of data for FSH (superovulated) and Sal-treated (non-superovulated) ewes demonstrated that FSH affected PR expression in all evaluated

  13. Next-generation Surface Enhanced Raman Scattering (SERS) Substrates for Hazard Detection

    Science.gov (United States)

    2012-09-01

    substrates at differing concentrations ranging from 0.05 ug/cm2 to 50 ug/cm2. These concentrations were independently validated by UV -Vis...standard Klarite substrates at a concentration of 5.0 ug/cm2. The concentration jetted was validated using a secondary UV -Vis technique.(20, 81) After... Spectros ., 994 (1997). [58] Alexander, T.A., Le, D.M., "Characterization of a commercialized SERS-active substrate and its application to the

  14. Metabolomic effects in HepG2 cells exposed to CeO2, SiO2 and CuO nanomaterials.

    Science.gov (United States)

    To better assess potential hepatotoxicity of nanomaterials, human liver HepG2 cells were exposed for three days to 5 different CeO2 (either 30 or 100 ug/ml), 3 SiO2 based (30 ug/ml) or 1 CuO (3 ug/ml) nanomaterials with dry primary particle sizes ranging from 15 to 213 nm. Metab...

  15. Gene : CBRC-AGAM-05-0028 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available 27560014 /ug=Aga.24572 /len=986 7e-09 22% MVANTFAIVAKRSAIVAKRSAIIANTFTIVANYSAVVAKSSAIDPKSSAIVGKTFAIVAKTFAIVA...KTFAIVANYSAVVANYSAIVAKSSAIVAKSSAIVANTFAIFANTFAIVANTFAIIAKTFAIVAKTFAIVAKTFAIVAKSSAIVAKSSAIVAKSSAIVANTFAIVAKSS...AIVAKSSAIITNTFTIVANYSAVVAKSSAIVPKNSAIVGKTFAIVAKTFAIVAKTFAIVANTFAIVANYSAVVANYSAIVA...KSSAIVAKSSAIVAKTFAIFANTFAIVANTFAIVANYSAIVAKSSAIVAKSFEIIVKTFAIFAKTFAIVANYSAIVAKTFAIVAINSEIVAKSSATVANTFAIVANTFAIVANTFAIVAKTFAIVANYSAIVA ...

  16. Gene : CBRC-MDOM-02-0490 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available 35195 /gi=3928780 /ug=Mdm.251 /len=1699 0.001 30% MHVKHLRHTYMIYVHANTCTHIPLYTLAYIIHTYTYIHICPSIHPSIHPSTHPHIHTST...HLHIHPSIHPLIHSSTHPHIYTSTHLSIHPSTHPPIHPSIHPSIHPSIHPSIHLPIHTSTYPHIHPSTHPSIHTSIHPSIHTSTHPSIHLPIHTSTYPHIHPSTHPSIHTSIHPSIHTSTHPSIHLPIHTST...YPHIHPSTHPSIHTSTHPSIHTSTHPSIHLPIHTSTYPHIHPSTHPSIHTSTHPSIHTST...HPSIHPSIHPSIHPSIHPSTLPHIYLSTHPSTHPSIHPHIHSSIHPHIHTSTQPASQPATHTYIHPSIDPHIHPTIHPHIHPSTHPFIHPSIDPHIHPTIHPHIHPSTHPSIHPSIDPLIHPSTHPHIHPSTHTCTWNGGRSTC ...

  17. Gene : CBRC-PMAR-01-0324 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available d=5' /gb=EG024802 /gi=115341549 /ug=Pma.618 /len=652 2e-14 24% MFCRCRCHWFFMFCRCRCHWFFMFCRCRCHWFFM...FCRCRCHWFFMFCRCRYHWFFMFCRCRCHWFFMFCRCRCHWFFMFCRCRCHWFFMFCRCRCHWFFMFCRCRCHWFFMFCRCRCHWFFMFCRCRCHWFFVFCRSRCHWFFM...FCRCRCHWFFMFCRCRFNWFFMFCRCRCHWFFMFCRSRCHWFFMFCRCRCHWFFVFCRSRCHWFFMFCRCRCHWFFVFCRSRCHWFFMFCRCRCHWFFMFYRCRCLNDAAVHKNKNTAIVHVCKVTP ...

  18. Gene : CBRC-OLAT-01-0033 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available /clone_end=3' /gb=DC259951 /gi=141600100 /ug=Ola.17741 /len=827 1e-20 31% MVVCTAVCMAVCAAVCTAVCKEVCIAICTAICAVDCMAVFIAVCTDVLTAVCTAVC...VAVCTAVCTAICAVDCMAVCIAVCTDILTAVYTAVCTAVCTAVCTAICAVDCMAVCIAVCTDILTAVYTAVCTAVCMVVCTDVLTAVCKAVCMAVCKAICTAVCTAVCTAVCLYE ...

  19. Gene : CBRC-MMUS-23-0040 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available LLKCVFVIYRDFHFSRHFPGPTVCISHFSRLLVNLSFFKSSSGCFSFSMIISFLSIFHVLQWRFLNFPPFSVFLAIFHILKCVLLIFWDFQFSCNIPGPTVCISHFSR...FSVISSFFKSSSGCFSFSMIFSFLAIFHVLQWILLYFPPFSVFLAIFHILKHVFLIFRDFQFSLNIPGPIVCISHFSCFSI...ISSSYFTSLTSLILFFRDFQFSRHIPGHTVCISHFSRFYCDIVIFQVVKWMFLIFHDFQFSCNIPCRTVDISKFFTFFSFPHHISRHKVCISHFP ... ... insert sequence /gb=AK156981 /gi=74152306 /ug=Mm.330279 /len=4633 1e-112 58% MIFSFLSIFHVLQWTFLNYLPFSVFLAIFH

  20. Gene : CBRC-XTRO-01-2729 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available 559 /gi=71785299 /ug=Str.71415 /len=820 6e-19 35% MQPPVYTTRLFHAAPCISHWALPCSPLYIPLRSSMQPPVYPTALFHAAPCISH...CALPCSPLYIPLRSSMQPPVYTTALFHAAPCISHCALPCSPLYIPLGFSMQPPVYPTGLFHAAPCISHWALPCRPLYIPLGFSMQPPVYPTGLFHAAPCISH...CALPCSPLYIPLRSSMQPPVYPTALFHAAPCISHCALPCSPLYIPLGSSMQPPVYPTALFHAAPCISHWAFPCSPLYIPLGSSMKHRTTFMQKTSTDAPAVPHTRSLTSCKLSLMLLPGLPKPFYIGIPRPYSQ ...

  1. Gene : CBRC-MMUS-09-0006 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available equence /gb=AK156981 /gi=74152306 /ug=Mm.330279 /len=4633 1e-120 79% MIFSFLAIFQVLQWTFPNFRPLSVFLAIFHVPKCVFLIFHDFQFPRHIPGPTVCISH...FSRFSVISSFFKTSSGCFSFFMIFSFLAIFHVLQWTFLNFPPFSVFLAIFHVLKCVFLIFRDFQFSCHIPGPTVCISHFSRFSVILSFFN...LSTACFSFSMIFSFLAIFHVLQWTFLNFPPFSVFLAIFHVLKCVFLIFRVFQVSRHIPGPTVCISHFSRFSVILSFFKLSSGCFSFSLIFTFLAIFQVLQGHFSFFTFSVILSFSICQLHVSHFP ...

  2. Ultrasound-Guided Miniscalpel-Needle Release versus Dry Needling for Chronic Neck Pain: A Randomized Controlled Trial

    Directory of Open Access Journals (Sweden)

    Yongjun Zheng

    2014-01-01

    Full Text Available Objective. To compare ultrasound-guided miniscalpel-needle (UG-MSN release versus ultrasound-guided dry needling (UG-DN for chronic neck pain. Methods. A total of 169 patients with chronic neck pain were randomized to receive either UG-MSN release or UG-DN. Before treatment and at 3 and 6 months posttreatment, pain was measured using a 10-point visual analogue scale (VAS. Neck function was examined using the neck disability index. Health-related quality of life was examined using the physical component score (PCS and mental component score (MCS of the SF-36 health status scale. Results. Patients in the UG-MSN release had greater improvement on the VAS (by 2 points at 3 months and 0.9 points at 6 months versus in the UG-DN arm; (both P<0.0001. Patients receiving UG-MSN release also showed significantly lower scores on the adjusted neck disability index, as well as significantly lower PCS. No severe complications were observed. Conclusion. UG-MSN release was superior to UG-DN in reducing pain intensity and neck disability in patients with chronic neck pain and was not associated with severe complications. The procedural aspects in the two arms were identical; however, we did not verify the blinding success. As such, the results need to be interpreted with caution.

  3. Radiation sensitivity of two Ginger varieties (Zingiber officinale Rosc.) to gamma irradiation

    International Nuclear Information System (INIS)

    Nwachukwu, E.C.; Ene, L.S.O.; Mbanaso, E.N.A.

    1994-01-01

    The mutability and radiosensitivity of two local ginger varieties in Nigeria ''Tafin Giwa'' (UG 1) and ''Yatsun Biri'' (UG 2) were studied using gamma rays from a 60Co gamma source. There was a high frequency of chlorophyll mutations indicating a high mutability in ginger. GR 50 was obtained at 5.0 and 6.0 Gy in UG1, and UG2, respectively, while LD50 was obtained at 8.75 Gy in both varieties. The dose limitation range for ginger was estimated to be 5.0-9.0 Gy [es

  4. Gene : CBRC-OANA-01-1685 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available | PREDICTED: similar to vomeronasal V1r-type receptor V1rg7 [Ornithorhynchus anatinus] 1e-148 100% gnl|UG|Oa...LSIFQAITISPSTSWWAGRKTKLPKCILPSFVIFWILNMLIDFHTLIVVTGPHNARIHQDMKYCSLGNASARATLIFSVVLSLRDLFFVGLMSVASVYMVFVLYSHHR

  5. Gene : CBRC-FRUB-02-0753 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available AB246172 /gi=115305877 /ug=Tru.3675 /len=5037 2e-47 41% MSNITTTTSATTSQTSSSTSTSPSTTSA...TTSSPTTSTTTSQTSSSTSTSPSTTSATTSSPTTSATTSQTSSSTATSPSTTSATTSSPTTSATTSQTSSSTSTSPSTTSATTSSPTTSATSSQTSSSTATSPSTTSETTSSPTTSA...TTSQTSSSTTSPSTSSATTSSPTTSATTSQTSSSTTSPSTTSATTSSPTTSATTSQTSSSTTSPSTTSATTSSPTTSATTSKTSSSTDTNPSTTSATTSSPTTSA...TTSQTSSSTTTNPSTTSATTSSPTTSATTSQTSSSTTSPSTTSATTSSPTTSATTSKKSSSTDTNPSTTSATTSSPTTSA...TSSQTSSSTSTSPSTTSTTTSSPTTSATTSQTSSSTSTSPSTSSATTSSPTTSATTSQTSSSTTSPSTTSATTSSPTTSATTSQTSSSTTSPSTTSTTTSSPTTSA

  6. Gene : CBRC-DMEL-08-0023 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available 8016 /ug=Dm.1879 /len=6178 4e-22 26% MYCSCTGPVLVLYWSRSGPVLVPYWSRTGPVPGPVLVLGPVLDS...VLGSVLGSVLGSVLVLVLVPYWSRSGPVLVPYWSRTGPVLVPYSVPYSIPYWVQYSVPYSVPYSVPYWSRTGPVLVPYWSRTGPVLVPYWSRTGPVLVPYWSRTGPVL...VQYSVPYWSRTGRVLCSVLGSVLGPVLVPYWSRTGPVLVPYWSRTGPVLVPYSVPYSVPYSVPYWSRTGPVLVPYWSRTGPVLVPYWSRTGPVLVPYWSRTGPVLVPYWSRTGP...VLSPVLSPVLVPYWSRTLFRTRFRTRSRTGPVLVPYWSRTGPVLVPYSVPYSVPYSVPYWSRTGPVLVPYWSRTGPVLVPYWSRTRSRTRSRTGP...VLVPYLSCTGPVLGHVLLLYWSRTGPILVPFWSRTGPVLVPYSVPYSYSVPYSIPYWVPYLVPYSVPYSFSYWFRTGPVLVPYWSRTGP

  7. Small battery operated unattended radar sensor for security systems

    Science.gov (United States)

    Plummer, Thomas J.; Brady, Stephen; Raines, Robert

    2013-06-01

    McQ has developed, tested, and is supplying to Unattended Ground Sensor (UGS) customers a new radar sensor. This radar sensor is designed for short range target detection and classification. The design emphasis was to have low power consumption, totally automated operation, a very high probability of detection coupled with a very low false alarm rate, be able to locate and track targets, and have a price compatible with the UGS market. The radar sensor complements traditional UGS sensors by providing solutions for scenarios that are difficult for UGS. The design of this radar sensor and the testing are presented in this paper.

  8. Gene : CBRC-MDOM-04-0140 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available /cds=p(1,2634) /gb=NM_001099531 /gi=156119554 /ug=Mdm.4760 /len=2634 0.33 30% MPNSLTSALLNLLIYELKDMNFPLTTALAASHRFCKDVSSLSFSSMKLLIISTI...CSLSNQFWRIVFFNFQLIFDLPLHVPLLIIIFIALLSEKVAFIISALLNLFGMFLC

  9. Associations between physical activity and characteristics of urban green space

    DEFF Research Database (Denmark)

    Schipperijn, Jasper; Bentsen, Peter; Troelsen, Jens

    2013-01-01

    of the nearest UGS, and the presence of certain features. However, the evidence to date is somewhat inconclusive, and dominated by studies from North America and Australia. There is a large variation in city structures, and recommendations for North American or Australian cities are not automatically valid...... was found. The amount and number of UGS within one kilometre revealed no association either. For PA in the nearest UGS positive associations with size, walking/cycling routes, wooded areas, water features, lights, pleasant views, bike rack, and parking lot were found. This indicates that PA in an UGS might...

  10. Gene : CBRC-PMAR-01-0595 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available =3' /gb=EE272592 /gi=111172325 /ug=Pma.6919 /len=680 2e-04 30% MRLEYLAAIHFNVMMSHFVMMSHFVMMSHFVMMSHVVMMS...YFVMMSHFVMMSHFVMSHVVMMSHFVMSHFVMMSHVVMMSHFVMMSHFVMMSHVVMMSHFVMMNHFVMMNHFVMMSHFVMMSHFVMMSHFVMSHVVMMS...HFVMMNHFVMMNHFVMMSHFVMMSHFVMMSHFVMMNHFVMMNHFVMMSHFVMMSHFVXXXXEPLRDDEPLRDDEPLRDDEPLRDDEPLRDDESLR

  11. Gene : CBRC-CINT-01-0073 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available 500 /gi=47795328 /ug=Cin.16042 /len=777 0.22 22% MCXXXXXXXXXXXXXXXXXIYKMSMLIYMMSMLIYMMSMLIYMMSMLIYMMSMLIYKLSMLIYMMSMLIYMMSMLIYMMS...MLIYMMSMLIYMMSMLIYMMSMLIYKMSMLIYMMSMLIYMMSMLIYMMSMLIYMMSMLIYKMSMLIYMMSMLIYMMSMLIYMMSMLIYMMSMLIYKLSMLIYMMSMLIYMMS...MLIYMMSMLIYMMSMLIYMMSMLIYMMSMLIYKMSMLIYMMSMLIYMMSMLIYMMSMLIYMMSMLIYMMSMLIYMMS...MLIYMMSMLIYMMSMLIYRLSXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX

  12. Gene : CBRC-MDOM-04-0034 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available 11) /gb=EF508680 /gi=145232584 /ug=Mdm.4709 /len=10011 0.055 29% MKLINYIYSSVWHFLINFINSS...VWHFLINFIYSSVWHFLINFINSSVWHFLINFIYSSVWHFLINFINSSVWHFLINFINSSVWHFLINFIYSSSLALFDQFHKLFSLALFDQFHILFSLALFDQFHKLFSLALFDQFHILFSLALFDQFHKLFSLALFDQFHILFSLALFDQFHKLFSLALFGQFHILFSLALFL ...

  13. Gene : CBRC-DRER-22-0039 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available 102920926 /ug=Dr.79541 /len=690 4e-72 87% MECAARSGDEKELENSKAGVVAARVLNSGVVARVLISCVVARVLSSGVVARVLISCVVAR...VLNSGVVARVLISCVVARVLNSGVVARVLISCVVARVLNSGVVARVLISCVVARVLNSGVVARVLISCVVARVLISCVDARVLNSGVVARVLISCVVARVLNSGVVAR...VLISCVVARVLISCVVARVLISCVVARVLNSGVVARVLISCVVARVLISCVVARVLNSGVVAGVLISCVVARVLNSGVVTRVLISCVVARVLISCVVAR...VLISCVDARVLNSGVVAGVLISCVVARVLNSGVVTRVLISCVVARVLISCVVARVLNSGVVSTLFRLMQT ...

  14. Gene : CBRC-CINT-01-0197 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available 1561) /gb=AY895021 /gi=62903344 /ug=Cin.18201 /len=1561 1.4 25% MELDHIVLVLRNIFLMV...VDWPFLWSVRRCHRMELDHTVLVLGNILQMVVEQPFLQLVRRCQRMELDHIVLVLGNILQMVVEQPFLQLVRRYQRMELDHIVLVLGNTLLMVVEQPFLQLVRRYQRMELDHI...VLVLGNTLLIVVEQPFLQLVRRYQRMELDHIVLVLGNTLLIVVEQPFLQLVRRYQRMELDHIVLVLGNTLLMEQPFLQLVRRYQRMELDHIVLVLGNILQMVVEQPFLQLVRRYQCMEQEQMKQVKE ...

  15. Gene : CBRC-XTRO-01-0146 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available d=5' /gb=ES686353 /gi=148865870 /ug=Str.75856 /len=769 6e-62 55% MYFSVFANEIRNFIANSCPM...LPVCAILCLPYAACMPYSACPMLPVCAILCLPYAACVCHTRPALCCLCVSYSACPMLPVCHILPALCCLCVLYFACPMLLVCVILDLPYAACVCHTLPALCCMCVPYSACPM...LPVCAILCLPYAACVPYSACPMLPVCAILCLPYAACVCHTLPALCCMCVPYSACPMLPVCAILCLPYAAGVCHTRPALCCLCVPYSACPMLPVFDIPCPYLPTVPLSVGQSQYLWHCPLSRIHC ...

  16. Gene : CBRC-XTRO-01-3375 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available d=5' /gb=ES686353 /gi=148865870 /ug=Str.75856 /len=769 8e-72 58% MLPVCHTLPALCCMCVPYSACPM...VPVCAILCLPYAACVFHTLPALCCLCVPYSACPMLPVCAILCLPYAACVFHTLPALCCLCVPYSACPMLPVCSILCLPYAACVFHTLPALCCLCVPYFPCPFLPVFHNLPVLCCLCVPYSACPM...LPVCPILCLPYAACVFHTLPALCCLCVPYSACPMLPVCSILCLPYAACVCHTLPALCCLCVPYSACPMLPVCSTLCLPYAACVCHTFPAFFCLCSIICLSYAACVFHTLPVLCCLCVPYSACPMLPVCATLCLPYAAYGR ...

  17. Gene : CBRC-MMUS-05-0037 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available 205) /gb=AB034730 /gi=7209718 /ug=Mm.329131 /len=3320 9e-14 24% MLLMCSMTMLLMRSAITLLICSATMLFMHSATM...LLMCSVNMLFMCSATMLFMGSATTLLMGSATMLLMGSANLLFMGSGTKLFKGSATMLFMGSATMLLMGSATMLLIGSATMLFKGSTNMLLMCSATMVFMGSGIMLFKGSATM...LFMHSSTMLHMGSGTKLFIGSATMLLMGSATMLFKGSATMLSMHSVTMLHMGSATMSFMGSATMLFNGSAAMSFMGSATMLRIPWRLGVEESLERLKEFSLTDLFSSGFMQG ...

  18. Gene : CBRC-RNOR-14-0029 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available ' /gb=CB805046 /gi=29921778 /ug=Rn.215427 /len=409 2e-13 100% MYHFLGFATLMLLMCSATM...MFMLSVNMLLMRSVNLLLTFSVHVLLICSVNTLPMCSVNMFMHSTIMLLMCSAIMLLMSSKVMLLMSSAIMLLMWSAILLRVRLATMLLMCSVITLFMGSATMLSMCPETMLITCSATTLSMCSATM...QSMGSATMQFMGSATMQFMHSANMLFMGSATMQFMHSSNMLFMGSATMQFMHSSNMLFMGSATMLFMGSATMQFMHSATMQVMGSATML...HMGSATTLFMGSATTLFMGPAIMLHMGSATTLFMGPAIMLHMGSATTLFMGPAIMLHMGSATMLFMGPAIMLHMGSATMLHMGSAIMLCMCPATM...LLMCSAIILYMGSATMLSMCSATMQFMGSATMQFMGSATMQFMGSATMLSMYSAIMQFMGSATMLSMCSATMQFMGSATMQFMHSATMQFMGSATMLSMCSATMQFMGSATMQFMGSATM ...

  19. Environmental factors influenting species composition of acidophilous grasslands patches in agricultural landscape

    Czech Academy of Sciences Publication Activity Database

    Halas, Petr

    2012-01-01

    Roč. 20, č. 1 (2012), s. 16-27 ISSN 1210-8812 Institutional support: RVO:68145535 Keywords : acidophilous grasslands * hemeroby * patch isolation * patch area * regression trees Subject RIV: DE - Earth Magnetism, Geodesy, Geography http://www.geonika.cz/EN/research/ENMgr/MGR_2012_01.pdf

  20. Wire-type MnO2/Multilayer graphene/Ni electrode for high-performance supercapacitors

    Science.gov (United States)

    Hu, Minglei; Liu, Yuhao; Zhang, Min; Wei, Helin; Gao, Yihua

    2016-12-01

    Commercially available wearable energy storage devices need a wire-type electrode with high strength, conductivity and electrochemical performance, as well as stable structure under deformation. Herein, we report a novel wire-type electrode of hierarchically structure MnO2 on Ni wire with multilayer graphene (MGr) as a buffer layer to enhance the electrical conductivity of the MnO2 and interface contact between the MnO2 and Ni wire. Thus, the wire-type MnO2/MGr/Ni electrode has a stable and high quality interface. The wire-type supercapacitor (WSC) based on wire-type MnO2/MGr/Ni electrode exhibits good electrochemical performance, high rate capability, extraordinary flexibility, and superior cycle lifetime. Length (area, volumetric) specific capacitance of the WSC reaches 6.9 mF cm-1 (73.2 mF cm-2, 9.8 F cm-3). Maximum length (volumetric) energy density of the WSC based on MnO2/MGr/Ni reaches 0.62 μWh cm-1 (0.88 mWh cm-3). Furthermore, the WSC has a short time constant (0.5-400 ms) and exhibits minimal change in capacitance under different bending shapes.

  1. A Model for the Identification of Areas Favourable for the Development of Tourism: A Case Study of the Šumava Mts. and South Bohemia Tourist Regions (Czech Republic)

    Czech Academy of Sciences Publication Activity Database

    Navrátil, J.; Pícha, K.; Martinát, Stanislav; Knotek, J.; Kučera, T.; Balounová, Z.; White Baravalle Gilliam, V. L.; Švec, R.; Rajchard, J.

    2013-01-01

    Roč. 21, č. 1 (2013), s. 25-40 ISSN 1210-8812 Institutional support: RVO:68145535 Keywords : GIS * tourism * Czech Republic * Šumava Mts. and South Bohemia tourist regions * development Subject RIV: DE - Earth Magnetism, Geodesy, Geography Impact factor: 0.341, year: 2013 http://www.geonika.cz/EN/research/ENMgr/MGR_2013_01.pdf

  2. On the coefficient conjecture of Clunie and Sheil-Small on univalent ...

    Indian Academy of Sciences (India)

    Transactions and Security), MGR Knowledge City, CIT Campus, Taramani,. Chennai 600 113, India. 2Department of Mathematics, Indian Institute of Technology Madras, ... Based on the investigation and a number of examples of this article, we propose two new .... It is natural to introduce and state analogous results for. C0.

  3. 2006 Marine Corps Systems Command Advanced Planning Briefing to Industry

    Science.gov (United States)

    2006-04-14

    Search on various criteria! 16 Manually -generated Solicitations: Available only for browsing and download from NECO because source document is textual...Program Managers Mr. M. Kane Business Mgr Mr. G. Jarani Chief Engineer Mr. J. Apgar Chief, Prod Mr. J. Lipinski CM/Sys Engring James Shields JPM LW155

  4. Preliminary Integrated Safety Analysis Status Report

    International Nuclear Information System (INIS)

    Gwyn, D.

    2001-01-01

    This report provides the status of the potential Monitored Geologic Repository (MGR) Integrated Safety Analysis (EA) by identifying the initial work scope scheduled for completion during the ISA development period, the schedules associated with the tasks identified, safety analysis issues encountered, and a summary of accomplishments during the reporting period. This status covers the period from October 1, 2000 through March 30, 2001

  5. The Footfall of Shopping Centres in Olomouc (Czech Republic): An Application of the Gravity Model

    Czech Academy of Sciences Publication Activity Database

    Klapka, Pavel; Erlebach, M.; Král, O.; Lehnert, M.; Mička, T.

    2013-01-01

    Roč. 21, č. 3 (2013), s. 12-26 ISSN 1210-8812 Institutional support: RVO:68145535 Keywords : footfall * spatial interaction * gravity model * shopping centre * Olomouc Subject RIV: DE - Earth Magnetism, Geodesy, Geography Impact factor: 0.341, year: 2013 http://www.geonika.cz/EN/research/ENMgr/MGR_2013_03.pdf

  6. Classification Accuracy Is Not Enough

    DEFF Research Database (Denmark)

    Sturm, Bob L.

    2013-01-01

    A recent review of the research literature evaluating music genre recognition (MGR) systems over the past two decades shows that most works (81\\%) measure the capacity of a system to recognize genre by its classification accuracy. We show here, by implementing and testing three categorically...

  7. Van autonomie terug naar natuurlijk­heid? Een reactie op prof.dr. H.M. Dupuis

    NARCIS (Netherlands)

    Boer, Th.A.

    Wie de inleidingen van Prof. Dupuis en Mgr. Eijk leest, kan zich moeilijk aan de indruk onttrekken dat zij het onderling behoorlijk eens zijn. Dat verbaast, want Eijk staat bekend als een aanhanger van het natuurrecht zoals geïnterpreteerd in de rooms-katholieke traditie en Dupuis als een

  8. FAA Air Traffic Activity. Fiscal Year 1991

    Science.gov (United States)

    1991-01-01

    MGR) GA 448 0 0 448 0 THOMASVILLE MUNICIPAL ............................................ (TVI) GA 963 0 0 963 0 TIFTON ...listed below for ordering purposes. ATLANTA, GA KANSAS CITY, MO 275 Peachtree Street. NE, Room 100, P.O. Box 56445, Atlanta, GA 120 Bannister Mail, 5600...CA L 3 660680 TORRANCE MUNICIPAL ................................... CA L 83 210157 ATLANTA INTERNATIONAL ............................. GA

  9. Analysis of the development of land use in the Morava River floodplain, with special emphasis on the landscape matrix

    Czech Academy of Sciences Publication Activity Database

    Kilianová, H.; Pechanec, V.; Brus, J.; Kirchner, Karel; Machar, I.

    2017-01-01

    Roč. 25, č. 1 (2017), s. 35-48 ISSN 1210-8812 Institutional support: RVO:68145535 Keywords : historical maps * land use changes * floodplain * Morava River * Czech Republic Subject RIV: DE - Earth Magnetism, Geodesy, Geography OBOR OECD: Physical geography Impact factor: 2.149, year: 2016 http://www.geonika.cz/mgr.html#articles

  10. Location Matters! Exploring Brownfields regeneration in a Spatial Context (Case Study of the South Moravian Region, Czech Republic)

    Czech Academy of Sciences Publication Activity Database

    Frantál, Bohumil; Kunc, Josef; Nováková, Eva; Klusáček, Petr; Martinát, Stanislav; Osman, Robert

    2013-01-01

    Roč. 21, č. 2 (2013), s. 5-19 ISSN 1210-8812 R&D Projects: GA MŠk(CZ) 7E11035 Institutional support: RVO:68145535 Keywords : brownfields * success factors * spatial analysis Subject RIV: DE - Earth Magnetism, Geodesy, Geography Impact factor: 0.341, year: 2013 http://www.geonika.cz/EN/research/ENMgr/MGR_2013_02.pdf

  11. Role of Magnetic Reconnection in Heating Astrophysical Plasmas

    Science.gov (United States)

    Hammoud, M. M.; El Eid, M.; Darwish, M.; Dayeh, M. A.

    2017-12-01

    The description of plasma in the context of a fluid model reveals the important phenomenon of magnetic reconnection (MGR). This process is thought to be the cause of particle heating and acceleration in various astrophysical phenomena. Examples are geomagnetic storms, solar flares, or heating the solar corona, which is the focus of the present contribution. The magnetohydrodynamic approach (MHD) provides a basic description of MGR. However, the simulation of this process is rather challenging. Although it is not yet established whether waves or reconnection play the dominant role in heating the solar atmosphere, the present goal is to examine the tremendous increase of the temperature between the solar chromosphere and the corona in a very narrow transition region. Since we are dealing with very-high temperature plasma, the modeling of such heating process seems to require a two-fluid description consisting of ions and electrons. This treatment is an extension of the one-fluid model of resistive MHD that has been recently developed by [Hammoud et al., 2017] using the modern numerical openfoam toolbox. In this work, we outline the two-fluid approach using coronal conditions, show evidence of MGR in the two-fluid description, and investigate the temperature increase as a result of this MGR process.

  12. Biogeographical relationship between landscapes pattern, chosen local abiotic factors and vegetation in forest edges

    Czech Academy of Sciences Publication Activity Database

    Lacina, Jan; Halas, Petr; Švec, P.

    2012-01-01

    Roč. 20, č. 4 (2012), s. 2-12 ISSN 1210-8812 Institutional support: RVO:68145535 Keywords : patch isolation * patch area * agricultural landscape * Bohemian-Moravian Upland Subject RIV: DE - Earth Magnetism, Geodesy, Geography http://www.geonika.cz/EN/research/ENMgr/MGR_2012_04.pdf

  13. Erasmus Mundus SEN: The Inclusive Scholarship Programme?

    Science.gov (United States)

    Grinbergs, Christopher J.; Jones, Hilary

    2013-01-01

    The Erasmus Mundus MA/Mgr in Special Education Needs (EM SEN) was created as a Masters Course funded by the European Commission's Erasmus Mundus Programme (EMP) to challenge and educate students in inclusive policy and practice in education. Yet, it is debatable the extent to which this programme embodies the values of an inclusive approach,…

  14. Post-Industrial Landscape: The Case of the Liberec Region, Czech Republic

    Czech Academy of Sciences Publication Activity Database

    Kolejka, Jaromír; Klimánek, M.; Fragner, B.

    2011-01-01

    Roč. 19, č. 4 (2011), s. 3-17 ISSN 1210-8812 Institutional support: RVO:68145535 Keywords : post-industrial landscapes * data sources * identification Subject RIV: DE - Earth Magnetism, Geodesy, Geography http://www.geonika.cz/EN/research/ENMgr/MGR_2011_04.pdf

  15. The anger-infused Ultimatum Game: A reliable and valid paradigm to induce and assess anger.

    Science.gov (United States)

    Gilam, Gadi; Abend, Rany; Shani, Hagai; Ben-Zion, Ziv; Hendler, Talma

    2018-03-22

    The Ultimatum Game (UG) is a canonical social decision-making task whereby a proposer divides a sum of money between himself and a responder who accepts or rejects the offer. Studies consistently demonstrate that unfair offers induce anger, and that rejecting such offers relates to aggression. Nevertheless, the UG is limited in interpersonal provocations common to real-life experiences of anger. Moreover, the psychometric properties of the UG as an anger-induction paradigm have yet to be evaluated. Here, to induce a more intense and genuine anger experience, we implemented a modified UG whereby short written provocations congruent with unfairness levels accompanied each offer. We aimed to test whether this anger-infused UG led to more anger and aggressive responses relative to the standard UG and to establish the reliability and validity of both versions. Participants performed either the anger-infused UG or a standard version, repeated twice, a week apart. They also performed the Taylor Aggression Paradigm, a reactive aggression paradigm, and completed emotion ratings and a trait anger inventory. Results indicate similar decreases in acceptance rates with increase in offer unfairness, and increases in reported anger, across both UG versions. Both versions demonstrated strong test-retest reliability. However, the anger-infused UG led to significantly stronger relations with reactive aggression and trait anger compared to the standard UG, providing evidence for better validity. The development of the anger-infused UG as a reliable and valid paradigm is pivotal for the induction and assessment of interpersonal anger and its aggressive expression in basic and clinical research settings. (PsycINFO Database Record (c) 2018 APA, all rights reserved).

  16. Mapping the heparin-binding site of the BMP antagonist gremlin by site-directed mutagenesis based on predictive modelling.

    Science.gov (United States)

    Tatsinkam, Arnold Junior; Mulloy, Barbara; Rider, Christopher C

    2015-08-15

    Gremlin is a member of the CAN (cerberus and DAN) family of secreted BMP (bone morphogenetic protein) antagonists and also an agonist of VEGF (vascular endothelial growth factor) receptor-2. It is critical in limb skeleton and kidney development and is re-expressed during tissue fibrosis. Gremlin binds strongly to heparin and heparan sulfate and, in the present study, we sought to investigate its heparin-binding site. In order to explore a putative non-contiguous binding site predicted by computational molecular modelling, we substituted a total of 11 key arginines and lysines located in three basic residue sequence clusters with homologous sequences from cerberus and DAN (differential screening selected gene abberative in neuroblastoma), CAN proteins which lack basic residues in these positions. A panel of six Myc-tagged gremlin mutants, MGR-1-MGR-6 (MGR, mutant gremlin), each containing different combinations of targeted substitutions, all showed markedly reduced affinity for heparin as demonstrated by their NaCl elution on heparin affinity chromatography, thus verifying our predictions. Both MGR-5 and MGR-6 retained BMP-4-binding activity comparable to that of wild-type gremlin. Low-molecular-mass heparin neither promoted nor inhibited BMP-4 binding. Finally, glutaraldehyde cross-linking demonstrated that gremlin forms non-covalent dimers, similar behaviour to that of DAN and also PRDC (protein related to cerberus and DAN), another CAN protein. The resulting dimer would possess two heparin-binding sites, each running along an exposed surface on the second β-strand finger loop of one of the monomers. © 2015 Authors; published by Portland Press Limited.

  17. WASTE TREATMENT BUILDING SYSTEM DESCRIPTION DOCUMENT

    Energy Technology Data Exchange (ETDEWEB)

    F. Habashi

    2000-06-22

    The Waste Treatment Building System provides the space, layout, structures, and embedded subsystems that support the processing of low-level liquid and solid radioactive waste generated within the Monitored Geologic Repository (MGR). The activities conducted in the Waste Treatment Building include sorting, volume reduction, and packaging of dry waste, and collecting, processing, solidification, and packaging of liquid waste. The Waste Treatment Building System is located on the surface within the protected area of the MGR. The Waste Treatment Building System helps maintain a suitable environment for the waste processing and protects the systems within the Waste Treatment Building (WTB) from most of the natural and induced environments. The WTB also confines contaminants and provides radiological protection to personnel. In addition to the waste processing operations, the Waste Treatment Building System provides space and layout for staging of packaged waste for shipment, industrial and radiological safety systems, control and monitoring of operations, safeguards and security systems, and fire protection, ventilation and utilities systems. The Waste Treatment Building System also provides the required space and layout for maintenance activities, tool storage, and administrative facilities. The Waste Treatment Building System integrates waste processing systems within its protective structure to support the throughput rates established for the MGR. The Waste Treatment Building System also provides shielding, layout, and other design features to help limit personnel radiation exposures to levels which are as low as is reasonably achievable (ALARA). The Waste Treatment Building System interfaces with the Site Generated Radiological Waste Handling System, and with other MGR systems that support the waste processing operations. The Waste Treatment Building System interfaces with the General Site Transportation System, Site Communications System, Site Water System, MGR

  18. WASTE TREATMENT BUILDING SYSTEM DESCRIPTION DOCUMENT

    International Nuclear Information System (INIS)

    Habashi, F.

    2000-01-01

    The Waste Treatment Building System provides the space, layout, structures, and embedded subsystems that support the processing of low-level liquid and solid radioactive waste generated within the Monitored Geologic Repository (MGR). The activities conducted in the Waste Treatment Building include sorting, volume reduction, and packaging of dry waste, and collecting, processing, solidification, and packaging of liquid waste. The Waste Treatment Building System is located on the surface within the protected area of the MGR. The Waste Treatment Building System helps maintain a suitable environment for the waste processing and protects the systems within the Waste Treatment Building (WTB) from most of the natural and induced environments. The WTB also confines contaminants and provides radiological protection to personnel. In addition to the waste processing operations, the Waste Treatment Building System provides space and layout for staging of packaged waste for shipment, industrial and radiological safety systems, control and monitoring of operations, safeguards and security systems, and fire protection, ventilation and utilities systems. The Waste Treatment Building System also provides the required space and layout for maintenance activities, tool storage, and administrative facilities. The Waste Treatment Building System integrates waste processing systems within its protective structure to support the throughput rates established for the MGR. The Waste Treatment Building System also provides shielding, layout, and other design features to help limit personnel radiation exposures to levels which are as low as is reasonably achievable (ALARA). The Waste Treatment Building System interfaces with the Site Generated Radiological Waste Handling System, and with other MGR systems that support the waste processing operations. The Waste Treatment Building System interfaces with the General Site Transportation System, Site Communications System, Site Water System, MGR

  19. Dioscorea trifida L.

    African Journals Online (AJOL)

    SAM

    2014-04-09

    Apr 9, 2014 ... Oxidation reached a similar level on medium S, T and ZR (2.17 - 2.40) while it was only 1.63 on medium. EBR. Well-developed shoots were ... pathogens, both in the field and during tuber storage, and viruses can accumulate .... Our objective was to study if these changes in. PGR content in the recovery ...

  20. A Gata2-Dependent Transcription Network Regulates Uterine Progesterone Responsiveness and Endometrial Function

    Directory of Open Access Journals (Sweden)

    Cory A. Rubel

    2016-10-01

    Full Text Available Altered progesterone responsiveness leads to female infertility and cancer, but underlying mechanisms remain unclear. Mice with uterine-specific ablation of GATA binding protein 2 (Gata2 are infertile, showing failures in embryo implantation, endometrial decidualization, and uninhibited estrogen signaling. Gata2 deficiency results in reduced progesterone receptor (PGR expression and attenuated progesterone signaling, as evidenced by genome-wide expression profiling and chromatin immunoprecipitation. GATA2 not only occupies at and promotes expression of the Pgr gene but also regulates downstream progesterone responsive genes in conjunction with the PGR. Additionally, Gata2 knockout uteri exhibit abnormal luminal epithelia with ectopic TRP63 expressing squamous cells and a cancer-related molecular profile in a progesterone-independent manner. Lastly, we found a conserved GATA2-PGR regulatory network in both human and mice based on gene signature and path analyses using gene expression profiles of human endometrial tissues. In conclusion, uterine Gata2 regulates a key regulatory network of gene expression for progesterone signaling at the early pregnancy stage.

  1. Experiment list: SRX735140 [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available SRX735140 hg19 TFs and others Epitope tags Uterus Endometrial stromal cells NA 4717...6648,92.9,11.2,8048 GSM1527529: PGR-B ChIPSeq; Homo sapiens; ChIP-Seq source_name=Endometrial stromal cells || cell type=Endometr

  2. Experiment list: SRX735139 [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available SRX735139 hg19 TFs and others Epitope tags Uterus Endometrial stromal cells NA 5046...8720,97.1,10.0,3809 GSM1527528: PGR-A ChIPSeq; Homo sapiens; ChIP-Seq source_name=Endometrial stromal cells || cell type=Endometr

  3. A mechanistic analysis of density dependence in algal population dynamics

    Directory of Open Access Journals (Sweden)

    Adrian eBorlestean

    2015-04-01

    Full Text Available Population density regulation is a fundamental principle in ecology, but the specific process underlying functional expression of density dependence remains to be fully elucidated. One view contends that patterns of density dependence are largely fixed across a species irrespective of environmental conditions, whereas another is that the strength and expression of density dependence are fundamentally variable depending on the nature of exogenous or endogenous constraints acting on the population. We conducted a study investigating the expression of density dependence in Chlamydomonas spp. grown under a gradient from low to high nutrient density. We predicted that the relationship between per capita growth rate (pgr and population density would vary from concave up to concave down as nutrient density became less limiting and populations experienced weaker density regulation. Contrary to prediction, we found that the relationship between pgr and density became increasingly concave-up as nutrient levels increased. We also found that variation in pgr increased, and pgr levels reached higher maxima in nutrient-limited environments. Most likely, these results are attributable to population growth suppression in environments with high intraspecific competition due to limited nutrient resources. Our results suggest that density regulation is strongly variable depending on exogenous and endogenous processes acting on the population, implying that expression of density dependence depends extensively on local conditions. Additional experimental work should reveal the mechanisms influencing how the expression of density dependence varies across populations through space and time.

  4. and C-terminus of

    Indian Academy of Sciences (India)

    amino acids 108–120) was expressed from Potato virus X (PVX)-based vector pGR106 as N- or C-terminal fusion with the PVX coat protein (PVX CP) in transgenic Nicotiana benthamiana plants. The fusion protein L2108-120-PVX CP was ...

  5. Strategies For Sustainable Conservation And Use Of Legume ...

    African Journals Online (AJOL)

    Strategies For Sustainable Conservation And Use Of Legume Genetic Resources In Ghana. ... Ghana Journal of Science ... Strategic development of conservation technologies in plant genetic resources (PGR) is the backbone for agricultural development, food security and sustainable livelihood, now and for the future.

  6. American Society of Clinical Oncology/College Of American Pathologists guideline recommendations for immunohistochemical testing of estrogen and progesterone receptors in breast cancer.

    NARCIS (Netherlands)

    Hammond, M.E.; Hayes, D.F.; Dowsett, M.; Allred, D.C.; Hagerty, K.L.; Badve, S.; Fitzgibbons, P.L.; Francis, G.; Goldstein, N.S.; Hayes, M.; Hicks, D.G.; Lester, S.; Love, R.; Mangu, P.B.; McShane, L.; Miller, K.; Osborne, C.K.; Paik, S.; Perlmutter, J.; Rhodes, A.; Sasano, H.; Schwartz, J.N.; Sweep, F.C.; Taube, S.; Torlakovic, E.E.; Valenstein, P.; Viale, G.; Visscher, D.; Wheeler, T.; Williams, R.B.; Wittliff, J.L.; Wolff, A.C.

    2010-01-01

    PURPOSE: To develop a guideline to improve the accuracy of immunohistochemical (IHC) estrogen receptor (ER) and progesterone receptor (PgR) testing in breast cancer and the utility of these receptors as predictive markers. METHODS: The American Society of Clinical Oncology and the College of

  7. American Society of Clinical Oncology/College of American Pathologists guideline recommendations for immunohistochemical testing of estrogen and progesterone receptors in breast cancer.

    NARCIS (Netherlands)

    Hammond, M.E.; Hayes, D.F.; Dowsett, M.; Allred, D.C.; Hagerty, K.L.; Badve, S.; Fitzgibbons, P.L.; Francis, G.; Goldstein, N.S.; Hayes, M.; Hicks, D.G.; Lester, S.; Love, R.; Mangu, P.B.; McShane, L.; Miller, K.; Osborne, C.K.; Paik, S.; Perlmutter, J.; Rhodes, A.; Sasano, H.; Schwartz, J.N.; Sweep, F.C.; Taube, S.; Torlakovic, E.E.; Valenstein, P.; Viale, G.; Visscher, D.; Wheeler, T.; Williams, R.B.; Wittliff, J.L.; Wolff, A.C.

    2010-01-01

    PURPOSE: To develop a guideline to improve the accuracy of immunohistochemical (IHC) estrogen receptor (ER) and progesterone receptor (PgR) testing in breast cancer and the utility of these receptors as predictive markers. METHODS: The American Society of Clinical Oncology and the College of

  8. American Society of Clinical Oncology/College of American Pathologists guideline recommendations for immunohistochemical testing of estrogen and progesterone receptors in breast cancer (unabridged version).

    NARCIS (Netherlands)

    Hammond, M.E.; Hayes, D.F.; Dowsett, M.; Allred, D.C.; Hagerty, K.L.; Badve, S.; Fitzgibbons, P.L.; Francis, G.; Goldstein, N.S.; Hayes, M.; Hicks, D.G.; Lester, S.; Love, R.; Mangu, P.B.; McShane, L.; Miller, K.; Osborne, C.K.; Paik, S.; Perlmutter, J.; Rhodes, A.; Sasano, H.; Schwartz, J.N.; Sweep, F.C.; Taube, S.; Torlakovic, E.E.; Valenstein, P.; Viale, G.; Visscher, D.; Wheeler, T.; Williams, R.B.; Wittliff, J.L.; Wolff, A.C.

    2010-01-01

    PURPOSE: To develop a guideline to improve the accuracy of immunohistochemical (IHC) estrogen receptor (ER) and progesterone receptor (PgR) testing in breast cancer and the utility of these receptors as predictive markers. METHODS: The American Society of Clinical Oncology and the College of

  9. Influence of Estradiol-17beta on Progesterone and Estrogen Receptor mRNA Expression in Porcine Follicular Granulosa Cells during Short-Term, In Vitro Real-Time Cell Proliferation

    Directory of Open Access Journals (Sweden)

    Sylwia Ciesiółka

    2016-01-01

    Full Text Available Progesterone (P4 and estradiol (E2 play a significant role in mammalian reproduction. Our study demonstrated that separated porcine cumulus cells (CCs and/or granulosa cells (GCs might proliferate in vitro during short-term, real-time primary culture. The GCs were analyzed according to gene expression of the progesterone receptor (nuclear form (pgr, progesterone receptor membrane component 1 (pgrmc1, and estrogen-related receptor beta 3 (esrrb3 in relation to two housekeeping genes: actb and pbgd. GCs were cultivated in medium with the E2. Both pgr/actb and pgr/pbgd revealed higher expression between 24 and 168 h of IVC of prolonged E2 treatment and at 48 h of IVC after acute E2 administration. The pgrmc1/actb and pgrmc1/pbgd displayed increased expression after prolonged E2 treatment between 24 and 120 h of IVC. The highest level of esrrb3/actb at 120 and 144 h, as well as esrrb3/pbgd at 120 h, in untreated controls as compared to the hormone-stimulated group, was observed. We suggest that E2 significantly influences the upregulation of pgr, pgrmc1, and esrrb3 expression in porcine GCs during real-time cell proliferation. Since esrrb3 expression is stimulated by E2 in both an acute and prolonged manner, estradiol may be recognized as a potential estrogen receptor agonist in GCs.

  10. 77 FR 6867 - Practice Guide for Proposed Trial Rules

    Science.gov (United States)

    2012-02-09

    ... new trial proceedings to be conducted by the Patent Trial and Appeal Board (Board) including inter... conducted by the Board including: (1) Inter partes review (IPR); (2) post-grant review (PGR); (3) a... response to the petition, including a simple statement that patent owner elects not to respond to the...

  11. Evaluation of estrogen receptor alpha and beta and progesterone receptor expression and correlation with clinicopathologic factors and proliferative marker Ki-67 in breast cancers

    DEFF Research Database (Denmark)

    Rosa, Fabíola E; Caldeira, José R F; Felipes, Joice

    2008-01-01

    To elucidate the molecular profile of hormonal steroid receptor status, we analyzed ER-alpha, ER-beta, and PGR mRNA and protein expression in 80 breast carcinomas using reverse transcriptase polymerase chain reaction (RT-PCR), quantitative RT-PCR, and immunohistochemical analysis. Qualitative ana...

  12. Evaluation of the ability of adjuvant tamoxifen-benefit gene signatures to predict outcome of hormone-naive estrogen receptor-positive breast cancer patients treated with tamoxifen in the advanced setting

    DEFF Research Database (Denmark)

    Sieuwerts, Anieta M; Lyng, Maria Bibi; Meijer-van Gelder, Marion E

    2014-01-01

    and NAT1 were significantly associated with a favorable PFS in multivariate analysis that included the traditional predictive factors: age, dominant relapse site, disease-free interval, ER and progesterone receptor (PGR), and adjuvant chemotherapy. This study shows that BCAR3, BCL2 and NAT1 in particular...

  13. Pengaruh Demihipo dan ZPT (Decamon® terhadap Mortalitas Telur dan Serangan Lalat Pengorok Daun, Liriomyza huidobrensis (Blanchard pada Tanaman Kentang

    Directory of Open Access Journals (Sweden)

    I Wayan Supartha

    2002-12-01

    Full Text Available Field experiment to determine the effectiveness of demihipo and Decamon® to induce the egg extrusion and reduce L. huidobrensis population larvae on potato was conducted in Pancasari, Buleleng (Bali from February to August 1999. The results indicated that application of Decamon to the plant was significantly able to increase egg-extrusion of L. huidobrensis from the leaf compared with the other treatments. While, weekly application of insecticide (demihipo was also significantly able to reduce the Larvae population on the plant. The application of the combination of both control measure (plant growth regulator or PGR and insecticide (demihipo was the most effective control to reduce the feeding or ovipositional-punctures of adult on the leaves. Therefore, the application of PGR and insecticide was the best to prevent and reduce the population development of L. huidobrensis in the field. In general, all control measures were able to increase the yield and advantage-added of the farmer. However, the highest increased of the yield and advantage-added in wet season were given by the plant treated with PGR (Decamon®, while in dry season given by the plant treated with the combination of PGR and demihipo.

  14. NCBI nr-aa BLAST: CBRC-BTAU-01-2489 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-BTAU-01-2489 ref|NP_997055.1| G protein-coupled receptor for asthma susceptibi... (G-protein coupled receptor for asthma susceptibility) (G-protein coupled receptor PGR14) gb|AAQ76966.1| GP

  15. NCBI nr-aa BLAST: CBRC-RNOR-08-0112 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-RNOR-08-0112 ref|NP_997055.1| G protein-coupled receptor for asthma susceptibi... (G-protein coupled receptor for asthma susceptibility) (G-protein coupled receptor PGR14) gb|AAQ76966.1| GP

  16. NCBI nr-aa BLAST: CBRC-RMAC-03-0034 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-RMAC-03-0034 ref|NP_997055.1| G protein-coupled receptor for asthma susceptibi... (G-protein coupled receptor for asthma susceptibility) (G-protein coupled receptor PGR14) gb|AAQ76966.1| GP

  17. NCBI nr-aa BLAST: CBRC-HSAP-07-0022 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-HSAP-07-0022 ref|NP_997055.1| G protein-coupled receptor for asthma susceptibi... (G-protein coupled receptor for asthma susceptibility) (G-protein coupled receptor PGR14) gb|AAQ76966.1| GP

  18. NCBI nr-aa BLAST: CBRC-PABE-08-0027 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-PABE-08-0027 ref|NP_997055.1| G protein-coupled receptor for asthma susceptibi... (G-protein coupled receptor for asthma susceptibility) (G-protein coupled receptor PGR14) gb|AAQ76966.1| GP

  19. NCBI nr-aa BLAST: CBRC-PTRO-08-0021 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-PTRO-08-0021 ref|NP_997055.1| G protein-coupled receptor for asthma susceptibi... (G-protein coupled receptor for asthma susceptibility) (G-protein coupled receptor PGR14) gb|AAQ76966.1| GP

  20. NCBI nr-aa BLAST: CBRC-OGAR-01-0527 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-OGAR-01-0527 ref|NP_997055.1| G protein-coupled receptor for asthma susceptibi... (G-protein coupled receptor for asthma susceptibility) (G-protein coupled receptor PGR14) gb|AAQ76966.1| GP

  1. NCBI nr-aa BLAST: CBRC-CFAM-14-0061 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-CFAM-14-0061 ref|NP_997055.1| G protein-coupled receptor for asthma susceptibi... (G-protein coupled receptor for asthma susceptibility) (G-protein coupled receptor PGR14) gb|AAQ76966.1| GP

  2. Open reading frame ssr2016 is required for antimycin A-sensitive photosystem I-driven cyclic electron flow in the cyanobacterium Synechocystis sp. PCC 6803

    NARCIS (Netherlands)

    Yeremenko, Nataliya; Jeanjean, Robert; Prommeenate, Peerada; Krasikov, Vladimir; Nixon, Peter J.; Vermaas, Wim F. J.; Havaux, Michel; Matthijs, Hans C. P.

    2005-01-01

    Open reading frame ssr2016 encodes a protein with substantial sequence similarities to PGR5 identified as a component of the antimycin A-sensitive ferredoxin:plastoquinone reductase (FQR) in PSI cyclic photophosphorylation in Arabidopsis thaliana. We studied cyclic electron flow in Synechocystis sp.

  3. Utilisation of nuclear energy and coal

    International Nuclear Information System (INIS)

    1982-01-01

    Following the views and experiences presented at an International Energy Conference held in November 1980 in Lisbon under the title ''Energy - A challenge for undertakings'', the Energy Commission of the International Chamber of Commerce has prepared a document which details the most important conclusions and makes recommendations. The costs and advantages are evaluated of nuclear energy and of coal. (P.G.R.)

  4. Responses of yield and N use of spring sown crops to N fertilization, with special reference to the use of plant growth regulators

    Directory of Open Access Journals (Sweden)

    L. PIETOLA

    2008-12-01

    Full Text Available The role of plant growth regulators (PGR in nitrogen (N fertilization of spring wheat and oats (CCC, fodder barley (etephon/mepiquat and oilseed rape (etephone in crop rotation was studied in 1993–1996 on loamy clay soil. Carry over effect of the N fertilization rates (0–180 kg ha-1 was evaluated in 1997. N fertilization rate for the best grain/seed yield (120–150 kg ha-1 was not affected by PGRs. The seed and N yields of oilseed rape were improved most frequently by recommended use of PGR. The yields of oats were increased in 1995–96. Even though PGR effectively shortened the plant height of spring wheat, the grain yield increased only in 1995. N yield of wheat grains was not increased. Response of fodder barley to PGR was insignificant or even negative in 1995. The data suggest that PGRs may decrease some N leaching at high N rates by improving N uptake by grain/seeds, if the yield is improved. The carryover study showed that in soils with no N fertilization, as well as in soils of high N rates, N uptake was higher than in soils with moderate N fertilization (60–90 kg ha-1 , independent of PGRs. According to soil mineral N contents, N leaching risk is significant (15–35 kg ha-1 only after dry and warm late seasons. After a favourable season of high yields, the N rates did not significantly affect soil mineral N contents. ;

  5. Status of sex steroid hormone receptors in large bowel cancer

    NARCIS (Netherlands)

    Meggouh, F.; Lointier, P.; Pezet, D.; Saez, S.

    1991-01-01

    To determine the potential role of sex steroid hormones in the development of colorectal tumors in humans, specific androgen (AR), estrogen (ER), and progesterone (PGR) receptors were investigated in normal mucosa (NM) and in tumor (T) paired biopsy specimens from 94 patients. Androgen receptors

  6. GRIN-Global: An International Project to Develop a Global Plant Genebank and Information Management System

    Science.gov (United States)

    Many of the world's national genebanks, responsible for the safeguarding and availability of their country's Plant Genetic Resource (PGR) collections, have lacked access to high quality IT needed to document and manage their collections electronically. The Germplasm Resource Information System (GRI...

  7. Antioxidant activity characterization, phytochemical screening, and proximate analysis of Cermela Hutan (Phyllanthus gomphocarpus Hook. F) roots and leaves.

    Science.gov (United States)

    Bahari, Ebby-Anuar; Zaaba, Nur Eleza; Haron, Norhisham; Dasiman, Razif; Amom, Zulkhairi

    2014-11-07

    Roots and leaves of the Cermela Hutan (Phyllanthus gomphocarpus Hook. F) plant were studied to determine antioxidant activity, phytochemical compounds, proportion of carbohydrate, crude protein, moisture, ash, fat, total phenolic content (TPC), and total flavonoid content (TFC). Ten percent (10%) aqueous extract from both Phyllanthus gomphocarpus roots (PGR) and leaves (PGL) were used in this study. Antioxidant activity characterization by TPC, TFC, Ferric Reducing Antioxidant Power (FRAP), 1,1-diphenyl-2-picrylhydrazyl (DPPH) scavenging activity, and phytochemical screening, as well as proximate analysis from both extracts were analyzed in this study. Phyllanthus gomphocarpus roots (PGR) and leaves (PGL) tested positive for flavonoid, saponin, tannins, and terpenoids, but PGR showed negative result for anthraquinones. In average weight of 100.0 g dry sample, the carbohydrates, protein, moisture, ash, fat, and energy content in PGR and PGL were 80.9%, 5.5%, 7.8%, 3.4%, 2.4%, and 367 Kcal/100g, and 66.5%, 14.8%, 10.7%, 6.5%, 1.5%, and 399 Kcal/100 g, respectively. Antioxidant assessments using FRAP and DPPH assay showed that PGL extracts possessed higher antioxidant capacity by reducing the ferric ion-TPTZ complex by 0.14 mg/ml ±0.0018 and higher scavenging activity, 83.83% ±0.54 as compared to PGR, 0.07 mg/ml ±0.0035 for FRAP and 62.87% ±1.33 for DPPH, respectively. The total phenolics content was significantly higher in PGL (208.77 mg GAE/g ±3.79) as compared to PGR (27.53 mg GAE/g ±0.42). However, there was no significant different in the total flavonoid contents for PGR (34.8 mg QE/g ±3.12) and PGL (32.43 mg QE/g ±3.92). Further investigations are suggested to isolate and characterize the other active constituents from this plant in combatting diseases.

  8. Biochemistry and Chemotherapy of Malaria and Leishmaniasis

    Science.gov (United States)

    1993-12-06

    ethanol plant extracts including; nutmeg (Myristicaceae sp.), ginger ( Zingiber officinale ), goldenseal root (Hydrastis canadensis), garlic (Allium...scorodoprasum (elephant garlic), Ailium sativum (garlic), Zingiber officinale ,ginger), Myristicaceae sp. (nutmeg), Hydrastis canadensis (goldenseal...They were Glycyrrhiza glabra (IC25: 6 ug protein/ml)(Fig.7), Zingiber officinale (IC25: 14 ug protein/ ml), and ethanol extracts of Myristacea sp

  9. Unigene BLAST: CBRC-ATHA-03-0010 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-ATHA-03-0010 gnl|UG|At#S11719378 Arabidopsis thaliana ATARP9 (ACTIN-RELATED PR...OTEIN 9); protein binding (ATARP9) mRNA, complete cds /cds=p(235,2025) /gb=NM_123716 /gi=30694311 /ug=At.26311 /len=2187 0.47 36% ...

  10. Decision Making on Allocating Urban Green Spaces Based upon Spatially-Varying Relationships between Urban Green Spaces and Urban Compaction Degree

    Directory of Open Access Journals (Sweden)

    Hsueh-Sheng Chang

    2015-09-01

    Full Text Available The compact city is becoming a prevailing paradigm in the world to control urban sprawl and achieve a pattern of sustainable urban development. However, discussions of the area's overcrowded neighborhoods, its health problems, and the destruction of its green areas have inspired self-examination with respect to the compact city paradigm. High population density attracts even more residents and frequently renders the existing urban green space (UGS insufficient for use as part of a living environment. Due to the unique benefits that these qualities confer, UGS allocation is now considered a significant contributing factor to urban livability. In addition, the UGS allocation may be different due to the presence of many spatial non-stationarity processes. Therefore, this study employs geographically-weighted regression (GWR to explore the unique and spatially-explicit relationships between the degree of urban compaction and UGS within the Taipei metropolitan area. Maps summarizing the GWR results demonstrate that there is significantly insufficient UGS allocation in the central area, which consists mainly of Taipei City. Townships with higher parameters contain UGS levels that better meet the needs of their residents. Overall, the exploration of conceptualizing spatial heterogeneity of relationships between the degree of urban compaction and UGS can provide insightful analyses for decision-making on allocating UGS.

  11. Unigene BLAST: CBRC-GGAL-02-0038 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-GGAL-02-0038 gnl|UG|Gga#S19184093 Gallus gallus opsin 1 (cone pigments), long-wave-sensitive (color bli...ndness, protan) (OPN1LW), mRNA /cds=p(9,1097) /gb=NM_205440 /gi=45382134 /ug=Gga.716 /len=1318 4e-30 25% ...

  12. Unigene BLAST: CBRC-GGAL-12-0011 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-GGAL-12-0011 gnl|UG|Gga#S19184022 Gallus gallus opsin 1 (cone pigments), long-wave-sensitive (color bli...ndness, protan) (OPN1LW), mRNA /cds=p(25,1080) /gb=NM_205409 /gi=45382276 /ug=Gga.786 /len=1507 5e-38 44% ...

  13. Unigene BLAST: CBRC-GGAL-26-0008 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-GGAL-26-0008 gnl|UG|Gga#S19184093 Gallus gallus opsin 1 (cone pigments), long-wave-sensitive (color bli...ndness, protan) (OPN1LW), mRNA /cds=p(9,1097) /gb=NM_205440 /gi=45382134 /ug=Gga.716 /len=1318 8e-82 44% ...

  14. Unigene BLAST: CBRC-GGAL-19-0006 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available ndness, protan) (OPN1LW), mRNA /cds=p(25,1080) /gb=NM_205409 /gi=45382276 /ug=Gga.786 /len=1507 0.0 100% ... ...CBRC-GGAL-19-0006 gnl|UG|Gga#S19184022 Gallus gallus opsin 1 (cone pigments), long-wave-sensitive (color bli

  15. Unigene BLAST: CBRC-HSAP-23-0072 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-HSAP-23-0072 gnl|UG|Hs#S1730560 Homo sapiens opsin 1 (cone pigments), medium-wave-sensitive (color blin...dness, deutan) (OPN1MW), mRNA /cds=p(1,1095) /gb=NM_000513 /gi=4503964 /ug=Hs.247787 /len=1095 0.0 100% ...

  16. Unigene BLAST: CBRC-GGAL-04-0034 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available ndness, protan) (OPN1LW), mRNA /cds=p(9,1097) /gb=NM_205440 /gi=45382134 /ug=Gga.716 /len=1318 1e-30 26% ... ...CBRC-GGAL-04-0034 gnl|UG|Gga#S19184093 Gallus gallus opsin 1 (cone pigments), long-wave-sensitive (color bli

  17. Unigene BLAST: CBRC-GGAL-06-0012 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available ndness, protan) (OPN1LW), mRNA /cds=p(25,1080) /gb=NM_205409 /gi=45382276 /ug=Gga.786 /len=1507 2e-85 49% ... ...CBRC-GGAL-06-0012 gnl|UG|Gga#S19184022 Gallus gallus opsin 1 (cone pigments), long-wave-sensitive (color bli

  18. Unigene BLAST: CBRC-GGAL-05-0037 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available ndness, protan) (OPN1LW), mRNA /cds=p(25,1080) /gb=NM_205409 /gi=45382276 /ug=Gga.786 /len=1507 4e-09 24% ... ...CBRC-GGAL-05-0037 gnl|UG|Gga#S19184022 Gallus gallus opsin 1 (cone pigments), long-wave-sensitive (color bli

  19. Unigene BLAST: CBRC-HSAP-07-0070 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-HSAP-07-0070 gnl|UG|Hs#S1730560 Homo sapiens opsin 1 (cone pigments), medium-wave-sensitive (color blin...dness, deutan) (OPN1MW), mRNA /cds=p(1,1095) /gb=NM_000513 /gi=4503964 /ug=Hs.247787 /len=1095 1e-80 43% ...

  20. Unigene BLAST: CBRC-GGAL-04-0026 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available ndness, protan) (OPN1LW), mRNA /cds=p(9,1097) /gb=NM_205440 /gi=45382134 /ug=Gga.716 /len=1318 6e-24 29% ... ...CBRC-GGAL-04-0026 gnl|UG|Gga#S19184093 Gallus gallus opsin 1 (cone pigments), long-wave-sensitive (color bli

  1. Unigene BLAST: CBRC-MMUS-20-0033 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-MMUS-20-0033 gnl|UG|Mm#S8040853 Mus musculus opsin 1 (cone pigments), short-wave-sensitive (color blind...ness, tritan) (Opn1sw), mRNA /cds=p(66,1106) /gb=NM_007538 /gi=31543369 /ug=Mm.56987 /len=2521 5e-78 42% ...

  2. Unigene BLAST: CBRC-GGAL-06-0000 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available ndness, protan) (OPN1LW), mRNA /cds=p(9,1097) /gb=NM_205440 /gi=45382134 /ug=Gga.716 /len=1318 5e-36 29% ... ...CBRC-GGAL-06-0000 gnl|UG|Gga#S19184093 Gallus gallus opsin 1 (cone pigments), long-wave-sensitive (color bli

  3. Unigene BLAST: CBRC-GGAL-03-0043 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available ndness, protan) (OPN1LW), mRNA /cds=p(9,1097) /gb=NM_205440 /gi=45382134 /ug=Gga.716 /len=1318 6e-26 26% ... ...CBRC-GGAL-03-0043 gnl|UG|Gga#S19184093 Gallus gallus opsin 1 (cone pigments), long-wave-sensitive (color bli

  4. Unigene BLAST: CBRC-HSAP-10-0031 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-HSAP-10-0031 gnl|UG|Hs#S1730560 Homo sapiens opsin 1 (cone pigments), medium-wave-sensitive (color blin...dness, deutan) (OPN1MW), mRNA /cds=p(1,1095) /gb=NM_000513 /gi=4503964 /ug=Hs.247787 /len=1095 4e-34 27% ...

  5. Unigene BLAST: CBRC-GGAL-04-0026 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available ndness, protan) (OPN1LW), mRNA /cds=p(25,1080) /gb=NM_205409 /gi=45382276 /ug=Gga.786 /len=1507 1e-25 28% ... ...CBRC-GGAL-04-0026 gnl|UG|Gga#S19184022 Gallus gallus opsin 1 (cone pigments), long-wave-sensitive (color bli

  6. Unigene BLAST: CBRC-HSAP-01-0117 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-HSAP-01-0117 gnl|UG|Hs#S1730560 Homo sapiens opsin 1 (cone pigments), medium-wave-sensitive (color blin...dness, deutan) (OPN1MW), mRNA /cds=p(1,1095) /gb=NM_000513 /gi=4503964 /ug=Hs.247787 /len=1095 9e-33 31% ...

  7. Unigene BLAST: CBRC-HSAP-07-0070 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-HSAP-07-0070 gnl|UG|Hs#S1730883 Homo sapiens opsin 1 (cone pigments), short-wave-sensitive (color blind...ness, tritan) (OPN1SW), mRNA /cds=p(8,1054) /gb=NM_001708 /gi=4502386 /ug=Hs.656404 /len=1101 0.0 100% ...

  8. Unigene BLAST: CBRC-GGAL-26-0008 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available ndness, protan) (OPN1LW), mRNA /cds=p(25,1080) /gb=NM_205409 /gi=45382276 /ug=Gga.786 /len=1507 9e-84 48% ... ...CBRC-GGAL-26-0008 gnl|UG|Gga#S19184022 Gallus gallus opsin 1 (cone pigments), long-wave-sensitive (color bli

  9. Unigene BLAST: CBRC-HSAP-23-0073 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-HSAP-23-0073 gnl|UG|Hs#S1730560 Homo sapiens opsin 1 (cone pigments), medium-wave-sensitive (color blin...dness, deutan) (OPN1MW), mRNA /cds=p(1,1095) /gb=NM_000513 /gi=4503964 /ug=Hs.247787 /len=1095 0.0 100% ...

  10. Unigene BLAST: CBRC-HSAP-10-0031 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-HSAP-10-0031 gnl|UG|Hs#S1730883 Homo sapiens opsin 1 (cone pigments), short-wave-sensitive (color blind...ness, tritan) (OPN1SW), mRNA /cds=p(8,1054) /gb=NM_001708 /gi=4502386 /ug=Hs.656404 /len=1101 1e-32 28% ...

  11. Unigene BLAST: CBRC-HSAP-23-0072 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-HSAP-23-0072 gnl|UG|Hs#S1730883 Homo sapiens opsin 1 (cone pigments), short-wave-sensitive (color blind...ness, tritan) (OPN1SW), mRNA /cds=p(8,1054) /gb=NM_001708 /gi=4502386 /ug=Hs.656404 /len=1101 1e-80 43% ...

  12. Unigene BLAST: CBRC-GGAL-03-0015 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available ndness, protan) (OPN1LW), mRNA /cds=p(25,1080) /gb=NM_205409 /gi=45382276 /ug=Gga.786 /len=1507 8e-27 32% ... ...CBRC-GGAL-03-0015 gnl|UG|Gga#S19184022 Gallus gallus opsin 1 (cone pigments), long-wave-sensitive (color bli

  13. Unigene BLAST: CBRC-GGAL-01-0052 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available ndness, protan) (OPN1LW), mRNA /cds=p(9,1097) /gb=NM_205440 /gi=45382134 /ug=Gga.716 /len=1318 5e-43 30% ... ...CBRC-GGAL-01-0052 gnl|UG|Gga#S19184093 Gallus gallus opsin 1 (cone pigments), long-wave-sensitive (color bli

  14. Unigene BLAST: CBRC-GGAL-06-0001 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available ndness, protan) (OPN1LW), mRNA /cds=p(9,1097) /gb=NM_205440 /gi=45382134 /ug=Gga.716 /len=1318 8e-21 24% ... ...CBRC-GGAL-06-0001 gnl|UG|Gga#S19184093 Gallus gallus opsin 1 (cone pigments), long-wave-sensitive (color bli

  15. Unigene BLAST: CBRC-MMUS-01-0101 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-MMUS-01-0101 gnl|UG|Mm#S8040853 Mus musculus opsin 1 (cone pigments), short-wave-sensitive (color blind...ness, tritan) (Opn1sw), mRNA /cds=p(66,1106) /gb=NM_007538 /gi=31543369 /ug=Mm.56987 /len=2521 3e-33 28% ...

  16. Unigene BLAST: CBRC-HSAP-23-0071 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-HSAP-23-0071 gnl|UG|Hs#S1730560 Homo sapiens opsin 1 (cone pigments), medium-wave-sensitive (color blin...dness, deutan) (OPN1MW), mRNA /cds=p(1,1095) /gb=NM_000513 /gi=4503964 /ug=Hs.247787 /len=1095 0.0 95% ...

  17. Unigene BLAST: CBRC-GGAL-19-0006 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available ndness, protan) (OPN1LW), mRNA /cds=p(9,1097) /gb=NM_205440 /gi=45382134 /ug=Gga.716 /len=1318 1e-87 50% ... ...CBRC-GGAL-19-0006 gnl|UG|Gga#S19184093 Gallus gallus opsin 1 (cone pigments), long-wave-sensitive (color bli

  18. Unigene BLAST: CBRC-MMUS-17-0171 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-MMUS-17-0171 gnl|UG|Mm#S8040853 Mus musculus opsin 1 (cone pigments), short-wave-sensitive (color blind...ness, tritan) (Opn1sw), mRNA /cds=p(66,1106) /gb=NM_007538 /gi=31543369 /ug=Mm.56987 /len=2521 2e-22 22% ...

  19. Unigene BLAST: CBRC-GGAL-12-0011 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available ndness, protan) (OPN1LW), mRNA /cds=p(9,1097) /gb=NM_205440 /gi=45382134 /ug=Gga.716 /len=1318 1e-32 30% ... ...CBRC-GGAL-12-0011 gnl|UG|Gga#S19184093 Gallus gallus opsin 1 (cone pigments), long-wave-sensitive (color bli

  20. Unigene BLAST: CBRC-GGAL-03-0043 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available ndness, protan) (OPN1LW), mRNA /cds=p(25,1080) /gb=NM_205409 /gi=45382276 /ug=Gga.786 /len=1507 8e-29 26% ... ...CBRC-GGAL-03-0043 gnl|UG|Gga#S19184022 Gallus gallus opsin 1 (cone pigments), long-wave-sensitive (color bli

  1. Unigene BLAST: CBRC-HSAP-04-0044 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-HSAP-04-0044 gnl|UG|Hs#S1730560 Homo sapiens opsin 1 (cone pigments), medium-wave-sensitive (color blin...dness, deutan) (OPN1MW), mRNA /cds=p(1,1095) /gb=NM_000513 /gi=4503964 /ug=Hs.247787 /len=1095 2e-34 27% ...

  2. Unigene BLAST: CBRC-HSAP-04-0044 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-HSAP-04-0044 gnl|UG|Hs#S1730883 Homo sapiens opsin 1 (cone pigments), short-wave-sensitive (color blind...ness, tritan) (OPN1SW), mRNA /cds=p(8,1054) /gb=NM_001708 /gi=4502386 /ug=Hs.656404 /len=1101 5e-23 25% ...

  3. Unigene BLAST: CBRC-GGAL-03-0047 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available ndness, protan) (OPN1LW), mRNA /cds=p(9,1097) /gb=NM_205440 /gi=45382134 /ug=Gga.716 /len=1318 3e-24 24% ... ...CBRC-GGAL-03-0047 gnl|UG|Gga#S19184093 Gallus gallus opsin 1 (cone pigments), long-wave-sensitive (color bli

  4. Hedonic pricing analysis of the influence of urban green spaces onto residential prices : the case of Leipzig, Germany

    NARCIS (Netherlands)

    Liebelt, Veronika; Bartke, Stephan; Schwarz, Nina

    2018-01-01

    In the light of global urbanization and biodiversity loss, ecosystem services provided by urban green spaces (UGS) are becoming increasingly important, not least as a recovery and recreation opportunity for citizens. The valuation of UGS is significant for urban planners, who make decisions on the

  5. Evidence for the Fundamental Difference Hypothesis or Not?: Island Constraints Revisited

    Science.gov (United States)

    Belikova, Alyona; White, Lydia

    2009-01-01

    This article examines how changes in linguistic theory affect the debate between the fundamental difference hypothesis and the access-to-Universal Grammar (UG) approach to SLA. With a focus on subjacency (Chomsky, 1973), a principle of UG that places constraints on "wh"-movement and that has frequently been taken as a test case for verifying…

  6. Unigene BLAST: CBRC-MMUS-14-0020 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-MMUS-14-0020 gnl|UG|Mm#S8040853 Mus musculus opsin 1 (cone pigments), short-wave-sensitive (color blind...ness, tritan) (Opn1sw), mRNA /cds=p(66,1106) /gb=NM_007538 /gi=31543369 /ug=Mm.56987 /len=2521 9e-37 29% ...

  7. Unigene BLAST: CBRC-HSAP-23-0073 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-HSAP-23-0073 gnl|UG|Hs#S1730883 Homo sapiens opsin 1 (cone pigments), short-wave-sensitive (color blind...ness, tritan) (OPN1SW), mRNA /cds=p(8,1054) /gb=NM_001708 /gi=4502386 /ug=Hs.656404 /len=1101 1e-80 43% ...

  8. Unigene BLAST: CBRC-MMUS-03-0073 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-MMUS-03-0073 gnl|UG|Mm#S8040853 Mus musculus opsin 1 (cone pigments), short-wave-sensitive (color blind...ness, tritan) (Opn1sw), mRNA /cds=p(66,1106) /gb=NM_007538 /gi=31543369 /ug=Mm.56987 /len=2521 2e-27 27% ...

  9. Unigene BLAST: CBRC-GGAL-03-0016 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available ndness, protan) (OPN1LW), mRNA /cds=p(25,1080) /gb=NM_205409 /gi=45382276 /ug=Gga.786 /len=1507 3e-50 34% ... ...CBRC-GGAL-03-0016 gnl|UG|Gga#S19184022 Gallus gallus opsin 1 (cone pigments), long-wave-sensitive (color bli

  10. Unigene BLAST: CBRC-MDOM-06-0030 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available ed neurotrophic factor (BDNF), mRNA /cds=p(1,786) /gb=XM_001368353 /gi=126332213 /ug=Mdm.339 /len=786 0.026 33% ... ...CBRC-MDOM-06-0030 gnl|UG|Mdm#S37377868 PREDICTED: Monodelphis domestica brain-deriv

  11. Blood Lead Levels And Potental Environmental Exposures Among ...

    African Journals Online (AJOL)

    p = 0.439). Low risk parental occupation (p = 0.001) and. Kales sourced from the market/kiosks (p = 0.001) were significantly associated with BLL ≥ 10ug/dl. Soil lead levels (Soil Pb) ranged from 3,000 to 90,000ug/kg, which was very high ...

  12. Geomechanical Assessments of Simultaneous Operation in the Case of Transition from Open Pit to Underground Mine in Vietnam

    Science.gov (United States)

    Niedbalski, Zbigniew; Nguyen, Phu Minh Vuong; Widzyk-Capehart, Eleonora

    2018-03-01

    Nowadays, for a number of reasons, many open pit mines are considering a transition from Open Pit (OP) to Underground (UG) to remain competitive. In OP-UG transition, UG operation is operated simultaneously with the OP operation for a certain period of time. Guidelines for the simultaneous operation of OP and UG are very difficult to establish, as there are very few case studies available. Yet, because of the OP-UG interactions; the operation has a higher safety, technical and management requirements than the OP or UG methods when considered separately. In Vietnam, Cao Son is one of many OP mines, which decided to change the operational system from OP to UG. Simultaneous operation started in 2015 and will be conducted until 2030 when the OP mine Cao Son ends its mining activities. In this paper, selected geomechanical considerations of the simultaneous operation are presented. A number of numerical modelling calculations using finitedifference software with code FLAC were carried out for calibration process, slope stability analysis and the OP-UG interaction analysis for the Cao Son - Khe Cham II-IV mine. Based on the results obtained from numerical modelling, the geomechanical assessments of simultaneous operation Cao Son - Khe Cham II-IV are discussed in this paper.

  13. Characterization of oils from Duranta repens leaf and seed

    Directory of Open Access Journals (Sweden)

    Agomuo Emmanuel

    2017-11-01

    Full Text Available The knowledge of the chemical composition of unpopular sources of edible oils has become paramount to supplement the usage of widely known vegetable oils. In this study, the gas chromatographic quantification of fatty acids and phytochemicals was carried out, and the physicochemical and micronutrient composition of Duranta repens leaf and seed oil were evaluated using standard methods. The leaf oils contained significantly higher (p  oleic > myristic > stearic > capric > linoleic > lauric > palmitoleic for the seed oil, while for the leaf oil linoleic > palmitoleic > oleic > stearic > palmitic > myristic > capric > lauric > myristoleic. The major phytochemical constituents of the seed oils were catechin (68.12 ug/ml, saponin (44.03 ug/ml, rutin (32.89 ug/ml, linamarin (22.66 ug/ml and tannins (19.62 ug/ml, while kaempherol (84.05 ug/ml, rutin (62.26 ug/ml and saponins (45.63 ug/ml were mostly predominant in the leaf oil. Spartein, anthocyanins and phytates were among the least phytochemicals in composition, for both samples. These chemical properties evaluated, suggest that Duranta repens seed oil is more suitable for industrial and therapeutic purposes.

  14. Unigene BLAST: CBRC-TGUT-37-0238 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available egment Chr 11 Brigham & Women's Genetics 0434 expressed variant 2-like mRNA, complete sequence /gb=DQ215253 /gi=76158658 /ug=Tgu.7189 /len=654 1.4 27% ... ...CBRC-TGUT-37-0238 gnl|UG|Tgu#S33942003 Taeniopygia guttata clone 0058P0013A02 DNA s

  15. Biodiversity in the city: key challenges for urban green space management

    Science.gov (United States)

    Myla F.J. Aronson; Christopher A. Lepczyk; Karl L. Evans; Mark A. Goddard; Susannah B. Lerman; J. Scott MacIvor; Charles H. Nilon; Timothy. Vargo

    2017-01-01

    Cities play important roles in the conservation of global biodiversity, particularly through the planning and management of urban green spaces (UGS). However, UGS management is subject to a complex assortment of interacting social, cultural, and economic factors, including governance, economics, social networks, multiple stakeholders, individual preferences, and social...

  16. report general | 1-Overview | 5-Publications | Indian Academy of ...

    Indian Academy of Sciences (India)

    In this process, the advantages offered by distance education methods should also be exploited. ... The U.G. course should be solid and broad based, providing a good ... Thus all U.G. students should take some common courses in physics, ...

  17. Unigene BLAST: CBRC-TGUT-29-0000 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-TGUT-29-0000 gnl|UG|Tgu#S36163076 Taeniopygia guttata clone 0057P0006B02 megalencephalic leukoencephalo...pathy with subcortical cysts 1-like mRNA, complete sequence /gb=EF191703 /gi=120431699 /ug=Tgu.3485 /len=1532 1.8 21% ...

  18. Unigene BLAST: CBRC-CFAM-23-0020 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-CFAM-23-0020 gnl|UG|Cfa#S19198630 ip04e12.g1 Brain - Cerebellum Library (DOGEST8) Canis familiaris cDNA clone ip04e12, mRNA sequence /clone=ip04e12 /gb=CN002408 /gi=45766087 /ug=Cfa.29570 /len=708 8e-08 38% ...

  19. Unigene BLAST: CBRC-CFAM-28-0014 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-CFAM-28-0014 gnl|UG|Cfa#S19200361 ip42h12.b1 Brain - Cerebellum Library (DOGEST8) Canis familiaris cDNA clone ip42h12, mRNA sequence /clone=ip42h12 /gb=CK995838 /gi=45759518 /ug=Cfa.10205 /len=413 4e-05 37% ...

  20. Unigene BLAST: CBRC-CFAM-35-0003 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-CFAM-35-0003 gnl|UG|Cfa#S19200945 ip12b05.b1 Brain - Cerebellum Library (DOGEST8) Canis familiaris cDNA clone ip12b05, mRNA sequence /clone=ip12b05 /gb=CK996905 /gi=45760585 /ug=Cfa.32635 /len=996 1.5 24% ...

  1. Unigene BLAST: CBRC-CFAM-33-0021 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-CFAM-33-0021 gnl|UG|Cfa#S19197038 ip37b10.b1 Brain - Cerebellum Library (DOGEST8) Canis familiaris cDNA clone ip37b10, mRNA sequence /clone=ip37b10 /gb=CK998901 /gi=45762581 /ug=Cfa.4074 /len=820 2e-18 79% ...

  2. Unigene BLAST: CBRC-CFAM-01-0041 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-CFAM-01-0041 gnl|UG|Cfa#S19200707 ip06d09.b1 Brain - Cerebellum Library (DOGEST8) Canis familiaris cDNA clone ip06d09, mRNA sequence /clone=ip06d09 /gb=CK996471 /gi=45760151 /ug=Cfa.45094 /len=754 7e-17 70% ...

  3. Unigene BLAST: CBRC-ATHA-05-0034 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-ATHA-05-0034 gnl|UG|At#S11736431 Arabidopsis thaliana ATMPK19 (Arabidopsis tha...liana MAP kinase 19); MAP kinase (ATMPK19) mRNA, complete cds /cds=p(1,1761) /gb=NM_112333 /gi=30683276 /ug=At.8069 /len=1897 6.9 42% ...

  4. Unigene BLAST: CBRC-FRUB-02-0691 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-FRUB-02-0691 gnl|UG|Tru#S21434263 AL836416 EFRd Takifugu rubripes cDNA clone EFRd031apc...G19, mRNA sequence /clone=EFRd031apcG19 /gb=AL836416 /gi=21878378 /ug=Tru.2410 /len=418 0.24 31% ...

  5. Unigene BLAST: CBRC-FRUB-02-0424 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-FRUB-02-0424 gnl|UG|Tru#S21433401 AL835449 EFRb Takifugu rubripes cDNA clone EFRb017apc...D5, mRNA sequence /clone=EFRb017apcD5 /gb=AL835449 /gi=21877411 /ug=Tru.1107 /len=522 8.4 39% ...

  6. Unigene BLAST: CBRC-FRUB-02-0750 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-FRUB-02-0750 gnl|UG|Tru#S21434499 AL836465 EFRd Takifugu rubripes cDNA clone EFRd031apc...H15, mRNA sequence /clone=EFRd031apcH15 /gb=AL836465 /gi=21878427 /ug=Tru.81 /len=452 1.9 26% ...

  7. Unigene BLAST: CBRC-FRUB-02-0743 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-FRUB-02-0743 gnl|UG|Tru#S21434499 AL836465 EFRd Takifugu rubripes cDNA clone EFRd031apc...H15, mRNA sequence /clone=EFRd031apcH15 /gb=AL836465 /gi=21878427 /ug=Tru.81 /len=452 1.4 26% ...

  8. Unigene BLAST: CBRC-FRUB-02-0642 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-FRUB-02-0642 gnl|UG|Tru#S21434581 AL836626 EFRe Takifugu rubripes cDNA clone EFRe005apc...A11, mRNA sequence /clone=EFRe005apcA11 /gb=AL836626 /gi=21878588 /ug=Tru.118 /len=378 3.6 33% ...

  9. Unigene BLAST: CBRC-FRUB-02-0924 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-FRUB-02-0924 gnl|UG|Tru#S21434557 AL836584 EFRe Takifugu rubripes cDNA clone EFRe005apc...K15, mRNA sequence /clone=EFRe005apcK15 /gb=AL836584 /gi=21878546 /ug=Tru.1833 /len=509 7.4 31% ...

  10. Unigene BLAST: CBRC-FRUB-02-0627 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-FRUB-02-0627 gnl|UG|Tru#S21434842 AL836687 EFRe Takifugu rubripes cDNA clone EFRe005apc...N22, mRNA sequence /clone=EFRe005apcN22 /gb=AL836687 /gi=21878649 /ug=Tru.3747 /len=363 1.4 48% ...

  11. Unigene BLAST: CBRC-FRUB-02-0118 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-FRUB-02-0118 gnl|UG|Tru#S21435395 AL837361 EFRh Takifugu rubripes cDNA clone EFRh101apc...A11, mRNA sequence /clone=EFRh101apcA11 /gb=AL837361 /gi=21879323 /ug=Tru.2111 /len=407 2.4 33% ...

  12. Unigene BLAST: CBRC-FRUB-02-0587 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-FRUB-02-0587 gnl|UG|Tru#S21435116 AL837106 EFRf Takifugu rubripes cDNA clone EFRf030apc...H13, mRNA sequence /clone=EFRf030apcH13 /gb=AL837106 /gi=21879068 /ug=Tru.387 /len=294 4.9 35% ...

  13. Unigene BLAST: CBRC-FRUB-02-0677 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-FRUB-02-0677 gnl|UG|Tru#S21435495 AL837483 EFRj Takifugu rubripes cDNA clone EFRj028apc...P21, mRNA sequence /clone=EFRj028apcP21 /gb=AL837483 /gi=21879445 /ug=Tru.1777 /len=323 7.9 50% ...

  14. Unigene BLAST: CBRC-FRUB-02-0784 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-FRUB-02-0784 gnl|UG|Tru#S21434499 AL836465 EFRd Takifugu rubripes cDNA clone EFRd031apc...H15, mRNA sequence /clone=EFRd031apcH15 /gb=AL836465 /gi=21878427 /ug=Tru.81 /len=452 2.0 26% ...

  15. Unigene BLAST: CBRC-FRUB-02-0299 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-FRUB-02-0299 gnl|UG|Tru#S21434159 AL836234 EFRd Takifugu rubripes cDNA clone EFRd007apc...O23, mRNA sequence /clone=EFRd007apcO23 /gb=AL836234 /gi=21878196 /ug=Tru.1814 /len=463 0.63 32% ...

  16. Unigene BLAST: CBRC-FRUB-02-0473 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-FRUB-02-0473 gnl|UG|Tru#S21435395 AL837361 EFRh Takifugu rubripes cDNA clone EFRh101apc...A11, mRNA sequence /clone=EFRh101apcA11 /gb=AL837361 /gi=21879323 /ug=Tru.2111 /len=407 0.47 28% ...

  17. Unigene BLAST: CBRC-FRUB-02-0104 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-FRUB-02-0104 gnl|UG|Tru#S21435233 AL837260 EFRg Takifugu rubripes cDNA clone EFRg101apc...H6, mRNA sequence /clone=EFRg101apcH6 /gb=AL837260 /gi=21879222 /ug=Tru.2053 /len=465 3.3 30% ...

  18. Unigene BLAST: CBRC-FRUB-02-0391 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-FRUB-02-0391 gnl|UG|Tru#S21434264 AL836417 EFRd Takifugu rubripes cDNA clone EFRd031apc...K15, mRNA sequence /clone=EFRd031apcK15 /gb=AL836417 /gi=21878379 /ug=Tru.1810 /len=428 0.75 34% ...

  19. Unigene BLAST: CBRC-FRUB-02-0702 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-FRUB-02-0702 gnl|UG|Tru#S21434160 AL836235 EFRd Takifugu rubripes cDNA clone EFRd007apc...K11, mRNA sequence /clone=EFRd007apcK11 /gb=AL836235 /gi=21878197 /ug=Tru.2312 /len=411 6.4 28% ...

  20. Pramana – Journal of Physics | News

    Indian Academy of Sciences (India)

    A novel pedagogical technique is presented that can be used in the undergraduate (UG) class to formulate a relativistically extended kinetic theory of gases and thermal speed distribution, while assuming the basic thermal symmetry arguments of the famous Maxwell–Boltzmann distribution as presented at the UG level.

  1. A new multiplicity formula for the Weyl modules of type A

    International Nuclear Information System (INIS)

    Ye Jiachen; Zhou Zhongguo

    2003-08-01

    A monomial basis and a filtration of subalgebras for the universal enveloping algebra U(g) of a complex simple Lie algebra g l of type A I is given in this note. In particular, a new multiplicity formula for the Weyl module V(λ) of U(g l ) is obtained in this note. (author)

  2. The polygenic risk for bipolar disorder influences brain regional function relating to visual and default state processing of emotional information.

    Science.gov (United States)

    Dima, Danai; de Jong, Simone; Breen, Gerome; Frangou, Sophia

    2016-01-01

    Genome-wise association studies have identified a number of common single-nucleotide polymorphisms (SNPs), each of small effect, associated with risk to bipolar disorder (BD). Several risk-conferring SNPs have been individually shown to influence regional brain activation thus linking genetic risk for BD to altered brain function. The current study examined whether the polygenic risk score method, which models the cumulative load of all known risk-conferring SNPs, may be useful in the identification of brain regions whose function may be related to the polygenic architecture of BD. We calculated the individual polygenic risk score for BD (PGR-BD) in forty-one patients with the disorder, twenty-five unaffected first-degree relatives and forty-six unrelated healthy controls using the most recent Psychiatric Genomics Consortium data. Functional magnetic resonance imaging was used to define task-related brain activation patterns in response to facial affect and working memory processing. We found significant effects of the PGR-BD score on task-related activation irrespective of diagnostic group. There was a negative association between the PGR-BD score and activation in the visual association cortex during facial affect processing. In contrast, the PGR-BD score was associated with failure to deactivate the ventromedial prefrontal region of the default mode network during working memory processing. These results are consistent with the threshold-liability model of BD, and demonstrate the usefulness of the PGR-BD score in identifying brain functional alternations associated with vulnerability to BD. Additionally, our findings suggest that the polygenic architecture of BD is not regionally confined but impacts on the task-dependent recruitment of multiple brain regions.

  3. Optimization of extraction parameters for recovery of a-amylase from the fermented bran of Bacillus circulans GRS313

    Directory of Open Access Journals (Sweden)

    Palit Soumen

    2001-01-01

    Full Text Available The extraction of alpha-amylase in the solid state fermentation of wheat bran by Bacillus circulans GRS313 was optimized. Among various solvents tested, maximum extraction was achieved when 2.5% (v/v glycerol was added. The optimum conditions for extraction were 2.5 hrs soaking time at 30° C under recirculation and agitated condition, which yielded 590 U/g bran of enzyme activity. Whereas under stationary soaking condition the activity of the enzyme was 439.58U/g bran. With repeated wash under the above optimum conditions showed that 600 U/g and 184.2 U/g of enzyme extracted in the 1st and 2nd washes respectively and only 36.84 U/g was recovered in the 3rd wash

  4. The Development of Theory of Mind and Positive and Negative Reciprocity in Preschool Children.

    Science.gov (United States)

    Schug, Joanna; Takagishi, Haruto; Benech, Catalina; Okada, Hiroyuki

    2016-01-01

    This study examined the relation between the acquisition of false-beliefs theory of mind (ToM) and reciprocity in preschoolers. Preschool-aged children completed a task assessing the understanding of false beliefs, and played an Ultimatum Game (UG) with another child in a face-to-face setting. Negative reciprocity was assessed by examining the rejection of unfair offers made by another child in the UG, while positive reciprocity was assessed by examining allocations made by participants in a Dictator Game (DG) following the UG. The results indicated that children who had passed a task assessing first-order false beliefs were more likely to make generous offers in a DG following a fair offer made by their partner in a proceeding UG, but that false beliefs ToM was unrelated to the rejection of unfair offers in the UG.

  5. Nutrient uptake by intact mycorrhizal Pinus sylvestris seedlings: a diagnostic tool to detect copper toxicity.

    Science.gov (United States)

    Van Tichelen, Katia K.; Vanstraelen, Tom; Colpaert, Jan V.

    1999-03-01

    We developed a nondestructive method for detecting early toxic effects of inflethal copper (Cu) concentrations on ectomycorrhizal and non-mycorrhizal (NM) Scots pine (Pinus sylvestris L.) seedlings. The fungal symbionts examined were Paxillus involutus (Fr.) Fr., Suillus luteus (Fr.) S.F. Gray and Thelephora terrestris (Ehrh.) Fr. The accumulation of Cu in needles and fungal development (ergosterol) in roots and infstrate were assessed. Inorganic phosphate (P(i)) and ammonium (NH(4) (+)) uptake capacities were determined in a semi-hydroponic cultivation system on intact P-limited plants that were exposed for 3 weeks to 0.32 (control), 8 or 16 &mgr;moles Cu(2+). Short-term effects of a 1-hour exposure to 32 &mgr;moles Cu(2+) on nutrient uptake rates were also determined. None of the Cu(2+) treatments affected plant growth or root ergosterol concentrations. The active fungal biomass in infstrate invaded by S. luteus was reduced by 50% in the 16 &mgr;M Cu(2+) treatment compared with the control treatment; however, colonization by S. luteus prevented an increased accumulation of Cu in the needles. In contrast, the 16 &mgr;M Cu(2+) treatment caused a 2.2-fold increase in needle Cu concentration in NM plants. Ergosterol concentrations in the infstrate colonized by P. involutus and T. terrestris were not affected by 16 &mgr;molar Cu(2+). Although P. involutus and T. terrestris were less sensitive to Cu(2+) than S. luteus, T. terrestris did not prevent the accumulation of Cu in needles of its host plant in the 16 &mgr;molar Cu(2+) treatment. Mycorrhizal plants consistently had higher P(i) and NH(4) (+) uptake capacities than NM plants. In the control treatment, specific P(i) uptake rates were almost 10, 4 and 3 times higher in plants associated with P. involutus, S. luteus and T. terrestris, respectively, than in NM plants, and specific NH(4) (+) uptake rates were about 2, 2 and 5 times higher, respectively, than those of NM seedlings. Compared with the corresponding

  6. Concentraciones de yodo en orina y en sal de consumo en mujeres entre 12 a 49 años del Perú

    Directory of Open Access Journals (Sweden)

    Carolina Tarqui-Mamani

    Full Text Available Objetivos. Determinar las concentraciones de yodo en orina y sal de consumo en mujeres entre 12 a 49 años en Perú. Materiales y métodos. Se realizó un estudio observacional y transversal. Durante el 2012 y 2013, se incluyó mujeres entre 12 a 49 años residentes en los hogares peruanos seleccionadas mediante un muestreo probabilístico, estratificado y multietápico. La determinación de yodo en orina se realizó por espectrofotometría basada en la reacción de Sandell-Kolthoff. La evaluación cualitativa de yodo en sal se realizó por yoditest y la cuantitativa por volumetría. El procesamiento se realizó mediante muestras complejas con ponderaciones. Se obtuvo medianas, rango intercuartílico y percentiles. Resultados. La mediana de yoduria en las participantes fue 250,4 ug/L; los departamentos con medianas de yoduria elevadas fueron: Moquegua (389,3 ug/L; Tacna (320,5 ug/L; Madre de Dios (319,8 ug/L, y Ucayali (306,0 ug/L; mientras que Puno (192,9 ug/L; Piura (188,1 ug/L y Tumbes (180,5 ug/L tuvieron medianas dentro de lo recomendado por la OMS. La mediana de yoduria en gestantes fue 274,6 ug/L (RIQ: 283 ug/L. El 82,5% de las muestras de sal tuvieron yodo ≥30 ppm y 1,9% tuvo valores de 0 ppm. Conclusiones. La mediana de yoduria en las mujeres peruanas está por encima de lo recomendado por la OMS y la mayoría de las muestras de sal tuvieron concentraciones adecuadas de yodo según la OMS

  7. Ugonin U stimulates NLRP3 inflammasome activation and enhances inflammasome-mediated pathogen clearance

    Directory of Open Access Journals (Sweden)

    Chun-Yu Chen

    2017-04-01

    Full Text Available The NOD-like receptor pyrin domain 3 (NLRP3 inflammasome contains Nod-like receptors, a subclass of pattern recognition receptors, suggesting that this complex has a prominent role in host defenses. Various structurally diverse stimulators activate the NLRP3 inflammasome through different signaling pathways. We previously reported that ugonin U (UgU, a natural flavonoid isolated from Helminthostachys zeylanica (L Hook, directly stimulates phospholipase C (PLC and triggers superoxide release in human neutrophils. In the present study, we showed that UgU induced NLRP3 inflammasome assembly and subsequent caspase-1 and interleukin (IL-1β processing in lipopolysaccharide-primed human monocytes. Moreover, UgU elicited mitochondrial superoxide generation in a dose-dependent manner, and a specific scavenger of mitochondrial reactive oxygen species (ROS diminished UgU-induced IL-1β and caspase-1 activation. UgU induced Ca2+ mobilization, which was inhibited by treatment with inhibitors of PLC or inositol triphosphate receptor (IP3R. Blocking Ca2+ mobilization, PLC, or IP3R diminished UgU-induced IL-1β release, caspase-1 activation, and mitochondrial ROS generation. These data demonstrated that UgU activated the NLPR3 inflammasome activation through Ca2+ mobilization and the production of mitochondrial ROS. We also demonstrated that UgU-dependent NLRP3 inflammasome activation enhanced the bactericidal function of human monocytes. The ability of UgU to stimulate human neutrophils and monocytes, both of which are professional phagocytes, and its capacity to activate the NLRP3 inflammasome, which is a promising molecular target for developing anti-infective medicine, indicate that UgU treatment should be considered as a possible novel therapy for treating infectious diseases.

  8. SUSCEPTIBILIDAD ANTIMICROBIANA DE AISLAMIENTOS DE Salmonella enterica PROVENIENTES DE PISOS, EQUIPOS, UTENSILIOS Y PRODUCTO TERMINADO EN PLANTAS DE BENEFICIO PORCINO EN COLOMBIA

    Directory of Open Access Journals (Sweden)

    P. M. Bermúdez

    2016-01-01

    Full Text Available La diseminación de Salmonella spp. resistente a antimicrobianos en las cadenas productivas de alimentos de origen animal es una preocupación de salud pública de carácter mundial. Este estudio describe los patrones de resistencia antimicrobiana de 283 aislamientos de Salmonella enterica procedentes de plantas de beneficio porcino en Colombia. Se evaluó la susceptibilidad antimicrobiana frente a diez antimicrobianos mediante el método de difusión en disco: amoxacilina-ácido clavulánico (30 ug, ampicilina (10 ug, ceftiofur (30 ug, ciprofloxacina (5 ug, cloranfenicol (30 ug, florfenicol (30 ug, gentamicina (10 ug, sulfadiazina/trimetroprim (25 ug, tetraciclina (30 ug y tilmicosina (15 ug. Los resultados evidenciaron la presencia de 279 aislamientos multirresistentes de Salmonella enterica de origen porcino provenientes del ambiente y del producto terminado en las plantas de beneficio evaluadas (46,64% n: 132. Se detectaron 52 patrones de multiresistencia: el más común fue ceftiofur-tetraciclina-tilmicosina en el 9,89% (n: 28 de los aislamientos. Con referencia a estos antimicrobianos, 96,82% (n: 274 de los aislamientos fueron resistentes a tetraciclina, 73,14% (n: 207 a tilmicosina y 28,27% (n: 80 a ceftiofur. De especial interés fue la alta proporción de aislamientos resistentes a ceftiofur, debido a una posible resistencia cruzada con ceftriaxona. Los resultados obtenidos demuestran la necesidad de promover el diseño e implementación de un Programa oficial Integrado de Vigilancia de la Resistencia Antimicrobiana, además de sistemas de monitoreo voluntario en cada eslabón de la cadena productiva porcina, para contribuir a la prevención y control de la transmisión de microorganismos resistentes de origen alimentario en el marco del sistema de gestión de inocuidad alimentaria en Colombia.

  9. Crystal Structure and Magnetic Behavior of Two New Dinuclear Carbonato-Bridged Copper(II) Compounds. Superexchange Pathway for the Different Coordination Modes of the Carbonato Bridge in Polynuclear Copper(II) Compounds.

    Science.gov (United States)

    Escuer, Albert; Mautner, Franz A.; Peñalba, Evaristo; Vicente, Ramon

    1998-08-24

    Four new &mgr;-CO(3)(2-) copper(II) complexes with different coordination modes for the carbonato bridge have been obtained by fixation of atmospheric CO(2): {(&mgr;(3)-CO(3))[Cu(3)(ClO(4))(3)(Et(3)dien)(3)]}(ClO(4)) (1), Et(3)dien = N,N',N"-triethylbis(2-aminoethane)amine; {(&mgr;-CO(3))[Cu(2)(H(2)O)(Et(4)dien)(2)]}(ClO(4))(2).H(2)O (2), Et(4)dien = N,N,N",N"-tetraethyl-bis(2-aminoethane)amine; {(&mgr;-CO(3))[Cu(2)(H(2)O)(2)(EtMe(4)dien)(2)]} (ClO(4))(2).2H(2)O (3), EtMe(4)dien = N'-ethyl-N,N,N",N"-tetramethylbis(2-aminoethane)amine; and {(&mgr;-CO(3))[Cu(2)(H(2)O)(Me(5)dien)(2)]}(ClO(4))(2).H(2)O (4), Me(5)dien = N,N,N',N",N"-pentamethylbis(2-aminoethane)amine. The crystal structures have been solved for 2, monoclinic system, space group P2(1)/n, formula [C(25)H(62)Cl(2)Cu(2)N(6)O(13)] with a = 12.763(6) Å, b = 25.125(8) Å, c = 13.261(4) Å, beta = 111.85(3) degrees, Z = 4, and for 3, triclinic system, space group P&onemacr;, formula [C(21)H(58)Cl(2)Cu(2)N(6)O(15)] with a = 8.412(3) Å, b = 14.667(4) Å, c = 16.555(5) Å, alpha = 99.66(2) degrees, beta = 102.14(2) degrees, gamma = 104.72(2) degrees, Z = 2. Susceptibility measurements show ferromagnetic behavior (J = +6.7(6) cm(-)(1)) for the trinuclear compound 1 whereas 2-4 are antiferromagnetically coupled with J = -17.8(8), -125.5(9), and -21.2(3) cm(-)(1) respectively. Certain synthetic aspects that may be related to the nuclearity of the copper(II) &mgr;-CO(3)(2-) compounds and the superexchange pathway for the different coordination modes of the carbonato bridge are discussed.

  10. Regional tectonic framework of the Pranhita Godavari basin, India

    Science.gov (United States)

    Biswas, S. K.

    2003-03-01

    The Pranhita-Godavari Gondwana rift (PGR) has a co-genetic relationship with Permo-Triassic reactivation of the Narmada-Son Geofracture (NSG). The Satpura Gondwana basin represents the terminal depocentre against the NSG, which restricted the northwestward propagation of the PGR. The NE-SW tensional stress responsible for the NW-SE trending PGR could not propagate beyond the ramp formed by uplift along the NSG and transformed kinetically into an ENE directed horizontal shear along the NSG, inducing large scale strike-slip movements. The latter dynamics were responsible for ENE extension of the Satpura rift as a pull-apart basin. The PGR extends up to the present east coast of India, where it is apparently terminated by the NE-SW trending Bapatla ridge along the Eastern Ghat Rift (EGR). The subsurface data, however, shows that the PGR extends across the Bapatla ridge and continues beneath the Cretaceous-Tertiary sediments of the Krishna-Godavari basin (KG) in the EGR. Thus, the Permo-Triassic PGR appears to have continued in the Indo-Antarctic plate before the Cretaceous break up. The EGR, during break up of the continents, cuts across the PGR and the KG basin was superimposed on it. The PGR site is located on a paleo-suture between the Dharwar and Bastar proto-cratons. The master faults developed bordering the rift, and the intra-rift higher order faults followed the pre-existing fabric. The transverse transfer zones manifested as basement ridges, divide the rift into segments of tectono-sedimentary domains. The major domains are the Chintalapudi, Godavari, and Chandrapur sub-basins, each of which subsided differentially. The central Godavari sub-basin subsided most and shows maximum structural complexity and sediment accommodation. The rifting started with initial half-graben faulting along the northeastern master fault and expanded by successive half graben faulting. This gave rise to intra-basinal horsts and grabens, which exercised control on the syn

  11. Simultaneous determination of sulphaquinoxaline and amprolium in veterinary mixture by HPLC and first derivative ultraviolet spectrophotometry

    International Nuclear Information System (INIS)

    El-Sattar, Osama Abd

    2002-01-01

    Two simple and reliable methods are described for the determination of sulphaquinoxaline (SQX) and amprolium (AMP) combined in veterinary powder. The first method depends on high performance liquid chromatography on a reversed phase column (Bondapak-C18) using mobile phase consisting of acetonitrile-methanol-water-phosphoric acid (30: 5: 55: 0.7, by volumes) at a flow rate of 1 ml min with UV detection at 254 nm. The detection limits were 0.2 ug ml and 0.35 ug ml and linearity ranges were 2-20 ug ml and 4-40ug ml for SQX and AMP, respectively. The second one deals with the first derivative (D) spectrophotometry with zero-crossing measurement at 253 nm and 226 nm for SQX and AMP respectively. The detection limits were 0.3 ug ml and linearity ranges were 1-18 ug ml and 4-32 ug-ml for SQX and AMP respectively. The proposed procedures were successfully applied to the determination of these drugs in laboratory prepared mixtures with mean percentage recovery ranged from 98.50 to 99.75 and in commercial preparation ranged from 103.85 to 104.85. (author)

  12. Mineralogic sources of metals in leachates from the weathering of sedex, massive sulfide, and vein deposit mining wastes

    Science.gov (United States)

    Diehl, S.F.; Hageman, P.L.; Seal, R.R.; Piatak, N.M.; Lowers, H.

    2011-01-01

    Weathered mine waste consists of oxidized primary minerals and chemically unstable secondary phases that can be sources of readily soluble metals and acid rock drainage. Elevated concentrations of metals such as Cd, Cu, Fe, Mn, Ni, Pb, and Zn are observed in deionized water-based leachate solutions derived from complex sedex and Cu-Pb-Zn mine wastes. Leachate (USGS FLT) from the Elizabeth mine, a massive sulfide deposit, has a pH of 3.4 and high concentrations of Al (16700 ug/L), Cu (440 ug/L), and Zn (8620 ug/L). Leachate from the sedex Faro mine has a pH of 3.5 and high concentrations of Al (2040 ug/L), Cu (1930 ug/L), Pb (2080 ug/L), and Zn (52900 ug/L). In contrast, higher-pH leachates produced from tailings of polymetallic vein deposits have order of magnitude lower metal concentrations. These data indicate that highly soluble secondary mineral phases exist at the surface of waste material where the samples were collected. Sulfide minerals from all sites exhibit differential degrees of weathering, from dissolution etched grain rims, to rinds of secondary minerals, to skeletal remnants. These microscale mineral-dissolution textures enhance weathering and metal teachability of waste material. Besides the formation of secondary minerals, sulfide grains from dried tailings samples may be coated by amorphous Fe-Al-Si minerals that also adsorb metals such as Cu, Ni, and Zn.

  13. Power to punish norm violations affects the neural processes of fairness-related decision making

    Directory of Open Access Journals (Sweden)

    Xuemei eCheng

    2015-12-01

    Full Text Available Punishing norm violations is considered an important motive during rejection of unfair offers in the Ultimatum Game (UG. The present study investigates the impact of the power to punish norm violations on people’s responses to unfairness and associated neural correlates. In the UG condition participants had the power to punish norm violations, while an alternate condition, the Impunity Game (IG, was presented where participants had no power to punish norm violations since rejection only reduced the responder’s income to zero. Results showed that unfair offers were rejected more often in UG compared to IG. At the neural level, anterior insula and dorsal anterior cingulate cortex were more active when participants received and rejected unfair offers in both UG and IG. Moreover, greater dorsolateral prefrontal cortex activity was observed when participants rejected than accepted unfair offers in UG but not in IG. Ventromedial prefrontal cortex activation was higher in UG than IG when unfair offers were accepted as well as when rejecting unfair offers in IG as opposed to UG. Taken together, our results demonstrate that the power to punish norm violations affects not only people’s behavioral responses to unfairness but also the neural correlates of the fairness-related social decision-making process.

  14. PHASE BEHAVIOR OF LIGHT GASES IN HYDROCARBON AND AQUEOUS SOLVENTS

    Energy Technology Data Exchange (ETDEWEB)

    KHALED A.M. GASEM; ROBERT L. ROBINSON, JR.

    1998-08-31

    Under previous support from the Department of Energy, an experimental facility has been established and operated to measure valuable vapor-liquid equilibrium data for systems of interest in the production and processing of coal fluids. To facilitate the development and testing of models for prediction of the phase behavior for such systems, we have acquired substantial amounts of data on the equilibrium phase compositions for binary mixtures of heavy hydrocarbon solvents with a variety of supercritical solutes, including hydrogen, methane, ethane, carbon monoxide, and carbon dioxide. The present project focuses on measuring the phase behavior of light gases and water in Fischer-Tropsch (F-T) type solvents at conditions encountered in indirect liquefaction processes and evaluating and developing theoretically-based correlating frameworks to predict the phase behavior of such systems. Specific goals of the proposed work include (a) developing a state-of-the-art experimental facility to permit highly accurate measurements of equilibrium phase compositions (solubilities) of challenging F-T systems, (b) measuring these properties for systematically-selected binary, ternary and molten F-T wax mixtures to provide critically needed input data for correlation development, (c) developing and testing models suitable for describing the phase behavior of such mixtures, and (d) presenting the modeling results in generalized, practical formats suitable for use in process engineering calculations. During the present period, the Park-Gasem-Robinson (PGR) equation of state (EOS) has been modified to improve its volumetric and equilibrium predictions. Specifically, the attractive term of the PGR equation was modified to enhance the flexibility of the model, and a new expression was developed for the temperature dependence of the attractive term in this segment-segment interaction model. The predictive capability of the modified PGR EOS for vapor pressure, and saturated liquid and

  15. Urinary continence following repair of intermediate and high urogenital sinus in CAH. Experience with 55 cases.

    Directory of Open Access Journals (Sweden)

    Maria Marcela Bailez

    2014-07-01

    Full Text Available Aim :Evaluate postoperative urinary continence in patients withcongenital adrenal hyperplasia(CAHwith intermediate (ITand high urogenital sinus (UGS who underwent a UGS mobilization maneuver .Methods: We called IT to those that although needing an aggressive dissection to get to the vagina, still have enough urethra proximal to the vaginal confluence. Very low variants are excluded from this analysis. Dissection always started in the posterior wall of the UGS with an aggressive separation from the anterior rectal wall. If the wide portion of the vagina was reached dissection stopped and the UGS opened ventrally widening to the introitus. Nineteen patients were treated using this maneuver (Group1. When more dissection was required the anterior wall of the UGS was dissected and carefully freed from the low retropubic space. Then the UGS was opened either ventrally or dorsally. Thirty three patients required this approach (Group 2 .Combined procedures were used in 3 patients with high UGS (Group 3. Results : Mean age at the time of the repair and length of the UGS were 12.2 years (4 months to 18 years and 3.75 cm (3 -8 cmfor G 1; 8 years (5 months to 17 years and 6.34 cm ( 4-12 cm in G2 and 8,3 years (2 -14 y and 11.5cm (11-12cm in G3. All patients had been regularly followed. Mean age at last follow up of 14.3y, 17y and 9.9y for groups 1, 2 and 3 respectively. All patients continue to void normally and are continent. All patients have 2 separate visible orifices in the vulva. Only 3 are sexually active.Conclusion: UGS mobilization for vaginoplasty in girls with CAH does not compromise voiding function or urinary continence,

  16. Promotion of hepatic preneoplastic lesions in male B6C3F1 mice by unleaded gasoline.

    Science.gov (United States)

    Standeven, A M; Wolf, D C; Goldsworthy, T L

    1995-01-01

    In previous studies, unleaded gasoline (UG) vapor was found to be a liver tumor promoter and hepatocarcinogen in female mice, but UG was not a hepatocarcinogen in male mice. However, UG vapor had similar transient mitogenic effects in nonlesioned liver of both male and female mice under the conditions of the cancer bioassay. We used an initiation-promotion protocol to determine whether UG vapor acts as a liver tumor promoter in male mice and to examine proliferative effects that may be critical to tumor development. Twelve-day-old male B6C3F1 mice were injected with N-nitrosodiethylamine (DEN; 5 mg/kg, intraperitoneally) or vehicle. Starting at 5-7 weeks of age, mice were exposed by inhalation 6 hr/day, 5 days/week for 16 weeks to 0 or 2046 ppm of PS-6 blend UG. UG treatment caused a significant 2.3-fold increase in the number of macroscopic hepatic masses in DEN-initiated mice, whereas no macroscopic masses were observed in non-initiated mice. Altered hepatic foci (AHF), which were predominantly basophilic in phenotype, were found almost exclusively in DEN-initiated mice. UG treatment significantly increased both the mean volume (threefold) and the volume fraction (twofold) of the AHF without increasing the number of AHF per unit area. UG also induced hepatic pentoxyresorufin-O-dealkylase (PROD) activity, a marker of CYP2B, by more than 12-fold over control with or without DEN cotreatment. To study hepatocyte proliferative effects of UG, we treated mice with 5-bromo-2'-deoxyuridine (BrdU) via osmotic pump for 3 days before necropsy and measured hepatocyte BrdU labeling index (LI) in AHF and nonlesioned liver.(ABSTRACT TRUNCATED AT 250 WORDS) Images Figure 1. PMID:7588481

  17. Addition of Aegilops U and M Chromosomes Affects Protein and Dietary Fiber Content of Wholemeal Wheat Flour

    Directory of Open Access Journals (Sweden)

    Marianna Rakszegi

    2017-09-01

    Full Text Available Cereal grain fiber is an important health-promoting component in the human diet. One option to improve dietary fiber content and composition in wheat is to introduce genes from its wild relatives Aegilops biuncialis and Aegilops geniculata. This study showed that the addition of chromosomes 2Ug, 4Ug, 5Ug, 7Ug, 2Mg, 5Mg, and 7Mg of Ae. geniculata and 3Ub, 2Mb, 3Mb, and 7Mb of Ae. biuncialis into bread wheat increased the seed protein content. Chromosomes 1Ug and 1Mg increased the proportion of polymeric glutenin proteins, while the addition of chromosomes 1Ub and 6Ub led to its decrease. Both Aegilops species had higher proportions of β-glucan compared to arabinoxylan (AX than wheat lines, and elevated β-glucan content was also observed in wheat chromosome addition lines 5U, 7U, and 7M. The AX content in wheat was increased by the addition of chromosomes 5Ug, 7Ug, and 1Ub while water-soluble AX was increased by the addition of chromosomes 5U, 5M, and 7M, and to a lesser extent by chromosomes 3, 4, 6Ug, and 2Mb. Chromosomes 5Ug and 7Mb also affected the structure of wheat AX, as shown by the pattern of oligosaccharides released by digestion with endoxylanase. These results will help to map genomic regions responsible for edible fiber content in Aegilops and will contribute to the efficient transfer of wild alleles in introgression breeding programs to obtain wheat varieties with improved health benefits.Key Message: Addition of Aegilops U- and M-genome chromosomes 5 and 7 improves seed protein and fiber content and composition in wheat.

  18. 5-10 GeV neutrinos from gamma-Ray burst fireballs

    Science.gov (United States)

    Bahcall; Meszaros

    2000-08-14

    A gamma-ray burst fireball is likely to contain an admixture of neutrons. Inelastic collisions between differentially streaming protons and neutrons in the fireball produce nu(&mgr;) (nu;(&mgr;)) of approximately 10 GeV as well as nu(e) (nu;(e)) of approximately 5 GeV, which could produce approximately 7 events/year in km(3) detectors, if the neutron abundance is comparable to that of protons. Photons of approximately 10 GeV from pi(0) decay and approximately 100 MeV nu;(e) from neutron decay are also produced, but will be difficult to detect. Photons with energies less, similar1 MeV from shocks following neutron decay produce a characteristic signal which may be distinguishable from the proton-related MeV photons.

  19. Interim dry fuel storage for magnox reactors

    Energy Technology Data Exchange (ETDEWEB)

    Bradley, N [National Nuclear Corporation, Risley, Warrington (United Kingdom); Ealing, C [GEC Energy Systems Ltd, Whetstone, Leicester (United Kingdom)

    1985-07-01

    In the UK the practice of short term buffer storage in water ponds prior to chemical reprocessing had already been established on the early gas cooled reactors in Calder Hall. Thus the choice of water pond buffer storage for MGR power plants logically followed the national policy decision to reprocess. The majority of the buffer storage period would take place at the reprocessing plant with only a nominal of 100 days targeted at the station. Since Magnox clad fuel is not suitable for long term pond storage, alternative methods of storage on future stations was considered desirable. In addition to safeguards considerations the economic aspects of the fuel cycle has influenced the conclusion that today the purchase of a MGR power plant with dry spent fuel storage and without commitment to reprocess would be a rational decision for a country initiating a nuclear programme. Dry storage requirements are discussed and two designs of dry storage facilities presented together with a fuel preparation facility.

  20. Prevalence of etravirine (ETR)-RAMs at NNRTI failure and predictors of resistance to ETR in a large Italian resistance database (ARCA).

    Science.gov (United States)

    Rusconi, S; Adorni, F; Bruzzone, B; Di Biagio, A; Meini, G; Callegaro, A; Punzi, G; Boeri, E; Pecorari, M; Monno, L; Gianotti, N; Butini, L; Galli, L; Polilli, E; Galli, M

    2013-10-01

    The prevalence of drug resistance associated with the failure of non-nucleoside reverse transcriptase inhibitor (NNRTI)-based regimens and the predictors of resistance to Etravirine (ETR) were assessed in 2854 subjects: 39 Monogram (MGR) >3, Tibotec (TBT) >2 and enhanced MGR (ENH) ≥4) emerged in the paediatric population. Multivariate analysis revealed an increased risk of developing TBT >2 for NNRTI exposure, ENH ≥4 for NNRTI and EFV exposure in paediatric subjects; NVP exposure and higher (≥3.5 log10) HIV-RNA values for all three algorithms in adult subjects, whereas CD4 ≥ 200/μL appeared to be protective. The risk of being ETR resistant was more than doubled for paediatric vs. adult subjects, probably due to a more extensive use of NNRTI and an incomplete virological control. © 2013 The Authors Clinical Microbiology and Infection © 2013 European Society of Clinical Microbiology and Infectious Diseases.

  1. INDUSTRIAL/MILITARY ACTIVITY-INITIATED ACCIDENT SCREENING ANALYSIS

    Energy Technology Data Exchange (ETDEWEB)

    D.A. Kalinich

    1999-09-27

    Impacts due to nearby installations and operations were determined in the Preliminary MGDS Hazards Analysis (CRWMS M&O 1996) to be potentially applicable to the proposed repository at Yucca Mountain. This determination was conservatively based on limited knowledge of the potential activities ongoing on or off the Nevada Test Site (NTS). It is intended that the Industrial/Military Activity-Initiated Accident Screening Analysis provided herein will meet the requirements of the ''Standard Review Plan for the Review of Safety Analysis Reports for Nuclear Power Plants'' (NRC 1987) in establishing whether this external event can be screened from further consideration or must be included as a design basis event (DBE) in the development of accident scenarios for the Monitored Geologic Repository (MGR). This analysis only considers issues related to preclosure radiological safety. Issues important to waste isolation as related to impact from nearby installations will be covered in the MGR performance assessment.

  2. Intact and Degraded Component Criticality Calculations of N Reactor Spent Nuclear Fuel

    International Nuclear Information System (INIS)

    L. Angers

    2001-01-01

    The objective of this calculation is to perform intact and degraded mode criticality evaluations of the Department of Energy's (DOE) N Reactor Spent Nuclear Fuel codisposed in a 2-Defense High-Level Waste (2-DHLW)/2-Multi-Canister Overpack (MCO) Waste Package (WP) and emplaced in a monitored geologic repository (MGR) (see Attachment I). The scope of this calculation is limited to the determination of the effective neutron multiplication factor (k eff ) for both intact and degraded mode internal configurations of the codisposal waste package. This calculation will support the analysis that will be performed to demonstrate the technical viability for disposing of U-metal (N Reactor) spent nuclear fuel in the potential MGR

  3. Closing the gap

    International Nuclear Information System (INIS)

    Moxon, Suzanne

    1999-01-01

    The problem of fish going through turbines at hydroelectric power plants and the growing concern over the survival rate of salmon at the US Army Corps operated Bonneville lock and dam on the Columbia river in the Pacific Northwest is discussed. The protection of the fish, the assessment of the hazards facing fish passing through turbines, the development of a new turbine, and improved turbine efficiency that reduces cavitation, turbulence and shear flow are examined. The closing of the gap between the turbine blades, hub and discharge ring to increase efficiency and reduce the risk to fish, and the development of the minimum gap runner (MGR) are described, and the lower maximum permitted power output of MGR is noted. (UK)

  4. Interim dry fuel storage for magnox reactors

    International Nuclear Information System (INIS)

    Bradley, N.; Ealing, C.

    1985-01-01

    In the UK the practice of short term buffer storage in water ponds prior to chemical reprocessing had already been established on the early gas cooled reactors in Calder Hall. Thus the choice of water pond buffer storage for MGR power plants logically followed the national policy decision to reprocess. The majority of the buffer storage period would take place at the reprocessing plant with only a nominal of 100 days targeted at the station. Since Magnox clad fuel is not suitable for long term pond storage, alternative methods of storage on future stations was considered desirable. In addition to safeguards considerations the economic aspects of the fuel cycle has influenced the conclusion that today the purchase of a MGR power plant with dry spent fuel storage and without commitment to reprocess would be a rational decision for a country initiating a nuclear programme. Dry storage requirements are discussed and two designs of dry storage facilities presented together with a fuel preparation facility

  5. Effect of anti-inflamentation extracts from Korean traditional medicinal herb

    Directory of Open Access Journals (Sweden)

    Zhang Xiaowan

    2014-09-01

    Full Text Available Five Mix Plant Extracts according to different extraction solvents were assessed for its cell viability and anti-inflammatory activity by in vitro methods. The single plant extract was extracted with 70% ethanol(EtOH and the mix plants(C.kousa, R.multiflora, T.nucifera, M.basjoo and S.glabra were extracted with EtOH 30%, 70%; Butylene Glycol(BG 30%, 70%; Propylene Glycol(PG 30%, 70%; Distilled Water(D.W. Cell viability was measured using the Micro culture tetrazolium (MTT assay method and Human fibroblast cells, CCD 1102 KERTr were used. The plant extracts with the maximum concentration that none toxic to the cells were evaluated for anti-inflammatory activity. Anti-inflammatory activity was evaluated using lipoxygenase inhibition assay method. A dose response curve was plotted to determine the IC50 values. Results showed that, at the 5 kinds of single plant extracts by 70% EtOH extraction solvent, it showed the IC50 was 280ug/ml of S1, 370ug/ml of S2, 380ug/ml of S3, 170ug/ml of S4 and 190ug/ml of S5. At the mix plant extracts by 7 kinds of extraction solvents (70%, 30% EtOH; 70%, 30% BG; 70%, 30% PG; D.W, it showed the IC50 was 140ug/ml of M E70, 140ug/ml of M E30, 120ug/ml of M BG70, 110ug/ml of M BG30, 120ug/ml of M PG70, 136ug/ml of M PG30 and 120ug/ml of M D.W. From the results, it is concluded that when these five plants mixed before extraction, it will extract more active ingredients with anti-inflammatory effects. Further study we will analyzing plants effective single compound using high performance liquid chromatography (HPLC profiling and progressing the experiments in vivo.

  6. Lipase production by Penicillium restrictum using solid waste of industrial babassu oil production as substrate.

    Science.gov (United States)

    Palma, M B; Pinto, A L; Gombert, A K; Seitz, K H; Kivatinitz, S C; Castilho, L R; Freire, D M

    2000-01-01

    Lipase, protease, and amylase production by Penicillium restrictum in solid-state fermentation was investigated. The basal medium was an industrial waste of babassu oil (Orbignya oleifera) production. It was enriched with peptone, olive oil, and Tween-80. The supplementation positively influenced both enzyme production and fungal growth. Media enriched with Tween-80 provided the highest protease activity (8.6 U/g), whereas those enriched with peptone and olive oil led to the highest lipase (27.8 U/g) and amylase (31.8 U/g) activities, respectively.

  7. Does reduced movement restrictions and use of assistive devices affect rehabilitation outcome after total hip replacement? A non-randomized, controlled study in 365 patients with six week follow up

    DEFF Research Database (Denmark)

    Mikkelsen, Lone Ramer; Petersen, Annemette Krintel; Søballe, Kjeld

    (primary outcome, HOOS), anxiety (HADS), working status and patient satisfaction were administered before THR, 3 and 6 weeks after. Findings / Results HOOS function score at the 3 measurement times were (mean ± SD); UG: 46±17 - 76±9 - 83±14 compared to RG: 43±16 – 81±14 - 83±13, (difference between groups...... over time, p=0.004). For return to work 6 weeks post THR, UG compared to RG: 53% versus 32% (p=0.045). No significant differences between groups in anxiety, hip dislocations and patient satisfaction. Conclusions No clinically relevant difference between UG and RG on patient evaluated function was found...

  8. Investigations of Photovoltaic Ferroelectric-Semiconductor Nonvolatile Memory.

    Science.gov (United States)

    1981-03-01

    HEWLETT-PACKARD BOX 3310 100 MARKET ST APT 1 3404 EAST HARMONY RD2U ATTN J. M. KIRSCH, MTS ATTN R. SCHAEFER ATTN L. W. JAMES, MTS FULLERTON, CA 92633...RADIO SYS SPERRY UNICORN 1300 S ROGERS 367 ORCHARD STREET 52-21 65 PL AT’rN J. F. PRATHER, MGR CEN ATTN I. A. PAULL, ES ATTN W. BURSTEIN, ENGR

  9. Logopedické materiály užívané při terapii dyslalie u dospělých klientů

    OpenAIRE

    Brodcová, Zuzana

    2012-01-01

    Author's name: Zuzana Brodcová School: Charles University, Prague Title: Dyslalia materials used in speech therapy for adults Consultant: Mgr. Lucie Durdilová Number of pages: 59 Number of attachments: 1 Year of defence: 2012 Key words: logopedical care for adults with dyslalia, pronounciation of czech sounds, logopedical materials for adults with dyslalia The theme of this thesis are logopedical materials using in the therapy of adults suffering from dyslalia. The first chapter is focused on...

  10. Biotransformation of selected anthelmintics in sheep tapeworm (Moniezia expansa)

    OpenAIRE

    Bečanová, Aneta

    2013-01-01

    Charles University in Prague Faculty of Pharmacy in Hradec Králové Department of Biochemical Sciences Candidate: Aneta Bečanová Supervisor: Mgr. Hana Bártíková, Ph.D. Title of diploma thesis: Biotransformation of selected anthelmintics in sheep tapeworm (Moniezia expansa) Biotransformation of anthelmintics is a process that prevents the parasite from adverse effects of xenobiotics. Therefore, it is the main factor that causes the reduction of an anthelmintic effect, resistance development and...

  11. Využití Linked Data pro sdílení dat o smlouvách veřejných institucí

    OpenAIRE

    Hryzlík, Pavel

    2016-01-01

    Title: Exploitation of Linked Data for sharing public agreements data Author: Bc. Pavel Hryzlík Department: Department of Software Engineering Supervisor: Doc. Mgr. Martin Nečaský, Ph.D., Department of Software Engineering Abstract: The objective of the thesis is to explore the possibilities of using Linked Data principles for publishing and sharing data on contracts of public institutions and their connections to related data in the public domain (eg. Business and trade register, register of...

  12. Regresní metody ve statistickém softwaru

    OpenAIRE

    Volchenkova, Irina

    2013-01-01

    b;g;igpiipu.txt[24.05.2013 12:17:27] Title: Regression methods in statistical software Author: Irina Volchenkova Department: Department of Probability and Mathematical Statistics Supervisor: Mgr. David Legát, Ph.D., Department of Probability and Mathematical Statistics Abstract: Regression analysis is a useful instrument for data mining. This thesis contains detailed information about linear regression especially about the mean least squares method. The theoretical part is divided into two pa...

  13. Distribuční smlouva v mezinárodním obchodním styku

    OpenAIRE

    Navrátilová, Gabriela

    2011-01-01

    of Dissertation Title: Distribution Agreement in the International Business Law Author: Mgr. Gabriela Navrátilová Tutor: Prof. JUDr. Monika Pauknerová, CSc, DSc. Legal Field: Law Institution: Charles University 1. The dissertation is divided in two parts, the first part is interested in the distribution agreement from the practical and theoretical point of view. Explication of the title distribution agreement is the substantive suppose for the understanding this institute in the field of the ...

  14. Validace HPLC metody stanovení piroxikamu v plasmě s využitím SPME a deproteinace

    OpenAIRE

    Kuželová, Kristýna

    2015-01-01

    Validation of HPLC evaluatoin of piroxicam in plasma using SPME and precipitation Rigorous Thesis Mgr. Kristýna Kuželová Charles University in Prague, Faculty of Pharmacy in Hradec Kralove, Department of Pharmaceutical Chemistry and Drug Control, Heyrovského 1203, Hradec Králové The purpose of this thesis was bioanalytical evalution of piroxicam using High Performance Liquid Chromatagraphy (HPLC). Piroxicam was isolated from plasma using SPME and protein precipitacion. Plasma was adjusted to ...

  15. Landscapes of lost energy: counterfactual geographical imaginary for a more sustainable society

    Czech Academy of Sciences Publication Activity Database

    Van der Horst, Dan

    2014-01-01

    Roč. 22, č. 2 (2014), s. 66-72 ISSN 1210-8812 R&D Projects: GA MŠk EE2.3.20.0025 Institutional support: RVO:68145535 Keywords : counterfactual * imagery * imagination * energy literacy Subject RIV: DE - Earth Magnetism, Geodesy, Geography Impact factor: 0.872, year: 2014 http://www.geonika.cz/EN/research/ENMgr/MGR_2014_02.pdf

  16. Kinesiotherapy of Parkinson`s disease and Parkinson`s syndrom

    OpenAIRE

    Zechovská, Lenka

    2013-01-01

    Author: Lenka Zechovská Institution: Rehabilitation Clinic, Faculty of Medicine in Hradec Králové Title: Kinesiotherapy of Parkinson's disease and Parkinson's syndrome Supervisor: Mgr. Ivana Vondráková Number of pages: 115 Number of attachments: 8 Year of defence: 2013 Keywords: Parkinson's disease, basal ganglia, tremor, rigidity, hypokinesia Bachelor thesis deals with the problems of Parkinson's disease and Parkinson's syndrome. The theoretical part includes the basal ganglia pathophysiolog...

  17. Náklady civilního procesu se zaměřením na odměnu za zastupování advokátem a advokátem jako opatrovníkem

    OpenAIRE

    Alexander, Eva

    2015-01-01

    Title: Cost of civil judicial proceedings with particular focus on attorneys' fees Author: Mgr. Eva Alexander Chair: Civil Law Date (final draft): 30 June 2014 Key words: costs of legal proceedings, reimbursement of legal fees, small claims The thesis analyzes the Czech legal rules relating to the costs of civil judicial proceedings, in particular the attorneys' fees. In the first part, the costs of civil judicial proceedings are described in general, including out-of-pocket expenses of parti...

  18. Využití infračervené a Ramanovy spektrometrie v preformulačním vývoji léčiv

    OpenAIRE

    Klimeš, Jiří

    2010-01-01

    56/56 ABSTRACT THE USE OF INFRARED AND RAMAN SPECTROSCOPY FOR PREFORMULATION PHARMACEUTICAL DEVELOPMNET Mgr. Jiří Klimeš April 2010 Department of Pharmaceutical Chemistry and Drug Control; Pharmaceutical Faculty, Charles University in Prague Zentiva, k.s, Prague, Development Department, Laboratories of Solid State Analysis Within pharmaceutical preformulation development, we are interested in information which is helpful for drug product formulation. The properties expected from drug product ...

  19. Light-Emitting Tag Testing in Conjunction with Testing of the Minimum Gap Runner Turbine Design at Bonneville Dam Powerhouse 1; FINAL

    International Nuclear Information System (INIS)

    Carlson, Thomas J

    2001-01-01

    This report describes a pilot study conducted by Tom Carlson of PNNL and Mark Weiland of MEVATEC Corp to test the feasibility of using light-emitting tags to visually track objects passing through the turbine environment of a hydroelectric dam. Light sticks were released at the blade tip, mid-blade, and hub in the MGR turbine and a Kaplan turbine at Bonneville Dam and videotaped passing thru the dam to determine visibility and object trajectories

  20. Analýza biologicky aktivních látek kapalinovou chromatografií

    OpenAIRE

    Pilařová, Pavla

    2013-01-01

    Charles University in Prague, Faculty of Pharmacy in Hradec Králové Department of Pharmaceutical Chemistry and Drug Control Candidate Mgr. Pavla Pilařová Supervisor Prof. RNDr. Jiří Klimeš, CSc. Title of Doctoral Thesis Analysis of biologicaly active substances using liquid chromatography Presented dissertation thesis is dedicated to the development of methods using liquid chromatography and involves thin-layer chromatography, high performance liquid chromatography and up-to date modification...

  1. A curse of coal? Exploring unintended regional consequences of coal energy in the Czech Republic

    Czech Academy of Sciences Publication Activity Database

    Frantál, Bohumil; Nováková, Eva

    2014-01-01

    Roč. 22, č. 2 (2014), s. 55-65 ISSN 1210-8812 R&D Projects: GA MŠk EE2.3.20.0025 Institutional support: RVO:68145535 Keywords : coal energy * environmental injustice * resource curse * spatial analysis * Czech Republic Subject RIV: DE - Earth Magnetism, Geodesy, Geography Impact factor: 0.872, year: 2014 http://www.geonika.cz/EN/research/ENMgr/MGR_2014_02.pdf

  2. New Trends and Challenges for Energy Geographies: Introduction to the Special Issue

    Czech Academy of Sciences Publication Activity Database

    Frantál, Bohumil; Pasqualetti, M. J.; Van der Horst, Dan

    2014-01-01

    Roč. 22, č. 2 (2014), s. 2-6 ISSN 1210-8812 R&D Projects: GA MŠk EE2.3.20.0025 Institutional support: RVO:68145535 Keywords : energy sources * energy landscape * renewable energy Subject RIV: DE - Earth Magnetism, Geodesy, Geography Impact factor: 0.872, year: 2014 http://www.geonika.cz/EN/research/ENMgr/MGR_2014_02.pdf

  3. Odraz archeologizovaných krajinných prvků v etnografických pramenech

    OpenAIRE

    Pohunek, Jan

    2016-01-01

    Reflection of archaeologized landscape elements in ethnographic resources Mgr. Jan Pohunek Abstract: This thesis discusses contemporary folklore interpretations of meanings of abandoned and decaying buildings and other types of artificial immovable monuments. Mutual relations between these interpretations and modes of place usage are also being observed. The research is based on ethnographic survey focused on Czech republic and including primarily interviews with various respondents and crtit...

  4. Environmental Compliance Assessment System (ECAS). North Carolina Supplement

    Science.gov (United States)

    1994-09-01

    of 30 mg/L and a weekly maximum average of 45 mgrL. (NOTE: Waste stabilization ponds that have a maximum design capacity of two mil- lion gal/day...and vector control are practiced when necessary. 5-113. MSWLF units Verify that underground tanks are placed a minimum of 2 ft [0.61 m] above the sea ...rodent, nematode , fungus, weed, or any other noxious or undesirable microorganism or macroorganism, except viruses, bacteria, or other microorganisms on

  5. Úvod do neparametrických metod

    OpenAIRE

    Prelecová, Natália

    2012-01-01

    Title: Introduction to Nonparametric Methods Author: Natália Prelecová Department: Department of Probability and Mathematical Statistics Supervisor: doc. Mgr. Michal Kulich,Ph.D., Department of Probability and Mathematical Statistics Abstract: The aim of this thesis is to introduce basic nonparametric methods. Nonparametric methods embrace a large class of statistical procedures which do not assume specific data distribution such as normal distribution. They often re- present the only availab...

  6. Etické principy konfucianismu ve vedení asijských podniků

    OpenAIRE

    Žuchová, Marcela

    2014-01-01

    Citation Confucian ethical principles in managing Asian companies: Diploma Thesis / Marcela Žuchová; supervisor: ThLic. Mgr. Denisa Červenková -- Praha, 2014. -- 86 p. Abstract The thesis "Confucian ethical principles in managing Asian companies" will present the ethical principles of Confucianism that affect the current management of Asian companies at Eastern Asia. The work will introduce with history of Confucianism, its influence on the culture in Asian countries and with some dominant el...

  7. Spiritualita uživatelů marihuany

    OpenAIRE

    Bučková, Aneta

    2014-01-01

    TITLE: Marijuana users spirituality AUTHOR: Aneta Bučková DEPARTMENT: Department of psychology SUPERVISOR: Mgr. Radovan Hrubý ABSTRACT: The theme of this thesis is spirituality of the marihuana users. The first part of the thesis focuses on the problematic of definition of spirituality. Furthermore, spirituality is put in historical and cultural context of use of psychotropic substances and finally in context of actual researches and approaches. The goal of the research part is to determine w...

  8. Víra jako sociální opora

    OpenAIRE

    Holečková, Žaneta

    2016-01-01

    Name and Suriname of the autor: Žaneta Holečková Institution: Charles University in Prague, Faculty of Medicine in Hradec Králové, Department of Social Medicine, Department of Nursing Title: Faith es social support Supervisor: Mgr. Michaela Votroubková Number of pages: 59 Number of attachments: 6 Year of defense: 2016 Keywords: faith, social support, Christianity, religion, nursing, disease, patient Summary: This bachelor's thesis represents Christian faith in terms of social support. It is s...

  9. Znalost a postoj k poskytování laické první pomoci u dospělé veřejnosti

    OpenAIRE

    Potulická, Jana

    2011-01-01

    Author: Potulická Jana Institution: Charles University in Prague, Medical faculty of Hradec Králové, Istitute of social medicine, Department of nursing Title of thesis: Knowledge and attitude of giving non-professional first aid to adult persons Consultant: Mgr. Votroubková Michaela Year of defense: 2011 Number of pages: 74 Number of annexes: 9 Key words: Non-professional First aid, Life Support, Lay's knowledge, Lay's attitude, Emergency Medical Servis Bachelor's Thesis is focused on dilemma...

  10. Probing the Higgs vacuum with general relativity

    Science.gov (United States)

    Mannheim, Philip D.; Kazanas, Demosthenes

    1991-01-01

    It is shown that the structure of the Higgs vacuum can be revealed in gravitational experiments which probe the Schwarzschild geometry to only one order in MG/r beyond that needed for the classical tests of general relativity. The possibility that deviations from the conventional geometry are at least theoretically conceivable is explored. The deviations obtained provide a diagnostic test for searching for the existence of macroscopic scalar fields and open up the possiblity for further exploring the Higgs mechanism.

  11. Monitored Geologic Repository Project Description Document

    International Nuclear Information System (INIS)

    Curry, P. M.

    2001-01-01

    The primary objective of the Monitored Geologic Repository Project Description Document (PDD) is to allocate the functions, requirements, and assumptions to the systems at Level 5 of the Civilian Radioactive Waste Management System (CRWMS) architecture identified in Section 4. It provides traceability of the requirements to those contained in Section 3 of the ''Monitored Geologic Repository Requirements Document'' (MGR RD) (YMP 2000a) and other higher-level requirements documents. In addition, the PDD allocates design related assumptions to work products of non-design organizations. The document provides Monitored Geologic Repository (MGR) technical requirements in support of design and performance assessment in preparing for the Site Recommendation (SR) and License Application (LA) milestones. The technical requirements documented in the PDD are to be captured in the System Description Documents (SDDs) which address each of the systems at Level 5 of the CRWMS architecture. The design engineers obtain the technical requirements from the SDDs and by reference from the SDDs to the PDD. The design organizations and other organizations will obtain design related assumptions directly from the PDD. These organizations may establish additional assumptions for their individual activities, but such assumptions are not to conflict with the assumptions in the PDD. The PDD will serve as the primary link between the technical requirements captured in the SDDs and the design requirements captured in US Department of Energy (DOE) documents. The approved PDD is placed under Level 3 baseline control by the CRWMS Management and Operating Contractor (M and O) and the following portions of the PDD constitute the Technical Design Baseline for the MGR: the design characteristics listed in Table 1-1, the MGR Architecture (Section 4.1), the Technical Requirements (Section 5), and the Controlled Project Assumptions (Section 6)

  12. Monitored Geologic Repository Project Description Document

    International Nuclear Information System (INIS)

    Curry, P.

    2000-01-01

    The primary objective of the Monitored Geologic Repository Project Description Document (PDD) is to allocate the functions, requirements, and assumptions to the systems at Level 5 of the Civilian Radioactive Waste Management System (CRWMS) architecture identified in Section 4. It provides traceability of the requirements to those contained in Section 3 of the ''Monitored Geologic Repository Requirements Document'' (MGR RD) (CRWMS M and O 2000b) and other higher-level requirements documents. In addition, the PDD allocates design related assumptions to work products of non-design organizations. The document provides Monitored Geologic Repository (MGR) engineering design basis in support of design and performance assessment in preparing for the Site Recommendation (SR) and License Application (LA) milestones. The engineering design basis documented in the PDD is to be captured in the System Description Documents (SDDs) which address each of the systems at Level 5 of the CRWMS architecture. The design engineers obtain the engineering design basis from the SDDs and by reference from the SDDs to the PDD. The design organizations and other organizations will obtain design related assumptions directly from the PDD. These organizations may establish additional assumptions for their individual activities, but such assumptions are not to conflict with the assumptions in the PDD. The PDD will serve as the primary link between the engineering design basis captured in the SDDs and the design requirements captured in U.S. Department of Energy (DOE) documents. The approved PDD is placed under Level 3 baseline control by the CRWMS Management and Operating Contractor (M and O) and the following portions of the PDD constitute the Technical Design Baseline for the MGR: the design characteristics listed in Table 2-1, the MGR Architecture (Section 4.1),the Engineering Design Bases (Section 5), and the Controlled Project Assumptions (Section 6)

  13. Marine Search, Rescue and Emergency Preparedness Study.

    Science.gov (United States)

    1975-09-01

    most points made by these men is that from the Manager of J. Percy Priest Reservoir, William Redmon, who is also a member of the Board of Directors of...Alamo Lake: COE - Lowell C. Flannery Curacanti: National Park Svc. - J. C. Riggs, Chief Park RangerI Jackson : Mancos Water Conservance District...Safety ! J. Percy Priest Reservoir: COE - William G. Redmon, Reservoir Mgr. John Sevier Steam Plant: TA - Walter C. Vance, Lt. Public Safety Kentucky Lake

  14. Performance of Pleurotus ostreatus mushroom grown on maize stalk residues supplemented with various levels of maize flour and wheat bran

    Directory of Open Access Journals (Sweden)

    Senzosenkosi Surprise MKHIZE

    Full Text Available Abstract Improving the performance of mushroom in terms of high production and fast growth rate is essential in mushroom cultivation. In the present study the performance of Pleurotus ostreatus was evaluated using varying levels of wheat bran (WB and maize flour (MF. The results indicated that Pleurotus ostreatus was highly influenced by different levels of supplementation, with 8% WB, 18% WB and 2% MF having higher contamination rate. The low levels of supplementation gave significantly better mycelial growth rate (MGR and shorter colonisation period as observed that the control had highest MGR whereby 20% MF had lowest MGR. The pinning time (TP was shortest at the first flush with minimum of 3 days (12% MF. The higher levels of supplementation showed maximum biological efficiency (BE such as 14% MF, 12% WB and 14% WB. The yield was also higher at high levels of supplementation such as 20% MF and 8% MF being the exception in the lower levels. Based on the results it was observed that for fast production of oyster mushroom there is no need to supplement the maize stalk substrate but for improved productivity supplements can be added up to certain limits such as 14% MF and 12 WB.

  15. Membrane-initiated non-genomic signaling by estrogens in the hypothalamus: cross-talk with glucocorticoids with implications for behavior

    Directory of Open Access Journals (Sweden)

    Jennifer eRainville

    2015-02-01

    Full Text Available The estrogen receptor (ER and glucocorticoid receptor (GR are members of the nuclear receptor superfamily that can signal using both non-genomic and genomic transcriptional modes. Though genomic modes of signaling have been well characterized and several behaviors attributed to this signaling mechanism, the physiological significance of non-genomic modes of signaling has not been well understood. This has partly been due to the controversy regarding the identity of the membrane ER (mER or membrane GR (mGR that may mediate rapid, non-genomic signaling and the downstream signaling cascades that may result as a consequence of steroid ligands binding the mER or the mGR. Both estrogens and glucocorticoids exert a number of actions on the hypothalamus, including feedback. This review focuses on the various candidates for the mER or mGR in the hypothalamus and the contribution of non-genomic signaling to classical hypothalamically-driven behaviors and changes in neuronal morphology. It also attempts to categorize some of the possible functions of non-genomic signaling at both the cellular level and at the organismal level that are relevant for behavior, including some behaviors that are regulated by both estrogens and glucocorticoids in a potentially synergistic manner. Lastly, it attempts to show that steroid signaling via non-genomic modes may provide the organism with rapid behavioral responses to stimuli.

  16. Acclimation of the summer annual species, lolium temulentum, to CO(2) enrichment

    Science.gov (United States)

    Lewis; Peratoner; Cairns; Causton; Foyer

    1999-11-01

    Lolium temulentum L. Ba 3081 was grown hydroponically in air (350 &mgr;mol mol(-1) CO(2)) and elevated CO(2) (700 &mgr;mol mol(-1) CO(2)) at two irradiances (150 and 500 &mgr;mol m(-2) s(-1)) for 35 days at which point the plants were harvested. Elevated CO(2) did not modify relative growth rate or biomass at either irradiance. Foliar carbon-to-nitrogen ratios were decreased at elevated CO(2) and plants had a greater number of shorter tillers, particularly at the lower growth irradiance. Both light-limited and light-saturated rates of photosynthesis were stimulated. The amount of ribulose-1, 5-bisphosphate carboxylase-oxygenase (Rubisco) protein was increased at elevated CO(2), but maximum extractable Rubisco activities were not significantly increased. A pronounced decrease in the Rubisco activation state was found with CO(2) enrichment, particularly at the higher growth irradiance. Elevated-CO(2)-induced changes in leaf carbohydrate composition were small in comparison to those caused by changes in irradiance. No CO(2)-dependent effects on fructan biosynthesis were observed. Leaf respiration rates were increased by 68% in plants grown with CO(2) enrichment and low light. We conclude that high CO(2) will only result in increased biomass if total light input favourably increases the photosynthesis-to-respiration ratio. At low irradiances, biomass is more limited by increased rates of respiration than by CO(2)-induced enhancement of photosynthesis.

  17. Efektifitas Pemberlakuan Sistem Satu Arah pada Jalan Indraprasta Kota Semarang dalam Rangka Pemerataan Sebaran Beban Lalu Lintas

    Directory of Open Access Journals (Sweden)

    Djoko Purwanto

    2016-06-01

    Full Text Available The traffic problems in a big city such as Semarang generally caused by the typical situation like overcrowding at peak hours. To overcome this problem, Semarang Government has implemented “One Way System” on the Indraprasta Street section without providing road partner. This study is intended to identify the effectiveness of this policy. The following streets were reviewed: Indraprasta, Imam Bonjol, Mgr. Soegiyopranoto, and Pierre Tendean. Further, the intersections which studied are Indraprasta-Imam Bonjol-Pierre Tendean and Tugu Muda. Traffic survey data were collected in the morning and afternoon peak hours. Manual Kapasitas Jalan Indonesia 1997 was used in the data analysis procedure. This short-term study was conducted by simulating the proposed scenario and compared with the existing situations.In conclusion, “One Way System” on Indraprasta Street section is assessed not effective due to its relatively small degree of saturation, while Mgr. Soegiyopranoto Street has a large degree of saturation. Therefore, the one-way system to Imam Bonjol Street and Mgr. Soegiyopranoto Street also needed to implement and form a “rotary link“. In addition, enacting contraflow for public transport on Soegiyopranoto Street and Imam Bonjol Street is necessary, also the arrangement of signals and geometric in the intersection that linked those three streets.

  18. Fluorouracil and high-dose leucovorin with radiotherapy as adjuvant therapy for rectal cancer. Results of a phase II study

    Energy Technology Data Exchange (ETDEWEB)

    Giralt, J. [Radiation Oncology Service, Hospital General Universitari Vall d`Hebron, Barcelona (Spain); Rubio, D. [Medical Oncology Service, Hospital General Universitari Vall d`Hebron, Barcelona (Spain); Maldonado, X. [Radiation Oncology Service, Hospital General Universitari Vall d`Hebron, Barcelona (Spain); Naval, J. [Dept. of Surgery, Hospital General Universitari Vall d`Hebron, Barcelona (Spain); Casado, S. [Medical Oncology Service, Hospital General Universitari Vall d`Hebron, Barcelona (Spain); Lara, F. [Dept. of Surgery, Hospital General Universitari Vall d`Hebron, Barcelona (Spain); Rosello, J.M. [Dept. of Preventive Medicine, Hospital General Universitari Vall d`Hebron, Barcelona (Spain); Armengol, M. [Dept. of Surgery, Hospital General Universitari Vall d`Hebron, Barcelona (Spain)

    1997-07-01

    The purpose of this phase II study was to evaluate the efficacy and toxicity of fluorouracil and high-dose leucovorin (5-FU/LV) with pelvic irradiation as adjuvant therapy for patients with macroscopical resected rectal or recto-sigmoid cancer. Following surgery for stages II-III primary (52) or recurrent rectal cancer (4), 56 patients received 8 cycles of 5-FU/LV and pelvic irradiation. 5-FU doses were 200 mgr/m{sup 2} for cycles 2-3 and 300 mgr/m{sup 2} for cycles 1 and 4-8. LV doses remained fixed at 200 mgr/m{sup 2}. Pelvic radiation was started in the third week, between the first and second cycle. The total dose was 50.4 Gy. No serve complications had been recorded. The incidence of grade 3 diarrhea was 19%. Three patients presented leukopenia grade 3 (5%). In 44 patients (78%) the planned treatment could be administered. The median follow-up was 40 months (range 22-66). Seven patients had a local relapse (13%) and 6 developed distant metastasis (10%). The 3-year disease-free survival was 72% and the overall survival was 76%. These preliminary results show that combined post-operative 5-FU/LV and pelvic radiotherapy are well tolerated and present a reasonable local control and survival rates. This adjuvant treatment should be evaluated in randomized trials. (orig.).

  19. Identifying online user reputation in terms of user preference

    Science.gov (United States)

    Dai, Lu; Guo, Qiang; Liu, Xiao-Lu; Liu, Jian-Guo; Zhang, Yi-Cheng

    2018-03-01

    Identifying online user reputation is significant for online social systems. In this paper, taking into account the preference physics of online user collective behaviors, we present an improved group-based rating method for ranking online user reputation based on the user preference (PGR). All the ratings given by each specific user are mapped to the same rating criteria. By grouping users according to their mapped ratings, the online user reputation is calculated based on the corresponding group sizes. Results for MovieLens and Netflix data sets show that the AUC values of the PGR method can reach 0.9842 (0.9493) and 0.9995 (0.9987) for malicious (random) spammers, respectively, outperforming the results generated by the traditional group-based method, which indicates that the online preference plays an important role for measuring user reputation.

  20. Current insights into hormonal regulation of microspore embryogenesis

    Directory of Open Access Journals (Sweden)

    Iwona eŻur

    2015-06-01

    Full Text Available Plant growth regulator (PGR crosstalk and interaction with the plant’s genotype and environmental factors play a crucial role in microspore embryogenesis (ME, controlling microspore-derived embryo differentiation and development as well as haploid/doubled haploid plant regeneration. The complexity of the PGR network which could exist at the level of biosynthesis, distribution, gene expression or signaling pathways, renders the creation of an integrated model of ME-control crosstalk impossible at present. However, the analysis of the published data together with the results received recently with the use of modern analytical techniques brings new insights into hormonal regulation of this process. This review presents a short historical overview of the most important milestones in the recognition of hormonal requirements for effective ME in the most important crop plant species and complements it with new concepts that evolved over the last decade of ME studies.

  1. Progesterone receptor variation and risk of ovarian cancer is limited to the invasive endometrioid subtype: results from the Ovarian Cancer Association Consortium pooled analysis

    DEFF Research Database (Denmark)

    Pearce, C.L.; Wu, A.H.; Gayther, S.A.

    2008-01-01

    There is evidence that progesterone plays a role in the aetiology of invasive epithelial ovarian cancer. Therefore, genes involved in pathways that regulate progesterone may be candidates for susceptibility to this disease. Previous studies have suggested that genetic variants in the progesterone...... receptor gene (PGR) may be associated with ovarian cancer risk, although results have been inconsistent. We have established an international consortium to pool resources and data from many ovarian cancer case-control studies in an effort to identify variants that influence risk. In this study, three PGR...... single nucleotide polymorphisms (SNPs), for which previous data have suggested they affect ovarian cancer risk, were examined. These were +331 C/T (rs10895068), PROGINS (rs1042838), and a 3' variant (rs608995). A total of 4788 ovarian cancer cases and 7614 controls from 12 case-control studies were...

  2. Information afternoons for BKW personnel

    International Nuclear Information System (INIS)

    Meichle, A.

    1983-01-01

    The management of Bernische Kraftwerke AG organise afternoon meetings for the staff each limited to 70/80 people. Brief details of the information afternoons are given, the main aims of which include updating knowledge on energy policy matters and the need for nuclear power, explaining company policy, improving staff motivation, considering the results of the poll on the standing of BKW with its customers, screening a company film and discussing matters raised by employees. (P.G.R.)

  3. Conveyor belt nuclear weighing machine

    International Nuclear Information System (INIS)

    Anon.

    1977-01-01

    In many industries the flow of materials on conveyor belts must be measured and controlled. Electromechanical weighing devices have high accuracy but are complicated and expensive to install and maintain. For many applications the nuclear weighing machine has sufficient accuracy but is considerably simpler, cheaper and more robust and is easier to maintain. The rating and performance of a gamma ray balance on the mar ket are detailed. (P.G.R.)

  4. Mexico: The Accidental Narco?

    Science.gov (United States)

    2011-06-30

    9 Gonzales, Maria de la Luz (2009-03-25). "Suman 10 mil 475 ejecuciones en esta administracion : PGR" (in Spanish). El Universal. http...the Sinaloa cartel, Ignacio Coronel was killed in 2010. The leader of La Familia, Nazario Moreno Gonzalez, could not escape the reach of Mexican...cartel, La Familia, had proposed truces with the government and promised a reduction in violence if the government focuses more on targeting its

  5. Convergence of glycogen synthase kinase 3β and GR signaling in response to fluoxetine treatment in chronically stressed female and male rats.

    Science.gov (United States)

    Mitic, Milos; Brkic, Zeljka; Lukic, Iva; Adzic, Miroslav

    2017-08-30

    Accumulating evidence strongly suggest that impaired glucocorticoid receptor (GR) signaling is involved in stress-related mood disorders, and nominate GR as a potential target for antidepressants (ADs). It is known that different classes of ADs affects the GR action via modifying its phosphorylation, while the mechanism through which ADs alter GR phosphorylation targeted by GSK3β, a kinase modulated via serotonin neurotransmission, are unclear. On this basis, we investigated whether GSK3β-GR signaling could be a convergence point of fluoxetine action on brain function and behavior, by examining its effect on GSK3β targeted-GR phosphorylation on threonine 171 (pGR171), and expression of GR-regulated genes in the hippocampus of female and male rats exposed to chronic isolation stress. Stress induced sex-specific GSK3β-targeted phosphorylation of pGR171 in the nucleus of the hippocampus of stressed animals. Namely, while in females stress triggered coupled action of GSK3β-pGR171 signaling, in males changes in pGR171 levels did not correspond to GSK3β activity. On the other hand, fluoxetine managed to up-regulate this pathway in sex-unbiased manner. Furthermore, fluoxetine reverted stress-induced changes in most of the analyzed genes in males, CRH, 5-HT1a and p11, while in females its effect was limited to CRH. These data further suggest that pGR171 signaling affects cellular localization of GR in response to chronic stress and fluoxetine in both sexes. Collectively, our results describe a novel convergence point between GR signaling and GSK3β pathway in rat hippocampus in response to stress and fluoxetine in both sexes and its involvement in fluoxetine-regulated brain function in males. Copyright © 2017 Elsevier B.V. All rights reserved.

  6. Bern Power Station Co

    International Nuclear Information System (INIS)

    1981-01-01

    The Bernische Kraftwerke electricity generation/supply company supplies about one eighth of the Swiss electrical energy demand with about one sixth of the Swiss generating capacity. Directly or indirectly one million inhabitants are supplied, a substantial contribution to the Swiss economy. Data given on BKW includes: historical background, structure, organisation, operations, generating plant, transmission/distribution equipment, electricity generated, supplied, exported and imported, financial aspects, accounting practice and cooperation arrangements with other utilities. (P.G.R.)

  7. Mexico-U.S. Relations: Issues for Congress

    Science.gov (United States)

    2008-12-18

    Mexico adopted a series of economic, political, and foreign policy reforms. It opened its economy to trade and investment, adopted electoral ...institutions and election agency. The Federal Election Institute (IFE) and Federal Electoral Tribunal (TEPJF) were well-regarded going into the 2006...Investiga PGR Crímenes Cometidos durante Conflicto en Oaxaca,” Notimex, January 4, 2007; Gerardo Soriano and Paulina I. Valencia, “Asegura APPO que

  8. Resistance within hemodialysis shunts predicts patency.

    Science.gov (United States)

    Bui, Trung D; Gordon, Ian L; Parashar, Amish; Vo, David; Wilson, Samuel E

    2006-01-01

    The authors examined the relationship between patency after thrombectomy of clotted dialysis grafts and intraoperative measurements of flow (Q), pressure gradient (PGR), and longitudinal resistance (RL). Eighteen thrombosed arteriovenous (AV) grafts underwent 21 thrombectomies. Pressures at arterial (P1) and venous (P2) ends of the AV grafts were determined with 22-gauge catheters and standard transducers; flow was measured with transit-time probes; arithmetic averaging of waveforms was used to compute mean Q, PGR, and RL. Kaplan-Meier patency curves were analyzed by using log rank methods. Mean patency for all grafts was 164 +/-152 days. For each variable, the 21 measurements were split and the patency curve for the grafts with the 11 lowest value grafts was compared to the curve representing the 10 highest value grafts. The difference between high RL versus low RL patency curves was significant with high-resistance grafts having a median patency of 55 days and low-resistance grafts having a median patency greater than 151 days (p = 0.0089). In contrast, the high Q group median patency was 151 days versus 174 days for the low Q group (p = 0.86). Median patency for the low PGR group was 115 days compared to 62 days for the high PGR group (p = 0.162). Longitudinal resistance within AV grafts, but not flow or pressure gradient, showed a significant correlation with patency after thrombectomy. Increased resistance to flow within AV grafts appears to be an important factor affecting the propensity of dialysis grafts to thrombose.

  9. Why do we build nuclear power stations

    International Nuclear Information System (INIS)

    Keppler, E.

    1984-01-01

    The author discusses some aspects of interest in the context of opposition to nuclear power in Switzerland. The part played and to be played by nuclear power in Switzerland is discussed, criticisms and objections are countered, the implications of power generation without further nuclear contribution are examined, and requests in certain quarters for a tax on power generation except from alternative sources are rejected. (P.G.R.)

  10. Determinants of import demand for non-renewable energy (petroleum) products: Empirical evidence from Nigeria

    International Nuclear Information System (INIS)

    Adewuyi, Adeolu O.

    2016-01-01

    This study estimated determinants of import demand for refined petroleum products in Nigeria for the period 1984–2013. It employed the autoregressive distributed lag (ARDL) bounds test cointegration method and analysed both long-run and short-run determinants of import demand for total and specific petroleum products. In the long-run, aggregate and sectoral incomes are significant determinants of import of refined kerosene. Further, real effective exchange rate (REER), aggregate income (GDP), manufacturing sector's income, domestic energy production (DEP) and population growth rate (PGR) are drivers of import of refined motor spirit Moreover, REER, DEP and manufacturing sector's income are propellers of import of refined distillate fuel. Also, REER and total output of petroleum products are major drivers of total import of refined petroleum products. Short-run results show that previous period GDP, PGR and manufacturing and service sectors' incomes are determinants of import demand for refined kerosene. Moreover, REER, GDP, previous PGR and manufacturing sector's income exert significant effects on the import of refined motor spirit. Further, significant effects of REER, DEP, previous PGR, domestic output of the product and manufacturing and service sectors' incomes on the import demand for distillate fuel were found. Policy implications of the foregoing are articulated in the paper. - Highlights: •Long-run and short-run drivers of import demand for petroleum products were estimated. •kerosene import is income elastic, gasoline import is income and relative price inelastic. •Exchange rate policies may have diverse effects on import of various petroleum product. •Expanding market size has implication for import demand for petroleum product varieties. •Import demand for petroleum products responds differently to various sectoral incomes.

  11. Five Polymorphisms and Breast Cancer Risk: Results from the Breast Cancer Association Consortium

    Science.gov (United States)

    Gaudet, Mia M.; Milne, Roger L.; Cox, Angela; Camp, Nicola J.; Goode, Ellen L.; Humphreys, Manjeet K.; Dunning, Alison M.; Morrison, Jonathan; Giles, Graham G.; Severi, Gianluca; Baglietto, Laura; English, Dallas R.; Couch, Fergus J.; Olson, Janet E.; Wang, Xianshu; Chang-Claude, Jenny; Flesch-Janys, Dieter; Abbas, Sascha; Salazar, Ramona; Mannermaa, Arto; Kataja, Vesa; Kosma, Veli-Matti; Lindblom, Annika; Margolin, Sara; Heikkinen, Tuomas; Kämpjärvi, Kati; Aaltonen, Kirsimari; Nevanlinna, Heli; Bogdanova, Natalia; Coinac, Irina; Schürmann, Peter; Dörk, Thilo; Bartram, Claus R.; Schmutzler, Rita K.; Tchatchou, Sandrine; Burwinkel, Barbara; Brauch, Hiltrud; Torres, Diana; Hamann, Ute; Justenhoven, Christina; Ribas, Gloria; Arias, José I.; Benitez, Javier; Bojesen, Stig E.; Nordestgaard, Børge G.; Flyger, Henrik L.; Peto, Julian; Fletcher, Olivia; Johnson, Nichola; Silva, Isabel dos Santos; Fasching, Peter A.; Beckmann, Matthias W.; Strick, Reiner; Ekici, Arif B.; Broeks, Annegien; Schmidt, Marjanka K.; van Leeuwen, Flora E.; Van’t Veer, Laura J.; Southey, Melissa C.; Hopper, John L.; Apicella, Carmel; Haiman, Christopher A.; Henderson, Brian E.; Le Marchand, Loic; Kolonel, Laurence N.; Kristensen, Vessela; Alnæs, Grethe Grenaker; Hunter, David J.; Kraft, Peter; Cox, David G.; Hankinson, Susan E.; Seynaeve, Caroline; Vreeswijk, Maaike P.G.; Tollenaar, Rob A.E.M.; Devilee, Peter; Chanock, Stephen; Lissowska, Jolanta; Brinton, Louise; Peplonska, Beata; Czene, Kamila; Hall, Per; Li, Yuqing; Liu, Jianjun; Balasubramanian, Sabapathy; Rafii, Saeed; Reed, Malcolm W.R.; Pooley, Karen A.; Conroy, Don; Baynes, Caroline; Kang, Daehee; Yoo, Keun-Young; Noh, Dong-Young; Ahn, Sei-Hyun; Shen, Chen-Yang; Wang, Hui-Chun; Yu, Jyh-Cherng; Wu, Pei-Ei; Anton-Culver, Hoda; Ziogoas, Argyrios; Egan, Kathleen; Newcomb, Polly; Titus-Ernstoff, Linda; Dietz, Amy Trentham; Sigurdson, Alice J.; Alexander, Bruce H.; Bhatti, Parveen; Allen-Brady, Kristina; Cannon-Albright, Lisa A.; Wong, Jathine; Chenevix-Trench, Georgia; Spurdle, Amanda B.; Beesley, Jonathan; Pharoah, Paul D.P.; Easton, Doug F.; Garcia-Closas, Montserrat

    2009-01-01

    Previous studies have suggested that minor alleles for ERCC4 rs744154, TNF rs361525, CASP10 rs13010627, PGR rs1042838, and BID rs8190315 may influence breast cancer risk, but the evidence is inconclusive due to their small sample size. These polymorphisms were genotyped in more than 30,000 breast cancer cases and 30,000 controls, primarily of European descent, from 30 studies in the Breast Cancer Association Consortium. We calculated odds ratios (OR) and 95% confidence intervals (95% CI) as a measure of association. We found that the minor alleles for these polymorphisms were not related to invasive breast cancer risk overall in women of European descent: ECCR4 per-allele OR (95% CI) = 0.99 (0.97–1.02), minor allele frequency = 27.5%; TNF 1.00 (0.95–1.06), 5.0%; CASP10 1.02 (0.98–1.07), 6.5%; PGR 1.02 (0.99–1.06), 15.3%; and BID 0.98 (0.86–1.12), 1.7%. However, we observed significant between-study heterogeneity for associations with risk for single-nucleotide polymorphisms (SNP) in CASP10, PGR, and BID. Estimates were imprecise for women of Asian and African descent due to small numbers and lower minor allele frequencies (with the exception of BID SNP). The ORs for each copy of the minor allele were not significantly different by estrogen or progesterone receptor status, nor were any significant interactions found between the polymorphisms and age or family history of breast cancer. In conclusion, our data provide persuasive evidence against an overall association between invasive breast cancer risk and ERCC4 rs744154, TNF rs361525, CASP10 rs13010627, PGR rs1042838, and BID rs8190315 genotypes among women of European descent. PMID:19423537

  12. Cartel Car Bombings in Mexico

    Science.gov (United States)

    2013-08-01

    Security OSINT Open Source Intelligence UXO Unexploded Ordnance PAN National Action Party (Partido Acción Nacional) PGR Office of the...infor- 35 mation beyond that provided by open source intelligence ( OSINT ). Such information, and the military intelligence process behind it that...required to be at the unclassified, yet limited distribution/sensitive and non-restric- tion on use OSINT levels for law enforcement utilization

  13. Effects of OK-432 (picibanil) on the estrogen receptors of MCF-7 cells and potentiation of antiproliferative effects of tamoxifen in combination with OK-432.

    Science.gov (United States)

    Aoyagi, H; Iino, Y; Takeo, T; Horii, Y; Morishita, Y; Horiuchi, R

    1997-01-01

    OK-432 (picibanil), a streptococcal preparation, has a strong biological response modifier (BRM) function and is expected to produce clinical improvement and prolongation of survival in treated cancer patients in Japan. We were interested in whether OK-432 augments estrogen receptor (ER) levels in breast cancer. To investigate the effect of the BRMs on cellular growth and the characteristics of ER and progesterone receptors (PgR) in the human breast cancer cell line MCF-7, we used OK-432, Krestin (PSK), a protein-bound polysaccharide extracted from Coriolus versicolor, and lentinan, a fungal branched (1...3)-beta-D-glycan. OK432 and PSK dose dependently inhibited DNA synthesis of MCF-7 cells, and the 50% inhibitory concentrations of OK-432 and PSK were 1.2 KE (klinische Einheit, clinical unit)/ml and 200 micrograms/ml, respectively. Lentinan showed no direct anticancer effect in vitro. We found that OK-432 induced a 2-fold increase in ER levels in MCF-7 cells at 0.005 KE/ml, but not in PgR. Lentinan and low-dose PSK did not change ER or PgR levels, but high-dose PSK decreased ER and PgR. We also studied the combined effect of OK-432 and antiestrogens, tamoxifen (TAM) and DP-TAT-59. The combined treatment with OK-432 and TAM showed an additive inhibitory effect on MCF-7 cells. These results suggest that OK-432 may augment the therapeutic effect of TAM in breast cancer.

  14. Preoperative core needle biopsy is accurate in determining molecular subtypes in invasive breast cancer

    International Nuclear Information System (INIS)

    Chen, Xiaosong; Yuan, Ying; Fei, Xiaochun; Jin, Xiaolong; Shen, Kunwei; Sun, Long; Mao, Yan; Zhu, Siji; Wu, Jiayi; Huang, Ou; Li, Yafen; Chen, Weiguo; Wang, Jianhua

    2013-01-01

    Estrogen receptor (ER), progesterone receptor (PgR), HER2, and Ki67 have been increasingly evaluated by core needle biopsy (CNB) and are recommended for classifying breast cancer into molecular subtypes. However, the concordance rate between CNB and open excision biopsy (OEB) has not been well documented. Patients with paired CNB and OEB samples from Oct. 2009 to Feb. 2012 in Ruijin Hospital were included. ER, PgR, HER2, and Ki67 were determined by immunohistochemistry (IHC). Patients with HER2 IHC 2+ were further examined by FISH. Cutoff value for Ki67 high expression was 14%. Molecular subtypes were constructed as follows: Luminal A, Luminal B, Triple Negative, and HER2 positive. There were 298 invasive breast cancer patients analyzed. Concordance rates for ER, PgR, and HER2 were 93.6%, 85.9%, and 96.3%, respectively. Ki67 expression was slightly higher in OEB than in CNB samples (29.3% vs. 26.8%, P = 0.046). Good agreement (κ = 0.658) was demonstrated in evaluating molecular subtypes between CNB and OEB, with a concordance rate of 77.2%. We also used a different Ki67 cutoff value (20%) for determining Luminal A and B subtypes in HR (hormone receptor) +/HER2- diseases and the overall concordance rate was 79.2%. However, using a cut-point of Ki67 either 14% or 20% for both specimens, there will be about 14% of HR+/HER2- specimens that are called Luminal A on CNB and Luminal B on OEB. CNB was accurate in determining ER, PgR, and HER2 status as well as non-Luminal molecular subtypes in invasive breast cancer. Ki67 should be retested on OEB samples in HR+/HER2- patients to accurately distinguish Luminal A from B tumors

  15. Immobilization of Aspergillus niger. beta. -D-glucosidase on aminated chitin and alumina/alginate

    Energy Technology Data Exchange (ETDEWEB)

    Bon, E.; Freire, D.; Mendes, M.F.; Soares. V.F.

    1986-01-01

    The immobilization of ..beta..-glucosidase was studied by (a) covalent coupling to aminated chitin (IME-C) and (b) adsorption onto alumina followed by gel entrapment of the suspension with calcium alginate (IME-A). The levels of catalytic activity determined against salicin at 50 C were 23.0 U/g and 0.2 U/g for the IME-C and IMA-A respectively. The first system was shown to be quite stable with a loss of only 2% of the initial activity over 14 days. The IME-A system had a half life of 14 days. The activity of IME-C was studied using cellobiose and enzymatic hydrolysates of sugar cane bagasse at several cellobiose concentrations. The activities obtained with cellobiose were 104.0 U/g and 72.0 U/g respectively. 13 references.

  16. Gene : CBRC-PMAR-01-0008 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available o Petromyzon marinus cDNA 3', mRNA sequence /clone_end=3' /gb=EE272683 /gi=111169662 /ug=Pma.1613 /len=663 1e-08 26% MEVGIS...IMEVAISIMEVDISIMEVDISIMEVGISIMEVGISIMEVGISIMEVDISIMEVGISIMEVAISIMEVAISIMEVGISITEVRISIMEVGIS...IMEVGISITEVGISITEVGISIMEVGISIMEVGISITEVGISITEVGISITEVGISIMEVGISIMEVGISIMEVGISIMEVGISIMEVGISIMEVGISIMEVGIS...ITEVGISIMEVGISITEVRISIMEVGFTITASSTSSLSSLTQARLLHLFPSTLQRTTSSCLMLSSSLSAMNNPLLDENLSTPPPLIILQIRHPSIHPHGGRPLSDAFRPWAAALFLVSAIGHRPSLAVTTRPDKAQISSGAV ...

  17. no es nada it is nothing simbonile we saw himjher

    African Journals Online (AJOL)

    Universal Grammar (UG) to applied linguistics and language teaching. In particular I am ... input in which subjects are sometimes physically present and .... in complex sentences than simple sentences, and I have found .... Present tense perf.

  18. Gene : CBRC-DRER-07-0003 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available C572172), mRNA /cds=p(17,10813) /gb=XM_695856 /gi=125855624 /ug=Dr.88794 /len=10813 0.0 37% TTTTASVTTTTEHTSTTEPSTTTTVPVTTTTEHTST...TEQSTTTTVPVTTTTEHTSTTELSTTTTAPVTTTTEHTSTTEPSTTTTAPVTTTTEHTSTTELSTTTTAPVTTTTEHTST...TELSTTTTAPVTTTTTEHTSTTEPSTTTTTPVTTTEHTSTTEPSTTTTAPVTTTEHTSTTEPSTTTTAPVTTTTEHTSTTEPPTTTTGPVTTTTTEHTST...TEQSTTTTTPVTTTEHTSTTEPSTTTTAPVTTTTEHTSTTEQSTTTTAPVTTTEHTSTTEPPTTTTKPITTTTEHTSTTEPSTTTTVPVTTTTEHTSTTEPSTTTTASVTTTTEHTST...TELSTTTTAPETTTTEHTSTTEPSTTTTAPVTTTTEHTSTTEPSTTTTAPVTTTQHTSTTEQSTTTTAPVTTTTEHTST

  19. Methanol Extract of Codonopsis pilosula Inhibits Inducible Nitric ...

    African Journals Online (AJOL)

    HP

    Department of Pharmacology and Toxicology, School of Dentistry, Kyung Hee University, .... triton X-100, 0.5 % NP-40, 1 ug/ml leupetin, and .... oxidative stress like smoking, ultraviolet rays, ... thereby disturbing the normal protein structure.

  20. Personnel and Vehicle Data Collection at Aberdeen Proving Ground (APG) and its Distribution for Research

    Science.gov (United States)

    2015-10-01

    28 Magnetometer Applied Physics Model 1540-digital 3-axis fluxgate 5 Amplifiers Alligator Technologies USBPGF-S1 programmable instrumentation...Acoustic, Seismic, magnetic, footstep, vehicle, magnetometer , geophone, unattended ground sensor (UGS) 16. SECURITY CLASSIFICATION OF: 17. LIMITATION

  1. Effects of visibility and types of the ground surface on the muscle activities of the vastus medialis oblique and vastus lateralis

    Science.gov (United States)

    Park, Jeong-ki; Lee, Dong-yeop; Kim, Jin-Seop; Hong, Ji-Heon; You, Jae-Ho; Park, In-mo

    2015-01-01

    [Purpose] The purpose of this study was to compare the effects of visibility and types of ground surface (stable and unstable) during the performance of squats on the muscle activities of the vastus medialis oblique (VMO) and vastus lateralis (VL). [Subjects and Methods] The subjects were 25 healthy adults in their 20s. They performed squats under four conditions: stable ground surface (SGS) with vision-allowed; unstable ground surface (UGS) with vision-allowed; SGS with vision-blocked; and UGS with vision-blocked. The different conditions were performed on different days. Surface electromyogram (EMG) values were recorded. [Results] The most significant difference in the activity of the VMO and VL was observed when the subjects performed squats on the UGS, with their vision blocked. [Conclusion] For the selective activation of the VMO, performing squats on an UGS was effective, and it was more effective when subjects’ vision was blocked. PMID:26356407

  2. Gene : CBRC-PMAR-01-0569 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available romyzon marinus cDNA, mRNA sequence /gb=CO548425 /gi=51796737 /ug=Pma.8609 /len=962 3e-06 21% MCCIGIADTLALLLHWHCCCIGIAATLA...LLLHWHCCYIGIVATLALLLRWHCCCIGIVDTLALLLHWHCCFIGIVAALALLLHWHCCCIGIVAALALLLHWHCCYIGIVATLA...LLLHWHCCYIRIAATLALLLHWHCCCIGIAAALALLLHWHCCCIGIVDTLALLLHWHCCYIGIAATLALLLHWHCCCIGIVATLALLLHWHCCYIGIAATLA...LLLHWHCCYIGIAATLALLLHWHCCCIGIAATLTLLLHCHSCTVRAPAVADTLGLRPSPNLYKEFTFRG ...

  3. Persistence of 14C maneb in lettuce plants an soil

    International Nuclear Information System (INIS)

    Bennaceur, M.; Sennaoui, Z.; Meguenni, H.

    1992-10-01

    Maneb residue is studied on lettuce plant and soil after spraying on greenhouse with 14C maneb. The residues declined with time. After 37 days from the application, 14C maneb residues in water extracts declined to 1,5. 10-2ug/g from 5,8. 10-1ug/g of the zero day sample in lettuce plants and 4,6. 10-3ug/g from 1,73. 10-1ug/g in soil. The 14C internals residues in lettuce and soil increase respectively till 16 days and 24 days, then decrease to 88% and 4,05% after 37 days. ETU was present in lettuce plant after 8 days then decreases with time. Two metabolites were identified by TLC (EU,ETU)

  4. Gene : CBRC-RNOR-10-0236 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available lete cds /cds=p(41,1927) /gb=AY325173 /gi=33086523 /ug=Rn.6897 /len=1933 1e-73 64% MVATITQDNRVNNNSSSSNNNSSSDHNKSNNSSNSSNSNNSSNSNNSS...NSNNSSNSSNSNNSSNSSNSSNSSNNSNSNNSSNSSNSSNSSNSNNNNSNSNNSSNSNNSSNINNSSNSNNSNSNNSS...NINNSSNSNNSNSNNSSNSNNSSNSNNSSNSNNSNSNNSNSNNSSNSNNSSNINNSSNSNNSNSNNSSNINNSSNSNNSNSNNSSNSNNSSNSNNSNSNNSSNINNSS...NSNNSNSNNSSNSNNSSNSNNSSNSSNSSNSSNNSNSNNSSKATTAVTATTAATATTAVTATTATATTAAKQQQQGWQCSSLVPGNRRQRQADPLS ...

  5. Gene : CBRC-RNOR-07-0266 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available 5 (LOC685755), mRNA /gb=XR_006286 /gi=109471595 /ug=Rn.197700 /len=1496 4e-65 64% MNGKKIIKLRAEINRNNNNNSSSSNSNNSSSSSNNNNSSSNSNNNSS...SNSNNNSSSSNSNNNSNNNSNSSNNSSSNNNSSSSNSNNSSNSNNSNNNSNSSNNNSNNSSSNSNNSNNNSS...SNSNNSNNNSNSNNSNSSNNNSNNNNSSSNSNNNNNNNSSNNNSSNNNNNSNNIKTTAATTTTATTTTAANAIIETKSWFLEKISKIDKPLFNIKVERKLNQINQPRKERRGV ...

  6. Gene : CBRC-PMAR-01-0249 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available nt subunit NF-180 mRNA, complete cds /cds=p(122,3454) /gb=U19361 /gi=632548 /ug=Pma.4811 /len=3763 8e-43 41% MRSSNSSSSRSSSNNSSSNSSNSS...RSSSNNSSSSNNSSRSSSNSSSSNRSSSNRSSSSSNSNSSSSSSSNRSRSSSNRSSSNRSSSNSSNSSNSSSSSNSS...SNSNSSNSRSNSSNSSNSRNSNSSSNSSSNSSNSNRRNSSNSSNSRSNNSSNSSNSSSNSSNSNSSSNSSSNSSNSNSSSNSSRSNNSSSSNSSNRSSNSSNNSSNSSSNSS...NSSNSSSNNSSNSSSSNSSNNNSSNSSNNNSSNSSNSSNNSNSSSNNNSNSSRSNSGFWLSHRTKSVAVTKPRGAFGLRFRGRLERCSLPT ...

  7. Gene : CBRC-RNOR-01-0770 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available pothetical protein LOC685755 (LOC685755), mRNA /gb=XR_006286 /gi=109471595 /ug=Rn.197700 /len=1496 6e-64 70% MFKPQYNYNNNSS...SSNNYNSNNNNSNSSSNNNSNSSSSNNNSNSSNNNSNSNNSNNSNNNSNSSSNNNSNSSNSNSSSNNNSNSSNNYNSNNNSSSSNSS...SNNSNNNNNNSNNNNSNNNSSNSSNSSSNNNSNSSNNNSSNNNSNSNSSNSNSNSSNSNSSSNNSNNNNSNSSNNNNNSSSNNSNNNNSSSNNNNSNSSNNNNNSS...SNNSNNNNNSNNNSNSSNSNSSSNNNNSNSSSNNSNNNNNSNSNSSNSNNNNSNNSNSNSSNNNSNNNNNSNSSNNNSNSNNSNSSNSSSNNSNSSSNNSNNNNNSNNSNSNSS...NSNNNNNSNNSNSNSSNSNSSNNNSNNNNSNSSNSNNNNSNSSNSNSNNSNSNSSNSNSNNSNNSSNSSSSNNNSNSNSS

  8. Gene : CBRC-RNOR-08-0111 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available complete cds /cds=p(41,1927) /gb=AY325173 /gi=33086523 /ug=Rn.6897 /len=1933 1e-76 65% MDDRSQKMNSYNNSSSNNNNNSSKNSNNSNSSSNNNSSNNNSNNSS...NNNSNSNNSKNSSSNNSSNSSNNSNSNNSNNSNSNNSSNNNSSNNNSNSNNSNNSSSNNSSNSNNNSSSNNSNNSNSNNSS...NSSSNNSSNSNNSSSSNNSSNSNNNSSSNNSNSNNSSNNSSNSNNSSSSNNSNSNSNNSNNSSNNSNNSSSNNSNNSNSNNSNSSSRNSNNSSNNSSNSNNSS...SSNNSNSSSSNSNNSSNSNNSKRLSLFRLTKLEIEENYLTYACGGSGVHDGSYIPSEDVCLGIPGDLKGVIVTLSDDGHLQCSYLGTD

  9. Gene : CBRC-CINT-01-0000 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available v425e13 /clone_end=3' /gb=BW467001 /gi=48602865 /ug=Cin.16926 /len=835 3e-11 23% TNTNNRTTHNNKITTHNNSS...TNTNNSSTNTTNSSTVTYNSTTLNNKNTTHNNSSTNTNNSSTVTHNGTTLNNKNTKHNNSFTNTNNSFTNTNISSTNTNNSSTITNNSFTNTNNSSTNTNNSS...TNTNNSVTNTNNSFTNTNDSTTHNNKITTHNNSSTNTNNSFTNTNISSTNTNNSSTNTNNSSTNTNNSSTINNNSSTITNNSSTNTNNSSTITNNSFTNTNNSSTNTNNSS...TNTNNSVTNTNNSFTNTNDSTTHNNKITTHNNSSTNTNNSFTNTNISSTNTNNSSTNTNNSSTNTNNSSTINNNSSTITNNSS...TNTNNSSTITNNSSTVTYNSSTNTNNSTTPNDNAINNNNYIKPMFMKSYAHACITIPTTRLVYFVYNFTITVVFKLLFITLFIF ...

  10. Gene : CBRC-MMUS-19-0101 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available protein (Dspp), mRNA /cds=p(77,2914) /gb=NM_010080 /gi=111120321 /ug=Mm.319832 /len=4431 3e-34 34% MDSRLCLNNRSNSSSSNNSRNNSS...SSSSSRNSRNNNNSNINNINTNSSRNNSSSRNNSNNSSWNSSNNSSSNNSSSNNSNTSKNNNSSNINYSNNSSSRSNSNNSS...SRNNSNNNNNKSSNHSSNNNSNNSSSSNSSNKSSSSNNNNNNSNNHSSNSNSNSSSSRINSNNNISNNNINNNSSSNNNSSNHSSNNNSNSSSSNNNSSSNNSHNSSSNNNNNQKQNQKQPKKSR ...

  11. BIOACTIVITIES AND MECHANISM OF SPIRO ENOL ETHER ANALOGUES AGAINST PIERIS RAPAE

    Institute of Scientific and Technical Information of China (English)

    Zhi-xiangZhang; Dong-meiCheng; Han-hongXu; Yu-linWu; andJun-faFan

    2004-01-01

    Nineteen kinds of spiro enol ether analogues were screened with larvae of Pieris rapae for antifeedant activity. The results showed that the antifeedant activity of compounds No.20 and No.12 was higher than others. In non-choice test, AFC50 values within 24 h of compounds No.20 and No.12 against 3rd instar larvae of P. rapae were 226.93ug/mL and 370.00ug/mL, and that in choice test against 4th larvae were 280.54 ug/mL and 398.88 ug/mL, respectively. Compd. No.20 could prolong the eggs hatch time and reduce the haemolymph content and the protein content in haemolymph of 4th instar larvae obviously. Compd. No.20 could protect tested leaves and control larvae of P. rapae effectively.

  12. 2512-IJBCS-Article-Okot Okumu

    African Journals Online (AJOL)

    hp

    heterophyllus and Moringa oleifera for treatment of community drinking water, Uganda ... *Auteur correspondant, E-mail: jokotokumu@caes.mak.ac.ug, jokotokumu@yahoo.com, ..... low, medium and high turbidity water by Jack fruit seed ...

  13. properties of extrudates from sorghum varieties abstract résumé

    African Journals Online (AJOL)

    ACSS

    Corresponding author: ybbyaru@yahoo.com, ybbyaruhanga@caes.mak.ac.ug. ABSTRACT. Extrusion cooking is a modern high-temperature short-time (HTST) processing technology, which is ... moisture contents and viscosities are treated,.

  14. banana juice as an alternative energy source for banana in vitro

    African Journals Online (AJOL)

    ACSS

    2015-02-23

    Feb 23, 2015 ... Corresponding author: sbmukasa@caes.mak.ac.ug, sbmukasa@yahoo.com ... However, the cost of tissue culture grade energy sources is high, thus making tissue ..... Treatment (banana juice from different Cvs at 50 ml l-1).

  15. Underground gas storage Lobodice geological model development based on 3D seismic interpretation

    International Nuclear Information System (INIS)

    Kopal, L.

    2015-01-01

    Aquifer type underground gas storage (UGS) Lobodice was developed in the Central Moravian part of Carpathian foredeep in Czech Republic 50 years ago. In order to improve knowledge about UGS geological structure 3D seismic survey was performed in 2009. Reservoir is rather shallow (400 - 500 m below surface) it is located in complicated locality so limitations for field acquisition phase were abundant. This article describes process work flow from 3D seismic field data acquisition to geological model creation. The outcomes of this work flow define geometry of UGS reservoir, its tectonics, structure spill point, cap rock and sealing features of the structure. Improving of geological knowledge about the reservoir enables less risky new well localization for UGS withdrawal rate increasing. (authors)

  16. Disease: H01588 [KEGG MEDICUS

    Lifescience Database Archive (English)

    Full Text Available estlessness or agitation. Headaches often recur at the same time each day during the cluster period, which c...ug) ... AUTHORS ... VanderPluym J ... TITLE ... Cluster Headache: Special Considerations for Treatment of Female P

  17. An Advanced VHF/UHF Short Range, Groundwave Propagation Model for Paths With Near-Earth Antennas

    National Research Council Canada - National Science Library

    Cross, Marshall W; Fung, Tat Y

    2006-01-01

    ... the earth such as: Unattended Ground Sensors (UGS) and Intelligent Munitions Systems (IMS), are attenuated above free space values by the lossy earth itself and any obstructions between a transmitter and receiver pair...

  18. Gene : CBRC-CINT-01-0032 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available :cieg003b01, full insert sequence /gb=AK116512 /gi=23589081 /ug=Cin.12858 /len=2519 0.027 32% MISCLLLNSPVCLMTICILLNLQVRLMMS...SVLLNSPVCLMMSCRLLNSPVRLMMSCLLNSPVRLMISCLLLNSPVRLMMSCILLNSPVRLMMSSVLLNSAVCLMMSCRLLNSPVRLMMS...CRLLNSPVRLMMSSVLLNSPVCLMMSCRLLNSPVRFIMSCLLPNSPVCLMTICILLNSQVRLMISSLLNSPVCLMMSSALLNSPVRLMMSSRLLNSPVRLMMSCRLLNSPVRLMMSCVLLNSPVRLMMSCLLLNSPVCLMMSCSF ...

  19. Gene : CBRC-CINT-01-0076 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available ntestinalis cDNA, clone:cieg003b01, full insert sequence /gb=AK116512 /gi=23589081 /ug=Cin.12858 /len=2519 5e-04 29% MMSCLLLNLPVRLMMS...CLLLNSPVCLMMSCRLLNSPVRLMISCLLLNSPVCLMMSCLLLNSPVRLMMSCLLLNSPVRLMMSCLLLNSPVCLMMS...CLLLNSPVRLMMSCLLLNSPVRLMISCLLLNSPVRLMISCLLLNPPVRLMMSCVLLNLPVRLMMICILSNSPVCLVISCLLLNSPVRLMISCLLLNSPVCLMMS...CVLPNSPVRLMMSCLLLNSPVRLMMSCLLLNLPVRLMMSCLLLNSPVCLMMSCLILNSPVRLMICCLLLNSPVCLMTICILLNSTVRLMICCLLLNPPVRLMISCLLNPPVRLMMSCVLLNSPVRLMTSRFRLELMYVRCLTIFKKFLL ...

  20. Publications | Page 62 | IDRC - International Development Research ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Results 611 - 620 of 6389 ... IDRC works with developing-country researchers and institutions to ... sp. strain UCD-UG_FMILLET was isolated from the roots of the Afro-. ... and men that perpetuate gender and inequality and power imbalances.

  1. Gene : CBRC-XTRO-01-3152 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available Neu108f03 /clone_end=3' /gb=BX693382 /gi=38342502 /ti=474115996 /ug=Str.40529 /len=838 3e-17 39% MPLAFAPS...PLAFAPSPLAFAPSPLAFAPSPLAFAPSPLAFPPSPLAFAPSPLAFPPSPLAFAPSPLAFAPSPLAFAPSPLAFPPSPLAFAPS...PLAFVPSLLAFPPSPHAFAPLPLAFAPSPLAFAPSPLAFAPSPLAFPPSPLPLLLCSLPFLLGPLPLLLCPFPLLLHPLSLLLCPLPLLLGPLPLLFCPFPWLLRPLPLLLCPLPLLLRPLSLLLCPFPLLLRPLPLLLRPLPLLLDPGHYTKRWALDVNTAITRP ...

  2. Gene : CBRC-DRER-26-0137 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available cDNA clone 3384097, mRNA sequence /clone=3384097 /gb=EB959993 /gi=102920926 /ug=Dr.79541 /len=690 4e-71 84% MECAARSGDEKELQNSKAGVVAR...VLISCVVARVLISCVVAQVLVSCVVARVLVSCVVARVLVSCVVARVLVSCVVARVLVSCVVARVLVSCVVARVLVSCVVAR...VLVSCVVARVLVSCVVARVLVSCVVARVLVSCVVARVLVSCVVARVLISCVVARVLVSCVVARVLVSCVVARVLVSCVVARVLVSCVVARVLVSCVVARVLVSCVVAR...VLNSGVVARVLNSGVVARVLNSGVVARVLNSGVVARVLISGVVARVLISCVVARVLNSCVVARVLIXXXXXXXXXXXXXXXXXXX

  3. Gene : CBRC-DRER-08-0063 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available 3384097, mRNA sequence /clone=3384097 /gb=EB959993 /gi=102920926 /ug=Dr.79541 /len=690 3e-61 79% MECAARRGDEKELENPKAGVVAARVLNSGVVAR...VLISCVVVRVLISCVVAARVLNSGVVARVLISCVVVRVLISCVVAARVLNSSVVARVLISCVVARVLISCVVAARVLNSSVVAR...VLISCVVARVLISCVVAARVLNSGVVARVLISCVVARVLISCVVAARVLNSSVVARVLISCVVAARVLNSGVVARVLISCVVARVLISCVVARVVISCVVAR...VLKSGVVARVLISCVVARVLNSGVVARVLISGVVARVLISCVVARVLISCVVARVLISCVVARTE ...

  4. Gene : CBRC-DRER-26-0260 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available 3384097, mRNA sequence /clone=3384097 /gb=EB959993 /gi=102920926 /ug=Dr.79541 /len=690 2e-68 82% MECAARSGDEKELENSKAGVVATRVLNSGVVAR...VLISCVVARVLNSGVVARVLISCVVARALISCVVARVLNSSVVARVLINSVVARVLISCVVARVLNSGVVARVLISCVVAR...VLNSGVVARVLISCVVARVLNSGVVARVLISCVVARVLISCVVARVLNSGVVARVLISCVVARVLNSGVVARVLISCVVARVLNSGVVARFLISCVVARVLNSGVVSTLFRLMQT ...

  5. The concentration of cadmium in hepatoma among Filipinos

    International Nuclear Information System (INIS)

    Alejandrino, A.L.; Goze, C.B.; Paradero, R.R.

    1977-08-01

    The concentration of cadmium in liver hepatoma and in normal liver in Filipinos was determined by atomic absorption spectrophotometry. Using NBS Bovine Liver (SRM1577) as reference material, a value of 0.28+-0.025 ug/g dry weight was obtained for cadmium which is close to the certified NBS value of 0.27+-0.04 ug/g. The mean percentage recovery for cadmium determination by AAS was 98.38%. A mean value of 2.14+-1.58 ug Cd/g liver hepatoma was observed for the 12 cases investigated, showing decreased cadmium levels in the cancerous liver compared to the mean value of 12.62 ug Cd/g observed for normal liver obtained from 10 cases of accidental deaths. The values are expressed on a dry weight basis

  6. Aryl hydrocarbon receptors in urogenital sinus mesenchyme mediate the inhibition of prostatic epithelial bud formation by 2,3,7,8-tetrachlorodibenzo-p-dioxin

    International Nuclear Information System (INIS)

    Ko, Kinarm; Moore, Robert W.; Peterson, Richard E.

    2004-01-01

    In utero exposure of male C57BL/6 mice to 2,3,7,8-tetrachlorodibenzo-p-dioxin (TCDD) prevents prostatic epithelial buds from forming in the ventral region of the urogenital sinus (UGS) and reduces the number of buds that form in the dorsolateral region. This inhibition of budding is aryl hydrocarbon receptor (AHR) dependent and appears to be the primary cause of lobe-specific prostate abnormalities in TCDD-exposed mice. TCDD can inhibit prostatic epithelial bud formation by acting directly on the UGS in vitro, but whether it does so via AHR in UGS mesenchyme, epithelium, or both was unknown. To address this issue, UGS mesenchyme and epithelium from gestation day (GD) 15 wild-type C57BL/6J male mice were isolated, recombined, and cultured in vitro for 5 days with 10 -8 M 5α-dihydrotestosterone (DHT) and either 10 -9 M TCDD or vehicle. Prostatic epithelial buds were viewed by light microscopy after removal of mesenchyme. Effects depended greatly on which portions of the mesenchyme were used: TCDD had little if any effect when whole UGS epithelium (UGE) was recombined with ventral plus dorsolateral mesenchyme, tended to reduce bud numbers in recombinants made with UGE and dorsolateral mesenchyme, and severely reduced bud numbers in recombinants made with UGE and ventral mesenchyme (VM). [VM + UGE] recombinants prepared from wild-type and AHR knockout (Ahr -/- ) mice were then cultured with DHT to determine the site of action of TCDD. AHR null mutation alone had no effect on budding. TCDD severely inhibited prostatic epithelial bud formation in recombinants that contained mesenchymal AHR, whereas bud formation was not inhibited by TCDD in recombinants lacking mesenchymal AHR, regardless of epithelial AHR status. These results demonstrate that UGS mesenchyme and not UGS epithelium is the site of action of TCDD. Therefore, the initial events responsible for abnormal UGS (and ultimately prostate) development occur within the UGS mesenchyme, and changes in gene expression

  7. Heavy Metal Contents of Municipal and Rural Dumpsite Soils and Rate of Accumulation by Carica papaya and Talinum triangulare in Uyo, Nigeria

    Directory of Open Access Journals (Sweden)

    G. A. Ebong

    2008-01-01

    Full Text Available Dumpsites in Uyo and most cities in Nigeria are used nutrients rich soils for cultivating fruits and vegetables without regards to the risk of toxic metal pollution by the wastes. This development necessitated the research on the assessment of the impact of municipal and rural dumpsites on the metal levels of the underlying soils, the relationship between the dumpsite- soil metal content and the rate of bio-accumulation by plants, the effect of plant specie and plant part on the rate of metal uptake. Atomic absorption spectrophotometer was employed for the analysis of the samples and results obtained from municipal dumpsite soil indicated the following mean concentrations: Fe, 1711.20 μg/g; Pb, 43.28 ug/g; Zn, 88.34 ug/g; Ni, 12.18 ug/g; Cd, 14.10 ug/g and Cu, 56.33 ug/g. These concentrations were relatively higher than the following concentrations: Fe, 1016.98 ug/g; Pb, 18.57 ug/g; Zn, 57.90 ug/g; Ni, 7.98 ug/g; Cd, 9.25 ug/g and Cu, 33.70 ug/g recorded for the rural dumpsite soil. Consequently, plants grown on municipal dumpsites soil accumulated higher concentrations of the metals than those on rural dumpsites. Results obtained from this study also revealed that plants grown on dumpsite soils bio-accumulated higher metal concentrations than their counterparts obtained from normal agricultural soils. The ability of plants to bioaccumulate these metals were also observed as being different from one plant to the other and from one plant parts to the other. And apart from Fe and Zn which recorded higher concentrations in the leaves of the plants studied, other metals recorded higher concentrations in the roots. The general results obtained revealed that the levels of Cd in dumpsite-soil were above the standard while the levels of Cd and Pb in plants were also above the recommended levels in plants. The implications of these high concentrations of these metals in soil and plants have been discussed. Some useful recommendations on the proper

  8. [Identification of candidate genes and expression profiles, as doping biomarkers].

    Science.gov (United States)

    Paparini, A; Impagnatiello, F; Pistilli, A; Rinaldi, M; Gianfranceschi, G; Signori, E; Stabile, A M; Fazio, V; Rende, M; Romano Spica, V

    2007-01-01

    Administration of prohibited substances to enhance athletic performance represents an emerging medical, social, ethical and legal issue. Traditional controls are based on direct detection of substances or their catabolites. However out-of-competition doping may not be easily revealed by standard analytical methods. Alternative indirect control strategies are based on the evaluation of mid- and long-term effects of doping in tissues. Drug-induced long-lasting changes of gene expression may be taken as effective indicators of doping exposure. To validate this approach, we used real-time PCR to monitor the expression pattern of selected genes in human haematopoietic cells exposed to nandrolone, insulin-like growth factor I (IGF-I) or growth hormone (GH). Some candidate genes were found significantly and consistently modulated by treatments. Nandrolone up-regulated AR, ESR2 and PGR in K562 cells, and SRD5A1, PPARA and JAK2 in Jurkat cells; IGF-I up-regulated EPOR and PGR in HL60 cells, and SRD5A1 in Jurkat; GH up-regulated SRD5A1 and GHR in K562. GATA1 expression was down-regulated in IGF-1-treated HL60, ESR2 was down-regulated in nandrolone-treated Jurkat, and AR and PGR were down-regulated in GH-treated Jurkat. This pilot study shows the potential of molecular biology-based strategies in anti-doping controls.

  9. Nuclear progesterone receptors are up-regulated by estrogens in neurons and radial glial progenitors in the brain of zebrafish.

    Directory of Open Access Journals (Sweden)

    Nicolas Diotel

    Full Text Available In rodents, there is increasing evidence that nuclear progesterone receptors are transiently expressed in many regions of the developing brain, notably outside the hypothalamus. This suggests that progesterone and/or its metabolites could be involved in functions not related to reproduction, particularly in neurodevelopment. In this context, the adult fish brain is of particular interest, as it exhibits constant growth and high neurogenic activity that is supported by radial glia progenitors. However, although synthesis of neuroprogestagens has been documented recently in the brain of zebrafish, information on the presence of progesterone receptors is very limited. In zebrafish, a single nuclear progesterone receptor (pgr has been cloned and characterized. Here, we demonstrate that this pgr is widely distributed in all regions of the zebrafish brain. Interestingly, we show that Pgr is strongly expressed in radial glial cells and more weakly in neurons. Finally, we present evidence, based on quantitative PCR and immunohistochemistry, that nuclear progesterone receptor mRNA and proteins are upregulated by estrogens in the brain of adult zebrafish. These data document for the first time the finding that radial glial cells are preferential targets for peripheral progestagens and/or neuroprogestagens. Given the crucial roles of radial glial cells in adult neurogenesis, the potential effects of progestagens on their activity and the fate of daughter cells require thorough investigation.

  10. Major Gravitational Phenomena Explained by the Micro-Quanta Paradigm

    Directory of Open Access Journals (Sweden)

    Michelini M.

    2010-01-01

    Full Text Available Some major problems of physics, which remained unsolved within classical and relativistic gravitation theories, are explained adopting the quantum gravity interaction descending from the micro-quanta paradigm. The energy source of the gravitational power $P_{gr}$, which heats and contracts the Bok's gas globules harbouring the future stars, is identified and defined as well as the gravitational power generated on the solid/fluid planets. Calculations are carried out to make the comparison between $P_{gr}$ predicted for the solar giant planets and the measured infrared radiation power $P_{int}$ coming from the interior. The case of planets with solid crust (Earth, etc. requires a particular attention due to the threat to stability produced by the thermal dilatation. An analysis is done of the Earth's planetary equilibrium which may be attained eliminating the temperature rise through the migration of hot internal magma across the crust fractured by earthquakes. The temperatures observed up to 420,000 years ago in Antartica through Vostok and Epica ice cores suggest the possibility that the Earth gravitational power $P_{gr}$ may be radiated in space through these temperature cycles (Glacial Eras. In this general frame the Earth's high seismicity and the dynamics of Plate tectonics may find their origin.

  11. Estrogen receptor, progesterone receptor, HER-2, and response to postmastectomy radiotherapy in high-risk breast cancer: the Danish Breast Cancer Cooperative Group

    DEFF Research Database (Denmark)

    Kyndi, Marianne; Sørensen, Flemming Brandt; Knudsen, Helle

    2008-01-01

    . End points were locoregional recurrence as isolated first event, distant metastases, and overall survival. For statistical analyses four subgroups were constructed from hormonal receptors (Rec). Rec+ was defined as ER+ and/or PgR+. Rec-as both ER-and PgR-. The four subgroups were Rec+/HER-2-, Rec......+/HER-2+, Rec-/HER-2-(triple negative), and Rec-/HER-2+. RESULTS: A significantly improved overall survival after PMRT was seen only among patients characterized by good prognostic markers such as hormonal receptor-positive and HER-2- patients (including the two Rec+ subtypes). No significant overall...... after PMRT were found for ER-and PgR-tumors compared with the ER+ and PgR+ tumors (P = .003 and .04, respectively), and for the triple-negative (P = .02), and the Rec-/HER-2+ subtypes (P = .003) compared with the Rec+/HER-2-subtype. CONCLUSION: Hormonal receptor status, HER-2, and the constructed...

  12. Potential of plant growth regulator and chlormequat chloride on alfalfa seed components

    International Nuclear Information System (INIS)

    Chen, J. S.; Lin, H.; Han, W.

    2016-01-01

    The use of plant growth regulators (PGRs) has opened new prospects for increased seed production in grasses and legumes, but little information is available on the effects of PGRs combination with chlormequat chloride (CCC) on alfalfa (Medicago sativa L.) seed yield components. This study was conducted to evaluate the effects of applying chlormequat chloride in combination with three PGRs (Naphthylacetic acid (NAA), gibberellic acid 3 (GA), and brassinolide (BR)) on seed yield, aboveground biomass, plant height, lodging, yield components. CCC was applied annually at the stooling stage while three PGRs were applied twice each year at the stages of flower bud formation and peak flowering. Results provides evidence that: (i) each PGR consistently increased seed yields, and the numbers of seeds per stem compared to untreated plants; (ii) CCC treatment reduced plant height and lodging, but also significantly decreased seed yield and did not affect aboveground biomass. (iii) effectiveness of CCC application depends on climatic conditions, especially in North-east China. (iiii) the optimum combination of CCC with a PGR to increase alfalfa seed production was failed to identify. (iiiii) no interactions between PGRs and CCC on seed yield were observed and neither the PGRs nor the CCC. But alfalfa seed yield could be improved by combining a PGR such as NAA. Our Results suggest that these PGRs could be used in alfalfa breeding to increase seed yield while maintaining high seed quality. (author)

  13. Peroxidase activity as a marker for estrogenicity

    International Nuclear Information System (INIS)

    Levy, J.; Liel, Y.; Glick, S.M.

    1981-01-01

    We examined the possibility that peroxidase activity might be a marker for estrogen activity in established estrogen-dependent tissues: dimethylbenz[a]anthracene (DMBA)-induced rat mammary tumours and human breast cancer. In DMBA-induced tumours undergoing regression after ovariectomy or tamoxifen treatment, tumour size decreased by 50%, estradiol receptors (ER) and progesterone receptors (PgR) decreased by 25 and 20%, respectively, but peroxidase activity paradoxically increased six- to sevenfold. In DMBA tumours stimulated by estradiol treatment or by the cessation of tamoxifen administration in intact rats, tumour size increased threefold. ER and PgR increased two- and threefold, respectively, while peroxidase activity decreased 50%. These data indicate an inverse relation between tumour growth, ER and PgR on the one hand, and peroxidase activity on the other. In the human breast cancers there was a singificant negative relation between the presence of ER and peroxidase activity. By using a calibrated Sephadex G-100 column it was shown that uterine peroxidase differs in molecular weight from the peroxidase of rat mammary tumours and that of human breast cancer. (author)

  14. Undernutrition and laterality of the corpus luteum affects gene expression in oviduct and uterus of pregnant ewes

    Directory of Open Access Journals (Sweden)

    V. de Brun

    2013-11-01

    Full Text Available The effect of undernutrition on gene expression of progesterone and oestrogen receptors (PGR and ESR1, and insulin-like growth factors 1 and 2 (IGF1 and IGF2 in the uterus and oviducts of ewes on day 5 after oestrus was investigated. The effect of the side of the uterus/oviduct regarding the ovary bearing a corpus luteum (CL (ipsi vs. contralateral was also analyzed. Fourteen oestrous synchronized ewes were fed either 1.5 (C, n=7 or 0.5 (L, n=7 times their maintenance requirements from the onset of the hormonal treatment (day -14, till slaughter on day 5 post-oestrus. Oviducts and samples of uterus were collected and their gene expression studied by real time RT-PCR. Undernourished ewes had greater PGR expression in the oviduct than control ewes, but lower expression of IGF1 in uterus and of IGF2 in oviducts. The ipsilateral oviduct presented lower expression of PGR, ESR1 and IGF2 mRNA than the contralateral one, but this did not occur in the uterus. In conclusion, there is an effect of undernutrition on gene expression that is transcript and organ dependent (uterus/oviduct. This work reports for the first time that growth factors and sex steroid receptor expression on day 5 after oestrus vary depending on the side of the CL-bearing ovary and the region of the reproductive tract.

  15. Assessment of exchange of crop in view of change climate and International Treaties.

    Science.gov (United States)

    Singh, Anil Kumar; Pedapati, Annitaa; Manibhushan

    2015-01-01

    To meet the UN millennium development goal of reducing the number of hungry people to half by 2015, there is utmost need to breed potentially high yielding varieties to match up the requirement along with corrective measures to bridge the gap between the potential yield and yield harvested by farmers. The scenario has changed from free access to limited access of plant genetic resources (PGR) and therefore, it is important to understand the issues in view of national and international agreements, intellectual property rights (IPR'S), climate change conditions and expanded scope of breeders and farmers rights for developed genotypes. For efficient management of PGR, developing countries need to understand the implications of PGR related IPR'S as stronger IPR'S in developed countries could have harmful effects by reduced exchange of genetic resources from developed countries. Keeping in view the existing realities every possible effort should be taken for enrichment of crop gene pool by introducing them from each and every corner of the globe. Keeping these facts in view this paper describes the priorities for introduction and exchange of important crop groups/crops along with some of their potential wild and weedy relatives and thrust has been given to generate awareness among the workers engaged in the breeders/crop improvement works. Information provided in this presentation can be utilized by prospective crop improvement works to plan to meet out the nationalfood security.

  16. Breast Tissue Composition and Immunophenotype and Its Relationship with Mammographic Density in Women at High Risk of Breast Cancer.

    Directory of Open Access Journals (Sweden)

    Jia-Min B Pang

    Full Text Available To investigate the cellular and immunophenotypic basis of mammographic density in women at high risk of breast cancer.Mammograms and targeted breast biopsies were accrued from 24 women at high risk of breast cancer. Mammographic density was classified into Wolfe categories and ranked by increasing density. The histological composition and immunophenotypic profile were quantified from digitized haematoxylin and eosin-stained and immunohistochemically-stained (ERα, ERβ, PgR, HER2, Ki-67, and CD31 slides and correlated to mammographic density.Increasing mammographic density was significantly correlated with increased fibrous stroma proportion (rs (22 = 0.5226, p = 0.0088 and significantly inversely associated with adipose tissue proportion (rs (22 = -0.5409, p = 0.0064. Contrary to previous reports, stromal expression of ERα was common (19/20 cases, 95%. There was significantly higher stromal PgR expression in mammographically-dense breasts (p=0.026.The proportion of stroma and fat underlies mammographic density in women at high risk of breast cancer. Increased expression of PgR in the stroma of mammographically dense breasts and frequent and unexpected presence of stromal ERα expression raises the possibility that hormone receptor expression in breast stroma may have a role in mediating the effects of exogenous hormonal therapy on mammographic density.

  17. Zatrucie tlenkiem węgla – drogi narażenia, obraz kliniczny, metody leczenia = Carbon monoxide poisoning, routes of exposure, clinical manifestation, treatment

    Directory of Open Access Journals (Sweden)

    Magdalena Sowa

    2015-04-01

    3Wojewódzka Stacja Pogotowia Ratunkowego w Bydgoszczy   Adres do korespondencji: mgr Magdalena Sowa Katedra i Zakład Laseroterapii i Fizjoterapii Uniwersytet Mikołaja Kopernika w Toruniu Collegium Medicum im. Ludwika Rydygiera w Bydgoszczy ul. Marii Skłodowskiej – Curie 9 85 – 094 Bydgoszcz e – mail: magdalena.sowa@cm.umk.pl   Streszczenie   Wprowadzenie: Tlenek węgla (CO jest bezbarwnym, bezwonnym, niedrażniącym i toksycznym gazem, niewykrywalnym przez narządy zmysłów. Powstaje on w wyniku niecałkowitego spalenia substancji, produktów zawierających węglowodory (np. gazy przemysłowe, węgiel drewno. Według badań stanowi jedną z najczęstszych przyczyn zatruć inhalacyjnych na świecie. Cel pracy: Celem pracy była analiza dróg narażenia, obrazu klinicznego oraz metod leczenia zatrucia tlenkiem węgla. Skrócony opis stanu wiedzy: Toksyczność tegoż związku jest silnie związana z jego wysokim powinowactwem do hemoglobiny (około 200 razy większe od tlenu. Strukturami najbardziej newralgicznymi i najbardziej narażonymi na działanie CO są serce i ośrodkowy układ nerwowy (OUN. Patomechanizm działania polega na wiązaniu się tlenku węgla z atomem żelaza w cząsteczce hemu, tworząc związek zwany karboksyhemoglobiną (COHb. Wentylacja powietrzem zwierającym CO wiedzie do hipoksji tkankowej czyli niedotlenienia. Zwolnieniu, a następnie zahamowaniu ulegają metaboliczne procesy oksydacyjne, dochodzi do akumulacji kwaśnych metabolitów, przyczyniających się do rozszerzenia tętnic mózgowych a w konsekwencji przekrwienia mózgu. Podsumowanie: Liczba zatruć tlenkiem węgla w Polsce jest znacznie większa niż w innych krajach Europy. W ostatnich latach zaobserwowano znaczny spadek śmiertelności spowodowanej zatruciem CO, jednakże nadal bardzo wysoki koszt zdrowotny, wyrażający się w tysiącach pacjentów tracących zdrowie  a nawet życie, skłania do dbałości o skuteczność  działań prewencyjnych.   S

  18. Planar algebra of the subgroup-subfactor

    Indian Academy of Sciences (India)

    We think of R α G as the II1-factor (R ∪{ug: g ∈ G}) ⊂ L(L2(R)), where ug(ˆx) ..... define a global trace on P, where for 0± the trace for P0± ∼= C is the obvious identity .... function for strings is either a local maximum or a local minimum. ..... In order to understand how the inclusion tangles act on the subgroup-subfactor planar.

  19. Asian Dust Observed During the KORUS Air Quality Mission Creates Significant Super-Micron NO3-, NH4+, and SO42- Aerosols.

    Science.gov (United States)

    Heim, E. W.; Dibb, J. E.; Scheuer, E. M.

    2017-12-01

    The KORUS mission was a collaborative effort between the Korean Institute of Environmental Research and NASA. KORUS provided a comprehensive assessment of air quality in Korea during early 2016. The intensive sampling campaign was timed to assess local photochemistry during increasing solar insolation and biogenic emissions; after the April peak in outflow of pollution and dust from central China. Chinese outflow is well characterized by Silica-Calcium rich dust. Despite the effort to avoid the period with strongest dust outflow, Ca2+ was well represented in all bulk (particle diameters up to 4.5 micron) aerosol filter samples filter measurements and submicron measurements of NH4+, SO42, and NO3- made by AMS indicates substantial super-micron fractions of these anthropogenic ions at times during KORUS-AQ. During the dustiest samples (Ca2+ > 1.5ug/m3) we see marked increases in super-micron concentration of NH4+, SO42-, and NO3-, m = 1.113 ug/m3 , 2.621 ug/m3 , 4.413 ug/m3, with the super-micron contribution to total concentration averaging 47%, 45%, and 81% respectively. In contrast, low dust days (Ca2+ < 0.2ug/m3) the super-micron concentrations averaged 0.262 ug/m3, 0.510 ug/m3, -0.029 ug/m3, respectively and accounted for just 20%, 14%, and 8% of total mass. During the dust events, samples that have trajectories passing over industrial centers in eastern China approached equivalence balance between Ca2++ NH4+ and SO42-+NO3-. In contrast dusty samples that did not pass over these industrial centers during transport to the West Sea and Korea maintained excess cations, dominantly Ca2+. This suggests that dust can act as an important carrier of Chinese pollution to Korea when this saturated dust reaches the peninsula.

  20. On star-critical and upper size Ramsey numbers

    NARCIS (Netherlands)

    Zhang, Yanbo; Broersma, Haitze J.; Chen, Yaojun

    2016-01-01

    In this paper, we study the upper size Ramsey number u(G1,G2)u(G1,G2), defined by Erdős and Faudree, as well as the star-critical Ramsey number r∗(G1,G2)r∗(G1,G2), defined by Hook and Isaak. We define Ramsey-full graphs and size Ramsey good graphs, and perform a detailed study on these graphs. We

  1. Effect of gamma-irradiation on the natural occurence of Fusarium mycotoxins in wheat, flour and bread

    International Nuclear Information System (INIS)

    Aziz, N.H.; Attia, E.-S.A.; Farag, S.A.

    1997-01-01

    A survey was carried out to obtain data on the occurence of Fusarium mycotoxin in wheat and flour samples collected from local markets in Egypt and to study the influence of gamma-irradiation on controlling the occurrence of thesemycotoxins in wheat, flour and bread. Deoxynivalenol (DON) was detected in five samples of wheat at levels ranging from 103 to 287 ug/kg and one sample each of flour and bread concentrations 188 and 170 ug/kg. Zearaleone (ZEN) was detected in ten samples of wheat at levels from 28 to 42 ug/kg and four samples each of flour and bread at concentrations of 95 and 34 ug/kg, respectively. T-2 toxin was detected only in one sample each of wheat, flour and bread at concentrations of 2.9, 2.2, and 2.3 ug/kg, respectively. Gamma-irradiation at dose level of 6 kGy completely eliminated fungal flora in flour and wheat. DON, ZEN and T-2 toxin concentrations are reduced to 85, 20 and 2.0 ug/kg for wheat and to 125, 45, and 1.0 ug/kg for flour after 4 kGy exposure and a sharp drop in Fusarium toxin levels occured at 6 kGy and was eliminated at 8 kGy. Bread prepared from 6 kGy was contaminate4d with Fusarium toxin at levels below 5 ug/kg. It was noticed that gamme-irradiation reduce greatly the natural occurrence of Fusarium mycotoxins in bread

  2. Unigene BLAST: CBRC-DRER-15-0112 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-DRER-15-0112 gnl|UG|Dr#S24600640 nao61h10.y1 Zebrafish Posterior segment. Unno...rmalized (nao) Danio rerio cDNA clone nao61h10 5', mRNA sequence /clone=nao61h10 /clone_end=5' /gb=DN895013 /gi=62879776 /ug=Dr.126440 /len=809 7e-49 71% ...

  3. Unigene BLAST: CBRC-DRER-15-0109 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-DRER-15-0109 gnl|UG|Dr#S24600640 nao61h10.y1 Zebrafish Posterior segment. Unno...rmalized (nao) Danio rerio cDNA clone nao61h10 5', mRNA sequence /clone=nao61h10 /clone_end=5' /gb=DN895013 /gi=62879776 /ug=Dr.126440 /len=809 4e-51 71% ...

  4. Unigene BLAST: CBRC-DRER-15-0107 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-DRER-15-0107 gnl|UG|Dr#S24600640 nao61h10.y1 Zebrafish Posterior segment. Unno...rmalized (nao) Danio rerio cDNA clone nao61h10 5', mRNA sequence /clone=nao61h10 /clone_end=5' /gb=DN895013 /gi=62879776 /ug=Dr.126440 /len=809 3e-59 84% ...

  5. Unigene BLAST: CBRC-DRER-15-0115 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-DRER-15-0115 gnl|UG|Dr#S24600640 nao61h10.y1 Zebrafish Posterior segment. Unno...rmalized (nao) Danio rerio cDNA clone nao61h10 5', mRNA sequence /clone=nao61h10 /clone_end=5' /gb=DN895013 /gi=62879776 /ug=Dr.126440 /len=809 1e-41 67% ...

  6. Unigene BLAST: CBRC-DRER-15-0111 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-DRER-15-0111 gnl|UG|Dr#S24600640 nao61h10.y1 Zebrafish Posterior segment. Unno...rmalized (nao) Danio rerio cDNA clone nao61h10 5', mRNA sequence /clone=nao61h10 /clone_end=5' /gb=DN895013 /gi=62879776 /ug=Dr.126440 /len=809 4e-48 73% ...

  7. Unigene BLAST: CBRC-DRER-15-0105 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-DRER-15-0105 gnl|UG|Dr#S24600640 nao61h10.y1 Zebrafish Posterior segment. Unno...rmalized (nao) Danio rerio cDNA clone nao61h10 5', mRNA sequence /clone=nao61h10 /clone_end=5' /gb=DN895013 /gi=62879776 /ug=Dr.126440 /len=809 9e-35 69% ...

  8. Unigene BLAST: CBRC-DRER-15-0102 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-DRER-15-0102 gnl|UG|Dr#S24600640 nao61h10.y1 Zebrafish Posterior segment. Unno...rmalized (nao) Danio rerio cDNA clone nao61h10 5', mRNA sequence /clone=nao61h10 /clone_end=5' /gb=DN895013 /gi=62879776 /ug=Dr.126440 /len=809 7e-30 54% ...

  9. Unigene BLAST: CBRC-DRER-15-0103 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-DRER-15-0103 gnl|UG|Dr#S24600640 nao61h10.y1 Zebrafish Posterior segment. Unno...rmalized (nao) Danio rerio cDNA clone nao61h10 5', mRNA sequence /clone=nao61h10 /clone_end=5' /gb=DN895013 /gi=62879776 /ug=Dr.126440 /len=809 6e-32 56% ...

  10. Unigene BLAST: CBRC-DRER-15-0101 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-DRER-15-0101 gnl|UG|Dr#S24600640 nao61h10.y1 Zebrafish Posterior segment. Unno...rmalized (nao) Danio rerio cDNA clone nao61h10 5', mRNA sequence /clone=nao61h10 /clone_end=5' /gb=DN895013 /gi=62879776 /ug=Dr.126440 /len=809 3e-47 77% ...

  11. Unigene BLAST: CBRC-DRER-15-0113 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-DRER-15-0113 gnl|UG|Dr#S24600640 nao61h10.y1 Zebrafish Posterior segment. Unno...rmalized (nao) Danio rerio cDNA clone nao61h10 5', mRNA sequence /clone=nao61h10 /clone_end=5' /gb=DN895013 /gi=62879776 /ug=Dr.126440 /len=809 2e-51 73% ...

  12. Unigene BLAST: CBRC-DRER-15-0114 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-DRER-15-0114 gnl|UG|Dr#S24600640 nao61h10.y1 Zebrafish Posterior segment. Unno...rmalized (nao) Danio rerio cDNA clone nao61h10 5', mRNA sequence /clone=nao61h10 /clone_end=5' /gb=DN895013 /gi=62879776 /ug=Dr.126440 /len=809 1e-38 62% ...

  13. Unigene BLAST: CBRC-DRER-15-0108 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-DRER-15-0108 gnl|UG|Dr#S24600640 nao61h10.y1 Zebrafish Posterior segment. Unno...rmalized (nao) Danio rerio cDNA clone nao61h10 5', mRNA sequence /clone=nao61h10 /clone_end=5' /gb=DN895013 /gi=62879776 /ug=Dr.126440 /len=809 7e-53 74% ...

  14. Unigene BLAST: CBRC-DRER-15-0100 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-DRER-15-0100 gnl|UG|Dr#S24600640 nao61h10.y1 Zebrafish Posterior segment. Unno...rmalized (nao) Danio rerio cDNA clone nao61h10 5', mRNA sequence /clone=nao61h10 /clone_end=5' /gb=DN895013 /gi=62879776 /ug=Dr.126440 /len=809 3e-52 75% ...

  15. Unigene BLAST: CBRC-DRER-15-0106 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-DRER-15-0106 gnl|UG|Dr#S24600640 nao61h10.y1 Zebrafish Posterior segment. Unno...rmalized (nao) Danio rerio cDNA clone nao61h10 5', mRNA sequence /clone=nao61h10 /clone_end=5' /gb=DN895013 /gi=62879776 /ug=Dr.126440 /len=809 2e-51 75% ...

  16. Unigene BLAST: CBRC-DRER-15-0110 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-DRER-15-0110 gnl|UG|Dr#S24600640 nao61h10.y1 Zebrafish Posterior segment. Unno...rmalized (nao) Danio rerio cDNA clone nao61h10 5', mRNA sequence /clone=nao61h10 /clone_end=5' /gb=DN895013 /gi=62879776 /ug=Dr.126440 /len=809 2e-71 99% ...

  17. Unigene BLAST: CBRC-DRER-15-0104 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-DRER-15-0104 gnl|UG|Dr#S24600640 nao61h10.y1 Zebrafish Posterior segment. Unno...rmalized (nao) Danio rerio cDNA clone nao61h10 5', mRNA sequence /clone=nao61h10 /clone_end=5' /gb=DN895013 /gi=62879776 /ug=Dr.126440 /len=809 5e-58 79% ...

  18. Uropygial gland volatiles may code for olfactory information about sex, individual, and species in Bengalese finches Lonchura striata

    Directory of Open Access Journals (Sweden)

    Jian-Xu ZHANG et al.

    2009-10-01

    Full Text Available Over-shadowed by eye-catching vocal and visual signals, chemical communication has long been overlooked in birds. This study aimed at exploring whether volatile composition of the uropygial gland secretion (UGS of birds was associated with the information about sex, individual and species. By using dichloromethane extraction and gas chromatography-mass spectrometry (GC-MS, we analyzed the UGS volatiles of domesticated Bengalese finches (Lonchura striata, Estrildiea which is also known as white-rumped munias. We characterized 16 volatile molecules from the UGS, including eight n-alkanols, five diesters, an ester, an aldehyde and a fatty acid, and quantified them in terms of GC peak area percentages (relative abundances. Among these compounds, hexadecanol and octadecanol were major components in both sexes. The former was richer in males than females and the latter richer in females than males, suggesting that they might be male and female pheromone candidates, respectively. The high inter-individual variations, in relative abundance, of the UGS volatiles implied that they might carry information about individuality. The similarity between GC profiles of the UGS and wing feather from same individuals indicates that the birds might preen the secretion to their feathers to transmit chemical cues. Additionally, by comparing with three sympatric passerine species,i.e., zebra finches Taeniopygia guttata, yellow-bowed buntings Emberiza chrysophrys and rooks Corvus frugilegus, we found that the composition of C13-C18 alkanols in the UGS might contain information about species. Our study also show that quantitative differences (degree of same UGS volatiles might be the key for the Bengalese finch to code for information about sex and individuality whereas both the kind and degree of UGS constituents could be utilized to code for information about species [Current Zoology 55 (5:–2009].

  19. Wastewater/Storm Water Characterization and Toxicity Identification Evaluation, Sheppard Air Force Base, Texas

    Science.gov (United States)

    1991-12-01

    support the NPDES permit renewal appl ication. the studies should collect sufficient data to characterize waste streams, including wastewater and WINTP...26Apr 1 30Apr I 1May I 2May Arsenic I uiI ᝺ ᝺i ᝺  ᝺! ᝺ Barium I ug l I i  . 4001 SWot 1000 " 2600 Beryllium J ug 1 ᝺ <o 0 <o

  20. Environmental and occupational exposures to mercury among indigenous people in Dunkwa-On-Offin, a small scale gold mining area in the South-West of Ghana.

    Science.gov (United States)

    Kwaansa-Ansah, E E; Basu, N; Nriagu, J O

    2010-11-01

    Total mercury concentrations in human hair and urine samples were determined to ascertain the extent of environmental and occupational mercury exposure in Dunkwa-On-Offin, a small scale gold mining area of the central-west region of Ghana. In all ninety-four (94) hair and urine samples comprising of forty (40) small scale miners and fifty-four (54) farmers were collected and analyzed for their total mercury levels using the cold vapour atomic absorption spectrometry. The hair total mercury concentrations ranged from 0.63 to 7.19 ug/g with a mean of 2.35 ± 1.58 ug/g for the farmers and 0.57-6.07 ug/g with a mean of 2.14 ± 1.53 ug/g for the small scale gold miners. There was no significant correlation between the total mercury concentration and the average weekly fish diet. The total mercury concentrations in urine of the miners were higher than those of the farmers and ranged from 0.32 to 3.62 ug/L with a mean of 1.23 ± 0.86 ug/L. The urine concentrations of farmers ranged from 0.075 to 2.31 ug/L with a mean of 0.69 ± 0.39 ug/L. Although the results indicate elevated internal dose of mercury the current levels of exposures do not appear to pose a significant health threat to the people.