WorldWideScience

Sample records for methodological challenges ssa

  1. Methodological Challenges in Estimating Trends and Burden of Cardiovascular Disease in Sub-Saharan Africa

    Directory of Open Access Journals (Sweden)

    Jacob K. Kariuki

    2015-01-01

    Full Text Available Background. Although 80% of the burden of cardiovascular disease (CVD is in developing countries, the 2010 global burden of disease (GBD estimates have been cited to support a premise that sub-Saharan Africa (SSA is exempt from the CVD epidemic sweeping across developing countries. The widely publicized perspective influences research priorities and resource allocation at a time when secular trends indicate a rapid increase in prevalence of CVD in SSA by 2030. Purpose. To explore methodological challenges in estimating trends and burden of CVD in SSA via appraisal of the current CVD statistics and literature. Methods. This review was guided by the Critical review methodology described by Grant and Booth. The review traces the origins and evolution of GBD metrics and then explores the methodological limitations inherent in the current GBD statistics. Articles were included based on their conceptual contribution to the existing body of knowledge on the burden of CVD in SSA. Results/Conclusion. Cognizant of the methodological challenges discussed, we caution against extrapolation of the global burden of CVD statistics in a way that underrates the actual but uncertain impact of CVD in SSA. We conclude by making a case for optimal but cost-effective surveillance and prevention of CVD in SSA.

  2. The Case for GEO Hosted SSA Payloads

    Science.gov (United States)

    Welsch, C.; Armand, B.; Repp, M.; Robinson, A.

    2014-09-01

    Space situational awareness (SSA) in the geosynchronous earth orbit (GEO) belt presents unique challenges, and given the national importance and high value of GEO satellites, is increasingly critical as space becomes more congested and contested. Space situational awareness capabilities can serve as an effective deterrent against potential adversaries if they provide accurate, timely, and persistent information and are resilient to the threat environment. This paper will demonstrate how simple optical SSA payloads hosted on GEO commercial and government satellites can complement the SSA mission and data provided by Space-Based Space Surveillance (SBSS) and the Geosynchronous Space Situational Awareness Program (GSSAP). GSSAP is built by Orbital Sciences Corporation and launched on July 28, 2014. Analysis performed for this paper will show how GEO hosted SSA payloads, working in combination with SBSS and GSSAP, can increase persistence and timely coverage of high value assets in the GEO belt. The potential to further increase GEO object identification and tracking accuracy by integrating SSA data from multiple sources across different viewing angles including GEO hosted SSA sources will be addressed. Hosting SSA payloads on GEO platforms also increases SSA mission architecture resiliency as the sensors are by distributed across multiple platforms including commercial platforms. This distributed architecture presents a challenging target for an adversary to attempt to degrade or disable. We will present a viable concept of operations to show how data from hosted SSA sensors could be integrated with SBSS and GSSAP data to present a comprehensive and more accurate data set to users. Lastly, we will present an acquisition approach using commercial practices and building on lessons learned from the Commercially Hosted Infra Red Payload CHIRP to demonstrate the affordability of GEO hosted SSA payloads.

  3. Evaluating Options for Civil Space Situational Awareness (SSA)

    Science.gov (United States)

    Lal, B.; Carioscia, S. A.

    In recent years, the number of active satellites and human-made orbital space debris has increased dramatically. An expansion of activities in space, as is currently being proposed by many commercial and international entities, is expected to further exacerbate this challenge. The 18th Space Control Squadron under the Department of Defense (DOD) United States Strategic Command provides space situational awareness (SSA) services to users outside the national security community at no cost. International and commercial users demand better SSA service than is currently feasible, and the demand comes at a time when DOD is under pressure to better prepare for and respond to growing space-based threats to national security. Concerned about the possibility of overextending across conflicting missions in a fiscally constrained environment, some DOD officials have publicly noted a desire to move SSA services not related to national security out of DOD purview. Responding to a request from the Federal Aviation Administration (FAA) Office of Commercial Space Transportation (AST), researchers at the Science and Technology Policy Institute (STPI) identified and evaluated potential approaches for providing SSA services for civil and commercial operations in space. In this paper, we summarize the report [1] and present the pros and cons of four approaches to the provision of civil SSA services in the United States: (1) maintaining status quo through continued provision by DOD; (2) provision by a civil government entity; (3) industry self-provision; and (4) provision by an international organization. Within the second approach, assuming the provision of SSA by a civil agency, STPI further identified and discussed four options: (1) civil agency service capability embedded within DOD; (2) independent civil service capability, using DOD software and systems; (3) independent civil service capability, using commercial software and systems; and (4) the government certifies non

  4. The colour potentials of SSA-containing mortar

    DEFF Research Database (Denmark)

    Kappel, Annemette; Ottosen, Lisbeth M.; Kirkelund, Gunvor Marie

    2015-01-01

    This paper reports an experimental study of aesthetical qualities of mortar containing sewage sludgeash (SSA). SSA is the residue produced at water treatment plants where incineration of the sludge is applied in order to decrease volume and to prevent pathogens from spreading. Today SSA is with a......This paper reports an experimental study of aesthetical qualities of mortar containing sewage sludgeash (SSA). SSA is the residue produced at water treatment plants where incineration of the sludge is applied in order to decrease volume and to prevent pathogens from spreading. Today SSA...

  5. Dicty_cDB: SSA423 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SS (Link to library) SSA423 (Link to dictyBase) - - - - SSA423F (Link to Original s...ite) SSA423F 443 - - - - - - Show SSA423 Library SS (Link to library) Clone ID SSA423 (Link to dictyBase) Atlas ID - NBRP ID - dict...yBase ID - Link to Contig - Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/...FIIGFFLCLTVFLTFVNSSEIDHQYSLTSSINGSSSGVSNSTDNTGCGEYTSCGDCREDK GCVWCGSEGICTEGTFYGTKPLNINGACKDFMWMQCKIQGRWAILIA...VSNSTDNTGCGEYTSCGDCREDK GCVWCGSEGICTEGTFYGTKPLNINGACKDFMWMQCKIQGRWAILIAAGGAFLIIVFFFI CLCCCCCRRKKDKHYHNIQDDET

  6. Dicty_cDB: SSA581 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SS (Link to library) SSA581 (Link to dictyBase) - - - Contig-U12576-1 SSA581Z (Link... to Original site) - - SSA581Z 504 - - - - Show SSA581 Library SS (Link to library) Clone ID SSA581 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U12576-1 Original site URL http://dict...SARPLGVAMILIGIDDELGPQLFKVDPAGVFTGYKATAAGEK EQESTNFLEKKFKSNPQLSKDETIQMAISTLQSVLGADLKSSDLEIGICTMDNRKFVIMT DEDI...QHASARPLGVAMILIGIDDELGPQLFKVDPAGVFTGYKATAAGEK EQESTNFLEKKFKSNPQLSKDETIQMAISTLQSVLGADLKSSDLEIGICTMDNRKFVIMT D

  7. Sessile serrated adenoma (SSA) vs. traditional serrated adenoma (TSA).

    Science.gov (United States)

    Torlakovic, Emina Emilia; Gomez, Jose D; Driman, David K; Parfitt, Jeremy R; Wang, Chang; Benerjee, Tama; Snover, Dale C

    2008-01-01

    The morphologic distinction between various serrated polyps of the colorectum may be challenging. The distinction between sessile serrated adenoma (SSA) and traditional serrated adenoma (TSA) may be difficult using currently available criteria mostly based on cytologic characteristics. We have evaluated 66 serrated polyps including 29 SSA, 18 TSA, and 19 hyperplastic polyps for overall shape of the polyps, architectural features of individual crypts, the presence of eosinophilic cytoplasm, size and distribution of the proliferation and maturation zones, as well as Ki-67 and CK20 expression. The extent of the expression of CK20 and Ki-67 could not distinguish between the 3 types of serrated polyps, but the distribution of their expression was very helpful and differences were statistically significant. The distribution of Ki-67+ cells was the single most helpful distinguishing feature of the serrated polyp type (PTSA had low Ki-67 expression, which was limited to "ectopic crypts" and admixed tubular adenomalike areas. In serrated polyps, ectopic crypt formation (ECF) defined by the presence of ectopic crypts with their bases not seated adjacent to the muscularis mucosae was nearly exclusive to TSA and was found in all cases, while the presence of cytologic atypia and eosinophilia of the cytoplasm were characteristic, but not limited to TSA. No evidence of ECF, but nevertheless abnormal distribution of proliferation zone was characteristic of SSA, whereas HP had neither. The presence of the ECF defines TSA in a more rigorous fashion than previous diagnostic criteria and also explains the biologic basis of exuberant protuberant growth associated with TSA and the lack of such growth in SSA. Recognition of this phenomenon may also help in exploring the genetic and molecular basis for differences between SSA and TSA, because these architectural abnormalities may well be a reflection of abnormalities in genetically programmed mucosal development.

  8. Dicty_cDB: SSA564 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SS (Link to library) SSA564 (Link to dictyBase) - - - - SSA564F (Link to Original s...ite) SSA564F 653 - - - - - - Show SSA564 Library SS (Link to library) Clone ID SSA564 (Link to dictyBase) Atlas ID - NBRP ID - dict...yBase ID - Link to Contig - Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/...NNTLKPKQTTKGFNIGGQPGNPTN*l--- Frame C: tlkfvmplvmkictslvlvlkrstk*rklfmmenshqtldgl...bits) Value N M77492 |M77492.1 Dictyostelium discoideum glycoprotein phosphorylase 2 (glpD) gene, complete c

  9. Systematic Sustainability Assessment (SSA) Tool for Hydroelectric Project in Malaysia

    Science.gov (United States)

    Turan, Faiz Mohd; Johan, Kartina

    2017-08-01

    Sustainably developed and managed hydropower has enormous potential to contribute to global sustainability goals. It is known that hydroelectricity contributing small amounts to greenhouse gas emissions and other atmospheric pollutants. However, developing the remaining hydroelectric potential offers many challenges, and public pressure and expectations on the environmental and social performance of hydroelectric tend to increase over time. This paper aims to develop Systematic Sustainability Assessment (SSA) Tool that promotes and guides more sustainable hydroelectric projects in the context of Malaysia. The proposed SSA tool which not only provide a quality and quantitative report of sustainability performance but also act as Self-Assessment Report (SAR) to provide roadmap to achieve greater level of sustainability in project management for continuous improvement. It is expected to provide a common language that allow government, civil society, financial institutions and the hydroelectric sector to talk about and evaluate sustainability issues. The advantage of SSA tool is it can be used at any stage of hydroelectric development, from the earliest planning stages right through to operation.

  10. Delivering SSA Capabilities to the Warfighter

    Science.gov (United States)

    van Weezendonk, J.; Sherk, J.; Ryan, T.; McGuire, R.

    The Space Superiority Systems Wing at the Space and Missile Center (SMC/SY) equips US forces with Offensive Counterspace (OCS), Defensive Counterspace (DCS), and Space Situation Awareness (SSA) systems that further enhance space superiority. The Technology Division (SYT) mission is to identify, develop, and transition cutting-edge technologies to the warfighter. SYT invests in the most relevant technologies for SSA, DCS and OCS that enhance SMC/SY's portfolio. This presentation will provide an overview of the SMC/SY SSA Technology being worked and highlights several key programs. The presentation will also highlight how the SMC/SY SSA efforts fit into to a Space Superiority Architecture. SYT executes its own Space Control Technology program line and leverages technologies from various DoD and national laboratories, Federally Funded Research and Development Companies, national agencies, industry and academia to accomplish their mission. The portions of the SY FY06 SSA portfolio that will be discussed are: Precision Metrics, Star Sensor Studies, Multi-mission Deployable Optical System, Intelligent Agent Data Fusion efforts, ESSA ACTD and the GReAT tech demo.

  11. Non-traditional Sensor Tasking for SSA: A Case Study

    Science.gov (United States)

    Herz, A.; Herz, E.; Center, K.; Martinez, I.; Favero, N.; Clark, C.; Therien, W.; Jeffries, M.

    Industry has recognized that maintaining SSA of the orbital environment going forward is too challenging for the government alone. Consequently there are a significant number of commercial activities in various stages of development standing-up novel sensors and sensor networks to assist in SSA gathering and dissemination. Use of these systems will allow government and military operators to focus on the most sensitive space control issues while allocating routine or lower priority data gathering responsibility to the commercial side. The fact that there will be multiple (perhaps many) commercial sensor capabilities available in this new operational model begets a common access solution. Absent a central access point to assert data needs, optimized use of all commercial sensor resources is not possible and the opportunity for coordinated collections satisfying overarching SSA-elevating objectives is lost. Orbit Logic is maturing its Heimdall Web system - an architecture facilitating “data requestor” perspectives (allowing government operations centers to assert SSA data gathering objectives) and “sensor operator” perspectives (through which multiple sensors of varying phenomenology and capability are integrated via machine -machine interfaces). When requestors submit their needs, Heimdall’s planning engine determines tasking schedules across all sensors, optimizing their use via an SSA-specific figure-of-merit. ExoAnalytic was a key partner in refining the sensor operator interfaces, working with Orbit Logic through specific details of sensor tasking schedule delivery and the return of observation data. Scant preparation on both sides preceded several integration exercises (walk-then-run style), which culminated in successful demonstration of the ability to supply optimized schedules for routine public catalog data collection – then adapt sensor tasking schedules in real-time upon receipt of urgent data collection requests. This paper will provide a

  12. 77 FR 38880 - Privacy Act of 1974, as Amended; Computer Matching Program (SSA/Railroad Retirement Board (SSA...

    Science.gov (United States)

    2012-06-29

    ... Security Administration (SSA). ACTION: Notice of a renewal of an existing computer matching program that... regarding protections for such persons. The Privacy Act, as amended, regulates the use of computer matching... SOCIAL SECURITY ADMINISTRATION [Docket No. SSA 2012-0002] Privacy Act of 1974, as Amended...

  13. SSA Disability Claim Data

    Data.gov (United States)

    Social Security Administration — The dataset includes fiscal year data for initial claims for SSA disability benefits that were referred to a state agency for a disability determination. Specific...

  14. The Aesthetical quality of SSA-containing mortar and concrete

    DEFF Research Database (Denmark)

    Kappel, Annemette; Kirkelund, Gunvor Marie; Ottosen, Lisbeth M.

    2014-01-01

    that gives a characteristic red colour. The process of grinding SSA has shown to improve the compressive strength of SSA- containing mortar (Donatello et al. 2010). Thus, in this study SSA was grinded in 6 different intervals ranging from 0 – 10 min, and then added to the mortar mix replacing 20% of cement....... The experiment revealed that the colour of the SSA-containing mortar intensified as the time interval of the grinding process increased. Each of the 6 steps within the time interval provided an additional colour tone and generated a colour scale consisting of mortar samples ranging from greyish to a more...

  15. SINGULAR SPECTRUM ANALYSIS: METHODOLOGY AND APPLICATION TO ECONOMICS DATA

    Institute of Scientific and Technical Information of China (English)

    Hossein HASSANI; Anatoly ZHIGLJAVSKY

    2009-01-01

    This paper describes the methodology of singular spectrum analysis (SSA) and demonstrate that it is a powerful method of time series analysis and forecasting, particulary for economic time series. The authors consider the application of SSA to the analysis and forecasting of the Iranian national accounts data as provided by the Central Bank of the Islamic Republic of lran.

  16. The organic fraction of bubble-generated, accumulation mode Sea Spray Aerosol (SSA

    Directory of Open Access Journals (Sweden)

    R. L. Modini

    2010-03-01

    Full Text Available Recent studies have detected a dominant accumulation mode (~100 nm in the Sea Spray Aerosol (SSA number distribution. There is evidence to suggest that particles in this mode are composed primarily of organics. To investigate this hypothesis we conducted experiments on NaCl, artificial SSA and natural SSA particles with a Volatility-Hygroscopicity-Tandem-Differential-Mobility-Analyser (VH-TDMA. NaCl particles were atomiser generated and a bubble generator was constructed to produce artificial and natural SSA particles. Natural seawater samples for use in the bubble generator were collected from biologically active, terrestrially-affected coastal water in Moreton Bay, Australia. Differences in the VH-TDMA-measured volatility curves of artificial and natural SSA particles were used to investigate and quantify the organic fraction of natural SSA particles. Hygroscopic Growth Factor (HGF data, also obtained by the VH-TDMA, were used to confirm the conclusions drawn from the volatility data. Both datasets indicated that the organic fraction of our natural SSA particles evaporated in the VH-TDMA over the temperature range 170–200 °C. The organic volume fraction for 71–77 nm natural SSA particles was 8±6%. Organic volume fraction did not vary significantly with varying water residence time (40 s to 24 h in the bubble generator or SSA particle diameter in the range 38–173 nm. At room temperature we measured shape- and Kelvin-corrected HGF at 90% RH of 2.46±0.02 for NaCl, 2.35±0.02 for artifical SSA and 2.26±0.02 for natural SSA particles. Overall, these results suggest that the natural accumulation mode SSA particles produced in these experiments contained only a minor organic fraction, which had little effect on hygroscopic growth. Our measurement of 8±6% is an order of magnitude below two previous measurements of the organic fraction in SSA particles of comparable sizes. We stress that our results were obtained using coastal seawater and

  17. Preliminary approach of the MELiSSA loop energy balance

    Science.gov (United States)

    Poulet, Lucie; Lamaze, Brigitte; Lebrun, Jean

    Long duration missions, such as the establishment of permanent bases on the lunar surface or the travel to Mars, require a huge amount of life support consumables (e.g. food, water and oxygen). Current rockets are at the moment unable to launch such a mass from Earth. Consequently Regenerative Life Support Systems are necessary to sustain long-term manned space mission to increase recycling rates and so reduce the launched mass. Thus the European and Canadian research has been concentrating on the MELiSSA (Micro-Ecological Life Support System Alternative) project over the last 20 years. MELiSSA is an Environmental Controlled Life Support System (ECLSS), i.e. a closed regenerative loop inspired of a lake ecosystem. Using light as a source of energy, MELiSSA's goal is the recovery of food, water and oxygen from CO2 and organic wastes, using microorganisms and higher plants. The architecture of a ECLSS depends widely on the mission scenario. To compare several ECLSS architectures and in order to be able to evaluate them, ESA is developing a multi criteria evaluation tool: ALISSE (Advanced LIfe Support System Evaluator). One of these criteria is the energy needed to operate the ECLSS. Unlike other criteria like the physical mass, the energy criterion has not been investigated yet and needs hence a detailed analysis. It will consequently be the focus of this study. The main objective of the work presented here is to develop a dynamic tool able to estimate the energy balance for several configurations of the MELiSSA loop. The first step consists in establishing the energy balance using concrete figures from the MELiSSA Pilot Plant (MPP). This facility located at the Universitat Autonoma de Barcelona (UAB) is aimed at the ground demonstration of the MELiSSA loop. The MELiSSA loop is structured on several subsystems; each of them is characterized by supplies, exhausts and process reactions. For the purpose of this study (i.e. a generic tool) the solver EES (Engineering

  18. 76 FR 41685 - Electronic Substitutions for Form SSA-538

    Science.gov (United States)

    2011-07-15

    ... visit our Internet site, Social Security Online, at http://www.socialsecurity.gov . SUPPLEMENTARY... SOCIAL SECURITY ADMINISTRATION 20 CFR Part 416 [Docket No. SSA-2009-0027] RIN 0960-AH02 Electronic Substitutions for Form SSA-538 AGENCY: Social Security Administration. ACTION: Final rule with request for...

  19. SSA State Agency Workload Data

    Data.gov (United States)

    Social Security Administration — The dataset is revised and expanded from 4 to 71 data fields. It includes monthly data from October 2000 onwards for SSA disability cases that were referred to the...

  20. GillespieSSA: Implementing the Gillespie Stochastic Simulation Algorithm in R

    Directory of Open Access Journals (Sweden)

    Mario Pineda-Krch

    2008-02-01

    Full Text Available The deterministic dynamics of populations in continuous time are traditionally described using coupled, first-order ordinary differential equations. While this approach is accurate for large systems, it is often inadequate for small systems where key species may be present in small numbers or where key reactions occur at a low rate. The Gillespie stochastic simulation algorithm (SSA is a procedure for generating time-evolution trajectories of finite populations in continuous time and has become the standard algorithm for these types of stochastic models. This article presents a simple-to-use and flexible framework for implementing the SSA using the high-level statistical computing language R and the package GillespieSSA. Using three ecological models as examples (logistic growth, Rosenzweig-MacArthur predator-prey model, and Kermack-McKendrick SIRS metapopulation model, this paper shows how a deterministic model can be formulated as a finite-population stochastic model within the framework of SSA theory and how it can be implemented in R. Simulations of the stochastic models are performed using four different SSA Monte Carlo methods: one exact method (Gillespie's direct method; and three approximate methods (explicit, binomial, and optimized tau-leap methods. Comparison of simulation results confirms that while the time-evolution trajectories obtained from the different SSA methods are indistinguishable, the approximate methods are up to four orders of magnitude faster than the exact methods.

  1. Qualitative interviewing: methodological challenges in Arab settings.

    Science.gov (United States)

    Hawamdeh, Sana; Raigangar, Veena

    2014-01-01

    To explore some of the main methodological challenges faced by interviewers in Arab settings, particularly during interviews with psychiatric nurses. Interviews are a tool used commonly in qualitative research. However, the cultural norms and practices of interviewees must be considered to ensure that an appropriate interviewing style is used, a good interviewee-interviewer relationship formed and consent for participation obtained sensitively. A study to explore the nature of psychiatric nurses' practices that used unstructured interviews. This is a methodology paper that discusses a personal experience of addressing many challenges that are specific to qualitative interviewing in Arab settings, supported by literature on the topic. Suggestions for improving the interview process to make it more culturally sensitive are provided and recommendations for future research are made. Openness, flexibility and a reflexive approach by the researcher can help manage challenges in Arab settings. Researchers should allow themselves to understand the cultural elements of a population to adapt interviewing methods with the aim of generating high quality qualitative research.

  2. A New Trend-Following Indicator: Using SSA to Design Trading Rules

    Science.gov (United States)

    Leles, Michel Carlo Rodrigues; Mozelli, Leonardo Amaral; Guimarães, Homero Nogueira

    Singular Spectrum Analysis (SSA) is a non-parametric approach that can be used to decompose a time-series as trends, oscillations and noise. Trend-following strategies rely on the principle that financial markets move in trends for an extended period of time. Moving Averages (MAs) are the standard indicator to design such strategies. In this study, SSA is used as an alternative method to enhance trend resolution in comparison with the traditional MA. New trading rules using SSA as indicator are proposed. This paper shows that for the Down Jones Industrial Average (DJIA) and Shangai Securities Composite Index (SSCI) time-series the SSA trading rules provided, in general, better results in comparison to MA trading rules.

  3. Challenges and Opportunities for Harmonizing Research Methodology

    DEFF Research Database (Denmark)

    van Hees, V. T.; Thaler-Kall, K.; Wolf, K. H.

    2016-01-01

    Objectives: Raw accelerometry is increasingly being used in physical activity research, but diversity in sensor design, attachment and signal processing challenges the comparability of research results. Therefore, efforts are needed to harmonize the methodology. In this article we reflect on how...... increased methodological harmonization may be achieved. Methods: The authors of this work convened for a two-day workshop (March 2014) themed on methodological harmonization of raw accelerometry. The discussions at the workshop were used as a basis for this review. Results: Key stakeholders were identified...... as manufacturers, method developers, method users (application), publishers, and funders. To facilitate methodological harmonization in raw accelerometry the following action points were proposed: i) Manufacturers are encouraged to provide a detailed specification of their sensors, ii) Each fundamental step...

  4. Preliminary study of the space adaptation of the MELiSSA life support system

    Science.gov (United States)

    Mas-Albaigès, Joan L.; Duatis, Jordi; Podhajsky, Sandra; Guirado, Víctor; Poughon, Laurent

    MELiSSA (Micro-Ecological Life Support System Alternative) is an European Space Agency (ESA) project focused on the development of a closed regenerative life support system to aid the development of technologies for future life support systems for long term manned planetary missions, e.g. a lunar base or missions to Mars. In order to understand the potential evolution of the MELiSSA concept towards its future use in the referred manned planetary mission context the MELiSSA Space Adaptation (MSA) activity has been undertaken. MSA's main objective is to model the different MELiSSA compartments using EcosimPro R , a specialized simulation tool for life support applications, in order to define a preliminary MELiSSA implementation for service in a man-tended lunar base scenario, with a four-member crew rotating in six-month increments, and performing the basic LSS functions of air revitalization, food production, and waste and water recycling. The MELiSSA EcosimPro R Model features a dedicated library for the different MELiSSA elements (bioreactors, greenhouse, crew, interconnecting elements, etc.). It is used to dimension the MELiSSA system in terms of major parameters like mass, volume and energy needs, evaluate the accuracy of the results and define the strategy for a progressive loop closure from the initial required performance (approx.100 The MELiSSA configuration(s) obtained through the EcosimPro R simulation are further analysed using the Advanced Life Support System Evaluation (ALISSE) metric, relying on mass, energy, efficiency, human risk, system reliability and crew time, for trade-off and optimization of results. The outcome of the MSA activity is, thus, a potential Life Support System architecture description, based on combined MELiSSA and other physico-chemical technologies, defining its expected performance, associated operational conditions and logistic needs.

  5. Validation of IPS Single-Station Analysis (SSA) Using MEXART Routines in Multi-Station Spectra. Comparison with Cross Correlation Function (CCF) Analysis.

    Science.gov (United States)

    Bisi, M. M.; Chang, O.; Gonzalez-Esparza, A.; Fallows, R. A.; Aguilar-Rodriguez, E.

    2017-12-01

    The phenomenon of Interplanetary Scintillation (IPS) occurs from the scattering of radio waves coming from compact radio sources that cross electron density fluctuations in the interplanetary medium. By analyzing these fluctuations in the measurements of flux intensity of galactic (compact) radio sources in a radio telescope, it is possible to infer some properties of structures in the solar wind. Studies based on observations of IPS have provided valuable information on the physics of the internal heliosphere for over 50 years. There are two techniques that provide IPS results: 1) Single-Station Analysis (SSA), where a theoretical model is fitted to the observed spectrum; and 2) Cross-Correlation Function (CCF), where two antennas separated by a few hundred kilometers simultaneously and independently observe the same radio source. In order to combine and complement solar wind speed determinations, it is important to validate the results of these two IPS techniques. In this work we analyze events from previously studied observations from MERLIN (Multi-Element Radio-Linked Interferometer Network) using the CCF methodology. The SSA model fit is applied to these observations and compared with the previous results to validate the two techniques. The objective is to know the behavior of the parameters in cases studied by CCFs that can be implemented in the SSA model. This work studies the capability of SSA model fit to describe complex events in the interplanetary environment and seeks to improve the adjustment of parameters from individual spectra to the theoretical model. The validation of these two methodologies is important to be able to combine data in real time from different radio telescopes which is necessary for the success of the Worldwide Interplanetary Scintillation Stations (WIPSS) Network to monitor solar wind structures using IPS data.

  6. Clinical and Pathological Roles of Ro/SSA Autoantibody System

    Directory of Open Access Journals (Sweden)

    Ryusuke Yoshimi

    2012-01-01

    Full Text Available Anti-Ro/SSA antibodies are among the most frequently detected autoantibodies against extractable nuclear antigens and have been associated with systemic lupus erythematosus (SLE and Sjögren's syndrome (SS. Although the presence of these autoantibodies is one of the criteria for the diagnosis and classification of SS, they are also sometimes seen in other systemic autoimmune diseases. In the last few decades, the knowledge of the prevalence of anti-Ro/SSA antibodies in various autoimmune diseases and symptoms has been expanded, and the clinical importance of these antibodies is increasing. Nonetheless, the pathological role of the antibodies is still poorly understood. In this paper, we summarize the milestones of the anti-Ro/SSA autoantibody system and provide new insights into the association between the autoantibodies and the pathogenesis of autoimmune diseases.

  7. Methodological challenges and lessons learned

    DEFF Research Database (Denmark)

    Nielsen, Poul Erik; Gustafsson, Jessica

    2017-01-01

    Taking as point of departure three recently conducted empirical studies, the aim of this article is to theoretically and empirically discuss methodological challenges studying the interrelations between media and social reality and to critically reflect on the methodologies used in the studies....... By deconstructing the studies, the article draws attention to the fact that different methods are able to grasp different elements of social reality. Moreover, by analysing the power relations at play, the article demonstrated that the interplay between interviewer and interviewee, and how both parties fit...... into present power structures, greatly influence the narratives that are co-produced during interviews. The article thus concludes that in order to fully understand complex phenomena it is not just enough to use a mixture of methods, the makeup of the research team is also imperative, as a diverse team...

  8. Arctic Region Space Weather Customers and SSA Services

    DEFF Research Database (Denmark)

    Høeg, Per; Kauristi, Kirsti; Wintoft, Peter

    Arctic inhabitants, authorities, and companies rely strongly on precise localization information and communication covering vast areas with low infrastructure and population density. Thus modern technology is crucial for establishing knowledge that can lead to growth in the region. At the same time...... and communication can be established without errors resulting from Space Weather effects. An ESA project have identified and clarified, how the products of the four ESA Space Weather Expert Service Centres (SWE) in the ESA Space Situational Awareness Programme (SSA), can contribute to the requirements of SSA...

  9. Evolution of ESA's SSA Conjunction Prediction Service

    Science.gov (United States)

    Escobar, D.; Sancho, A. Tirado, J.; Agueda, A.; Martin, L.; Luque, F.; Fletcher, E.; Navarro, V.

    2013-08-01

    This paper presents the recent evolution of ESA's SSA Conjunction Prediction Service (CPS) as a result of an on-going activity in the Space Surveillance and Tracking (SST) Segment of ESA's Space Situational Awareness (SSA) Programme. The CPS is one of a number of precursor services being developed as part of the SST segment. It has been implemented as a service to provide external users with web-based access to conjunction information and designed with a service-oriented architecture. The paper encompasses the following topics: service functionality enhancements, integration with a live objects catalogue, all vs. all analyses supporting an operational concept based on low and high fidelity screenings, and finally conjunction detection and probability algorithms.

  10. App Studies : Platform Rules and Methodological Challenges

    NARCIS (Netherlands)

    Gerlitz, C.; Helmond, A.; van der Vlist, F.; Weltevrede, E.; De Groote, S.; Majmundar, P.

    2016-01-01

    The panel engages with conceptual and methodological challenges within a specific area of ‘internet rules’, namely the space of mobile apps. Whereas the web was set out to function as a ‘generative’ and open technology facilitating the production of unanticipated services and applications, the

  11. MELiSSA celebrates 25 years of research into life support

    International Nuclear Information System (INIS)

    2015-01-01

    MELiSSA (Micro-Ecological Life Support System Alternative) is a collaborative project with the European Space Agency ESA and various other scientific partners. The objective of MELiSSA is to develop a system that is able to provide manned space missions with food, drinking water and oxygen autonomously in space. Drinkable water and oxygen are currently being made in the international space station ISS by filtering waste water and by electrolysing water. However, such physiochemical technologies do not offer a solution for food. The MELiSSA project intends to reuse waste products, which include CO2, water, stools and urine from the astronauts, and even the perspiration moisture in the cabin and to transfer these into food through the use of micro-organisms.

  12. Theoretical White Dwarf Spectra on Demand: TheoSSA

    Science.gov (United States)

    Ringat, E.; Rauch, T.

    2010-11-01

    In the last decades, a lot of progress was made in spectral analysis. The quality (e.g. resolution, S/N ratio) of observed spectra has improved much and several model-atmosphere codes were developed. One of these is the ``Tübingen NLTE Model-Atmosphere Package'' (TMAP), that is a highly developed program for the calculation of model atmospheres of hot, compact objects. In the framework of the German Astrophysical Virtual Observatory (GAVO), theoretical spectral energy distributions (SEDs) can be downloaded via TheoSSA. In a pilot phase, TheoSSA is based on TMAP model atmospheres. We present the current state of this VO service.

  13. Assessing species saturation: conceptual and methodological challenges.

    Science.gov (United States)

    Olivares, Ingrid; Karger, Dirk N; Kessler, Michael

    2018-05-07

    Is there a maximum number of species that can coexist? Intuitively, we assume an upper limit to the number of species in a given assemblage, or that a lineage can produce, but defining and testing this limit has proven problematic. Herein, we first outline seven general challenges of studies on species saturation, most of which are independent of the actual method used to assess saturation. Among these are the challenge of defining saturation conceptually and operationally, the importance of setting an appropriate referential system, and the need to discriminate among patterns, processes and mechanisms. Second, we list and discuss the methodological approaches that have been used to study species saturation. These approaches vary in time and spatial scales, and in the variables and assumptions needed to assess saturation. We argue that assessing species saturation is possible, but that many studies conducted to date have conceptual and methodological flaws that prevent us from currently attaining a good idea of the occurrence of species saturation. © 2018 Cambridge Philosophical Society.

  14. TiSSA eelkonverents doktorantidele Tallinnas / Koidu Saame

    Index Scriptorium Estoniae

    Saame, Koidu

    2010-01-01

    Tallinna Ülikoolis toimunud TiSSA doktorantide eelkonverentsist 22.-24. aug. 2010.a. Doktorantide ettekannetest. Esinesid: Hans-Uwe Otto, Andriy Yuryev, Tiina Naarits, Ivar Tröner, Koidu Saame, Maija Jäppinen, Janissa Miettinen

  15. BOREAS TE-01 SSA Soil Lab Data

    Data.gov (United States)

    National Aeronautics and Space Administration — ABSTRACT: This data set provides a set of soil properties for the SSA. The soil samples were collected at sets of soil pits. Major soil properties include soil...

  16. BOREAS TE-01 SSA Soil Lab Data

    Data.gov (United States)

    National Aeronautics and Space Administration — This data set provides a set of soil properties for the SSA. The soil samples were collected at sets of soil pits. Major soil properties include soil horizon; dry...

  17. Challenges and Prospects of Methodological Anarchism for Science ...

    African Journals Online (AJOL)

    This paper examjnes Feyerabend's idea of Methodological Anarchism. Specifically, it looks at its challenges and prospects for the growth of science and epistemology in Africa. Feyerabend's point is that people develop best in pluralistic societies; that contain many ideas, traditions and forms of life. It is argued that ...

  18. Hydraulic and mechanical behavior of landfill clay liner containing SSA in contact with leachate.

    Science.gov (United States)

    Zhang, Qian; Lu, Haijun; Liu, Junzhu; Wang, Weiwei; Zhang, Xiong

    2018-05-01

    Sewage sludge ash (SSA) produced by municipal sludge can be used as a modified additive for clay liner, and improves the working performance of landfill clay liner in contact with leachate. Under the action of landfill leachate, the permeability, shear strength, phase composition, and pore structure of the modified clay are investigated through the flexible wall permeability test, triaxial shear test, thermal gravimetric and differential thermal analysis, and low-temperature nitrogen adsorption test, respectively. The hydraulic conductivity of the modified clay containing 0-5% SSA is in the range of 3.94 × 10 -8 -1.16 × 10 -7  cm/s, and the pollutant concentration of the sample without SSA was higher than others. The shear strength of the modified clay is more than that of the traditional clay liner, the cohesion rate of modified clay increases from 32.5 to 199.91 kPa, and the internal friction angle decreases from 32.5° to 15.6°. Furthermore, the weight loss rates of the samples are 15.69%, 17.92%, 18.06%, and 20.68%, respectively, when the SSA content increases from 0% to 5%. The total pore volume and average pore diameter of the modified clay decrease with the increase in the SSA content, respectively. However, the specific area of the modified clay increases with the increase in the SSA content.

  19. BOREAS TF-01 SSA-OA Soil Characteristics Data

    Data.gov (United States)

    National Aeronautics and Space Administration — Data collected in support of the effort to characterize and interpret soil information at the SSA-OA tower site in 1994. Data collected include soil respiration,...

  20. BOREAS TF-01 SSA-OA Soil Characteristics Data

    Data.gov (United States)

    National Aeronautics and Space Administration — ABSTRACT: Data collected in support of the effort to characterize and interpret soil information at the SSA-OA tower site in 1994. Data collected include soil...

  1. Conducting Research with LGB People of Color: Methodological Challenges and Strategies

    Science.gov (United States)

    DeBlaere, Cirleen; Brewster, Melanie E.; Sarkees, Anthony; Moradi, Bonnie

    2010-01-01

    Methodological barriers have been highlighted as a primary reason for the limited research with lesbian, gay, and bisexual (LGB) people of color. Thus, strategies for anticipating and addressing potential methodological barriers are needed. To address this need, this article discusses potential challenges associated with conducting research with…

  2. Organizational ethnography and methodological angst: Myths and challenges in the field

    NARCIS (Netherlands)

    Yanow, D.

    2009-01-01

    Purpose – The purpose of this paper is to assess the myths and challenges in the field of organizational ethnography and methodological angst. Design/methodology/approach – This paper is initially written as an invited keynote address for the 3rd Annual Joint Symposium on “Current Developments in

  3. The relationship of the lipoprotein SsaB, manganese and superoxide dismutase in Streptococcus sanguinis virulence for endocarditis.

    Science.gov (United States)

    Crump, Katie E; Bainbridge, Brian; Brusko, Sarah; Turner, Lauren S; Ge, Xiuchun; Stone, Victoria; Xu, Ping; Kitten, Todd

    2014-06-01

    Streptococcus sanguinis colonizes teeth and is an important cause of infective endocarditis. Our prior work showed that the lipoprotein SsaB is critical for S. sanguinis virulence for endocarditis and belongs to the LraI family of conserved metal transporters. In this study, we demonstrated that an ssaB mutant accumulates less manganese and iron than its parent. A mutant lacking the manganese-dependent superoxide dismutase, SodA, was significantly less virulent than wild-type in a rabbit model of endocarditis, but significantly more virulent than the ssaB mutant. Neither the ssaB nor the sodA mutation affected sensitivity to phagocytic killing or efficiency of heart valve colonization. Animal virulence results for all strains could be reproduced by growing bacteria in serum under physiological levels of O(2). SodA activity was reduced, but not eliminated in the ssaB mutant in serum and in rabbits. Growth of the ssaB mutant in serum was restored upon addition of Mn(2+) or removal of O(2). Antioxidant supplementation experiments suggested that superoxide and hydroxyl radicals were together responsible for the ssaB mutant's growth defect. We conclude that manganese accumulation mediated by the SsaB transport system imparts virulence by enabling cell growth in oxygen through SodA-dependent and independent mechanisms. © 2014 John Wiley & Sons Ltd.

  4. Synthesis and crystal structures of a novel layered silicate SSA-1 and its microporous derivatives by topotactic transformation.

    Science.gov (United States)

    Takahashi, S; Kurita, Y; Ikeda, T; Miyamoto, M; Uemiya, S; Oumi, Y

    2016-10-18

    The synthesis of a novel layered silicate SSA-1 (SSA: silicate synthesized with a quaternary amine) was achieved in the SiO 2 -H 2 O-TEAOH (TEAOH: tetraethylammonium hydroxide - as an organic structural directing agent) system. The crystal structure of SSA-1 involved two silicate layers composed of bre [10T]-type CBU (Composite Building Unit) and TEAOH in interlayers. The topotactic transformation of SSA-1 by calcination was examined, resulting in a porous material (PML-1: porous material transformed from a layered silicate) with a 108 m 2 g -1 BET surface area and 0.035 cm 3 g -1 pore volume. PML-1 is a siliceous microporous material with silanols in the framework and possesses unique properties, such as hydrophilicity, in spite of all its silica composition. The most reasonable crystal structure of PML-1 was successfully determined on the basis of the crystal structure of SSA-1 by a combination of manual modelling, PXRD pattern simulation, DFT optimization and Rietveld analysis. Additionally, an interlayer expanded siliceous zeolite SSA-1 (IEZ-SSA-1) was also successfully prepared by silylation using trichloro(methyl)silane under acidic conditions. IEZ-SSA-1 showed hydrophilicity or hydrophobicity properties by changing the functional group of the pillar part in the interlayer. Additionally, IEZ-SSA-1 showed a large gas adsorption property (537 m 2 g -1 and 0.21 cm 3 g -1 ).

  5. Methodological challenges in retailer buying behaviour research

    DEFF Research Database (Denmark)

    Hansen, Tommy Holm; Skytte, Hans

    This paper presents a review of studies on retailer buying behaviour with focus on the methodological issues. It is argued that the researcher of retailer buying behaviour is faced with particular challenges regarding the sample frame, defining th of analysis, potentially small populations and low...... response rates, buying centres and product specific behaviour. At the end, the authors propose a descriptive research design that will try to take account of the mentioned issues....

  6. Do the Asian Drivers undermine the export-oriented industrialisation in SSA?

    OpenAIRE

    Kaplinsky, Raphael; Morris, Mike

    2008-01-01

    An increase in outward orientation in general, and in export-oriented manufacturing in particular is widely indicated as a suitable developmental path for SSA. The logic for this is drawn both from the demonstration effect of China and the earlier generation of Asian NICs, and from theory. However, the entry of China (and to a lesser extent India) into the global economy as a significant exporter of manufactures poses severe problems for export-oriented growth in SSA. This can be seen from SS...

  7. Spectral Analysis within the Virtual Observatory: The GAVO Service TheoSSA

    Science.gov (United States)

    Ringat, E.

    2012-03-01

    In the last decade, numerous Virtual Observatory organizations were established. One of these is the German Astrophysical Virtual Observatory (GAVO) that e.g. provides access to spectral energy distributions via the service TheoSSA. In a pilot phase, these are based on the Tübingen NLTE Model-Atmosphere Package (TMAP) and suitable for hot, compact stars. We demonstrate the power of TheoSSA in an application to the sdOB primary of AA Doradus by comparison with a “classical” spectral analysis.

  8. Sewage sludge ash (SSA in high performance concrete: characterization and application

    Directory of Open Access Journals (Sweden)

    C. M. A. Fontes

    Full Text Available ABSTRACT Sewage sludge originated from the process of treatment of wastewater has become an environmental issue for three main reasons: contains pathogens, heavy metals and organic compounds that are harmful to the environmental and human health; high volumes are daily generated; and shortage of landfill sites for proper disposal. This research deals with the viability study of sewage sludge utilization, after calcination process, as mineral admixture in the production of concrete. High-performance concretes were produced with replacement content of 5% and 10% by weight of Portland cement with sewage sludge ash (SSA. The influence of this ash was analyzed through physical and mechanical tests. Analysis showed that the mixtures containing SSA have lower values of compressive strength than the reference. The results of absorptivity, porosity and accelerated penetration of chloride ions, presents that mixtures containing ash showed reductions compared to the reference. This indicates that SSA provided refinement of the pore structure, which was confirmed by mercury intrusion porosimetry test.

  9. Biomimetics as a design methodology – possibilities and challenges

    DEFF Research Database (Denmark)

    Lenau, Torben Anker

    2009-01-01

    Biomimetics – or bionik as it is called in parts of Europe – offer a number of promising opportunities and challenges for the designer. The paper investigates how biomimetics as a design methodology is used in engineering design by looking at examples of biological searches and highlight...

  10. Lupus systémique et atteinte rénale: Apport des anticorps anti-SSA ...

    African Journals Online (AJOL)

    -SSA dans 12 cas (40%).Cinq patients (62.5%) ayant une atteinte rénale avaient des anticorps anti DNA négatifs. Parmi ces patients avec atteinte rénale, 37.5% avaient des anticorps anti SSA sans anticorps anti DNA. La moitié des patients ...

  11. Two Methodological Challenges for Teacher-Researchers: Reflexivity and Trustworthiness

    Science.gov (United States)

    Xerri, Daniel

    2018-01-01

    Teacher research is lauded as a beneficial enterprise both for practitioners and for learners. However, teachers are sometimes accused of not possessing the necessary knowledge and skills to conduct research effectively. This article focuses on the need for teacher-researchers to find means of addressing the methodological challenges of engaging…

  12. Crowdsourcing-Based Geoinformation, Disadvantaged Urbanisation Challenges, Subsaharan Africa: Theoretical Perspectives and Notes

    Directory of Open Access Journals (Sweden)

    Ingwe Richard

    2017-03-01

    Full Text Available Scholars and practitioners concerned with geoinformation, cyber-cartography, development studies, and other subjects increasingly explore crowdsourcing and its huge advantages for development. Some have advocated it for adoption/promotion by government as a means of citizen engagement. The objective of this article is to increase the appreciation of the contribution that crowdsourcing can make towards resolving challenges associated with disadvantaged urbanisation in sub-Saharan Africa (SSA. We review urban challenges of SSA and three practices of crowdsourcing: volunteered geographic information (VGI, Citizen Science (CS, and Participatory Mapping (PM. Then we examine problems associated with the advocacy for government adoption of those practices in SSA. We argue that civil society collaboration with an international governmental organisation (IGO instead of government promises a better way of adopting and promoting them. This suggestion is based on the fact that work related to this strategy is carried out by a global coalition of civil society, the UN-NGLS. This strategy promises a more rapid way of taking advantage of fast-tracking public engagement in the economic region, SSA.

  13. Economic evaluation in stratified medicine: methodological issues and challenges

    Directory of Open Access Journals (Sweden)

    Hans-Joerg eFugel

    2016-05-01

    Full Text Available Background: Stratified Medicine (SM is becoming a practical reality with the targeting of medicines by using a biomarker or genetic-based diagnostic to identify the eligible patient sub-population. Like any healthcare intervention, SM interventions have costs and consequences that must be considered by reimbursement authorities with limited resources. Methodological standards and guidelines exist for economic evaluations in clinical pharmacology and are an important component for health technology assessments (HTAs in many countries. However, these guidelines have initially been developed for traditional pharmaceuticals and not for complex interventions with multiple components. This raises the issue as to whether these guidelines are adequate to SM interventions or whether new specific guidance and methodology is needed to avoid inconsistencies and contradictory findings when assessing economic value in SM.Objective: This article describes specific methodological challenges when conducting health economic (HE evaluations for SM interventions and outlines potential modifications necessary to existing evaluation guidelines /principles that would promote consistent economic evaluations for SM.Results/Conclusions: Specific methodological aspects for SM comprise considerations on the choice of comparator, measuring effectiveness and outcomes, appropriate modelling structure and the scope of sensitivity analyses. Although current HE methodology can be applied for SM, greater complexity requires further methodology development and modifications in the guidelines.

  14. The SSB-positive/SSA-negative antibody profile is not associated with key phenotypic features of Sjögren's syndrome

    DEFF Research Database (Denmark)

    Baer, Alan N; McAdams DeMarco, Mara; Shiboski, Stephen C

    2015-01-01

    phenotypic features. Among SICCA participants classified with SS on the basis of the American-European Consensus Group or American College of Rheumatology criteria, only 2% required the anti-SSB-alone test result to meet these criteria. CONCLUSIONS: The presence of anti-SSB, without anti-SSA antibodies, had...... participants, 2061 (63%) had negative anti-SSA/anti-SSB, 1162 (35%) had anti-SSA with or without anti-SSB, and 74 (2%) anti-SSB alone. Key SS phenotypic features were more prevalent and had measures indicative of greater disease activity in those participants with anti-SSA, either alone or with anti-SSB, than...... in those with anti-SSB alone or negative SSA/SSB serology. These between-group differences were highly significant and not explained by confounding by age, race/ethnicity or gender. Participants with anti-SSB alone were comparable to those with negative SSA/SSB serology in their association with these key...

  15. Model-Atmosphere Spectra of Central Stars of Planetary Nebulae - Access via the Virtual Observatory Service TheoSSA

    Science.gov (United States)

    Rauch, T.; Reindl, N.

    2014-04-01

    In the framework of the Virtual Observatory (VO), the German Astrophysical Virtual Observatory GAVO project provides easy access to theoretical spectral energy distributions (SEDs) within the registered GAVO service TheoSSA (http://dc.g-vo.org/theossa). TheoSSA is based on the well established Tübingen NLTE Model-Atmosphere Package (TMAP) for hot, compact stars. This includes central stars of planetary nebulae. We show examples of TheoSSA in operation.

  16. Possible role of anti-SSA/Ro antibodies in the pathogenesis of pulmonary hypertension

    Directory of Open Access Journals (Sweden)

    Kelsey Guerreso

    2016-01-01

    Conclusion: It is known that pulmonary hypertension has association with autoimmune diseases, however no clear markers yet exist. Anti-SSA/Ro antibodies have been rarely described in cases of pulmonary disease, and less so in pulmonary hypertension. This case describes a unique association between isolated pulmonary hypertension and anti-SSA/Ro antibody, thereby illustrating the need to investigate this autoantibody and others in the pathogenesis of autoimmune pulmonary hypertension.

  17. Understanding Large-scale Structure in the SSA22 Protocluster Region Using Cosmological Simulations

    Science.gov (United States)

    Topping, Michael W.; Shapley, Alice E.; Steidel, Charles C.; Naoz, Smadar; Primack, Joel R.

    2018-01-01

    We investigate the nature and evolution of large-scale structure within the SSA22 protocluster region at z = 3.09 using cosmological simulations. A redshift histogram constructed from current spectroscopic observations of the SSA22 protocluster reveals two separate peaks at z = 3.065 (blue) and z = 3.095 (red). Based on these data, we report updated overdensity and mass calculations for the SSA22 protocluster. We find {δ }b,{gal}=4.8+/- 1.8 and {δ }r,{gal}=9.5+/- 2.0 for the blue and red peaks, respectively, and {δ }t,{gal}=7.6+/- 1.4 for the entire region. These overdensities correspond to masses of {M}b=(0.76+/- 0.17)× {10}15{h}-1 {M}ȯ , {M}r=(2.15+/- 0.32)× {10}15{h}-1 {M}ȯ , and {M}t=(3.19+/- 0.40)× {10}15{h}-1 {M}ȯ for the red, blue, and total peaks, respectively. We use the Small MultiDark Planck (SMDPL) simulation to identify comparably massive z∼ 3 protoclusters, and uncover the underlying structure and ultimate fate of the SSA22 protocluster. For this analysis, we construct mock redshift histograms for each simulated z∼ 3 protocluster, quantitatively comparing them with the observed SSA22 data. We find that the observed double-peaked structure in the SSA22 redshift histogram corresponds not to a single coalescing cluster, but rather the proximity of a ∼ {10}15{h}-1 {M}ȯ protocluster and at least one > {10}14{h}-1 {M}ȯ cluster progenitor. Such associations in the SMDPL simulation are easily understood within the framework of hierarchical clustering of dark matter halos. We finally find that the opportunity to observe such a phenomenon is incredibly rare, with an occurrence rate of 7.4{h}3 {{{Gpc}}}-3. Based on data obtained at the W.M. Keck Observatory, which is operated as a scientific partnership among the California Institute of Technology, the University of California, and the National Aeronautics and Space Administration, and was made possible by the generous financial support of the W.M. Keck Foundation.

  18. 77 FR 43639 - Privacy Act of 1974, as Amended; Computer Matching Program (Social Security Administration (SSA...

    Science.gov (United States)

    2012-07-25

    ... SOCIAL SECURITY ADMINISTRATION [Docket No. SSA 2011-0090] Privacy Act of 1974, as Amended; Computer Matching Program (Social Security Administration (SSA)/Department of Veterans Affairs (VA.... SUPPLEMENTARY INFORMATION: A. General The Computer Matching and Privacy Protection Act of 1988 (Pub. L. 100-503...

  19. 77 FR 54943 - Privacy Act of 1974, as Amended; Computer Matching Program (Social Security Administration (SSA...

    Science.gov (United States)

    2012-09-06

    ... SOCIAL SECURITY ADMINISTRATION [Docket No. SSA 2012-0016] Privacy Act of 1974, as Amended; Computer Matching Program (Social Security Administration (SSA)/Department of Veterans Affairs (VA.... SUPPLEMENTARY INFORMATION: A. General The Computer Matching and Privacy Protection Act of 1988 (Pub. L. 100-503...

  20. BOREAS TF-02 SSA-OA Tethersonde Meteorological and Ozone Data

    Data.gov (United States)

    National Aeronautics and Space Administration — ABSTRACT: The BOREAS TF-02 team collected various trace gas and energy flux data along with meteorological parameters at the SSA-OA site. This data set contains...

  1. BOREAS TF-02 SSA-OA Tethersonde Meteorological and Ozone Data

    Data.gov (United States)

    National Aeronautics and Space Administration — The BOREAS TF-02 team collected various trace gas and energy flux data along with meteorological parameters at the SSA-OA site. This data set contains meteorological...

  2. The post-2015 development agenda for diabetes in sub-Saharan Africa: challenges and future directions.

    Science.gov (United States)

    Renzaho, Andre M N

    2015-01-01

    Diabetes is one of the non-communicable diseases (NCDs) which is rising significantly across sub-Saharan African (SSA) countries and posing a threat to the social, economic, and cultural fabric of the SSA population. The inclusion of NCDs into the post-2015 development agenda along with the global monitoring framework provides an opportunity to monitor progress of development programmes in developing countries. This paper examines challenges associated with dealing with diabetes within the development agenda in SSA and explores some policy options. This conceptual review draws from a range of works published in Medline and the grey literature to advance the understanding of the post-2015 development agenda and how it relates to NCDs. The paper begins with the burden of diabetes in sub-Sahara Africa and then moves on to examine challenges associated with diabetes prevention, treatment, and management in Africa. It finishes by exploring policy implications. With regards to development programmes on NCDs in the SSA sub-continent, several challenges exist: 1) poor documentation of risk factors, 2) demographic transitions (rapid urbanisation and ageing), 3) the complementary role of traditional healers, 4) tuberculosis and the treatment of the acquired immunodeficiency syndrome as risk factors for diabetes, 5) diabetes in complex emergencies, 6) diabetes as an international development priority and not a policy agenda for many SSA countries, and 7) poorly regulated food and beverage industry. For the post-2015 development agenda for NCDs to have an impact, sufficient investments will be needed to address legislative, technical, human, and fiscal resource constraints through advocacy, accountability, political leadership, and effective public-private partnership. Striking the right balance between competing demands and priorities, policies, and implementation strategies hold the key to an effective response to diabetes in SSA countries.

  3. The post-2015 development agenda for diabetes in sub-Saharan Africa: challenges and future directions

    Directory of Open Access Journals (Sweden)

    Andre M. N. Renzaho

    2015-05-01

    Full Text Available Background: Diabetes is one of the non-communicable diseases (NCDs which is rising significantly across sub-Saharan African (SSA countries and posing a threat to the social, economic, and cultural fabric of the SSA population. The inclusion of NCDs into the post-2015 development agenda along with the global monitoring framework provides an opportunity to monitor progress of development programmes in developing countries. This paper examines challenges associated with dealing with diabetes within the development agenda in SSA and explores some policy options. Design: This conceptual review draws from a range of works published in Medline and the grey literature to advance the understanding of the post-2015 development agenda and how it relates to NCDs. The paper begins with the burden of diabetes in sub-Sahara Africa and then moves on to examine challenges associated with diabetes prevention, treatment, and management in Africa. It finishes by exploring policy implications. Results: With regards to development programmes on NCDs in the SSA sub-continent, several challenges exist: 1 poor documentation of risk factors, 2 demographic transitions (rapid urbanisation and ageing, 3 the complementary role of traditional healers, 4 tuberculosis and the treatment of the acquired immunodeficiency syndrome as risk factors for diabetes, 5 diabetes in complex emergencies, 6 diabetes as an international development priority and not a policy agenda for many SSA countries, and 7 poorly regulated food and beverage industry. Conclusion: For the post-2015 development agenda for NCDs to have an impact, sufficient investments will be needed to address legislative, technical, human, and fiscal resource constraints through advocacy, accountability, political leadership, and effective public–private partnership. Striking the right balance between competing demands and priorities, policies, and implementation strategies hold the key to an effective response to diabetes

  4. 76 FR 55690 - Submission for OMB Review; Comment Request; The SSA-NIH Collaboration To Improve the Disability...

    Science.gov (United States)

    2011-09-08

    ...; Comment Request; The SSA-NIH Collaboration To Improve the Disability Determination Process: Validation of... Collection: Title: The SSA-NIH Collaboration to Improve the Disability Determination Process: Validation of IRT-CAT tools. Type of Information Collection Request: NEW. Need and Use of Information Collection...

  5. 78 FR 12127 - Privacy Act of 1974, as Amended; Computer Matching Program (SSA/Department of the Treasury...

    Science.gov (United States)

    2013-02-21

    ... 1310 AGENCY: Social Security Administration (SSA). ACTION: Notice of a renewal of an existing computer..., as shown above. SUPPLEMENTARY INFORMATION: A. General The Computer Matching and Privacy Protection... SOCIAL SECURITY ADMINISTRATION [Docket No. SSA 2013-0007] Privacy Act of 1974, as Amended...

  6. 75 FR 51154 - Privacy Act of 1974, as Amended; Computer Matching Program (SSA/Department of the Treasury...

    Science.gov (United States)

    2010-08-18

    ... 1310 AGENCY: Social Security Administration (SSA) ACTION: Notice of a renewal of an existing computer..., as shown above. SUPPLEMENTARY INFORMATION: A. General The Computer Matching and Privacy Protection... SOCIAL SECURITY ADMINISTRATION [Docket No. SSA 2010-0035] Privacy Act of 1974, as Amended...

  7. 78 FR 51264 - Privacy Act of 1974, as Amended; Computer Matching Program (SSA/Department of the Treasury...

    Science.gov (United States)

    2013-08-20

    ... 1016 AGENCY: Social Security Administration (SSA). ACTION: Notice of a renewal of an existing computer... above. SUPPLEMENTARY INFORMATION: A. General The Computer Matching and Privacy Protection Act of 1988... SOCIAL SECURITY ADMINISTRATION [Docket No. SSA 2013-0022] Privacy Act of 1974, as Amended...

  8. 78 FR 16564 - Privacy Act of 1974, as Amended; Computer Matching Program (SSA/Office of Personnel Management...

    Science.gov (United States)

    2013-03-15

    ... 1021 AGENCY: Social Security Administration (SSA). ACTION: Notice of a renewal of existing computer... above. SUPPLEMENTARY INFORMATION: A. General The Computer Matching and Privacy Protection Act of 1988... SOCIAL SECURITY ADMINISTRATION [Docket No. SSA 2012-0073] Privacy Act of 1974, as Amended...

  9. 75 FR 62623 - Privacy Act of 1974, as Amended; Computer Matching Program (SSA/Internal Revenue Service (IRS...

    Science.gov (United States)

    2010-10-12

    ... SOCIAL SECURITY ADMINISTRATION [Docket No. SSA 2010-0015] Privacy Act of 1974, as Amended; Computer Matching Program (SSA/ Internal Revenue Service (IRS))--Match Number 1016 AGENCY: Social Security... regarding protections for such persons. The Privacy Act, as amended, regulates the use of computer matching...

  10. 77 FR 27108 - Privacy Act of 1974, as Amended; Computer Matching Program (SSA/Office of Child Support...

    Science.gov (United States)

    2012-05-08

    ...: Social Security Administration (SSA). ACTION: Notice of a renewal of an existing computer matching... protections for such persons. The Privacy Act, as amended, regulates the use of computer matching by Federal... SOCIAL SECURITY ADMINISTRATION [Docket No. SSA 2012-0010] Privacy Act of 1974, as Amended...

  11. 76 FR 77238 - Submission for OMB Review; Comment Request; The SSA-NIH Collaboration to Improve the Disability...

    Science.gov (United States)

    2011-12-12

    ... Collaboration to Improve the Disability Determination Process: Validation of IRT-CAT tools. Type of Information...; Comment Request; The SSA-NIH Collaboration to Improve the Disability Determination Process: Validation of... being developed to assist in the SSA disability determination process. The utilization of CAT technology...

  12. 75 FR 18251 - Privacy Act of 1974, as Amended; Computer Matching Program (SSA/Internal Revenue Service (IRS...

    Science.gov (United States)

    2010-04-09

    ... SOCIAL SECURITY ADMINISTRATION [Docket No. SSA-2009-0066] Privacy Act of 1974, as Amended; Computer Matching Program (SSA/ Internal Revenue Service (IRS))--Match 1305 AGENCY: Social Security... INFORMATION: A. General The Computer Matching and Privacy Protection Act of 1988 (Public Law (Pub. L.) 100-503...

  13. 75 FR 7648 - Privacy Act of 1974, as Amended; Computer Matching Program (SSA/Department of Veterans Affairs...

    Science.gov (United States)

    2010-02-22

    ... Computer Matching and Privacy Protection Act of 1988 (Public Law (Pub. L.) 100-503), amended the Privacy... SOCIAL SECURITY ADMINISTRATION [Docket No. SSA 2010-0006] Privacy Act of 1974, as Amended; Computer Matching Program (SSA/ Department of Veterans Affairs/Veterans Benefits Administration (VA/ VBA...

  14. 75 FR 59780 - Privacy Act of 1974, as Amended; Computer Matching Program (SSA/Railroad Retirement Board (RRB...

    Science.gov (United States)

    2010-09-28

    ... SOCIAL SECURITY ADMINISTRATION [Docket No. SSA 2010-0040] Privacy Act of 1974, as Amended; Computer Matching Program (SSA/ Railroad Retirement Board (RRB))--Match Number 1006 AGENCY: Social Security...: A. General The Computer Matching and Privacy Protection Act of 1988 (Pub. L.) 100-503), amended the...

  15. 77 FR 32709 - Privacy Act of 1974, as Amended; Computer Matching Program (SSA/Department of Homeland Security...

    Science.gov (United States)

    2012-06-01

    ...; Computer Matching Program (SSA/ Department of Homeland Security (DHS))--Match Number 1010 AGENCY: Social Security Administration (SSA). ACTION: Notice of a renewal of an existing computer matching program that... amended by the Computer Matching and Privacy Protection Act of 1988, as amended, and the regulations and...

  16. 78 FR 12128 - Privacy Act of 1974; Computer Matching Program (SSA/Department of the Treasury, Internal Revenue...

    Science.gov (United States)

    2013-02-21

    ... SOCIAL SECURITY ADMINISTRATION [Docket No. SSA 2012-0067] Privacy Act of 1974; Computer Matching... Security Administration (SSA). ACTION: Notice of a renewal of an existing computer matching program... INFORMATION: A. General The Computer Matching and Privacy Protection Act of 1988 (Public Law (Pub. L.) 100-503...

  17. 77 FR 49849 - Privacy Act of 1974, as Amended; Computer Matching Program (SSA/Office of Child Support...

    Science.gov (United States)

    2012-08-17

    ...: Social Security Administration (SSA). ACTION: Notice of a renewal of an existing computer-matching... INFORMATION: A. General The Computer Matching and Privacy Protection Act of 1988 (Public Law (Pub. L.) 100-503... SOCIAL SECURITY ADMINISTRATION [Docket No. SSA 2012-0021] Privacy Act of 1974, as Amended...

  18. 78 FR 69926 - Privacy Act of 1974, as Amended; Computer Matching Program (SSA/Centers for Medicare & Medicaid...

    Science.gov (United States)

    2013-11-21

    ...: Social Security Administration (SSA). ACTION: Notice of a renewal of an existing computer matching... INFORMATION: A. General The Computer Matching and Privacy Protection Act of 1988 (Pub. L 100-503), amended the... SOCIAL SECURITY ADMINISTRATION [Docket No. SSA 2013-0059] Privacy Act of 1974, as Amended...

  19. 75 FR 32833 - Privacy Act of 1974, as Amended; Computer Matching Program (SSA/Office of Personnel Management...

    Science.gov (United States)

    2010-06-09

    ... SOCIAL SECURITY ADMINISTRATION [Docket No. SSA-2009-0077] Privacy Act of 1974, as Amended; Computer Matching Program (SSA/ Office of Personnel Management (OPM))--Match 1307 AGENCY: Social Security... INFORMATION: A. General The Computer Matching and Privacy Protection Act of 1988 (Public Law (Pub. L.) 100-503...

  20. Tough Teens: The Methodological Challenges of Interviewing Teenagers as Research Participants

    Science.gov (United States)

    Bassett, Raewyn; Beagan, Brenda L.; Ristovski-Slijepcevic, Svetlana; Chapman, Gwen E.

    2008-01-01

    Encouraging a teenager to have a conversation in a semistructured research interview is fraught with difficulties. The authors discuss the methodological challenges encountered when interviewing adolescents of European Canadian, African Canadian, and Punjabi Canadian families who took part in the Family Food Decision-Making Study in two regions of…

  1. 75 FR 68396 - Privacy Act of 1974, as Amended; Computer Matching Program (SSA/Department of Labor (DOL))-Match...

    Science.gov (United States)

    2010-11-05

    ... SOCIAL SECURITY ADMINISTRATION [Docket No. SSA 2010-0052] Privacy Act of 1974, as Amended; Computer Matching Program (SSA/ Department of Labor (DOL))--Match Number 1003 AGENCY: Social Security... as shown above. SUPPLEMENTARY INFORMATION: A. General The Computer Matching and Privacy Protection...

  2. Evaluating the impact of agricultural extension programmes in sub-Saharan Africa: Challenges and prospects

    Directory of Open Access Journals (Sweden)

    Hailemichael Taye

    2013-09-01

    Full Text Available Background: In sub-Saharan Africa (SSA, impact evaluation has been used to assess whether agricultural extension interventions have brought the intended result or to establish causal linkages between interventions and outcomes. However, there is some scepticism about the validity and reliability of the results of the impact evaluation reports due to some contradictory and exaggerated results. Objectives: This article analyses some impact evaluation studies conducted in SSA as to why contradictions and exaggerations are manifested in some reports and what would be the future prospects of impact evaluation of agricultural extension programmes in the region. Methods: Impact evaluation reports and results of agricultural extension programmes from 10 SSA countries were reviewed and analysed based on impact evaluation principles and theories. Results: The results show that most of the evaluations reported positive impacts. There are also conflicting reports on extension performance. The fact that the overwhelming majority of impact evaluation reports claim positive extension impacts is not in line with the reports on agricultural productivity growth in the region. There are various reasons for over estimated impacts and contradictory results, which include use of poor impact evaluation methodologies, lack of reliable data and insufficient capacity to conduct rigorous impact evaluations. Conclusion: Due to these challenges and the shift in agricultural research and extension approaches, it is recommended that rather than investing effort in trying to prove impact, greater attention should be given to improving impact as well as using other innovative monitoring and evaluation (M&E and learning tools that consider the dynamic nature of agricultural development.

  3. Effect of sewage sludge ash (SSA on the mechanical performance and corrosion levels of reinforced Portland cement mortars

    Directory of Open Access Journals (Sweden)

    Andión, L. G.ª

    2006-06-01

    Full Text Available The article describes a study conducted to determinecorrosion in reinforcement embedded in Portland cement(PC mortars with different percentages of sewage sludgeash (SSA admixtures. The polarization resistancetechnique was used to determine the steel corrosion rate(Icorr in the test specimens. The samples were subjectedto different environmental conditions and aggressiveagents: 100% relative humidity (RH, accelerated carbonationat 70% RH and seawater immersion. Portlandcement was partially substituted for SSA in the mixes atrates of 0, 10, 20, 30 and 60% (by mass to make thedifferent mortars. The results show that where cementwas replaced by SSA at rates of up to 10% by mass,mortar corrosion performance was comparable to thebehaviour observed in SSA-free mortars (control mortar:0% SSA. Data for higher rates are also shown. From themechanical standpoint, SSA exhibited moderate pozzolanicactivity and the best performance when SSA wasadded at a rate of 10% to mixes with a water/(binder:PC + SSA (w/b ratio of 0.5.Se ha estudiado el nivel de corrosion que presentan lasarmaduras embebidas en morteros fabricados con cementoPortland (CP con diferentes porcentajes de sustitucion deceniza de lodo de depuradora (CLD. Se ha utilizado la tecnicade la Resistencia a la Polarizacion para determinar lavelocidad de corrosion del acero embebido en las muestrasestudiadas. Las muestras se han sometido a diferentes condicionesambientales y agentes agresivos: 100% de humedadrelativa (HR, carbonatacion acelerada al 70% HR einmersion en agua de mar. Para la fabricacion de los distintosmorteros, el cemento Portland ha sido parcialmente sustituidopor CLD en los siguientes porcentajes en masa: 0,10, 20, 30 y 60%. Los resultados muestran que sustitucionesde cemento por CLD de hasta el 10% en masa no alteranel comportamiento frente a la corrosion de los morterosal compararlos con los morteros libres de CLD (morteroscontrol: 0% de sustitucion de cemento por CLD. Se

  4. BOREAS TF-06 SSA-YA Surface Energy Flux and Meteorological Data

    Data.gov (United States)

    National Aeronautics and Space Administration — ABSTRACT: Contains meteorology data collected at the SSA-YA tower flux site by the TF6 group. These data were reported at 10 minute intervals. The flux and ancillary...

  5. 77 FR 24756 - Privacy Act of 1974, as Amended; Computer Matching Program (SSA/Department of Labor (DOL))-Match...

    Science.gov (United States)

    2012-04-25

    ... SOCIAL SECURITY ADMINISTRATION [Docket No. SSA 2011-0084] Privacy Act of 1974, as Amended; Computer Matching Program (SSA/ Department of Labor (DOL))--Match Number 1003 AGENCY: Social Security... above. SUPPLEMENTARY INFORMATION: A. General The Computer Matching and Privacy Protection Act of 1988...

  6. Vulnerable participants in health research: methodological and ethical challenges

    DEFF Research Database (Denmark)

    Nordentoft, Helle Merete; Kappel, Nanna

    2011-01-01

    , leaving both professionals and researchers in ethical and moral dilemmas. In this article, we specifically focus on the methodological challenges of obtaining informed consent from drug users and terminally ill cancer patients in our PhD research. The question is how to illuminate the needs and problems......Ethical guidelines for conducting research are embedded in the Helsinki Declaration of 1964. We contend that these abstract and intentionally universal guidelines need to be appropriated for social and healthcare research, in which purpose and methods often deviate from medical research....... The guidelines appear to be instrumental and over-simplistic representations of the often ‘messy’ realities surrounding the research process that is often guided by relational and local negotiations of ethical solutions. Vulnerable participants, for instance, challenge both professional and research ethics...

  7. Methodological challenges in qualitative content analysis: A discussion paper.

    Science.gov (United States)

    Graneheim, Ulla H; Lindgren, Britt-Marie; Lundman, Berit

    2017-09-01

    This discussion paper is aimed to map content analysis in the qualitative paradigm and explore common methodological challenges. We discuss phenomenological descriptions of manifest content and hermeneutical interpretations of latent content. We demonstrate inductive, deductive, and abductive approaches to qualitative content analysis, and elaborate on the level of abstraction and degree of interpretation used in constructing categories, descriptive themes, and themes of meaning. With increased abstraction and interpretation comes an increased challenge to demonstrate the credibility and authenticity of the analysis. A key issue is to show the logic in how categories and themes are abstracted, interpreted, and connected to the aim and to each other. Qualitative content analysis is an autonomous method and can be used at varying levels of abstraction and interpretation. Copyright © 2017 Elsevier Ltd. All rights reserved.

  8. Rapid assessment of populations trends of invasive species: Singular Spectrum Analysis (SSA

    Directory of Open Access Journals (Sweden)

    DANA, ED

    2010-01-01

    Full Text Available Singular Spectrum Analysis (SSA is a powerful analytical approach for biodi-versity management. Its main advan-tages are due to its intuitive processing and visualization, since mathematical workflow is conceptually similar to the widely accepted Principal Components Analysis. Detailed analyses of popula-tion trends with mathematical tools are often difficult to achieve for managers by a number of reasons (large numbers or areas monitored, large number of species, insufficient statistics skills, strong knowledge level in demographic analyses, etc.. SSA has been used since the 1970’s in signal processing to clarify signal vs. noisy information, but it has also been used in climate change analy-sis and other developmental areas. Be-sides, SSA is a rapid-learning method for technicians and managers with medium level of mathematical knowledge. Free software in Unix environment is avail-able. Unfortunately, no free and friendly software is available for Win-dows SO. Although R package may offer solutions for really advanced users, it does not fit real work situations for managers of biological invasions. Cater-pillar (Gistat Group, Ltd is by now, the best option found by the author in terms of price, facility for results inter-pretation and time consumed in learn-ing. The main disadvantage is the poor content of tutorial files

  9. 77 FR 24757 - Privacy Act of 1974, as Amended; Computer Matching Program (SSA/Department of Labor (DOL))-Match...

    Science.gov (United States)

    2012-04-25

    ... SOCIAL SECURITY ADMINISTRATION [Docket No. SSA 2011-0083] Privacy Act of 1974, as Amended; Computer Matching Program (SSA/ Department of Labor (DOL))--Match Number 1015 AGENCY: Social Security... regarding protections for such persons. The Privacy Act, as amended, regulates the use of computer matching...

  10. Surviving space flight: case study on MELiSSA's CIII nitrifying compartment

    Science.gov (United States)

    Ilgrande, Chiara; Lasseur, Christophe; Mastroleo, Felice; Paille, Christel; Leys, Natalie; Morozova, Julia; Ilyin, Vyacheslav; Clauwaert, Peter; Christiaens, Marlies E. R.; Lindeboom, Ralph E. F.; Vlaeminck, Siegfried; Prat, Delphine; Arroyo, Jose M. C.; Conincx, Ilse; Van Hoey, Olivier; Roume, Hugo; Udert, Kai; Sas, Benedikt

    2016-07-01

    Space synthetic biology offers key opportunities for long-term space missions. Planets mining, terraformation, space medicine and Life Support technologies would all benefit from an integrative biological approach. However, space is a harsh environment for life: microgravity, temperature, UV and cosmic radiation can affect the health and functionality of microorganisms and plants, possibly preventing the optimal performance of the systems. The European Space Agency's Life Support System (MELiSSA) has been developed as a model for future long term Space missions and Space habitation. MELiSSA is a 5 compartment artificial ecosystem with microorganisms and higher, that aims at completely recycling gas, liquid and solid waste. In this study, the survival and functional activity after Lower Earth Orbit conditions of microbial nitrogen conversions, relevant for MELiSSA's CIII compartment, was tested. Synthetic communities containing Nitrosomonas europeae, Nitrosomonas ureae, Nitrobacter winogradskyi, Nitrospira moscoviensis and Cupriavidus pinatubonensis were exposed to the Lower Earth Orbit conditions of the International Space Station (ISS) for 7 days. Nitrosomonas europeae, Nitrobacter winogradskyi, Cupriavidus pinatubonensis, and three mixed communities (a urine nitrification sludge, a sludge containing aerobic ammonia oxidizing bacteria and anammox bacteria (OLAND), and an aquaculture sludge containing ammonia oxidizing archaea) were exposed to Lower Earth Orbit conditions for 44 days. Survival after both space flights was demonstrated because nitritation, nitratation, denitrification and anammox activity could be restored at a rate comparable to ground storage conditions. Our results validate the potential survival feasibility and suggest future space applications for N-related microorganisms.

  11. 77 FR 33547 - Privacy Act of 1974, as Amended; Computer Matching Program (SSA/Centers for Medicare and Medicaid...

    Science.gov (United States)

    2012-06-06

    ...: Social Security Administration (SSA). ACTION: Notice of a new computer matching program that will expire... protections for such persons. The Privacy Act, as amended, regulates the use of computer matching by Federal... SOCIAL SECURITY ADMINISTRATION [Docket No. SSA 2012-0015] Privacy Act of 1974, as Amended...

  12. THE CHALLENGE OF KEEPING-UP: CURRENT METHODOLOGIES IN ANALYZING THE STUDENTS RECRUITING AREA BY UNIVERSITIES

    Directory of Open Access Journals (Sweden)

    MĂLĂESCU SIMONA

    2013-11-01

    Full Text Available The challenge of keeping-up: current methodologies in analyzing the students recruiting area by universities. Despite all progress made in the field and in some collateral areas extremely useful methodologically (e.g. the use of GIS, for some countries emerging from communist space methodologically upgrading to the latest advances in modelling and forecast of students recruitment by universities remains a difficult challenge. The analysis and modelling of the geographical area of recruiting students for a particular university represents even for the foreign literature a niche, not necessarily consciously neglected but only reached sidely due, most likely, to ignoring the benefits which the focus of concerns on this aspect would bring into focus and directing more efficiently university marketing efforts. This paper aims precisely to seek, through a meta-analysis of existing literature, disparate developments that led in some form or will allow improved modeling spatial areas of recruitment of students by universities and the challenges and limitations that apply methodological advances the area where universities belonging to the ex-communist involved. Beyond the theoretical benefit from a practical perspective, the meta-analysis aimed at synthesizing elements of good practice that can be applied to the local university system.

  13. 20 CFR 411.597 - Will SSA periodically review the outcome payment system and the outcome-milestone payment system...

    Science.gov (United States)

    2010-04-01

    ... 20 Employees' Benefits 2 2010-04-01 2010-04-01 false Will SSA periodically review the outcome payment system and the outcome-milestone payment system for possible modifications? 411.597 Section 411... Employment Network Payment Systems § 411.597 Will SSA periodically review the outcome payment system and the...

  14. 20 CFR 403.100 - When can an SSA employee testify or produce information or records in legal proceedings?

    Science.gov (United States)

    2010-04-01

    ... information or records in legal proceedings? 403.100 Section 403.100 Employees' Benefits SOCIAL SECURITY ADMINISTRATION TESTIMONY BY EMPLOYEES AND THE PRODUCTION OF RECORDS AND INFORMATION IN LEGAL PROCEEDINGS § 403.100 When can an SSA employee testify or produce information or records in legal proceedings? An SSA...

  15. Human Decision Processes: Implications for SSA Support Tools

    Science.gov (United States)

    Picciano, P.

    2013-09-01

    Despite significant advances in computing power and artificial intelligence (AI), few critical decisions are made without a human decision maker in the loop. Space Situational Awareness (SSA) missions are both critical and complex, typically adhering to the human-in-the-loop (HITL) model. The collection of human operators injects a needed diversity of expert knowledge, experience, and authority required to successfully fulfill SSA tasking. A wealth of literature on human decision making exists citing myriad empirical studies and offering a varied set of prescriptive and descriptive models of judgment and decision making (Hastie & Dawes, 2001; Baron, 2000). Many findings have been proven sufficiently robust to allow information architects or system/interface designers to take action to improve decision processes. For the purpose of discussion, these concepts are bifurcated in two groups: 1) vulnerabilities to mitigate, and 2) capabilities to augment. These vulnerabilities and capabilities refer specifically to the decision process and should not be confused with a shortcoming or skill of a specific human operator. Thus the framing of questions and orders, the automated tools with which to collaborate, priming and contextual data, and the delivery of information all play a critical role in human judgment and choice. Evaluating the merits of any decision can be elusive; in order to constrain this discussion, ‘rational choice' will tend toward the economic model characteristics such as maximizing utility and selection consistency (e.g., if A preferred to B, and B preferred to C, than A should be preferred to C). Simple decision models often encourage one to list the pros and cons of a decision, perhaps use a weighting schema, but one way or another weigh the future benefit (or harm) of making a selection. The result (sought by the rationalist models) should drive toward higher utility. Despite notable differences in researchers' theses (to be discussed in the full

  16. 77 FR 6620 - Privacy Act of 1974, as Amended; Computer Matching Program (SSA/the States); Match 6000 and 6003

    Science.gov (United States)

    2012-02-08

    ... SOCIAL SECURITY ADMINISTRATION [Docket No. SSA 2011-0102] Privacy Act of 1974, as Amended; Computer Matching Program (SSA/ the States); Match 6000 and 6003 AGENCY: Social Security Administration..., as shown above. SUPPLEMENTARY INFORMATION: A. General The Computer Matching and Privacy Protection...

  17. 76 FR 12398 - Privacy Act of 1974, as Amended; Computer Matching Program (SSA/Bureau of the Public Debt (BPD...

    Science.gov (United States)

    2011-03-07

    ... SOCIAL SECURITY ADMINISTRATION [Docket No. SSA 2010-0034] Privacy Act of 1974, as Amended; Computer Matching Program (SSA/ Bureau of the Public Debt (BPD))--Match Number 1304 AGENCY: Social Security... as shown above. SUPPLEMENTARY INFORMATION: A. General The Computer Matching and Privacy Protection...

  18. Challenges and Opportunities for Harmonizing Research Methodology: Raw Accelerometry.

    Science.gov (United States)

    van Hees, Vincent T; Thaler-Kall, Kathrin; Wolf, Klaus-Hendrik; Brønd, Jan C; Bonomi, Alberto; Schulze, Mareike; Vigl, Matthäus; Morseth, Bente; Hopstock, Laila Arnesdatter; Gorzelniak, Lukas; Schulz, Holger; Brage, Søren; Horsch, Alexander

    2016-12-07

    Raw accelerometry is increasingly being used in physical activity research, but diversity in sensor design, attachment and signal processing challenges the comparability of research results. Therefore, efforts are needed to harmonize the methodology. In this article we reflect on how increased methodological harmonization may be achieved. The authors of this work convened for a two-day workshop (March 2014) themed on methodological harmonization of raw accelerometry. The discussions at the workshop were used as a basis for this review. Key stakeholders were identified as manufacturers, method developers, method users (application), publishers, and funders. To facilitate methodological harmonization in raw accelerometry the following action points were proposed: i) Manufacturers are encouraged to provide a detailed specification of their sensors, ii) Each fundamental step of algorithms for processing raw accelerometer data should be documented, and ideally also motivated, to facilitate interpretation and discussion, iii) Algorithm developers and method users should be open about uncertainties in the description of data and the uncertainty of the inference itself, iv) All new algorithms which are pitched as "ready for implementation" should be shared with the community to facilitate replication and ongoing evaluation by independent groups, and v) A dynamic interaction between method stakeholders should be encouraged to facilitate a well-informed harmonization process. The workshop led to the identification of a number of opportunities for harmonizing methodological practice. The discussion as well as the practical checklists proposed in this review should provide guidance for stakeholders on how to contribute to increased harmonization.

  19. ASSESSMENT OF QUALITY OF LIFE: PRESENT AND FUTURE METHODOLOGICAL CHALLENGES

    Directory of Open Access Journals (Sweden)

    Isabel Benítez

    2016-01-01

    Full Text Available The growing importance of quality of life in diverse domains, such as health, school performance and social participation, has led to the development of new conceptualisations and assessments of the construct. This diversity of perspectives brings about many benefits, but it also creates an obstacle for the formulation of a single unifying definition of the construct and, therefore, an agreed instrument or assessment framework. The aim of this study is to discuss the current methodological challenges in the measurement of quality of life. Firstly, we provide a brief description of the construct as defined in various areas, then we examine the new methodological developments and different applications. We also present an overview of the different possibilities for future developments in defining and measuring quality of life in national and international studies.

  20. 75 FR 9012 - Privacy Act of 1974, as Amended; Computer Matching Program (SSA/U.S. Department of Health and...

    Science.gov (United States)

    2010-02-26

    ... INFORMATION: A. General The Computer Matching and Privacy Protection Act of 1988 (Pub. L. 100-503), amended... SOCIAL SECURITY ADMINISTRATION [Docket No. SSA-2009-0052] Privacy Act of 1974, as Amended; Computer Matching Program (SSA/ U.S. Department of Health and Human Services (HHS), Administration for...

  1. A hybrid intermediate language between SSA and CPS

    DEFF Research Database (Denmark)

    Torrens, Paulo; Vasconcellos, Cristiano; Gonçalves, Ju

    2017-01-01

    passing style (CPS) lambda calculus has been used as intermediate language for functional language compilers, they are (almost) equivalent and it is possible to draw syntactic translations between them. This short paper aims to present an untyped intermediate language which may be interpreted as both SSA...... and CPS, in order to provide a common language for both imperative and functional compilers, as well to take advantage of optimizations designed for either one of the approaches. Finally, potential variants and research opportunities are discussed....

  2. Remote Ultra-low Light Imaging (RULLI) For Space Situational Awareness (SSA): Modeling And Simulation Results For Passive And Active SSA

    International Nuclear Information System (INIS)

    Thompson, David C.; Shirey, Robert L.; Roggemann, Michael C; Gudimetla, Rao

    2008-01-01

    Remote Ultra-Low Light Imaging detectors are photon limited detectors developed at Los Alamos National Laboratories. RULLI detectors provide a very high degree of temporal resolution for the arrival times of detected photoevents, but saturate at a photo-detection rate of about 10 6 photo-events per second. Rather than recording a conventional image, such as output by a charged coupled device (CCD) camera, the RULLI detector outputs a data stream consisting of the two-dimensional location, and time of arrival of each detected photo-electron. Hence, there is no need to select a specific exposure time to accumulate photo-events prior to the data collection with a RULLI detector this quantity can be optimized in post processing. RULLI detectors have lower peak quantum efficiency (from as low as 5% to perhaps as much as 40% with modern photocathode technology) than back-illuminated CCD's (80% or higher). As a result of these factors, and the associated analyses of signal and noise, we have found that RULLI detectors can play two key new roles in SSA: passive imaging of exceedingly dim objects, and three-dimensional imaging of objects illuminated with an appropriate pulsed laser. In this paper we describe the RULLI detection model, compare it to a conventional CCD detection model, and present analytic and simulation results to show the limits of performance of RULLI detectors used for SSA applications at AMOS field site

  3. The Psychological Study of Video Game Players: Methodological Challenges and Practical Advice

    Science.gov (United States)

    King, Daniel; Delfabbro, Paul; Griffiths, Mark

    2009-01-01

    Video game playing has received increased academic interest over the last few decades, particularly with regard to the psychological understanding of addiction. Based on the many studies carried out by the authors, this paper summarises some of the methodological challenges which may arise when studying video game players, including obstacles…

  4. Challenges for extension service to render efficient post-transformer ...

    African Journals Online (AJOL)

    LPhidza

    challenges facing the agricultural sector in SSA, jointly leading to low ... technology; and incompatibility of current education, training, and extension structures with ... and subsidized credit through government lending institutions is no longer available. Private .... There is so much knowledge and information that we generate.

  5. Effect of lime addition during sewage sludge treatment on characteristics of resulting SSA when it is used in cementitious materials.

    Science.gov (United States)

    Vouk, D; Nakic, D; Štirmer, N; Baricevic, A

    2017-02-01

    Final disposal of sewage sludge is important not only in terms of satisfying the regulations, but the aspect of choosing the optimal wastewater treatment technology, including the sludge treatment. In most EU countries, significant amounts of stabilized and dewatered sludge are incinerated, and sewage sludge ash (SSA) is generated as a by product. At the same time, lime is one of the commonly used additives in the sewage sludge treatment primarily to stabilize the sludge. In doing so, the question arose how desirable is such addition of lime if the sludge is subsequently incinerated, and the generated ash is further used in the production of cementitious materials. A series of mortars were prepared where 10-20% of the cement fraction was replaced by SSA. Since all three types of analyzed SSA (without lime, with lime added during sludge stabilization and with extra lime added during sludge incineration) yielded nearly same results, it can be concluded that if sludge incineration is accepted solution, lime addition during sludge treatment is unnecessary even from the standpoint of preserving the pozzolanic properties of the resulting SSA. Results of the research carried out on cement mortars point to the great possibilities of using SSA in concrete industry.

  6. The East Asian Development Experience: Policy Lessons, Implications, and Recommendations for Sub-Saharan Africa (SSA) Global Competitiveness

    OpenAIRE

    Ashford C. Chea

    2012-01-01

    The paper looks at the development experience of East Asia and draws lessons for Sub-Saharan Africa in building global competitiveness. It starts with a historical perspective of both regions’ developmental trajectories. This is followed by an analysis of the causes of East Asia’s superior economic performance and development and SSA underdevelopment. The article also draws policy lessons from East Asia development strategies for SSA global competitiveness. The paper ends with a presentation ...

  7. Researching local sports initiatives for young migrants from a political perspective: methodological and practical challenges

    Directory of Open Access Journals (Sweden)

    Noemi García-Arjona

    2017-11-01

    Full Text Available The processes of incorporation of young migrants have been studied using a range of new approaches. Among them, sports and physical activity have been claimed as a space for social and cultural integration. To date, most research has been based mainly on ethnographic and grassroots perspectives to better understand the experiences of sports practices of migrants and their families. However, fewer contributions have focused on the political discourse on sports as a field of integration. This article explores methodological challenges arosen when choosing sports policies as a field of study. The main methodological challenges considered include the contested conceptualizations of the target population in sports initiatives and the development of comparative selection criteria for different levels of institutional participants. An indepth analysis of these methodological issues can help to reflect on the ideological constructs of sports as a field of integration and highlight the contribution of the political sociological perspective to existing migration studies.

  8. MELiSSA Food Characterization general approach and current status

    Science.gov (United States)

    Weihreter, Martin; Chaerle, Laury; Secco, Benjamin; Molders, Katrien; van der Straeten, Dominique; Duliere, Eric; Pieters, Serge; Maclean, Heather; Dochain, Denis; Quinet, Muriel; Lutts, Stanley; Graham, Thomas; Stasiak, Michael; Rondeau Vuk, Theresa; Zheng, Youbin; Dixon, Mike; Laniau, Martine; Larreture, Alain; Timsit, Michel; Aronne, Giovanna; Barbieri, Giancarlo; Buonomo, Roberta; Veronica; Paradiso, Roberta; de Pascale, Stafania; Galbiati, Massimo; Troia, A. R.; Nobili, Matteo; Bucchieri, Lorenzo; Page, Valérie; Feller, Urs; Lasseur, Christophe

    Higher plants play an important role in closed ecological life support systems as oxygen pro-ducers, carbon dioxide and water recyclers, and as a food source. For an integration of higher plant chambers into the MELiSSA (Micro Ecological Life Support System Alternative) loop, a detailed characterization and optimization of the full food production and preparation chain is needed. This implies the prediction and control of the nutritional quality of the final products consumed by the crew, the prediction of the wastes quality and quantity produced along the chain for further waste treatment (MELiSSA waste treatment) and the optimization of overall efficiencies. To reach this goal several issues have to be studied in an integrated manner: the physiological responses of crops to a range of environmental parameters, crop yield efficiencies and respective ratio and composition of edible and inedible biomass, the processability and storability of the produced food and last but not least composition of wastes in view of further degradation (fiber content). Within the Food Characterization (FC) project several compar-ative plant growth bench tests were carried out to obtain preliminary data regarding these aspects. Four pre-selected cultivars of each of the four energy-rich crops with worldwide usage -wheat, durum wheat, potato and soybean -were grown under well-characterized environmental conditions. The different cultivars of each species are screened for their performance in view of a closed loop application by parameter ranking. This comprises the characterization of edi-ble/inedible biomass ratio, nutritional quality, processability and overall performance under the specific conditions of hydroponic cultivation and artificial illumination. A second closely linked goal of the FC project is to develop a mechanistic physiological plant model, which will ease the integration of higher plants compartments in the MELiSSA concept by virtue of its predictive abilities

  9. Rational construction of an ssa-type of MOF through pre-organizing the ligand's conformation and its exceptional gas adsorption properties.

    Science.gov (United States)

    Wang, Yao; He, Minghui; Tian, Zhi; Zhong, Haoyan; Zhu, Lisha; Zhang, Yingying; Zhang, Xiaoping; Chen, De-Li; He, Yabing

    2018-02-13

    Ssa-type MOFs constructed from dicopper paddlewheels and bent diisophthalate ligands exhibit a promising potential for gas adsorption which benefits from their rich open copper sites and polyhedron-based cages with suitable sizes. However, the rational construction of such types of MOFs is exceedingly challenging because the bent diisophthalate ligands employed are inclined to exhibit various conformations and thus are prone to form MOFs with varied topologies. In this work, by pre-organizing the ligand's conformation, we successfully targeted an ssa-type MOF ZJNU-57 from a bent diisophthalate ligand. More significantly, ZJNU-57 exhibits excellent hydrolytic stability and high C 2 H 2 and CO 2 uptake capacities as well as impressive C 2 H 2 /CH 4 and CO 2 /CH 4 adsorption selectivities, indicating its promising potential for C 2 H 2 /CH 4 and CO 2 /CH 4 separation, which are relevant to acetylene production and natural gas purification. This work not only provides a rare water-stable MOF based on the Cu 2 (COO) 4 cluster for highly selective adsorption of C 2 H 2 and CO 2 from CH 4 , but also demonstrates that the ligand conformation-controlled assembly strategy may be an efficient approach toward the construction of MOF materials with definite topologies for specific applications.

  10. Post-Traumatic Stress Symptoms in Post-ICU Family Members: Review and Methodological Challenges.

    Science.gov (United States)

    Petrinec, Amy B; Daly, Barbara J

    2016-01-01

    Family members of intensive care unit (ICU) patients are at risk for symptoms of post-traumatic stress disorder (PTSD) following ICU discharge. The aim of this systematic review is to examine the current literature regarding post-ICU family PTSD symptoms with an emphasis on methodological issues in conducting research on this challenging phenomenon. An extensive review of the literature was performed confining the search to English language studies reporting PTSD symptoms in adult family members of adult ICU patients. Ten studies were identified for review published from 2004 to 2012. Findings demonstrate a significant prevalence of family PTSD symptoms in the months following ICU hospitalization. However, there are several methodological challenges to the interpretation of existing studies and to the conduct of future research including differences in sampling, identification of risk factors and covariates of PTSD, and lack of consensus regarding the most appropriate PTSD symptom measurement tools and timing. © The Author(s) 2014.

  11. Challenges in implementing a Planetary Boundaries based Life-Cycle Impact Assessment methodology

    DEFF Research Database (Denmark)

    Ryberg, Morten; Owsianiak, Mikolaj; Richardson, Katherine

    2016-01-01

    of resolving the challenges and developing such methodology is discussed. The challenges are related to technical issues, i.e., modelling and including the Earth System processes and their control variables as impact categories in Life-Cycle Impact Assessment and to theoretical considerations with respect...... to the interpretation and use of Life-Cycle Assessment results in accordance with the Planetary Boundary framework. The identified challenges require additional research before a Planetary Boundaries based Life-Cycle Impact Assessment method can be developed. Research on modelling the impacts on Earth System processes......Impacts on the environment from human activities are now threatening to exceed thresholds for central Earth System processes, potentially moving the Earth System out of the Holocene state. To avoid such consequences, the concept of Planetary Boundaries was defined in 2009, and updated in 2015...

  12. Methodological Challenges in Sustainability Science: A Call for Method Plurality, Procedural Rigor and Longitudinal Research

    Directory of Open Access Journals (Sweden)

    Henrik von Wehrden

    2017-02-01

    Full Text Available Sustainability science encompasses a unique field that is defined through its purpose, the problem it addresses, and its solution-oriented agenda. However, this orientation creates significant methodological challenges. In this discussion paper, we conceptualize sustainability problems as wicked problems to tease out the key challenges that sustainability science is facing if scientists intend to deliver on its solution-oriented agenda. Building on the available literature, we discuss three aspects that demand increased attention for advancing sustainability science: 1 methods with higher diversity and complementarity are needed to increase the chance of deriving solutions to the unique aspects of wicked problems; for instance, mixed methods approaches are potentially better suited to allow for an approximation of solutions, since they cover wider arrays of knowledge; 2 methodologies capable of dealing with wicked problems demand strict procedural and ethical guidelines, in order to ensure their integration potential; for example, learning from solution implementation in different contexts requires increased comparability between research approaches while carefully addressing issues of legitimacy and credibility; and 3 approaches are needed that allow for longitudinal research, since wicked problems are continuous and solutions can only be diagnosed in retrospect; for example, complex dynamics of wicked problems play out across temporal patterns that are not necessarily aligned with the common timeframe of participatory sustainability research. Taken together, we call for plurality in methodologies, emphasizing procedural rigor and the necessity of continuous research to effectively addressing wicked problems as well as methodological challenges in sustainability science.

  13. Preparation and characterization of PVA/SSA membranes with Al{sub 2}O{sub 3} nanoparticles for fuel cell applications; Preparacao de caracterizacao de membranas de PVAL/SSA na presenca de nanoparticulas de Al{sub 2}O{sub 3} para aplicacao em celulas de combustivel

    Energy Technology Data Exchange (ETDEWEB)

    Oliveira, Paula N.; Pires, Alfredo T.N. [Grupo de Estudo em Materiais Polimericos - POLIMAT - UFSC, Florianopolis, SC (Brazil); Catarino, Margarida; Brandao, Lucia; Tanaka, Alfredo; Mendes, Adelio [Faculdade de Engenharia da Universidade do Porto, Porto (Portugal)

    2011-07-01

    In the present study, PVA/SSA membranes were prepared with and without the addition of Al{sub 2}O{sub 3} nanoparticles. Sulfosuccinic acid (SSA) was used as the crosslinking agent. Membranes were prepared with different amounts of SSA (26, 43 and 55 wt.%) and with 5 and 10 wt.% of nanoparticles. Crosslinking was performed at 90 degree C during 1.5 h. Membranes were analyzed by infrared spectroscopy, thermal analysis, water absorption, ion exchange capacity (IEC) and proton conductivity. The results showed that control of the crosslinking conditions, IEC value, water absorption and polymer structure are of significant importance to obtain a set of properties suitable for application in proton exchange membrane fuel cells. (author)

  14. Shock Hazard Prevention through Self-Healing Insulative Coating on SSA Metallic Bearings, Phase II

    Data.gov (United States)

    National Aeronautics and Space Administration — The space suit assembly (SSA) contains metallic bearings at the wrist, neck, and waist, which are exposed to space environment, and pose a potential shock hazard....

  15. Methodologies for nuclear material accounting and control: challenges and expectations

    International Nuclear Information System (INIS)

    Ramakumar, K.L.

    2007-01-01

    Nuclear Material Accounting and Control (NUMAC) represents one of the most important and indispensable responsibilities of any nuclear installation. The emphasis is to ensure that the nuclear material being handled in the nuclear installation is properly accounted for with the expected accuracy and confidence levels. A number of analytical methods based on both destructive and non-destructive assay techniques are available at the disposal of the nuclear analytical scientists for this purpose and they have been enumerated extensively in literature. Instead of recounting the analytical methodologies available, an attempt has been made in this paper to highlight some of the challenges. (author)

  16. Sewage sludge ash (SSA) from large and small incineration plants as a potential source of phosphorus - Polish case study.

    Science.gov (United States)

    Smol, Marzena; Kulczycka, Joanna; Kowalski, Zygmunt

    2016-12-15

    The aim of this research is to present the possibility of using the sewage sludge ash (SSA) generated in incineration plants as a secondary source of phosphorus (P). The importance of issues related to P recovery from waste materials results from European Union (UE) legislation, which indicated phosphorus as a critical raw material (CRM). Due to the risks of a shortage of supply and its impact on the economy, which is greater than other raw materials, the proper management of phosphorus resources is required in order to achieve global P security. Based on available databases and literature, an analysis of the potential use of SSA for P-recovery in Poland was conducted. Currently, approx. 43,000 Mg/year of SSA is produced in large and small incineration plants and according to in the Polish National Waste Management Plan 2014 (NWMP) further steady growth is predicted. This indicates a great potential to recycle phosphorus from SSA and to reintroduce it again into the value chain as a component of fertilisers which can be applied directly on fields. The amount of SSA generated in installations, both large and small, varies and this contributes to the fact that new and different P recovery technology solutions must be developed and put into use in the years to come (e.g. mobile/stationary P recovery installations). The creation of a database focused on the collection and sharing of data about the amount of P recovered in EU and Polish installations is identified as a helpful tool in the development of an efficient P management model for Poland. Copyright © 2016 Elsevier Ltd. All rights reserved.

  17. Economic evaluation of health promotion interventions for older people: do applied economic studies meet the methodological challenges?

    Science.gov (United States)

    Huter, Kai; Dubas-Jakóbczyk, Katarzyna; Kocot, Ewa; Kissimova-Skarbek, Katarzyna; Rothgang, Heinz

    2018-01-01

    In the light of demographic developments health promotion interventions for older people are gaining importance. In addition to methodological challenges arising from the economic evaluation of health promotion interventions in general, there are specific methodological problems for the particular target group of older people. There are especially four main methodological challenges that are discussed in the literature. They concern measurement and valuation of informal caregiving, accounting for productivity costs, effects of unrelated cost in added life years and the inclusion of 'beyond-health' benefits. This paper focuses on the question whether and to what extent specific methodological requirements are actually met in applied health economic evaluations. Following a systematic review of pertinent health economic evaluations, the included studies are analysed on the basis of four assessment criteria that are derived from methodological debates on the economic evaluation of health promotion interventions in general and economic evaluations targeting older people in particular. Of the 37 studies included in the systematic review, only very few include cost and outcome categories discussed as being of specific relevance to the assessment of health promotion interventions for older people. The few studies that consider these aspects use very heterogeneous methods, thus there is no common methodological standard. There is a strong need for the development of guidelines to achieve better comparability and to include cost categories and outcomes that are relevant for older people. Disregarding these methodological obstacles could implicitly lead to discrimination against the elderly in terms of health promotion and disease prevention and, hence, an age-based rationing of public health care.

  18. A methodology for the validated design space exploration of fuel cell powered unmanned aerial vehicles

    Science.gov (United States)

    Moffitt, Blake Almy

    Unmanned Aerial Vehicles (UAVs) are the most dynamic growth sector of the aerospace industry today. The need to provide persistent intelligence, surveillance, and reconnaissance for military operations is driving the planned acquisition of over 5,000 UAVs over the next five years. The most pressing need is for quiet, small UAVs with endurance beyond what is capable with advanced batteries or small internal combustion propulsion systems. Fuel cell systems demonstrate high efficiency, high specific energy, low noise, low temperature operation, modularity, and rapid refuelability making them a promising enabler of the small, quiet, and persistent UAVs that military planners are seeking. Despite the perceived benefits, the actual near-term performance of fuel cell powered UAVs is unknown. Until the auto industry began spending billions of dollars in research, fuel cell systems were too heavy for useful flight applications. However, the last decade has seen rapid development with fuel cell gravimetric and volumetric power density nearly doubling every 2--3 years. As a result, a few design studies and demonstrator aircraft have appeared, but overall the design methodology and vehicles are still in their infancy. The design of fuel cell aircraft poses many challenges. Fuel cells differ fundamentally from combustion based propulsion in how they generate power and interact with other aircraft subsystems. As a result, traditional multidisciplinary analysis (MDA) codes are inappropriate. Building new MDAs is difficult since fuel cells are rapidly changing in design, and various competitive architectures exist for balance of plant, hydrogen storage, and all electric aircraft subsystems. In addition, fuel cell design and performance data is closely protected which makes validation difficult and uncertainty significant. Finally, low specific power and high volumes compared to traditional combustion based propulsion result in more highly constrained design spaces that are

  19. MELiSSA third compartment: Nitrosomonas europaea and Nitrobacter winogradskyi axenic cultures in bioreactors

    Science.gov (United States)

    Cruvellier, Nelly; Lasseur, Christophe; Poughon, Laurent; Creuly, Catherine; Dussap, Gilles

    Nitrogen is a key element for the life and its balance on Earth is regulated by the nitrogen cycle. This loop includes several steps among which nitrification that permits the transformation of the ammonium into nitrate. The MELiSSA loop is an artificial ecosystem designed for life support systems (LSS). It is based on the carbon and nitrogen cycles and the recycling of the non-edible part of the higher plants and the waste produced by the crew. In this order, all the wastes are collected in the first compartment to degrade them into organic acids and CO2. These compounds are joining the second compartment which is a photoheterotrophic compartment where at the outlet an organic-free medium containing ammonium is produced. This solution will be the substrate of the third compartment where nitrification is done. This compartment has to oxidize the ammonium into nitrate, and this biological reaction needs two steps. In the MELiSSA loop, the nitrification is carried out by two bacteria: Nitrosomonas europaea ATCC® 19718™ which is oxidizing ammonia into nitrite and Nitrobacter winogradskyi ATCC® 25391™ which is producing nitrate from nitrite in the third compartment. These two bacteria are growing in axenic conditions on a fixed bed bioreactor filled with Biostyr® beads. The nitrogen compounds are controlled by Ionic Chromatography and colorimetric titration for each sample. The work presented here deals with the culture of both bacteria in pure cultures and mixed cultures in stirred and aerated bioreactors of different volumes. The first aim of our work is the characterization of the bacteria growth in bioreactors and in the nitrifying fixed-bed column. The experimental results confirm that the growth is slow; the maximal growth rate in suspended cultures is 0.054h-1 for Nitrosomonas europaea and 0.022h-1 for Nitrobacter winogradskyi. Mixed cultures are difficult to control and operate but one could be done for more than 500 hours. The characterization of the

  20. Advantageous use of SSA technique to observe effects of thickness, antioxidant and oxygen in gamma irradiated low density polyethylene

    Energy Technology Data Exchange (ETDEWEB)

    Perez, C.J., E-mail: cjperez@fi.mdp.edu.ar [Research Institute of Material Science and Technology (INTEMA), National Research Council (CONICET), Engineering Faculty, Mar del Plata University, Av. J.B. Justo 4302, 7600 Mar del Plata (Argentina); Failla, M.D. [Planta Piloto de Ingenieria Quimica-PLAPIQUI (UNS-CONICET), Camino ' La Carrindanga' Km 7, 8000 Bahia Blanca (Argentina); Carella, J.M. [Research Institute of Material Science and Technology (INTEMA), National Research Council (CONICET), Engineering Faculty, Mar del Plata University, Av. J.B. Justo 4302, 7600 Mar del Plata (Argentina)

    2012-06-20

    Highlights: Black-Right-Pointing-Pointer Information from successive self-nucleation and annealing technique is analyzed. Black-Right-Pointing-Pointer Oxygen and antioxidants reduce crosslinking efficiency by reaction with free radicals. Black-Right-Pointing-Pointer Recognizable differences are obtained in samples irradiated at different atmospheres. - Abstract: Information obtained from successive self-nucleation and annealing (SSA) technique is analyzed, paying special attention to the observable effects of samples thickness and antioxidant and oxygen concentrations. Molecular structure changes for low density polyethylene (LDPE) samples, irradiated under three different atmospheres for doses between 33 and 222 kGy were analyzed, with emphasis on the changes of longer polymethylene crystallizable lengths. Antioxidant and oxygen concentrations were varied for samples of different thickness to study the effects on degradation. The changes in the molecular structure were followed simultaneously by SSA and Infrared spectroscopy (FTIR) via carbonyl group concentration. Preliminary quantifications of the SSA technique sensitivity are also advanced.

  1. Family Photography and Persecuted Communities: Methodological Challenges.

    Science.gov (United States)

    McAllister, Kirsten Emiko

    2018-05-01

    This paper examines methodological challenges involved in conducting research on family photographs from persecuted communities, using Japanese Canadian photos as a case study. Approaching family photography as a social practice that instills dominant familial ideologies, the paper examines their "performative scripts" that arrange family members according to normative identities and roles. The paper argues that researchers are not immune to scripts that shape how and what we have been socialized to see (and not see) in family photos. The paper thus presents techniques to distance oneself from these performative scripts and one's involvement in their social and emotional dynamics. Once able to disentangle oneself from the genre's normative practices, the paper argues it is necessary to situate the photos in their social and political context of persecution and survival. Given the insular, inward looking character of family photographs, the paper concludes by calling for intersectional analyses, reflecting on how one might bring one's own family photos into engagement with the photos of Indigenous families and turns to those of the Skwxwú7mesh (Squamish) Nation. © 2018 Canadian Sociological Association/La Société canadienne de sociologie.

  2. Methodological Challenges in Studies Comparing Prehospital Advanced Life Support with Basic Life Support.

    Science.gov (United States)

    Li, Timmy; Jones, Courtney M C; Shah, Manish N; Cushman, Jeremy T; Jusko, Todd A

    2017-08-01

    Determining the most appropriate level of care for patients in the prehospital setting during medical emergencies is essential. A large body of literature suggests that, compared with Basic Life Support (BLS) care, Advanced Life Support (ALS) care is not associated with increased patient survival or decreased mortality. The purpose of this special report is to synthesize the literature to identify common study design and analytic challenges in research studies that examine the effect of ALS, compared to BLS, on patient outcomes. The challenges discussed in this report include: (1) choice of outcome measure; (2) logistic regression modeling of common outcomes; (3) baseline differences between study groups (confounding); (4) inappropriate statistical adjustment; and (5) inclusion of patients who are no longer at risk for the outcome. These challenges may affect the results of studies, and thus, conclusions of studies regarding the effect of level of prehospital care on patient outcomes should require cautious interpretation. Specific alternatives for avoiding these challenges are presented. Li T , Jones CMC , Shah MN , Cushman JT , Jusko TA . Methodological challenges in studies comparing prehospital Advanced Life Support with Basic Life Support. Prehosp Disaster Med. 2017;32(4):444-450.

  3. Heterogeneous Effects in Education: The Promise and Challenge of Incorporating Intersectionality into Quantitative Methodological Approaches

    Science.gov (United States)

    Schudde, Lauren

    2018-01-01

    To date, the theory of intersectionality has largely guided qualitative efforts in social science and education research. Translating the construct to new methodological approaches is inherently complex and challenging, but offers the possibility of breaking down silos that keep education researchers with similar interests--but different…

  4. Ethical challenges facing veterinary professionals in Ireland: results from Policy Delphi with vignette methodology

    Science.gov (United States)

    Magalhães-Sant'Ana, M.; More, S. J.; Morton, D. B.; Hanlon, A.

    2016-01-01

    Ethics is key to the integrity of the veterinary profession. Despite its importance, there is a lack of applied research on the range of ethical challenges faced by veterinarians. A three round Policy Delphi with vignette methodology was used to record the diversity of views on ethical challenges faced by veterinary professionals in Ireland. Forty experts, comprising veterinary practitioners, inspectors and nurses, accepted to participate. In round 1, twenty vignettes describing a variety of ethically challenging veterinary scenarios were ranked in terms of ethical acceptability, reputational risk and perceived standards of practice. Round 2 aimed at characterising challenges where future policy development or professional guidance was deemed to be needed. In round 3, possible solutions to key challenges were explored. Results suggest that current rules and regulations are insufficient to ensure best veterinary practices and that a collective approach is needed to harness workable solutions for the identified ethical challenges. Challenges pertaining mostly to the food chain seem to require enforcement measures whereas softer measures that promote professional discretion were preferred to address challenges dealing with veterinary clinical services. These findings can support veterinary representative bodies, advisory committees and regulatory authorities in their decision making, policy and regulation. PMID:27613779

  5. Overview of Human-Centric Space Situational Awareness (SSA) Science and Technology (S&T)

    Science.gov (United States)

    Ianni, J.; Aleva, D.; Ellis, S.

    2012-09-01

    A number of organizations, within the government, industry, and academia, are researching ways to help humans understand and react to events in space. The problem is both helped and complicated by the fact that there are numerous data sources that need to be planned (i.e., tasked), collected, processed, analyzed, and disseminated. A large part of the research is in support of the Joint Space Operational Center (JSpOC), National Air and Space Intelligence Center (NASIC), and similar organizations. Much recent research has been specifically targeting the JSpOC Mission System (JMS) which has provided a unifying software architecture. This paper will first outline areas of science and technology (S&T) related to human-centric space situational awareness (SSA) and space command and control (C2) including: 1. Object visualization - especially data fused from disparate sources. Also satellite catalog visualizations that convey the physical relationships between space objects. 2. Data visualization - improve data trend analysis as in visual analytics and interactive visualization; e.g., satellite anomaly trends over time, space weather visualization, dynamic visualizations 3. Workflow support - human-computer interfaces that encapsulate multiple computer services (i.e., algorithms, programs, applications) into a 4. Command and control - e.g., tools that support course of action (COA) development and selection, tasking for satellites and sensors, etc. 5. Collaboration - improve individuals or teams ability to work with others; e.g., video teleconferencing, shared virtual spaces, file sharing, virtual white-boards, chat, and knowledge search. 6. Hardware/facilities - e.g., optimal layouts for operations centers, ergonomic workstations, immersive displays, interaction technologies, and mobile computing. Secondly we will provide a survey of organizations working these areas and suggest where more attention may be needed. Although no detailed master plan exists for human

  6. Conceptual and methodological challenges to integrating SEA and cumulative effects assessment

    International Nuclear Information System (INIS)

    Gunn, Jill; Noble, Bram F.

    2011-01-01

    The constraints to assessing and managing cumulative environmental effects in the context of project-based environmental assessment are well documented, and the potential benefits of a more strategic approach to cumulative effects assessment (CEA) are well argued; however, such benefits have yet to be clearly demonstrated in practice. While it is widely assumed that cumulative effects are best addressed in a strategic context, there has been little investigation as to whether CEA and strategic environmental assessment (SEA) are a 'good fit' - conceptually or methodologically. This paper identifies a number of conceptual and methodological challenges to the integration of CEA and SEA. Based on results of interviews with international experts and practitioners, this paper demonstrates that: definitions and conceptualizations of CEA are typically weak in practice; approaches to effects aggregation vary widely; a systems perspective lacks in both SEA and CEA; the multifarious nature of SEA complicates CEA; tiering arrangements between SEA and project-based assessment are limited to non-existing; and the relationship of SEA to regional planning remains unclear.

  7. Forecasting Energy-Related CO2 Emissions Employing a Novel SSA-LSSVM Model: Considering Structural Factors in China

    Directory of Open Access Journals (Sweden)

    Huiru Zhao

    2018-03-01

    Full Text Available Carbon dioxide (CO2 emissions forecasting is becoming more important due to increasing climatic problems, which contributes to developing scientific climate policies and making reasonable energy plans. Considering that the influential factors of CO2 emissions are multiplex and the relationships between factors and CO2 emissions are complex and non-linear, a novel CO2 forecasting model called SSA-LSSVM, which utilizes the Salp Swarm Algorithm (SSA to optimize the two parameters of the least squares support sector machine (LSSVM model, is proposed in this paper. The influential factors of CO2 emissions, including the gross domestic product (GDP, population, energy consumption, economic structure, energy structure, urbanization rate, and energy intensity, are regarded as the input variables of the SSA-LSSVM model. The proposed model is verified to show a better forecasting performance compared with the selected models, including the single LSSVM model, the LSSVM model optimized by the particle swarm optimization algorithm (PSO-LSSVM, and the back propagation (BP neural network model, on CO2 emissions in China from 2014 to 2016. The comparative analysis indicates the SSA-LSSVM model is greatly superior and has the potential to improve the accuracy and reliability of CO2 emissions forecasting. CO2 emissions in China from 2017 to 2020 are forecast combined with the 13th Five-Year Plan for social, economic and energy development. The comparison of CO2 emissions of China in 2020 shows that structural factors significantly affect CO2 emission forecasting results. The average annual growth of CO2 emissions slows down significantly due to a series of policies and actions taken by the Chinese government, which means China can keep the promise that greenhouse gas emissions will start to drop after 2030.

  8. BOREAS TF-8 NSA-OJP and SSA-OBS Ceilometer Data

    Science.gov (United States)

    Moore, Kathleen E.; Hall, Forrest G. (Editor); Huemmrich, Karl (Editor); Fitzjarrald, David R.

    2000-01-01

    The BOREAS TF-8 team used ceilometers to collect data on the fraction of the sky covered with clouds and the cloud height. Included with these data is the surface-based lifting condensation level, derived from temperature and humidity values acquired at the flux tower at the NSA-OJP site. Ceilo-meter data were collected at the NSA-OJP site in 1994 and at the NSA-OJP and SSA-OBS sites in 1996. The data are available in tabular ASCII files. The data files are available on a CD-ROM (see document number 20010000884).

  9. VBA SSA Acc To Fed Rec Online (SAFRO) - Also known as Veterans Benefit Administration Query (VBAQ).

    Data.gov (United States)

    Social Security Administration — The purpose of this query is to provide SSA field office personnel with real-time access to military discharge data from the VA BIRLS database. This information is...

  10. Introduction to Visual Communication in the Age of Social Media: Conceptual, Theoretical and Methodological Challenges

    Directory of Open Access Journals (Sweden)

    Uta Russmann

    2017-12-01

    Full Text Available This thematic issue of Media and Communication focuses attention on the shift towards visual images on social media as well as the transformation of visual communication which has occurred within the online ecology of social media platforms. The sharing of images is becoming an integral part of the social media experience today, and given that social media platforms are the prime locus for sociability—at least among young people in the West—this shift towards visuals arguably transforms how we relate to each other and the world around us, as well as how we perceive and construct our sense of self. For researchers, this raises conceptual, theoretical and methodological challenges. This thematic issue presents six articles as well as a book review on visual communication in social media focusing on developing a conceptual apparatus and precise definitions of objects and practices of study as well as contributions that address and discuss the methodological challenges as well as their potential solutions. The idea was to synergize research from a wide variety of communication-related disciplines on this rather new topic.

  11. The Challenges of Participant Photography: A Critical Reflection on Methodology and Ethics in Two Cultural Contexts.

    Science.gov (United States)

    Murray, Linda; Nash, Meredith

    2017-05-01

    Photovoice and photo-elicitation are two common methods of participant photography used in health research. Although participatory photography has many benefits, this critical reflection provides fellow researchers with insights into the methodological and ethical challenges faced when using such methods. In this article, we critically reflect on two studies that used participatory photography in different cultural contexts. The first study used photo-elicitation to investigate mothers' experiences of infant settling in central Vietnam. The second study used photovoice to explore pregnant embodiment in Australia. Following a discussion of the literature and a detailed overview of the two studies, we examine the methodological challenges in using participant photography before, during and after each study. This is followed by a discussion of ethical concerns that arose in relation to the burden of participation, confidentiality, consent, and the photographing of families and children. To conclude, we highlight implications for using participatory photography in other settings.

  12. A review on human reinstatement studies: an overview and methodological challenges.

    Science.gov (United States)

    Haaker, Jan; Golkar, Armita; Hermans, Dirk; Lonsdorf, Tina B

    2014-09-01

    In human research, studies of return of fear (ROF) phenomena, and reinstatement in particular, began only a decade ago and recently are more widely used, e.g., as outcome measures for fear/extinction memory manipulations (e.g., reconsolidation). As reinstatement research in humans is still in its infancy, providing an overview of its stability and boundary conditions and summarizing methodological challenges is timely to foster fruitful future research. As a translational endeavor, clarifying the circumstances under which (experimental) reinstatement occurs may offer a first step toward understanding relapse as a clinical phenomenon and pave the way for the development of new pharmacological or behavioral ways to prevent ROF. The current state of research does not yet allow pinpointing these circumstances in detail and we hope this review will aid the research field to advance in this direction. As an introduction, we begin with a synopsis of rodent work on reinstatement and theories that have been proposed to explain the findings. The review however mainly focuses on reinstatement in humans. We first describe details and variations of the experimental setup in reinstatement studies in humans and give a general overview of results. We continue with a compilation of possible experimental boundary conditions and end with the role of individual differences and behavioral and/or pharmacological manipulations. Furthermore, we compile important methodological and design details on the published studies in humans and end with open research questions and some important methodological and design recommendations as a guide for future research. © 2014 Haaker et al.; Published by Cold Spring Harbor Laboratory Press.

  13. Persistent fetal sinus bradycardia associated with maternal anti-SSA/Ro and anti-SSB/La antibodies

    NARCIS (Netherlands)

    Chockalingam, Priya; Jaeggi, Edgar T.; Rammeloo, Lukas A.; Haak, Monique C.; Adama van Scheltema, Phebe N.; Breur, Johannes M. P. J.; Bartelings, Margot M.; Clur, Sally-Ann B.; Blom, Nico A.

    2011-01-01

    To study the clinical course and outcome of fetal sinus bradycardia (SB) due to maternal antibody-induced sinus node dysfunction. We reviewed the maternal, prenatal, and postnatal findings of fetuses with SB associated with elevated maternal anti-SSA/Ro and anti-SSB/La antibodies. Of the 6 cases

  14. SSA DISABILITY. SGA Levels Appear to Affect the Work Behavior of Relatively Few Beneficiaries, but More Data Needed

    National Research Council Canada - National Science Library

    Baucus, Max

    2002-01-01

    ... physical or mental impairment has earnings that exceed the Substantial Gainful Activity (SGA) level, which represents SSA's principal standard for determining whether a disabled individual is able to work...

  15. The Bioethanol Industry in Sub-Saharan Africa: History, Challenges, and Prospects

    Directory of Open Access Journals (Sweden)

    Evanie Devi Deenanath

    2012-01-01

    Full Text Available Recently, interest in using bioethanol as an alternative to petroleum fuel has been escalating due to decrease in the availability of crude oil. The application of bioethanol in the motor-fuel industry can contribute to reduction in the use of fossil fuels and in turn to decreased carbon emissions and stress of the rapid decline in crude oil availability. Bioethanol production methods are numerous and vary with the types of feedstock used. Feedstocks can be cereal grains (first generation feedstock, lignocellulose (second generation feedstock, or algae (third generation feedstock feedstocks. To date, USA and Brazil are the leading contributors to global bioethanol production. In sub-Saharan Africa, bioethanol production is stagnant. During the 1980s, bioethanol production has been successful in several countries including Zimbabwe, Malawi, and Kenya. However, because of numerous challenges such as food security, land availability, and government policies, achieving sustainability was a major hurdle. This paper examines the history and challenges of bioethanol production in sub-Saharan Africa (SSA and demonstrates the bioethanol production potential in SSA with a focus on using bitter sorghum and cashew apple juice as unconventional feedstocks for bioethanol production.

  16. The bioethanol industry in sub-Saharan Africa: history, challenges, and prospects.

    Science.gov (United States)

    Deenanath, Evanie Devi; Iyuke, Sunny; Rumbold, Karl

    2012-01-01

    Recently, interest in using bioethanol as an alternative to petroleum fuel has been escalating due to decrease in the availability of crude oil. The application of bioethanol in the motor-fuel industry can contribute to reduction in the use of fossil fuels and in turn to decreased carbon emissions and stress of the rapid decline in crude oil availability. Bioethanol production methods are numerous and vary with the types of feedstock used. Feedstocks can be cereal grains (first generation feedstock), lignocellulose (second generation feedstock), or algae (third generation feedstock) feedstocks. To date, USA and Brazil are the leading contributors to global bioethanol production. In sub-Saharan Africa, bioethanol production is stagnant. During the 1980s, bioethanol production has been successful in several countries including Zimbabwe, Malawi, and Kenya. However, because of numerous challenges such as food security, land availability, and government policies, achieving sustainability was a major hurdle. This paper examines the history and challenges of bioethanol production in sub-Saharan Africa (SSA) and demonstrates the bioethanol production potential in SSA with a focus on using bitter sorghum and cashew apple juice as unconventional feedstocks for bioethanol production.

  17. 77 FR 74913 - Privacy Act of 1974, as Amended; Computer Matching Program (Social Security Administration (SSA...

    Science.gov (United States)

    2012-12-18

    ...; Computer Matching Program (Social Security Administration (SSA)/Office of Personnel Management (OPM.... SUPPLEMENTARY INFORMATION: A. General The Computer Matching and Privacy Protection Act of 1988 (Public Law (Pub... computer matching involving the Federal government could be performed and adding certain protections for...

  18. Socio-Hydrology: Conceptual and Methodological Challenges in the Bidirectional Coupling of Human and Water Systems

    Science.gov (United States)

    Scott, C. A.

    2014-12-01

    This presentation reviews conceptual advances in the emerging field of socio-hydrology that focuses on coupled human and water systems. An important current challenge is how to better couple the bidirectional influences between human and water systems, which lead to emergent dynamics. The interactions among (1) the structure and dynamics of systems with (2) human values and norms lead to (3) outcomes, which in turn influence subsequent interactions. Human influences on hydrological systems are relatively well understood, chiefly resulting from developments in the field of water resources. The ecosystem-service concept of cultural value has expanded understanding of decision-making beyond economic rationality criteria. Hydrological impacts on social processes are less well developed conceptually, but this is changing with growing attention to vulnerability, adaptation, and resilience, particularly in the face of climate change. Methodological limitations, especially in characterizing the range of human responses to hydrological events and drivers, still pose challenges to modeling bidirectional human-water influences. Evidence from multiple case studies, synthesized in more broadly generic syndromes, helps surmount these methodological limitations and offers the potential to improve characterization and quantification of socio-hydrological systems.

  19. Methodological Challenges in Examining the Impact of Healthcare Predictive Analytics on Nursing-Sensitive Patient Outcomes.

    Science.gov (United States)

    Jeffery, Alvin D

    2015-06-01

    The expansion of real-time analytic abilities within current electronic health records has led to innovations in predictive modeling and clinical decision support systems. However, the ability of these systems to influence patient outcomes is currently unknown. Even though nurses are the largest profession within the healthcare workforce, little research has been performed to explore the impact of clinical decision support on their decisions and the patient outcomes associated with them. A scoping literature review explored the impact clinical decision support systems containing healthcare predictive analytics have on four nursing-sensitive patient outcomes (pressure ulcers, failure to rescue, falls, and infections). While many articles discussed variable selection and predictive model development/validation, only four articles examined the impact on patient outcomes. The novelty of predictive analytics and the inherent methodological challenges in studying clinical decision support impact are likely responsible for this paucity of literature. Major methodological challenges include (1) multilevel nature of intervention, (2) treatment fidelity, and (3) adequacy of clinicians' subsequent behavior. There is currently insufficient evidence to demonstrate efficacy of healthcare predictive analytics-enhanced clinical decision support systems on nursing-sensitive patient outcomes. Innovative research methods and a greater emphasis on studying this phenomenon are needed.

  20. Vector Topographic Map Data over the BOREAS NSA and SSA in SIF Format

    Science.gov (United States)

    Knapp, David; Nickeson, Jaime; Hall, Forrest G. (Editor)

    2000-01-01

    This data set contains vector contours and other features of individual topographic map sheets from the National Topographic Series (NTS). The map sheet files were received in Standard Interchange Format (SIF) and cover the BOReal Ecosystem-Atmosphere Study (BOREAS) Northern Study Area (NSA) and Southern Study Area (SSA) at scales of 1:50,000 and 1:250,000. The individual files are stored in compressed Unix tar archives.

  1. 20 CFR 408.1205 - How can a State have SSA administer its State recognition payment program?

    Science.gov (United States)

    2010-04-01

    ... recognition payment program? 408.1205 Section 408.1205 Employees' Benefits SOCIAL SECURITY ADMINISTRATION SPECIAL BENEFITS FOR CERTAIN WORLD WAR II VETERANS Federal Administration of State Recognition Payments § 408.1205 How can a State have SSA administer its State recognition payment program? A State (or...

  2. Solar Flare Prediction Science-to-Operations: the ESA/SSA SWE A-EFFort Service

    Science.gov (United States)

    Georgoulis, Manolis K.; Tziotziou, Konstantinos; Themelis, Konstantinos; Magiati, Margarita; Angelopoulou, Georgia

    2016-07-01

    We attempt a synoptical overview of the scientific origins of the Athens Effective Solar Flare Forecasting (A-EFFort) utility and the actions taken toward transitioning it into a pre-operational service of ESA's Space Situational Awareness (SSA) Programme. The preferred method for solar flare prediction, as well as key efforts to make it function in a fully automated environment by coupling calculations with near-realtime data-downloading protocols (from the Solar Dynamics Observatory [SDO] mission), pattern recognition (solar active-region identification) and optimization (magnetic connectivity by simulated annealing) will be highlighted. In addition, the entire validation process of the service will be described, with its results presented. We will conclude by stressing the need for across-the-board efforts and synergistic work in order to bring science of potentially limited/restricted interest into realizing a much broader impact and serving the best public interests. The above presentation was partially supported by the ESA/SSA SWE A-EFFort project, ESA Contract No. 4000111994/14/D/MRP. Special thanks go to the ESA Project Officers R. Keil, A. Glover, and J.-P. Luntama (ESOC), M. Bobra and C. Balmer of the SDO/HMI team at Stanford University, and M. Zoulias at the RCAAM of the Academy of Athens for valuable technical help.

  3. Potential use of sewage sludge ash (SSA as a cement replacement in precast concrete blocks

    Directory of Open Access Journals (Sweden)

    Pérez-Carrión, M.

    2014-03-01

    Full Text Available The present study explored the technological feasibility of re-using sewage sludge ash (SSA as a Portland cement replacement in commercially manufactured pre cast concrete blocks. The blocks analysed were made to the guidelines laid down in Spain’s National Plan for Waste Water Treatment Plant Sludge, 2001–2006, and European Union specifications (CE marking for such products. Performance was compared in three families of blocks, with 0, 10 and 20% SSA. The findings proved that SSA is apt for pre cast concrete block manufacture and that, in addition to the economic and environmental benefits afforded, its use would improve certain of the properties of conventional block.El objetivo de esta investigación es estudiar el uso potencial de las cenizas de lodos de depuradora (CLD, como sustitución del cemento Portland en bloques de hormigón prefabricados, de forma que se pueda lograr una revalorización de este material de desecho mediante este procedimiento. La metodología utilizada en este trabajo se rige por las directrices del Plan Nacional Español de Lodos de Aguas Residuales de 2001–2006, y por las exigencias del Consejo Europeo (marcado CE, que es obligatorio para este tipo de productos. Se han utilizado dos niveles de sustitución de cemento (10% y 20%, y todos los resultados han sido referidos a las muestras control. Los resultados obtenidos muestran que es posible utilizar una sustitución parcial del cemento por CLD, en la fabricación de bloques de hormigón prefabricados, y por lo tanto, se pueden conseguir beneficios económicos y ambientales, así como la mejora de una serie de propiedades.

  4. Neurodevelopment in children with and without congenital heart block born to anti-Ro/SSA-positive mothers.

    Science.gov (United States)

    Skog, Amanda; Tingström, Joanna; Salomonsson, Stina; Sonesson, Sven-Erik; Wahren-Herlenius, Marie

    2013-01-01

    To define factors influencing neurodevelopment in children with and without complete congenital heart block (CHB) born to mothers with Ro/SSA autoantibodies. Medical records of a population-based cohort of siblings with (n = 60) and without (n = 54) CHB born 1974-2009 to anti-Ro/SSA-positive mothers were retrieved from children primary healthcare centres and school health services and used to extract data on neurodevelopment. Impaired neurodevelopment was reported in 16% of the children (18/114) during the follow-up time of 13.0 (8.2-17.5) years, median (quartiles). Reported problems included speech (9%), motor (8%) and learning (8%) impairment, attention deficit (5%) and behavioural impairment (4%). Impairment in motor skill development was more common in boys (p influenced by maternal SLE (p influenced by both maternal SLE (p influence neurodevelopment. Follow-up of neurodevelopment should therefore be considered for children with CHB, especially if the mother is diagnosed with SLE. ©2012 The Author(s)/Acta Paediatrica ©2012 Foundation Acta Paediatrica.

  5. BOREAS RSS-7 Landsat TM LAI IMages of the SSA and NSA

    Science.gov (United States)

    Hall, Forrest G. (Editor); Nickeson, Jaime (Editor); Chen, Jing; Cihlar, Josef

    2000-01-01

    The BOReal Ecosystem-Atmosphere Study Remote Sensing Science (BOREAS RSS-7) team used Landsat Thematic Mapper (TM) images processed at CCRS to produce images of Leaf Area Index (LAI) for the BOREAS study areas. Two images acquired on 06-Jun and 09-Aug-1991 were used for the SSA, and one image acquired on 09-Jun-1994 was used for the NSA. The LAI images are based on ground measurements and Landsat TM Reduced Simple Ratio (RSR) images. The data are stored in binary image-format files.

  6. 75 FR 54213 - Privacy Act of 1974, as Amended; Computer Matching Program (SSA/Office of Personnel Management...

    Science.gov (United States)

    2010-09-03

    ... 1021 AGENCY: Social Security Administration (SSA). ACTION: Notice of a renewal of an existing computer.... SUPPLEMENTARY INFORMATION: A. General The Computer Matching and Privacy Protection Act of 1988 (Public Law (Pub... computer matching involving the Federal government could be performed and adding certain protections for...

  7. Production characteristics of lettuce Lactuca sativa L. in the frame of the first crop tests in the Higher Plant Chamber integrated into the MELiSSA Pilot Plant

    Science.gov (United States)

    Tikhomirova, Natalia; Lawson, Jamie; Stasiak, Michael; Dixon, Mike; Paille, Christel; Peiro, Enrique; Fossen, Arnaud; Godia, Francesc

    Micro-Ecological Life Support System Alternative (MELiSSA) is an artificial closed ecosystem that is considered a tool for the development of a bioregenerative life support system for manned space missions. One of the five compartments of MELiSSA loop -Higher Plant Chamber was recently integrated into the MELiSSA Pilot Plant facility at Universitat Aut`noma deo Barcelona. The main contributions expected by integration of this photosynthetic compartment are oxygen, water, vegetable food production and CO2 consumption. Production characteristics of Lactuca sativa L., as a MELiSSA candidate crop, were investigated in this work in the first crop experiments in the MELiSSA Pilot Plant facility. The plants were grown in batch culture and totaled 100 plants with a growing area 5 m long and 1 m wide in a sealed controlled environment. Several replicates of the experiments were carried out with varying duration. It was shown that after 46 days of lettuce cultivation dry edible biomass averaged 27, 2 g per plant. However accumulation of oxygen in the chamber, which required purging of the chamber, and decrease in the food value of the plants was observed. Reducing the duration of the tests allowed uninterrupted test without opening the system and also allowed estimation of the crop's carbon balance. Results of productivity, tissue composition, nutrient uptake and canopy photosynthesis of lettuce regardless of test duration are discussed in the paper.

  8. Function of SSA subfamily of Hsp70 within and across species varies widely in complementing Saccharomyces cerevisiae cell growth and prion propagation.

    Directory of Open Access Journals (Sweden)

    Deepak Sharma

    2009-08-01

    Full Text Available The cytosol of most eukaryotic cells contains multiple highly conserved Hsp70 orthologs that differ mainly by their spatio-temporal expression patterns. Hsp70s play essential roles in protein folding, transport or degradation, and are major players of cellular quality control processes. However, while several reports suggest that specialized functions of Hsp70 orthologs were selected through evolution, few studies addressed systematically this issue.We compared the ability of Ssa1p-Ssa4p from Saccharomyces cerevisiae and Ssa5p-Ssa8p from the evolutionary distant yeast Yarrowia lipolytica to perform Hsp70-dependent tasks when expressed as the sole Hsp70 for S. cerevisiae in vivo. We show that Hsp70 isoforms (i supported yeast viability yet with markedly different growth rates, (ii influenced the propagation and stability of the [PSI(+] and [URE3] prions, but iii did not significantly affect the proteasomal degradation rate of CFTR. Additionally, we show that individual Hsp70 orthologs did not induce the formation of different prion strains, but rather influenced the aggregation properties of Sup35 in vivo. Finally, we show that [URE3] curing by the overexpression of Ydj1p is Hsp70-isoform dependent.Despite very high homology and overlapping functions, the different Hsp70 orthologs have evolved to possess distinct activities that are required to cope with different types of substrates or stress situations. Yeast prions provide a very sensitive model to uncover this functional specialization and to explore the intricate network of chaperone/co-chaperone/substrates interactions.

  9. BOREAS HYP-8 DEM Data Over The NSA-MSA and SSA-MSA in The AEAC Projection

    Science.gov (United States)

    Knapp, David E.; Hall, Forrest G. (Editor); Wang, Xue-Wen; Band, L. E.; Smith, David E. (Technical Monitor)

    2000-01-01

    These data were derived from the original Digital Elevation Models (DEMs) produced by the Boreal Ecosystem-Atmosphere Study (BOREAS) Hydrology (HYD)-8 team. The original DEMs were in the Universal Transverse Mercator (UTM) projection, while this product is projected in the Albers Equal-Area Conic (AEAC) projection. The pixel size of the data is 100 meters, which is appropriate for the 1:50,000-scale contours from which the DEMs were made. The original data were compiled from information available in the 1970s and 1980s. This data set covers the two Modeling Sub-Areas (MSAs) that are contained within the Southern Study Area (SSA) and the Northern Study Area (NSA). The data are stored in binary, image format files. The DEM data over the NSA-MSA and SSA-MSA in the AEAC projection are available from the Earth Observing System Data and Information System (EOSDIS) Oak Ridge National Laboratory (ORNL) Distributed Active Archive Center (DAAC). The data files are available on a CD-ROM (see document number 20010000884).

  10. 76 FR 21091 - Privacy Act of 1974, as Amended; Computer Matching Program (SSA/Centers for Medicare & Medicaid...

    Science.gov (United States)

    2011-04-14

    ...: Social Security Administration (SSA). ACTION: Notice of a renewal of an existing computer matching...: A. General The Computer Matching and Privacy Protection Act of 1988 (Public Law (Pub. L.) 100-503...), as amended, (Pub. L. 100-503, the Computer Matching and Privacy Protection Act (CMPPA) of 1988), the...

  11. 76 FR 71417 - Privacy Act of 1974, as Amended; Computer Matching Program (SSA/Law Enforcement Agencies (LEA...

    Science.gov (United States)

    2011-11-17

    ...; Computer Matching Program (SSA/ Law Enforcement Agencies (LEA)) Match Number 5001 AGENCY: Social Security... protections for such persons. The Privacy Act, as amended, regulates the use of computer matching by Federal... accordance with the Privacy Act of 1974, as amended by the Computer Matching and Privacy Protection Act of...

  12. 78 FR 37875 - Privacy Act of 1974, as Amended; Computer Matching Program (SSA/Bureau of the Fiscal Service...

    Science.gov (United States)

    2013-06-24

    ...: Social Security Administration (SSA). ACTION: Notice of a renewal of an existing computer matching... above. SUPPLEMENTARY INFORMATION: A. General The Computer Matching and Privacy Protection Act of 1988... computer matching involving the Federal government could be performed and adding certain protections for...

  13. Comment s'inventer un père écrivain: Albert camus chez Maïssa Bey

    NARCIS (Netherlands)

    Rosello, M.

    2015-01-01

    This article focuses on the role played by Camus in Maïssa Bey’s work. Focusing on the ambivalent and paradoxical place he occupies in Au commencement était la mer and l’Ombre d’un homme qui marche au soleil, I analyse the construction of the father or rather Bey’s definition of fathers. The

  14. The appropriation of new media and the interrelation with social change in Uasin Gishu, Kenya - methodological and epistemological challenges

    DEFF Research Database (Denmark)

    Gustafsson, Jessica; Nielsen, Poul Erik

    The aim of this paper is to theoretically and empirically discuss methodological challenges related to studying the interrelations between the appropriations of new media and socio-cultural changes in the Global South. Empirically the paper takes its point of departure in three sub-projects within...

  15. Caffeine and cognitive performance: persistent methodological challenges in caffeine research.

    Science.gov (United States)

    James, Jack E

    2014-09-01

    Human cognitive performance is widely perceived to be enhanced by caffeine at usual dietary doses. However, the evidence for and against this belief continues to be vigorously contested. Controversy has centred on caffeine withdrawal and withdrawal reversal as potential sources of experimental confounding. In response, some researchers have enlisted "caffeine-naïve" experimental participants (persons alleged to consume little or no caffeine) assuming that they are not subject to withdrawal. This mini-review examines relevant research to illustrate general methodological challenges that have been the cause of enduring confusion in caffeine research. At issue are the processes of caffeine withdrawal and withdrawal reversal, the definition of caffeine-naïve, the population representativeness of participants deemed to be caffeine-naïve, and confounding due to caffeine tolerance. Attention to these processes is necessary if premature conclusions are to be avoided, and if caffeine's complex effects and the mechanisms responsible for those effects are to be illuminated. Strategies are described for future caffeine research aimed at minimising confounding from withdrawal and withdrawal reversal. Copyright © 2014 Elsevier Inc. All rights reserved.

  16. Conceptual and methodological challenges for neuroimaging studies of autistic spectrum disorders

    Directory of Open Access Journals (Sweden)

    Mazzone Luigi

    2010-03-01

    Full Text Available Abstract Autistic Spectrum Disorders (ASDs are a set of complex developmental disabilities defined by impairment in social interaction and communication, as well as by restricted interests or repetitive behaviors. Neuroimaging studies have substantially advanced our understanding of the neural mechanisms that underlie the core symptoms of ASDs. Nevertheless, a number of challenges still remain in the application of neuroimaging techniques to the study of ASDs. We review three major conceptual and methodological challenges that complicate the interpretation of findings from neuroimaging studies in ASDs, and that future imaging studies should address through improved designs. These include: (1 identification and implementation of tasks that more specifically target the neural processes of interest, while avoiding the confusion that the symptoms of ASD may impose on both the performance of the task and the detection of brain activations; (2 the inconsistency that disease heterogeneity in persons with ASD can generate on research findings, particularly heterogeneity of symptoms, symptom severity, differences in IQ, total brain volume, and psychiatric comorbidity; and (3 the problems with interpretation of findings from cross-sectional studies of persons with ASD across differing age groups. Failure to address these challenges will continue to hinder our ability to distinguish findings that outline the causes of ASDs from brain processes that represent downstream or compensatory responses to the presence of the disease. Here we propose strategies to address these issues: 1 the use of simple and elementary tasks, that are easier to understand for autistic subjects; 2 the scanning of a more homogenous group of persons with ASDs, preferably at younger age; 3 the performance of longitudinal studies, that may provide more straight forward and reliable results. We believe that this would allow for a better understanding of both the central pathogenic

  17. Risk assessment of cryogenic installations – implementation, applicability of methodologies and challenges at CERN

    CERN Multimedia

    CERN. Geneva

    2016-01-01

    For the safe design of a cryogenic installation, it is essential to carry out a comprehensive hazard identification and risk estimate in order to put in place the necessary control measures for an adequate risk mitigation. According to CERN Safety Rules, it is mandatory that the organic unit owning a cryogenic facility conducts and documents a risk assessment. This requirement is also given by the European Directive 2014/68/EU to manufacturers of pressure equipment. During the talk, some of the challenges CERN faces in the development of risk assessments across the broad array of activities involving cryogenic equipment in the organization will be discussed. Challenges such as the choice of the best-suited risk assessment methodology based on the features and complexity of the installation/activities, the efforts to develop tools to facilitate hazard identification, risk analysis and definition of related measures to protect the health and safety of workers, such as streamlined guidelines, forms and check...

  18. Health effects of ambient air pollution – recent research development and contemporary methodological challenges

    Directory of Open Access Journals (Sweden)

    Ren Cizao

    2008-11-01

    Full Text Available Abstract Exposure to high levels of air pollution can cause a variety of adverse health outcomes. Air quality in developed countries has been generally improved over the last three decades. However, many recent epidemiological studies have consistently shown positive associations between low-level exposure to air pollution and health outcomes. Thus, adverse health effects of air pollution, even at relatively low levels, remain a public concern. This paper aims to provide an overview of recent research development and contemporary methodological challenges in this field and to identify future research directions for air pollution epidemiological studies.

  19. 20 CFR 408.1235 - How does the State transfer funds to SSA to administer its recognition payment program?

    Science.gov (United States)

    2010-04-01

    ... administer its recognition payment program? 408.1235 Section 408.1235 Employees' Benefits SOCIAL SECURITY ADMINISTRATION SPECIAL BENEFITS FOR CERTAIN WORLD WAR II VETERANS Federal Administration of State Recognition Payments § 408.1235 How does the State transfer funds to SSA to administer its recognition payment program...

  20. 76 FR 5235 - Privacy Act of 1974, as Amended; Computer Matching Program (SSA Internal Match)-Match Number 1014

    Science.gov (United States)

    2011-01-28

    ...; Computer Matching Program (SSA Internal Match)--Match Number 1014 AGENCY: Social Security Administration... regarding protections for such persons. The Privacy Act, as amended, regulates the use of computer matching....C. 552a, as amended, and the provisions of the Computer Matching and Privacy Protection Act of 1988...

  1. Implementation and evaluation of a pharmacist-led hypertension management service in primary care: outcomes and methodological challenges

    OpenAIRE

    Bajorek, Beata; Lemay, Kate S.; Magin, Parker; Roberts, Christopher; Krass, Ines; Armour, Carol L.

    2016-01-01

    Background: Suboptimal utilisation of pharmacotherapy, non-adherence to prescribed treatment, and a lack of monitoring all contribute to poor blood (BP) pressure control in patients with hypertension. Objective: The objective of this study was to evaluate the implementation of a pharmacist-led hypertension management service in terms of processes, outcomes, and methodological challenges. Method: A prospective, controlled study was undertaken within the Australian primary care setting. C...

  2. Methodological challenges of optical tweezers-based X-ray fluorescence imaging of biological model organisms at synchrotron facilities.

    Science.gov (United States)

    Vergucht, Eva; Brans, Toon; Beunis, Filip; Garrevoet, Jan; Bauters, Stephen; De Rijcke, Maarten; Deruytter, David; Janssen, Colin; Riekel, Christian; Burghammer, Manfred; Vincze, Laszlo

    2015-07-01

    Recently, a radically new synchrotron radiation-based elemental imaging approach for the analysis of biological model organisms and single cells in their natural in vivo state was introduced. The methodology combines optical tweezers (OT) technology for non-contact laser-based sample manipulation with synchrotron radiation confocal X-ray fluorescence (XRF) microimaging for the first time at ESRF-ID13. The optical manipulation possibilities and limitations of biological model organisms, the OT setup developments for XRF imaging and the confocal XRF-related challenges are reported. In general, the applicability of the OT-based setup is extended with the aim of introducing the OT XRF methodology in all research fields where highly sensitive in vivo multi-elemental analysis is of relevance at the (sub)micrometre spatial resolution level.

  3. 76 FR 12397 - Privacy Act of 1974, as Amended; Computer Matching Program (SSA/Bureau of the Public Debt (BPD...

    Science.gov (United States)

    2011-03-07

    ...; Computer Matching Program (SSA/ Bureau of the Public Debt (BPD))--Match Number 1038 AGENCY: Social Security... as shown above. SUPPLEMENTARY INFORMATION: A. General The Computer Matching and Privacy Protection... containing SSNs extracted from the Supplemental Security Record database. Exchanges for this computer...

  4. Measuring alterations in oscillatory brain networks in schizophrenia with resting-state MEG: State-of-the-art and methodological challenges.

    Science.gov (United States)

    Alamian, Golnoush; Hincapié, Ana-Sofía; Pascarella, Annalisa; Thiery, Thomas; Combrisson, Etienne; Saive, Anne-Lise; Martel, Véronique; Althukov, Dmitrii; Haesebaert, Frédéric; Jerbi, Karim

    2017-09-01

    Neuroimaging studies provide evidence of disturbed resting-state brain networks in Schizophrenia (SZ). However, untangling the neuronal mechanisms that subserve these baseline alterations requires measurement of their electrophysiological underpinnings. This systematic review specifically investigates the contributions of resting-state Magnetoencephalography (MEG) in elucidating abnormal neural organization in SZ patients. A systematic literature review of resting-state MEG studies in SZ was conducted. This literature is discussed in relation to findings from resting-state fMRI and EEG, as well as to task-based MEG research in SZ population. Importantly, methodological limitations are considered and recommendations to overcome current limitations are proposed. Resting-state MEG literature in SZ points towards altered local and long-range oscillatory network dynamics in various frequency bands. Critical methodological challenges with respect to experiment design, and data collection and analysis need to be taken into consideration. Spontaneous MEG data show that local and global neural organization is altered in SZ patients. MEG is a highly promising tool to fill in knowledge gaps about the neurophysiology of SZ. However, to reach its fullest potential, basic methodological challenges need to be overcome. MEG-based resting-state power and connectivity findings could be great assets to clinical and translational research in psychiatry, and SZ in particular. Copyright © 2017 International Federation of Clinical Neurophysiology. Published by Elsevier B.V. All rights reserved.

  5. Dynamic characterisation of the specific surface area for fracture networks

    Science.gov (United States)

    Cvetkovic, V.

    2017-12-01

    One important application of chemical transport is geological disposal of high-level nuclear waste for which crystalline rock is a prime candidate for instance in Scandinavia. Interconnected heterogeneous fractures of sparsely fractured rock such as granite, act as conduits for transport of dissolved tracers. Fluid flow is known to be highly channelized in such rocks. Channels imply narrow flow paths, adjacent to essentially stagnant water in the fracture and/or the rock matrix. Tracers are transported along channelised flow paths and retained by minerals and/or stagnant water, depending on their sorption properties; this mechanism is critical for rocks to act as a barrier and ultimately provide safety for a geological repository. The sorbing tracers are retained by diffusion and sorption on mineral surfaces, whereas non-sorbing tracers can be retained only by diffusion into stagnant water of fractures. The retention and transport properties of a sparsely fractured rock will primarily depend on the specific surface area (SSA) of the fracture network which is determined by the heterogeneous structure and flow. The main challenge when characterising SSA on the field-scale is its dependence on the flow dynamics. We first define SSA as a physical quantity and clarify its importance for chemical transport. A methodology for dynamic characterisation of SSA in fracture networks is proposed that relies on three sets of data: i) Flow rate data as obtained by a flow logging procedure; ii) transmissivity data as obtained by pumping tests; iii) fracture network data as obtained from outcrop and geophysical observations. The proposed methodology utilises these data directly as well as indirectly through flow and particle tracking simulations in three-dimensional discrete fracture networks. The methodology is exemplified using specific data from the Swedish site Laxemar. The potential impact of uncertainties is of particular significance and is illustrated for radionuclide

  6. Imaginative methodologies in the social sciences

    DEFF Research Database (Denmark)

    Imaginative Methodologies develops, expands and challenges conventional social scientific methodology and language by way of literary, poetic and other alternative sources of inspiration. Sociologists, social workers, anthropologists, criminologists and psychologists all try to rethink, provoke...... and reignite social scientific methodology. Imaginative Methodologies challenges the mainstream social science methodological orthodoxy closely guarding the boundaries between the social sciences and the arts and humanities, pointing out that authors and artists are often engaged in projects parallel to those...... of the social sciences and vice versa, and that artistic and cultural productions today do not constitute a specialist field, but are integral to our social reality. The book will be of interest to scholars and students in the social sciences and across the arts and humanities working with questions...

  7. The origin of life and its methodological challenge.

    Science.gov (United States)

    Wächtershäuser, G

    1997-08-21

    The problem of the origin of life is discussed from a methodological point of view as an encounter between the teleological thinking of the historian and the mechanistic thinking of the chemist; and as the Kantian task of replacing teleology by mechanism. It is shown how the Popperian situational logic of historic understanding and the Popperian principle of explanatory power of scientific theories, when jointly applied to biochemistry, lead to a methodology of biochemical retrodiction, whereby common precursor functions are constructed for disparate successor functions. This methodology is exemplified by central tenets of the theory of the chemo-autotrophic origin of life: the proposal of a surface metabolism with a two-dimensional order; the basic polarity of life with negatively charged constituents on positively charged mineral surfaces; the surface-metabolic origin of phosphorylated sugar metabolism and nucleic acids; the origin of membrane lipids and of chemi-osmosis on pyrite surfaces; and the principles of the origin of the genetic machinery. The theory presents the early evolution of life as a process that begins with chemical necessity and winds up in genetic chance.

  8. BOREAS Elevation Contours over the NSA and SSA in ARC/INFO Generate Format

    Science.gov (United States)

    Knapp, David; Nickeson, Jaime; Hall, Forrest G. (Editor)

    2000-01-01

    This data set was prepared by BORIS Staff by reformatting the original data into the ARC/INFO Generate format. The original data were received in SIF at a scale of 1:50,000. BORIS staff could not find a format document or commercial software for reading SIF; the BOREAS HYD-08 team pro-vided some C source code that could read some of the SIF files. The data cover the BOREAS NSA and SSA. The original data were compiled from information available in the 1970s and 1980s. The data are available in ARC/INFO Generate format files.

  9. Implementation and evaluation of a pharmacist-led hypertension management service in primary care: outcomes and methodological challenges.

    Science.gov (United States)

    Bajorek, Beata; Lemay, Kate S; Magin, Parker; Roberts, Christopher; Krass, Ines; Armour, Carol L

    2016-01-01

    Suboptimal utilisation of pharmacotherapy, non-adherence to prescribed treatment, and a lack of monitoring all contribute to poor blood (BP) pressure control in patients with hypertension. The objective of this study was to evaluate the implementation of a pharmacist-led hypertension management service in terms of processes, outcomes, and methodological challenges. A prospective, controlled study was undertaken within the Australian primary care setting. Community pharmacists were recruited to one of three study groups: Group A (Control - usual care), Group B (Intervention), or Group C (Short Intervention). Pharmacists in Groups B and C delivered a service comprising screening and monitoring of BP, as well as addressing poor BP control through therapeutic adjustment and adherence strategies. Pharmacists in Group C delivered the shortened version of the service. Significant changes to key outcome measures were observed in Group C: reduction in systolic and diastolic BPs at the 3-month visit (P<0.01 and P<0.01, respectively), improvement in medication adherence scores (P=0.01), and a slight improvement in quality of life (EQ-5D-3L Index) scores (P=0.91). There were no significant changes in Group B (the full intervention), and no differences in comparison to Group A (usual care). Pharmacists fed-back that patient recruitment was a key barrier to service implementation, highlighting the methodological implications of screening. A collaborative, pharmacist-led hypertension management service can help monitor BP, improve medication adherence, and optimise therapy in a step-wise approach. However, blood pressure screening can effect behaviour change in patients, presenting methodological challenges in the evaluation of services in this context.

  10. Implementation and evaluation of a pharmacist-led hypertension management service in primary care: outcomes and methodological challenges

    Directory of Open Access Journals (Sweden)

    Bajorek B

    2016-06-01

    Full Text Available Background: Suboptimal utilisation of pharmacotherapy, non-adherence to prescribed treatment, and a lack of monitoring all contribute to poor blood (BP pressure control in patients with hypertension. Objective: The objective of this study was to evaluate the implementation of a pharmacist-led hypertension management service in terms of processes, outcomes, and methodological challenges. Method: A prospective, controlled study was undertaken within the Australian primary care setting. Community pharmacists were recruited to one of three study groups: Group A (Control – usual care, Group B (Intervention, or Group C (Short Intervention. Pharmacists in Groups B and C delivered a service comprising screening and monitoring of BP, as well as addressing poor BP control through therapeutic adjustment and adherence strategies. Pharmacists in Group C delivered the shortened version of the service. Results: Significant changes to key outcome measures were observed in Group C: reduction in systolic and diastolic BPs at the 3-month visit (P<0.01 and P<0.01, respectively, improvement in medication adherence scores (P=0.01, and a slight improvement in quality of life (EQ-5D-3L Index scores (P=0.91. There were no significant changes in Group B (the full intervention, and no differences in comparison to Group A (usual care. Pharmacists fed-back that patient recruitment was a key barrier to service implementation, highlighting the methodological implications of screening. Conclusion: A collaborative, pharmacist-led hypertension management service can help monitor BP, improve medication adherence, and optimise therapy in a step-wise approach. However, blood pressure screening can effect behaviour change in patients, presenting methodological challenges in the evaluation of services in this context.

  11. Exploring the implications of the influence of organisational culture on work-life balance practices: evidence from Nigerian medical doctors

    OpenAIRE

    Adisa, Toyin Ajibade; Modi, Chima; Osabutey, Ellis L. C.

    2017-01-01

    Purpose - Whilst significant evidence of western work-life balance (WLB) challenges exists, studies that explore Sub-Saharan Africa (SSA) are scarce. This article explores how organisational culture in Nigerian medical organisations influences doctors’ WLB and examines the implications of supportive and unsupportive cultures on doctors’ WLB. \\ud \\ud Methodology - The paper uses qualitative data gleaned from semi-structured interviews of 60 medical doctors across the six geo-political zones of...

  12. Culturally appropriate methodology in obtaining a representative sample of South Australian Aboriginal adults for a cross-sectional population health study: challenges and resolutions.

    Science.gov (United States)

    Marin, Tania; Taylor, Anne Winifred; Grande, Eleonora Dal; Avery, Jodie; Tucker, Graeme; Morey, Kim

    2015-05-19

    The considerably lower average life expectancy of Aboriginal and Torres Strait Islander Australians, compared with non-Aboriginal and non-Torres Strait Islander Australians, has been widely reported. Prevalence data for chronic disease and health risk factors are needed to provide evidence based estimates for Australian Aboriginal and Torres Strait Islanders population health planning. Representative surveys for these populations are difficult due to complex methodology. The focus of this paper is to describe in detail the methodological challenges and resolutions of a representative South Australian Aboriginal population-based health survey. Using a stratified multi-stage sampling methodology based on the Australian Bureau of Statistics 2006 Census with culturally appropriate and epidemiological rigorous methods, 11,428 randomly selected dwellings were approached from a total of 209 census collection districts. All persons eligible for the survey identified as Aboriginal and/or Torres Strait Islander and were selected from dwellings identified as having one or more Aboriginal person(s) living there at the time of the survey. Overall, the 399 interviews from an eligible sample of 691 SA Aboriginal adults yielded a response rate of 57.7%. These face-to-face interviews were conducted by ten interviewers retained from a total of 27 trained Aboriginal interviewers. Challenges were found in three main areas: identification and recruitment of participants; interviewer recruitment and retainment; and using appropriate engagement with communities. These challenges were resolved, or at least mainly overcome, by following local protocols with communities and their representatives, and reaching agreement on the process of research for Aboriginal people. Obtaining a representative sample of Aboriginal participants in a culturally appropriate way was methodologically challenging and required high levels of commitment and resources. Adhering to these principles has resulted in a

  13. Identifying the determinants of premature mortality in Russia: overcoming a methodological challenge

    Directory of Open Access Journals (Sweden)

    Leon David A

    2007-11-01

    Full Text Available Abstract Background It is thought that excessive alcohol consumption is related to the high mortality among working age men in Russia. Moreover it has been suggested that alcohol is a key proximate driver of the very sharp fluctuations in mortality seen in this group since the mid-1980s. Designing an individual-level study suitable to address the potential acute effects of alcohol consumption on mortality in Russia has posed a challenge to epidemiologists, especially because of the need to identify factors that could underlie the rapid changes up and down in mortality rates that have been such a distinctive feature of the Russian mortality crisis. In order to address this study question which focuses on exposures acting shortly before sudden death, a cohort would be unfeasibly large and would suffer from recruitment bias. Methods Although the situation in Russia is unusual, with a very high death rate characterised by many sudden and apparently unexpected deaths in young men, the methodological problem is common to research on any cause of death where many deaths are sudden. Results We describe the development of an innovative approach that has overcome some of these challenges: a case-control study employing proxy informants and external data sources to collect information about proximate determinants of mortality. Conclusion This offers a set of principles that can be adopted by epidemiologists studying sudden and unexpected deaths in other settings.

  14. Effects of the Extraterrestrial Environment on Plants: Recommendations for Future Space Experiments for the MELiSSA Higher Plant Compartment

    Directory of Open Access Journals (Sweden)

    Silje A. Wolff

    2014-05-01

    Full Text Available Due to logistical challenges, long-term human space exploration missions require a life support system capable of regenerating all the essentials for survival. Higher plants can be utilized to provide a continuous supply of fresh food, atmosphere revitalization, and clean water for humans. Plants can adapt to extreme environments on Earth, and model plants have been shown to grow and develop through a full life cycle in microgravity. However, more knowledge about the long term effects of the extraterrestrial environment on plant growth and development is necessary. The European Space Agency (ESA has developed the Micro-Ecological Life Support System Alternative (MELiSSA program to develop a closed regenerative life support system, based on micro-organisms and higher plant processes, with continuous recycling of resources. In this context, a literature review to analyze the impact of the space environments on higher plants, with focus on gravity levels, magnetic fields and radiation, has been performed. This communication presents a roadmap giving directions for future scientific activities within space plant cultivation. The roadmap aims to identify the research activities required before higher plants can be included in regenerative life support systems in space.

  15. A proposed reductionist solution to address the methodological challenges of inconsistent reflexology maps and poor experimental controls in reflexology research: a discussion paper.

    Science.gov (United States)

    Jones, Jenny; Thomson, Patricia; Lauder, William; Leslie, Stephen J

    2013-03-01

    Reflexology is a complex massage intervention, based on the concept that specific areas of the feet (reflex points) correspond to individual internal organs within the body. Reflexologists trained in the popular Ingham reflexology method claim that massage to these points, using massage techniques unique to reflexology, stimulates an increase in blood supply to the corresponding organ. Reflexology researchers face two key methodological challenges that need to be addressed if a specific treatment-related hemodynamic effect is to be scientifically demonstrated. The first is the problem of inconsistent reflexology foot maps; the second is the issue of poor experimental controls. This article proposes a potential experimental solution that we believe can address both methodological challenges and in doing so, allow any specific hemodynamic treatment effect unique to reflexology to experimentally reveal itself.

  16. Gene transcript analysis blood values correlate with 68Ga-DOTA-somatostatin analog (SSA) PET/CT imaging in neuroendocrine tumors and can define disease status

    International Nuclear Information System (INIS)

    Bodei, L.; Kidd, M.; Modlin, I.M.; Drozdov, I.; Prasad, V.; Severi, S.; Paganelli, G.; Ambrosini, V.; Kwekkeboom, D.J.; Krenning, E.P.; Baum, R.P.

    2015-01-01

    Precise determination of neuroendocrine tumor (NET) disease status and response to therapy remains a rate-limiting concern for disease management. This reflects limitations in biomarker specificity and resolution capacity of imaging. In order to evaluate biomarker precision and identify if combinatorial blood molecular markers and imaging could provide added diagnostic value, we assessed the concordance between 68 Ga-somatostatin analog (SSA) positron emission tomography (PET), circulating NET gene transcripts (NETest), chromogranin A (CgA), and Ki-67 in NETs. We utilized two independent patient groups with positive 68 Ga-SSA PET: data set 1 ( 68 Ga-SSA PETs undertaken for peptide receptor radionuclide therapy (PRRT), as primary or salvage treatment, n = 27) and data set 2 ( 68 Ga-SSA PETs performed in patients referred for initial disease staging or restaging after various therapies, n = 22). We examined the maximum standardized uptake value (SUV max ), circulating gene transcripts, CgA levels, and baseline Ki-67. Regression analyses, generalized linear modeling, and receiver-operating characteristic (ROC) analyses were undertaken to determine the strength of the relationships. SUV max measured in two centers were mathematically evaluated (regression modeling) and determined to be comparable. Of 49 patients, 47 (96 %) exhibited a positive NETest. Twenty-six (54 %) had elevated CgA (χ 2 = 20.1, p < 2.5 x 10 -6 ). The majority (78 %) had Ki-67 < 20 %. Gene transcript scores were predictive of imaging with >95 % concordance and significantly correlated with SUV max (R 2 = 0.31, root-mean-square error = 9.4). The genes MORF4L2 and somatostatin receptors SSTR1, 3, and 5 exhibited the highest correlation with SUV max . Progressive disease was identified by elevated levels of a quotient of MORF4L2 expression and SUV max [ROC-derived AUC (R 2 = 0.7, p < 0.05)]. No statistical relationship was identified between CgA and Ki-67 and no relationship with imaging parameters

  17. Methodological Challenges of Research in Nudging

    NARCIS (Netherlands)

    Kleef, van E.; Trijp, van J.C.M.

    2018-01-01

    Complex societal issues, related to health and sustainability, provide major challenges to scientists, business managers, and policy makers alike. Despite their diversity, these issues have in common that effective solutions to public health (e.g., reducing prevalence of overweight and obesity) and

  18. Challenges faced by health-care providers offering infant-feeding counseling to HIV-positive women in sub-Saharan Africa: a review of current research.

    Science.gov (United States)

    Tuthill, Emily L; Chan, Jessica; Butler, Lisa M

    2015-01-01

    Exclusive breastfeeding (EBF) has been identified as the optimal nutrition and critical behavior in attaining human immunodeficiency virus (HIV)-free infant survival in resource-limited settings. Health-care providers (HCPs) in clinic- and community-settings throughout sub-Saharan Africa (sSA) provide infant-feeding counseling. However, rates of EBF at 6 months of age are suboptimal. HCPs are uniquely positioned to educate HIV-positive mothers and provide support by addressing known barriers to EBF. However, limited evidence exists on the experiences faced by HCPs in providing counseling on infant feeding to HIV-positive women. Our objective is to describe experiences faced by HCPs when delivering infant-feeding counseling in the context of HIV in program settings in sSA. We searched a range of electronic databases, including PubMed, CINAHL, and PsycINFO from January 1990 to February 2013, in addition to hand-searching, cross-reference searching, and personal communications. The search was limited to publications in English. Empirical studies of HCP experiences providing infant-feeding counseling in the prevention of mother-to-child transmission (PMTCT) of HIV programs in sSA were selected. We identified 10 peer-reviewed articles reporting HCP challenges in infant-feeding counseling that met inclusion criteria. Articles included qualitative, cross-sectional and mixed-method studies, and cumulatively reported 31 challenges faced by HCPs. Among the challenges identified, the most commonly reported were personal beliefs held by the HCPs toward infant feeding in the context of HIV, contradictory messages, staff workload, directive counseling styles, and a lack of practical strategies to offer mothers, often leading to improvised counseling approaches. Counseling strategies need to be developed that are relevant, meaningful, and responsive to the needs of both HCPs and mothers.

  19. 75 FR 30839 - Privacy Act of 1974; CMS Computer Match No. 2010-03, HHS Computer Match No. 1003, SSA Computer...

    Science.gov (United States)

    2010-06-02

    ... 1974; CMS Computer Match No. 2010-03, HHS Computer Match No. 1003, SSA Computer Match No. 1048, IRS... Services (CMS). ACTION: Notice of renewal of an existing computer matching program (CMP) that has an...'' section below for comment period. DATES: Effective Dates: CMS filed a report of the Computer Matching...

  20. Ultraviolet radiation (UVR) induces cell-surface Ro/SSA antigen expression by human keratinocytes in vitro: a possible mechanism for the UVR induction of cutaneous lupus lesions

    International Nuclear Information System (INIS)

    Jones, S.K.

    1992-01-01

    Antinuclear antibodies are useful markers of connective tissue disease. In this study, UVB but not UVA induced the expression of Ro/SSA antigen on keratinocyte surfaces in vitro. This expression was also found with the extractable nuclear antigens RnP and Sm, but not with single or double-stranded DNA. The expression was prevented by blocking protein synthesis, suggesting that it was an active process. The results suggest that UVB exposure may result in the expression of Ro/SSA antigen on the surfaces of basal keratinocytes in vivo. This antigen could then bind circulating antibody leading to the cutaneous lesions in neonatal and subacute cutaneous lupus erythematosus. (Author)

  1. Challenges in dental statistics: survey methodology topics

    OpenAIRE

    Pizzo, Giuseppe; Milani, Silvano; Spada, Elena; Ottolenghi, Livia

    2013-01-01

    This paper gathers some contributions concerning survey methodology in dental research, as discussed during the first Workshop of the SISMEC STATDENT working group on statistical methods and applications in dentistry, held in Ancona on the 28th September 2011.The first contribution deals with the European Global Oral Health Indicators Development (EGOHID) Project which proposed a comprehensive and standardized system of epidemiological tools (questionnaires and clinical forms) for national da...

  2. The Societal Nature of Subjectivity: An Interdisciplinary Methodological Challenge

    Directory of Open Access Journals (Sweden)

    Henning Salling Olesen

    2012-09-01

    Full Text Available The thematic issue presents a psycho-societal approach to qualitative empirical research in several areas of everyday social life. It is an approach which integrates a theory of subjectivity and an interpretation methodology which integrates hermeneutic experiences from text analysis and psychoanalysis. Its particular focus is on subjectivity—as an aspect of the research object and as an aspect of the research process. By the term "approach" is indicated the intrinsic connection between the theorizing of an empirical object and the reflection of the research process and the epistemic subject. In terms of methodology it revives the themes originally launched in FQS exactly ten years ago: "Subjectivity and Reflectivity in Qualitative Research" (BREUER, MRUCK & ROTH, 2002; MRUCK & BREUER, 2003. This editorial introduction presents the intellectual background of the psycho-societal methodology, reflects on its relevance and critical perspectives in a contemporary landscape of social science, and comments the way in which an international and interdisciplinary research group has developed this approach to profane empirical research. URN: http://nbn-resolving.de/urn:nbn:de:0114-fqs120345

  3. Investigating the association between medication adherence and health-related quality of life in COPD : Methodological challenges when using a proxy measure of adherence

    NARCIS (Netherlands)

    Boland, Melinde R. S.; van Boven, Job F. M.; Kruis, Annemarije L.; Chavannes, Niels H.; van der Molen, Thys; Goossens, Lucas M. A.; Rutten-van Molken, Maureen P. M. H.

    Background: The association between non-adherence to medication and health-related quality-of-life (HRQoL) in Chronic Obstructive Pulmonary Disease (COPD) remains poorly understood. Different ways to deal with methodological challenges to estimate this association have probably contributed to

  4. Gene transcript analysis blood values correlate with {sup 68}Ga-DOTA-somatostatin analog (SSA) PET/CT imaging in neuroendocrine tumors and can define disease status

    Energy Technology Data Exchange (ETDEWEB)

    Bodei, L. [European Institute of Oncology, Division of Nuclear Medicine, Milan (Italy); Kidd, M.; Modlin, I.M.; Drozdov, I. [Wren Laboratories, Branford, CT (United States); Prasad, V. [Charite University Hospital, Department of Nuclear Medicine, Berlin (Germany); Severi, S.; Paganelli, G. [Istituto Scientifico Romagnolo per lo Studio e la Cura dei Tumori (IRST) IRCCS, Nuclear Medicine and Radiometabolic Units, Meldola (Italy); Ambrosini, V. [S. Orsola-Malpighi University Hospital, Nuclear Medicine, Bologna (Italy); Kwekkeboom, D.J.; Krenning, E.P. [Erasmus Medical Center Rotterdam, Nuclear Medicine Department, Rotterdam (Netherlands); Baum, R.P. [Zentralklinik Bad Berka, THERANOSTICS Center for Molecular Radiotherapy and Imaging, Bad Berka (Germany)

    2015-08-15

    Precise determination of neuroendocrine tumor (NET) disease status and response to therapy remains a rate-limiting concern for disease management. This reflects limitations in biomarker specificity and resolution capacity of imaging. In order to evaluate biomarker precision and identify if combinatorial blood molecular markers and imaging could provide added diagnostic value, we assessed the concordance between {sup 68}Ga-somatostatin analog (SSA) positron emission tomography (PET), circulating NET gene transcripts (NETest), chromogranin A (CgA), and Ki-67 in NETs. We utilized two independent patient groups with positive {sup 68}Ga-SSA PET: data set 1 ({sup 68}Ga-SSA PETs undertaken for peptide receptor radionuclide therapy (PRRT), as primary or salvage treatment, n = 27) and data set 2 ({sup 68}Ga-SSA PETs performed in patients referred for initial disease staging or restaging after various therapies, n = 22). We examined the maximum standardized uptake value (SUV{sub max}), circulating gene transcripts, CgA levels, and baseline Ki-67. Regression analyses, generalized linear modeling, and receiver-operating characteristic (ROC) analyses were undertaken to determine the strength of the relationships. SUV{sub max} measured in two centers were mathematically evaluated (regression modeling) and determined to be comparable. Of 49 patients, 47 (96 %) exhibited a positive NETest. Twenty-six (54 %) had elevated CgA (χ{sup 2} = 20.1, p < 2.5 x 10{sup -6}). The majority (78 %) had Ki-67 < 20 %. Gene transcript scores were predictive of imaging with >95 % concordance and significantly correlated with SUV{sub max} (R {sup 2} = 0.31, root-mean-square error = 9.4). The genes MORF4L2 and somatostatin receptors SSTR1, 3, and 5 exhibited the highest correlation with SUV{sub max}. Progressive disease was identified by elevated levels of a quotient of MORF4L2 expression and SUV{sub max} [ROC-derived AUC (R {sup 2} = 0.7, p < 0.05)]. No statistical relationship was identified

  5. School-to-Work-Transition—Career Development and Family Planning: Methodological Guidelines and Challenges of a Qualitative Longitudinal Panel-Study

    Directory of Open Access Journals (Sweden)

    Thomas Kühn

    2000-06-01

    Full Text Available We are presenting the basic features of our qualitative German panel study concerning the job entry of young adults, dealing also with methodological issues. The selection of the respondents in qualified jobs (commercial-technical, crafts/trade, services took into account gender-specific aspects, different labor-market prospects and regions. From the quantitative panel, a theoretical sample of respondents was selected who were interviewed three times in three-years intervals (3 waves. These interviews, focusing on individual biographies (i.e. orientations and action strategies form the basis for constructing a typology. Methodological innovations concern the modeling of the sequence of occupational actions and orientations as life-course sequences and the case-specific and case-comparing analysis of interview transcripts. This was done—based on a data bank containing the interview material—by means of a detailed scheme of categories. The integration of quantitative and qualitative longitudinal data presents a theoretical and methodological challenge. Our focus is on biography and life-course research which suggests an interdisciplinary approach. URN: urn:nbn:de:0114-fqs0002178

  6. An analysis of the potential for achieving the fourth millennium development goal in SSA with domestic resources.

    Science.gov (United States)

    O'Hare, Bernadette; Makuta, Innocent

    2015-02-25

    The importance of good health is reflected in the fact that more than half of the eight Millennium Development Goals (MDGs) are aimed at improving health status. Goal 4 (MDG4) aims to reduce child mortality. The progress indicator for goal 4 is the under-five mortality rate (U5M), with a targeted reduction of two thirds by 2015 from 1990 levels. This paper seeks to compare the time (in years) Sub Saharan African (SSA) countries will take to reach their MDG4 target at the current rate of decline, and the time it could have taken to reach their target if domestic resources had not been lost through illicit financial flows, corruption and servicing of debt since 2000. We estimate the amount by which the Gross Domestic Product (GDP) per capita would increase (in percentage terms) if losses of resource through illicit financial flows, corruption and debt servicing, were reduced. Using the income elasticity of U5M, a metric which reports the percentage change in U5M for a one percent change in GDP per capita, we estimate the potential gains in the annual reduction of the under-five mortality if these resource losses were reduced. At the current rate of reduction in U5M, nine countries out of this sample of 36 SSA countries (25%) will achieve their MDG4 target by 2015. In the absence of the leakages (IFF, corruption and debt service) 30 out of 36 (83%) would reach their MDG4 target by 2015 and all except one country, Zimbabwe would have achieved their MDG4 by 2017 (97%). In view of the uncertainty of the legitimacy of African debts we have also provided results where we excluded debt repayment from our analysis. Most countries would have met MDG4 target by curtailing these outflows. In order to release latent resources in SSA for development, action will be needed both by African countries and internationally. We consider that stemming these outflows, and thereby reducing the need for aid, can be achieved with a more transparent global financial system.

  7. Assessing climate risks across different business sectors and industries: an investigation of methodological challenges at national scale for the UK

    Science.gov (United States)

    Surminski, Swenja; Di Mauro, Manuela; Baglee, J. Alastair R.; Connell, Richenda K.; Hankinson, Joel; Haworth, Anna R.; Ingirige, Bingunath; Proverbs, David

    2018-06-01

    Climate change poses severe risks for businesses, which companies as well as governments need to understand in order to take appropriate steps to manage those. This, however, represents a significant challenge as climate change risk assessment is itself a complex, dynamic and geographically diverse process. A wide range of factors including the nature of production processes and value chains, the location of business sites as well as relationships and interdependencies with customers and suppliers play a role in determining if and how companies are impacted by climate risks. This research explores the methodological challenges for a national-scale assessment of climate risks through the lens of the UK Climate Change Risk Assessment (UKCCRA) process and compares the approaches adopted in the first and second UKCCRA (2011, 2016), while also reflecting on international experiences elsewhere. A review of these issues is presented, drawing on a wide body of contemporary evidence from a range of sources including the research disciplines, grey literature and government policy. The study reveals the methodological challenges and highlights six broad themes, namely scale, evidence base, adaptation responses, scope, interdependencies and public policy. The paper concludes by identifying suitable lessons for future national climate risk assessments, which should guide the next phase of research in preparation for UKCCRA3 and those of national-level risk assessments elsewhere. This article is part of the theme issue `Advances in risk assessment for climate change adaptation policy'.

  8. Inernational research in health care management: its need in the 21st century, methodological challenges, ethical issues, pitfalls, and practicalities.

    Science.gov (United States)

    Buttigieg, Sandra C; Rathert, Cheryl; D'Aunno, Thomas A; Savage, Grant T

    2015-01-01

    This commentary argues in favor of international research in the 21st century. Advances in technology, science, communication, transport, and infrastructure have transformed the world into a global village. Industries have increasingly adopted globalization strategies. Likewise, the health sector is more internationalized whereby comparisons between diverse health systems, international best practices, international benchmarking, cross-border health care, and cross-cultural issues have become important subjects in the health care literature. The focus has now turned to international, collaborative, cross-national, and cross-cultural research, which is by far more demanding than domestic studies. In this commentary, we explore the methodological challenges, ethical issues, pitfalls, and practicalities within international research and offer possible solutions to address them. The commentary synthesizes contributions from four scholars in the field of health care management, who came together during the annual meeting of the Academy of Management to discuss with members of the Health Care Management Division the challenges of international research. International research is worth pursuing; however, it calls for scholarly attention to key methodological and ethical issues for its success. This commentary addresses salient issues pertaining to international research in one comprehensive account.

  9. Scalable privacy-preserving data sharing methodology for genome-wide association studies: an application to iDASH healthcare privacy protection challenge.

    Science.gov (United States)

    Yu, Fei; Ji, Zhanglong

    2014-01-01

    In response to the growing interest in genome-wide association study (GWAS) data privacy, the Integrating Data for Analysis, Anonymization and SHaring (iDASH) center organized the iDASH Healthcare Privacy Protection Challenge, with the aim of investigating the effectiveness of applying privacy-preserving methodologies to human genetic data. This paper is based on a submission to the iDASH Healthcare Privacy Protection Challenge. We apply privacy-preserving methods that are adapted from Uhler et al. 2013 and Yu et al. 2014 to the challenge's data and analyze the data utility after the data are perturbed by the privacy-preserving methods. Major contributions of this paper include new interpretation of the χ2 statistic in a GWAS setting and new results about the Hamming distance score, a key component for one of the privacy-preserving methods.

  10. TiSSA pleenum "Sotsiaaltöö kriisi ajal" : mida on sotsiaaltööl pakkuda ja kes saab sellest kasu? / Regina Lind

    Index Scriptorium Estoniae

    Lind, Regina

    2010-01-01

    22.-27. aug. 2010 toimus Tallinna Ülikoolis TiSSA doktorantide eelkonverents ja pleenum. Pleenumil peetud sotsiaalteadlaste ettekannetest. Esinesid: Holger Ziegler, Karin Böllert, Catrin Heite, Hans van Ewijk, Walter Lorenz, Mikko Mäntysaari, Heinz Sünker, Synnöve Karvinen-Niinikoski, Olga Borodkina

  11. Induction of Osmoadaptive Mechanisms and Modulation of Cellular Physiology Help Bacillus licheniformis Strain SSA 61 Adapt to Salt Stress

    Energy Technology Data Exchange (ETDEWEB)

    Paul, Sangeeta; Aggarwal, Chetana; Thakur, Jyoti Kumar; Bandeppa, G. S.; Khan, Md. Aslam; Pearson, Lauren M.; Babnigg, Gyorgy; Giometti, Carol S.; Joachimiak, Andrzej

    2015-01-06

    Bacillus licheniformis strain SSA 61, originally isolated from Sambhar salt lake, was observed to grow even in the presence of 25 % salt stress. Osmoadaptive mechanisms of this halotolerant B. licheniformis strain SSA 61, for long-term survival and growth under salt stress, were determined. Proline was the preferentially accumulated compatible osmolyte. There was also increased accumulation of antioxidants ascorbic acid and glutathione. Among the different antioxidative enzymes assayed, superoxide dismutase played the most crucial role in defense against salt-induced stress in the organism. Adaptation to stress by the organism involved modulation of cellular physiology at various levels. There was enhanced expression of known proteins playing essential roles in stress adaptation, such as chaperones DnaK and GroEL, and general stress protein YfkM and polynucleotide phosphorylase/polyadenylase. Proteins involved in amino acid biosynthetic pathway, ribosome structure, and peptide elongation were also overexpressed. Salt stress-induced modulation of expression of enzymes involved in carbon metabolism was observed. There was up-regulation of a number of enzymes involved in generation of NADH and NADPH, indicating increased cellular demand for both energy and reducing power.

  12. Methodological challenges involved in compiling the Nahua pharmacopeia.

    Science.gov (United States)

    De Vos, Paula

    2017-06-01

    Recent work in the history of science has questioned the Eurocentric nature of the field and sought to include a more global approach that would serve to displace center-periphery models in favor of approaches that take seriously local knowledge production. Historians of Iberian colonial science have taken up this approach, which involves reliance on indigenous knowledge traditions of the Americas. These traditions present a number of challenges to modern researchers, including availability and reliability of source material, issues of translation and identification, and lack of systematization. This essay explores the challenges that emerged in the author's attempt to compile a pre-contact Nahua pharmacopeia, the reasons for these challenges, and the ways they may - or may not - be overcome.

  13. Unsolicited written narratives as a methodological genre in terminal illness: challenges and limitations.

    Science.gov (United States)

    O'Brien, Mary R; Clark, David

    2012-02-01

    Stories about illness have proven invaluable in helping health professionals understand illness experiences. Such narratives have traditionally been solicited by researchers through interviews and the collection of personal writings, including diaries. These approaches are, however, researcher driven; the impetus for the creation of the story comes from the researcher and not the narrator. In recent years there has been exponential growth in illness narratives created by individuals, of their own volition, and made available for others to read in print or as Internet accounts. We sought to determine whether it was possible to identify such material for use as research data to explore the subject of living with the terminal illness amyotrophic lateral sclerosis/motor neuron disease--the contention being that these accounts are narrator driven and therefore focus on issues of greatest importance to the affected person. We encountered and sought to overcome a number of methodological and ethical challenges, which is our focus here.

  14. Methodological challenges in assessing the environmental status of a marine ecosystem: case study of the Baltic Sea.

    Directory of Open Access Journals (Sweden)

    Henn Ojaveer

    Full Text Available Assessments of the environmental status of marine ecosystems are increasingly needed to inform management decisions and regulate human pressures to meet the objectives of environmental policies. This paper addresses some generic methodological challenges and related uncertainties involved in marine ecosystem assessment, using the central Baltic Sea as a case study. The objectives of good environmental status of the Baltic Sea are largely focusing on biodiversity, eutrophication and hazardous substances. In this paper, we conduct comparative evaluations of the status of these three segments, by applying different methodological approaches. Our analyses indicate that the assessment results are sensitive to a selection of indicators for ecological quality objectives that are affected by a broad spectrum of human activities and natural processes (biodiversity, less so for objectives that are influenced by a relatively narrow array of drivers (eutrophications, hazardous substances. The choice of indicator aggregation rule appeared to be of essential importance for assessment results for all three segments, whereas the hierarchical structure of indicators had only a minor influence. Trend-based assessment was shown to be a useful supplement to reference-based evaluation, being independent of the problems related to defining reference values and indicator aggregation methodologies. Results of this study will help in setting priorities for future efforts to improve environmental assessments in the Baltic Sea and elsewhere, and to ensure the transparency of the assessment procedure.

  15. The influence of quorum sensing in compartment II of the MELiSSA loop

    Science.gov (United States)

    Condori, Sandra; Mastroleo, Felice; Wattiez, Ruddy; Leys, Natalie

    MELiSSA (Micro-Ecological Life Support System Alternative) has been conceived as a 5 compartments microorganisms and higher plants recycling system for long haul space flights. Rhodospirillum rubrum S1H colonizes compartment II. Previous work reported that continuous culture of the bacterium in a photobioreactor could lead to thick biofilm formation, leading to bioreactor arrest. Our aim is to investigate the unknown quorum sensing (QS) system of R. rubrum S1H, specifically under MELiSSA relevant culture conditions meaning light anaerobic (LAN) and using acetate as carbon source. In that purpose an autoinducer synthase gene (Rru_A3396) knockout mutant was constructed by allelic exchange generating strain M68. In addition phenotypic comparison between wild type (WT) and M68 was performed. Results of thin layer chromatography assay where Agrobacterium tumefaciens NT1 have been used as reporter strain showed that WT produces acyl-homoserine lactones (AHLs) from C4 to C12 acyl carbon chain length; however, in M68 no AHLs were detected confirming that gene Rru_A3396 (named rruI) encodes an autoinducer synthase. Interestingly under a low shear or static environment M68 showed cell aggregation similar as reported in a closely related bacterium Rhodobacter sphaeroides (cerI mutant). In contrast to WT, M68 did not form biofilm and exhibited a decreased motility and pigment content. M68 vs wild type transcriptomics results showed that 326 genes were statistically significant differentially expressed. Downregulation of genes related to photosynthesis e.g., reaction center subunits, light harvesting complex and photosynthetic assembly proteins was observed. Similar results were obtained for preliminary proteomic analysis. Results obtained showed that in R. rubrum S1H the AHL-based QS system regulates almost 8% of the genome which is linked to biofilm formation among other biological processes described above. Since strain M68 could not be used in compartment II due to its less

  16. Urban growth and water access in sub-Saharan Africa: Progress, challenges, and emerging research directions.

    Science.gov (United States)

    Dos Santos, S; Adams, E A; Neville, G; Wada, Y; de Sherbinin, A; Mullin Bernhardt, E; Adamo, S B

    2017-12-31

    For the next decade, the global water crisis remains the risk of highest concern, and ranks ahead of climate change, extreme weather events, food crises and social instability. Across the globe, nearly one in ten people is without access to an improved drinking water source. Least Developed Countries (LDCs) especially in sub-Saharan Africa (SSA) are the most affected, having disproportionately more of the global population without access to clean water than other major regions. Population growth, changing lifestyles, increasing pollution and accelerating urbanization will continue to widen the gap between the demand for water and available supply especially in urban areas, and disproportionately affect informal settlements, where the majority of SSA's urban population resides. Distribution and allocation of water will be affected by climate-induced water stresses, poor institutions, ineffective governance, and weak political will to address scarcity and mediate uncertainties in future supply. While attempts have been made by many scientists to examine different dimensions of water scarcity and urban population dynamics, there are few comprehensive reviews, especially focused on the particular situation in Sub-Saharan Africa. This paper contributes to interdisciplinary understanding of urban water supply by distilling and integrating relevant empirical knowledge on urban dynamics and water issues in SSA, focusing on progress made and associated challenges. It then points out future research directions including the need to understand how alternatives to centralized water policies may help deliver sustainable water supply to cities and informal settlements in the region. Copyright © 2017 Elsevier B.V. All rights reserved.

  17. Methodological challenges to bridge the gap between regional climate and hydrology models

    Science.gov (United States)

    Bozhinova, Denica; José Gómez-Navarro, Juan; Raible, Christoph; Felder, Guido

    2017-04-01

    The frequency and severity of floods worldwide, together with their impacts, are expected to increase under climate change scenarios. It is therefore very important to gain insight into the physical mechanisms responsible for such events in order to constrain the associated uncertainties. Model simulations of the climate and hydrological processes are important tools that can provide insight in the underlying physical processes and thus enable an accurate assessment of the risks. Coupled together, they can provide a physically consistent picture that allows to assess the phenomenon in a comprehensive way. However, climate and hydrological models work at different temporal and spatial scales, so there are a number of methodological challenges that need to be carefully addressed. An important issue pertains the presence of biases in the simulation of precipitation. Climate models in general, and Regional Climate models (RCMs) in particular, are affected by a number of systematic biases that limit their reliability. In many studies, prominently the assessment of changes due to climate change, such biases are minimised by applying the so-called delta approach, which focuses on changes disregarding absolute values that are more affected by biases. However, this approach is not suitable in this scenario, as the absolute value of precipitation, rather than the change, is fed into the hydrological model. Therefore, bias has to be previously removed, being this a complex matter where various methodologies have been proposed. In this study, we apply and discuss the advantages and caveats of two different methodologies that correct the simulated precipitation to minimise differences with respect an observational dataset: a linear fit (FIT) of the accumulated distributions and Quantile Mapping (QM). The target region is Switzerland, and therefore the observational dataset is provided by MeteoSwiss. The RCM is the Weather Research and Forecasting model (WRF), driven at the

  18. Researching health inequalities with Community Researchers: practical, methodological and ethical challenges of an 'inclusive' research approach.

    Science.gov (United States)

    Salway, Sarah; Chowbey, Punita; Such, Elizabeth; Ferguson, Beverly

    2015-01-01

    Public health research sometimes uses members of communities as researchers. These are called Community Researchers. The advantage of using Community Researchers is that it enables people who live in communities to participate in research by designing the research, gathering data and being involved in analysis. This 'participatory' approach also has the potential to reach communities that might otherwise not be included in research. There are few studies that report the experiences of Community Researchers who take part in such research. This study helps fill this gap by exploring the issues and challenges faced by Community Researchers involved in a study of health and poverty in ethnically mixed areas of east London, UK. Through the accounts of 12 researchers, the study reveals that being a community 'insider' had advantages: many felt they had been able to gain the trust of respondents and access people for the research that would have otherwise been missed. The role of Community Researcher was, however, difficult to manage with some researchers feeling burdened by their role and the increased knowledge they had about the lives of those in their community. In addition to the personal challenges for the Community Researchers, the findings raise various ethical and methodological issues that need consideration in participatory research. Background Inclusive research approaches are increasingly employed by public health researchers. Recent methodological development includes the engagement of Community Researchers (CRs), who use their knowledge and networks to facilitate research with the community with which they identify. Few studies have explored the experiences of CRs in the research process, an important element of any comprehensive assessment of the pros and cons of such research endeavours. We report here on the experiences of CRs engaged in a study of health inequalities and poverty in ethnically diverse and disadvantaged areas of London, UK. Methods We

  19. Laboratory methodologies for indicators of iron status: strengths, limitations, and analytical challenges.

    Science.gov (United States)

    Pfeiffer, Christine M; Looker, Anne C

    2017-12-01

    Biochemical assessment of iron status relies on serum-based indicators, such as serum ferritin (SF), transferrin saturation, and soluble transferrin receptor (sTfR), as well as erythrocyte protoporphyrin. These indicators present challenges for clinical practice and national nutrition surveys, and often iron status interpretation is based on the combination of several indicators. The diagnosis of iron deficiency (ID) through SF concentration, the most commonly used indicator, is complicated by concomitant inflammation. sTfR concentration is an indicator of functional ID that is not an acute-phase reactant, but challenges in its interpretation arise because of the lack of assay standardization, common reference ranges, and common cutoffs. It is unclear which indicators are best suited to assess excess iron status. The value of hepcidin, non-transferrin-bound iron, and reticulocyte indexes is being explored in research settings. Serum-based indicators are generally measured on fully automated clinical analyzers available in most hospitals. Although international reference materials have been available for years, the standardization of immunoassays is complicated by the heterogeneity of antibodies used and the absence of physicochemical reference methods to establish "true" concentrations. From 1988 to 2006, the assessment of iron status in NHANES was based on the multi-indicator ferritin model. However, the model did not indicate the severity of ID and produced categorical estimates. More recently, iron status assessment in NHANES has used the total body iron stores (TBI) model, in which the log ratio of sTfR to SF is assessed. Together, sTfR and SF concentrations cover the full range of iron status. The TBI model better predicts the absence of bone marrow iron than SF concentration alone, and TBI can be analyzed as a continuous variable. Additional consideration of methodologies, interpretation of indicators, and analytic standardization is important for further

  20. Drets lingüístics i ordenament constitucional. Seguretat lingüística vs jerarquia lingüística. Un estudi comparat de Suïssa i Espanya

    OpenAIRE

    Tasa Fuster, Vicenta

    2016-01-01

    Aquesta tesi doctoral té com a objecte l’anàlisi comparat del tractament legal que reben les diferents llengües d’Espanya i de Suïssa en les constitucions i en la legislació respectives, tot considerant que Espanya i Suïssa són dos estats plurilingües i amb una organització territorial complexa. El treball és fet dins del Dret Constitucional; però té en compte també altres ciències socials, com ara la Ciència Política, la Teoria Política, anàlisi de les polítiques públiques o la sociolingüíst...

  1. Analytical methodology for nuclear safeguards

    International Nuclear Information System (INIS)

    Ramakumar, K.L.

    2011-01-01

    This paper attempts to briefly describe the analytical methodologies available and also highlight some of the challenges, expectations from nuclear material accounting and control (NUMAC) point of view

  2. Sex Work Research: Methodological and Ethical Challenges

    Science.gov (United States)

    Shaver, Frances M.

    2005-01-01

    The challenges involved in the design of ethical, nonexploitative research projects with sex workers or any other marginalized population are significant. First, the size and boundaries of the population are unknown, making it extremely difficult to get a representative sample. Second, because membership in hidden populations often involves…

  3. BOREAS RSS-8 BIOME-BGC SSA Simulation of Annual Water and Carbon Fluxes

    Science.gov (United States)

    Hall, Forrest G. (Editor); Nickeson, Jaime (Editor); Kimball, John

    2000-01-01

    The BOREAS RSS-8 team performed research to evaluate the effect of seasonal weather and landcover heterogeneity on boreal forest regional water and carbon fluxes using a process-level ecosystem model, BIOME-BGC, coupled with remote sensing-derived parameter maps of key state variables. This data set contains derived maps of landcover type and crown and stem biomass as model inputs to determine annual evapotranspiration, gross primary production, autotrophic respiration, and net primary productivity within the BOREAS SSA-MSA, at a 30-m spatial resolution. Model runs were conducted over a 3-year period from 1994-1996; images are provided for each of those years. The data are stored in binary image format. The data files are available on a CD-ROM (see document number 20010000884), or from the Oak Ridge National Laboratory (ORNL) Distributed Active Archive Center (DAAC).

  4. Methodology of sustainability accounting

    Directory of Open Access Journals (Sweden)

    O.H. Sokil

    2017-03-01

    Full Text Available Modern challenges of the theory and methodology of accounting are realized through the formation and implementation of new concepts, the purpose of which is to meet the needs of users in standard and unique information. The development of a methodology for sustainability accounting is a key aspect of the management of an economic entity. The purpose of the article is to form the methodological bases of accounting for sustainable development and determine its goals, objectives, object, subject, methods, functions and key aspects. The author analyzes the theoretical bases of the definition and considers the components of the traditional accounting methodology. Generalized structural diagram of the methodology for accounting for sustainable development is offered in the article. The complex of methods and principles of sustainable development accounting for systematized and non-standard provisions has been systematized. The new system of theoretical and methodological provisions of accounting for sustainable development is justified in the context of determining its purpose, objective, subject, object, methods, functions and key aspects.

  5. Methodological challenges when doing research that includes ethnic minorities

    DEFF Research Database (Denmark)

    Morville, Anne-Le; Erlandsson, Lena-Karin

    2016-01-01

    minorities are included. Method: A thorough literature search yielded 21 articles obtained from the scientific databases PubMed, Cinahl, Web of Science and PsychInfo. Analysis followed Arksey and O’Malley’s framework for scoping reviews, applying content analysis. Results: The results showed methodological...

  6. Metabolic consequences of obesity and insulin resistance in polycystic ovary syndrome: diagnostic and methodological challenges.

    Science.gov (United States)

    Jeanes, Yvonne M; Reeves, Sue

    2017-06-01

    Women with polycystic ovary syndrome (PCOS) have a considerable risk of metabolic dysfunction. This review aims to present contemporary knowledge on obesity, insulin resistance and PCOS with emphasis on the diagnostic and methodological challenges encountered in research and clinical practice. Variable diagnostic criteria for PCOS and associated phenotypes are frequently published. Targeted searches were conducted to identify all available data concerning the association of obesity and insulin resistance with PCOS up to September 2016. Articles were considered if they were peer reviewed, in English and included women with PCOS. Obesity is more prevalent in women with PCOS, but studies rarely reported accurate assessments of adiposity, nor split the study population by PCOS phenotypes. Many women with PCOS have insulin resistance, though there is considerable variation reported in part due to not distinguishing subgroups known to have an impact on insulin resistance as well as limited methodology to measure insulin resistance. Inflammatory markers are positively correlated with androgen levels, but detailed interactions need to be identified. Weight management is the primary therapy; specific advice to reduce the glycaemic load of the diet and reduce the intake of pro-inflammatory SFA and advanced glycation endproducts have provided promising results. It is important that women with PCOS are educated about their increased risk of metabolic complications in order to make timely and appropriate lifestyle modifications. Furthermore, well-designed robust studies are needed to evaluate the mechanisms behind the improvements observed with dietary interventions.

  7. Challenges in dental statistics: survey methodology topics

    Directory of Open Access Journals (Sweden)

    Giuseppe Pizzo

    2013-12-01

    Full Text Available This paper gathers some contributions concerning survey methodology in dental research, as discussed during the first Workshop of the SISMEC STATDENT working group on statistical methods and applications in dentistry, held in Ancona on the 28th September 2011.The first contribution deals with the European Global Oral Health Indicators Development (EGOHID Project which proposed a comprehensive and standardized system of epidemiological tools (questionnaires and clinical forms for national data collection on oral health in Europe. The second contribution regards the design and conduct of trials to evaluate the clinical efficacy and safety of toothbrushes and mouthrinses. Finally, a flexible and effective tool used to trace dental age reference charts tailored to Italian children is presented.

  8. Sulfonylurea herbicides – methodological challenges in setting aquatic limit values

    DEFF Research Database (Denmark)

    Rosenkrantz, Rikke Tjørnhøj; Baun, Anders; Kusk, Kresten Ole

    according to the EU Water Framework Directive, the resulting Water Quality Standards (WQSs) are below the analytical quantification limit, making it difficult to verify compliance with the limit values. However, several methodological concerns may be raised in relation to the very low effect concentrations...... and rimsulfuron. The following parameters were varied during testing: pH, exposure duration, temperature and light/dark cycle. Preliminary results show that a decrease in pH causes an increase in toxicity for all compounds. Exposure to a high concentration for 24 hours caused a reduction in growth rate, from...... for setting limit values for SUs or if more detailed information should be gained by taking methodological considerations into account....

  9. Estimation of undernutrition and mean calorie intake in Africa: methodology, findings and implications.

    Science.gov (United States)

    van Wesenbeeck, Cornelia F A; Keyzer, Michiel A; Nubé, Maarten

    2009-06-27

    As poverty and hunger are basic yardsticks of underdevelopment and destitution, the need for reliable statistics in this domain is self-evident. While the measurement of poverty through surveys is relatively well documented in the literature, for hunger, information is much scarcer, particularly for adults, and very different methodologies are applied for children and adults. Our paper seeks to improve on this practice in two ways. One is that we estimate the prevalence of undernutrition in sub-Saharan Africa (SSA) for both children and adults based on anthropometric data available at province or district level, and secondly, we estimate the mean calorie intake and implied calorie gap for SSA, also using anthropometric data on the same geographical aggregation level. Our main results are, first, that we find a much lower prevalence of hunger than presented in the Millennium Development reports (17.3% against 27.8% for the continent as a whole). Secondly, we find that there is much less spread in mean calorie intake across the continent than reported by the Food and Agricultural Organization (FAO) in the State of Food and Agriculture, 2007, the only estimate that covers the whole of Africa. While FAO estimates for calorie availability vary from a low of 1760 Kcal/capita/day for Central Africa to a high of 2825 Kcal/capita/day for Southern Africa, our estimates lay in a range of 2245 Kcal/capita/day (Eastern Africa) to 2618 Kcal/capita/day for Southern Africa. Thirdly, we validate the main data sources used (the Demographic and Health Surveys) by comparing them over time and with other available data sources for various countries. We conclude that the picture of Africa that emerges from anthropometric data is much less negative than that usually presented. Especially for Eastern and Central Africa, the nutritional status is less critical than commonly assumed and also mean calorie intake is higher, which implies that agricultural production and hence income must also

  10. The Methodological Imperatives of Feminist Ethnography

    Directory of Open Access Journals (Sweden)

    Richelle D. Schrock

    2013-12-01

    Full Text Available Feminist ethnography does not have a single, coherent definition and is caught between struggles over the definition and goals of feminism and the multiple practices known collectively as ethnography. Towards the end of the 1980s, debates emerged that problematized feminist ethnography as a productive methodology and these debates still haunt feminist ethnographers today. In this article, I provide a concise historiography of feminist ethnography that summarizes both its promises and its vulnerabilities. I address the three major challenges I argue feminist ethnographers currently face, which include responding productively to feminist critiques of representing "others," accounting for feminisms' commitment to social change while grappling with poststructuralist critiques of knowledge production, and confronting the historical and ongoing lack of recognition for significant contributions by feminist ethnographers. Despite these challenges, I argue that feminist ethnography is a productive methodology and I conclude by delineating its methodological imperatives. These imperatives include producing knowledge about women's lives in specific cultural contexts, recognizing the potential detriments and benefits of representation, exploring women's experiences of oppression along with the agency they exercise in their own lives, and feeling an ethical responsibility towards the communities in which the researchers work. I argue that this set of imperatives enables feminist ethnographers to successfully navigate the challenges they face.

  11. Solving a methodological challenge in work stress evaluation with the Stress Assessment and Research Toolkit (StART): a study protocol.

    Science.gov (United States)

    Guglielmi, Dina; Simbula, Silvia; Vignoli, Michela; Bruni, Ilaria; Depolo, Marco; Bonfiglioli, Roberta; Tabanelli, Maria Carla; Violante, Francesco Saverio

    2013-06-22

    Stress evaluation is a field of strong interest and challenging due to several methodological aspects in the evaluation process. The aim of this study is to propose a study protocol to test a new method (i.e., the Stress Assessment and Research Toolkit) to assess psychosocial risk factors at work. This method addresses several methodological issues (e.g., subjective vs. objective, qualitative vs quantitative data) by assessing work-related stressors using different kinds of data: i) organisational archival data (organisational indicators sheet); ii) qualitative data (focus group); iii) worker perception (questionnaire); and iv) observational data (observational checklist) using mixed methods research. In addition, it allows positive and negative aspects of work to be considered conjointly, using an approach that considers at the same time job demands and job resources. The integration of these sources of data can reduce the theoretical and methodological bias related to stress research in the work setting, allows researchers and professionals to obtain a reliable description of workers' stress, providing a more articulate vision of psychosocial risks, and allows a large amount of data to be collected. Finally, the implementation of the method ensures in the long term a primary prevention for psychosocial risk management in that it aims to reduce or modify the intensity, frequency or duration of organisational demands.

  12. Recognizing and overcoming challenges of couple interview research.

    Science.gov (United States)

    Mellor, Ruth M; Slaymaker, Emma; Cleland, John

    2013-10-01

    In this article we discuss some methodological and ethical challenges we faced when conducting a couple-based study on men's role in contraceptive switching, and how we overcame them. The challenges we discuss include recruiting couples with a range of experiences, ensuring informed consent of participants, maintaining confidentiality within interviews, and participants discussing interview content between interviews. As appropriate, we have drawn on study participants' views of these challenges. We conclude that although couple research poses challenges, they can be overcome or minimized, and that for certain research questions this methodology is well worth using.

  13. Technologies, Methodologies and Challenges in Network Intrusion Detection and Prevention Systems

    Directory of Open Access Journals (Sweden)

    Nicoleta STANCIU

    2013-01-01

    Full Text Available This paper presents an overview of the technologies and the methodologies used in Network Intrusion Detection and Prevention Systems (NIDPS. Intrusion Detection and Prevention System (IDPS technologies are differentiated by types of events that IDPSs can recognize, by types of devices that IDPSs monitor and by activity. NIDPSs monitor and analyze the streams of network packets in order to detect security incidents. The main methodology used by NIDPSs is protocol analysis. Protocol analysis requires good knowledge of the theory of the main protocols, their definition, how each protocol works.

  14. Methodology for eliciting, encoding and simulating human decision making behaviour

    OpenAIRE

    Rider, Conrad Edgar Scott

    2012-01-01

    Agent-based models (ABM) are an increasingly important research tool for describing and predicting interactions among humans and their environment. A key challenge for such models is the ability to faithfully represent human decision making with respect to observed behaviour. This thesis aims to address this challenge by developing a methodology for empirical measurement and simulation of decision making in humanenvironment systems. The methodology employs the Beliefs-Desires-I...

  15. Assessing the comparative effectiveness of newly marketed medications: methodological challenges and implications for drug development.

    Science.gov (United States)

    Schneeweiss, S; Gagne, J J; Glynn, R J; Ruhl, M; Rassen, J A

    2011-12-01

    Comparative-effectiveness research (CER) aims to produce actionable evidence regarding the effectiveness and safety of medical products and interventions as they are used outside of controlled research settings. Although CER evidence regarding medications is particularly needed shortly after market approval, key methodological challenges include (i) potential bias due to channeling of patients to the newly marketed medication because of various patient-, physician-, and system-related factors; (ii) rapid changes in the characteristics of the user population during the early phase of marketing; and (iii) lack of timely data and the often small number of users in the first few months of marketing. We propose a mix of approaches to generate comparative-effectiveness data in the early marketing period, including sequential cohort monitoring with secondary health-care data and propensity score (PS) balancing, as well as extended follow-up of phase III and phase IV trials, indirect comparisons of placebo-controlled trials, and modeling and simulation of virtual trials.

  16. Application of indirect immunofluorescent test with an improved HEp-2 substrate tranfected with human Ro60/SSA autoantigens

    International Nuclear Information System (INIS)

    Lv Liangjing; Chen Shunle; Gu Yueying; Shen Nan; Bao Chunde; Wang Yuan; Xue Feng; Ye Peng; Yu Chongzhao

    2006-01-01

    To develop an improved substrate for indirect immunofluorescent test (IIF) to detect anti-Ro/SSA autoantibodies, the human 60-kDa Ro/SSA autoantigens (Ro60) cDNAs were obtained from placental cDNA library using PCR and were cloned into the mammalian expression vectorpEGFP-C1. Then the recombinant plasmids were transfected into HEp-2 cells. We con- firmed the overexpression, localization and antigenicity of fusion proteins in transfected cells by means of fluorescence microscopy, immunoblotting and IIF. HEp-2 and HEp-Ro60 was analyzed by IIF using a panel of 10 precipitinpositive anti-Ro human sera simultaneously. Stable expression of Ro60-GFP (green fluorescent protein) fusion proteins maintained ten more generations. And Ro60-GFP kept the antigenicity of Ro and had its own characteristic immunofluorescent pattern in HEp-Ro60 cells. The transfectants dramatically increased the sensitivity of IIF testing (a mean increase of 6.7-fold in endpoint titer, P<0.01). Eight (8/10) positive an- ti-Ro sera showed characteristic immunofluorescent pattern on HEp-Ro60, including two sera which were antinuclear antibodies (ANA) negative on untransfected HEp-2. IIF-ANA in all healthy sera were negative on HEp-Ro60. As a kind of new substrate of IIF, the Ro60 transfectants can be used to detect anti-Ro antibodies. In addition, transfected HEp-2 cells kept the immunofluorescent property of HEp-2 cells in IIF-ANA tests and could be employed as substrate for the routine IIF-ANA detection. The method improved the sensitivity of IIF-ANA. (authors)

  17. Methodology for astronaut reconditioning research.

    Science.gov (United States)

    Beard, David J; Cook, Jonathan A

    2017-01-01

    Space medicine offers some unique challenges, especially in terms of research methodology. A specific challenge for astronaut reconditioning involves identification of what aspects of terrestrial research methodology hold and which require modification. This paper reviews this area and presents appropriate solutions where possible. It is concluded that spaceflight rehabilitation research should remain question/problem driven and is broadly similar to the terrestrial equivalent on small populations, such as rare diseases and various sports. Astronauts and Medical Operations personnel should be involved at all levels to ensure feasibility of research protocols. There is room for creative and hybrid methodology but careful systematic observation is likely to be more achievable and fruitful than complex trial based comparisons. Multi-space agency collaboration will be critical to pool data from small groups of astronauts with the accepted use of standardised outcome measures across all agencies. Systematic reviews will be an essential component. Most limitations relate to the inherent small sample size available for human spaceflight research. Early adoption of a co-operative model for spaceflight rehabilitation research is therefore advised. Copyright © 2016 Elsevier Ltd. All rights reserved.

  18. Reference Management Methodologies for Large Structural Models at Kennedy Space Center

    Science.gov (United States)

    Jones, Corey; Bingham, Ryan; Schmidt, Rick

    2011-01-01

    There have been many challenges associated with modeling some of NASA KSC's largest structures. Given the size of the welded structures here at KSC, it was critically important to properly organize model struc.ture and carefully manage references. Additionally, because of the amount of hardware to be installed on these structures, it was very important to have a means to coordinate between different design teams and organizations, check for interferences, produce consistent drawings, and allow for simple release processes. Facing these challenges, the modeling team developed a unique reference management methodology and model fidelity methodology. This presentation will describe the techniques and methodologies that were developed for these projects. The attendees will learn about KSC's reference management and model fidelity methodologies for large structures. The attendees will understand the goals of these methodologies. The attendees will appreciate the advantages of developing a reference management methodology.

  19. Methodological challenges in a study on falls in an older population of Cape Town, South Africa.

    Science.gov (United States)

    Kalula, Sebastiana Z; Ferreira, Monica; Swingler, George H; Badri, Motasim; Sayer, Avan A

    2017-09-01

    Falls are a major cause of disability, morbidity and mortality in older persons, but have been under researched in developing countries. To describe challenges encountered in a community-based study on falls in a multi-ethnic population aged ≥65 years in a low-income setting. The study was conducted in four stages: A pilot study (n=105) to establish a sample size for the survey. An equipment validation study (n=118) to use for fall risk determination. A cross-sectional baseline (n=837) and a 12-month follow-up survey (n=632) to establish prevalence and risk factors for falls. Prevalence rate of 26.4% (95% CI 23.5-29.5%) and risk factors for recurrent falls: previous falls, self-reported poor mobility and dizziness were established. Adaptations to the gold standard prospective fall research study design were employed: 1) to gain access to the study population in three selected suburbs, 2) to perform assessments in a non-standardised setting, 3) to address subjects' poverty and low literacy levels, and high attrition of subjects and field workers. Studies on falls in the older population of low- to middle-income countries have methodological challenges. Adaptive strategies used in the Cape Town study and the research experience reported may be instructive for investigators planning similar studies in such settings.

  20. The complexity and challenges of determining GHG (greenhouse gas) emissions from grid electricity consumption and conservation in LCA (life cycle assessment) – A methodological review

    International Nuclear Information System (INIS)

    Soimakallio, Sampo; Kiviluoma, Juha; Saikku, Laura

    2011-01-01

    The way in which GHG (greenhouse gas) emissions associated with grid electricity consumption is handled in different LCA (life cycle assessment) studies, varies significantly. Apart from differences in actual research questions, methodological choices and data set selection have a significant impact on the outcomes. These inconsistencies result in difficulties to compare the findings of various LCA studies. This review paper explores the issue from a methodological point of view. The perspectives of ALCA (attributional life cycle assessment) and CLCA (consequential life cycle assessment) are reflected. Finally, the paper summarizes the key issues and provides suggestions on the way forward. The major challenge related to both of the LCA categories is to determine the GHG emissions of the power production technologies under consideration. Furthermore, the specific challenge in ALCA is to determine the appropriate electricity production mix, and in CLCA, to identify the marginal technologies affected and related consequences. Significant uncertainties are involved, particularly in future-related LCAs, and these should not be ignored. Harmonization of the methods and data sets for various purposes is suggested, acknowledging that selections might be subjective. -- Highlights: ► Methods to assess GHG emissions from grid electricity consumption in LCA vary. ► We explored the major challenges related to various methods. ► Significant uncertainties are involved particularly in future-related GHG emissions. ► The most appropriate method depends on the equity viewpoints.

  1. Local and regional low carbon scenarios methodology, challenges and opportunities

    International Nuclear Information System (INIS)

    2010-01-01

    In its first part, this report discusses the emergence of local climate and energy policy in Europe, the implementation of nationally imposed but regionally anchored energy scenarios (i.e. in France, the Climate Air Energy Regional Schemes or SRCAE). Then it addresses the methodological and political aspects of local and regional low emission scenarios: methodologies and typologies of energy scenarios, ways to define an appropriate emission reduction and energy consumption objective, ways to deal with emission or carbon gaps, ways to make local emission inventories, ways to gather local data, ways to deal with special emission sources, ways to assess and develop local energy efficiency and renewable energy potentials, ways to take energy sufficiency into account, and the evolution from energy autonomy to 100% renewable energy territories. The last part addresses the issues of stake holder and citizen participation in the definition of long term strategies

  2. Researching experiences of cancer: the importance of methodology.

    Science.gov (United States)

    Entwistle, V; Tritter, J Q; Calnan, M

    2002-09-01

    This paper draws on contributions to and discussions at a recent MRC HSRC-sponsored workshop 'Researching users' experiences of health care: the case of cancer'. We focus on the methodological and ethical challenges that currently face researchers who use self-report methods to investigate experiences of cancer and cancer care. These challenges relate to: the theoretical and conceptual underpinnings of research; participation rates and participant profiles; data collection methods (the retrospective nature of accounts, description and measurement, and data collection as intervention); social desirability considerations; relationship considerations; the experiences of contributing to research; and the synthesis and presentation of findings. We suggest that methodological research to tackle these challenges should be integrated into substantive research projects to promote the development of a strong knowledge base about experiences of cancer and cancer care.

  3. [Would you mind a little bit less? Methodological and ethical challenges posed by the reduction of overtreatment].

    Science.gov (United States)

    Strech, Daniel

    2013-01-01

    The present paper outlines two central challenges that should be taken into account when making a concerted effort to reduce excessive medical care (overdiagnosis and overtreatment): first, the inevitability of value judgements in the risk-benefit assessment of medical treatment measures in conjunction with the need to go beyond the individual doctor-patient relationship and make these value judgements while, at least in part, assuming the role of acting deputy; and second, the need for a sufficient level of competence and trust in evidence-based medicine on the part of both physicians and patients. The paper will explain how one can say in a methodologically reasonable and ethically acceptable manner that a certain medical measure - in the context of the regular care setting - will objectively cause a "net harm" to the patient. Relevant institutions in the German healthcare system will be described that are currently conducting risk-benefit assessments (by different means and with different purposes). Taking the known entity of clinical guidelines as an example, the paper will demonstrate that the subjects of overdiagnosis and overtreatment as well as shortage of medical care can be more explicitly communicated by employing certain additional methodological tools. Finally, some central implementation barriers to a successful application of "Less is more!" will be presented and critically discussed. (As supplied by publisher). Copyright © 2013. Published by Elsevier GmbH.

  4. Practical Issues of Conducting a Q Methodology Study: Lessons Learned From a Cross-cultural Study.

    Science.gov (United States)

    Stone, Teresa Elizabeth; Maguire, Jane; Kang, Sook Jung; Cha, Chiyoung

    This article advances nursing research by presenting the methodological challenges experienced in conducting a multination Q-methodology study. This article critically analyzes the relevance of the methodology for cross-cultural and nursing research and the challenges that led to specific responses by the investigators. The use of focus groups with key stakeholders supplemented the Q-analysis results. The authors discuss practical issues and shared innovative approaches and provide best-practice suggestions on the use of this flexible methodology. Q methodology has the versatility to explore complexities of contemporary nursing practice and cross-cultural health research.

  5. A stale challenge to the philosophy of science: commentary on "Is psychology based on a methodological error?" by Michael Schwarz.

    Science.gov (United States)

    Ruck, Nora; Slunecko, Thomas

    2010-06-01

    In his article "Is psychology based on a methodological error?" and based on a quite convincing empirical basis, Michael Schwarz offers a methodological critique of one of mainstream psychology's key test theoretical axioms, i.e., that of the in principle normal distribution of personality variables. It is characteristic of this paper--and at first seems to be a strength of it--that the author positions his critique within a frame of philosophy of science, particularly positioning himself in the tradition of Karl Popper's critical rationalism. When scrutinizing Schwarz's arguments, however, we find Schwarz's critique profound only as an immanent critique of test theoretical axioms. We raise doubts, however, as to Schwarz's alleged 'challenge' to the philosophy of science because the author not at all seems to be in touch with the state of the art of contemporary philosophy of science. Above all, we question the universalist undercurrent that Schwarz's 'bio-psycho-social model' of human judgment boils down to. In contrast to such position, we close our commentary with a plea for a context- and culture sensitive philosophy of science.

  6. METHODOLOGICAL APPROACHES AND CHALLENGES IN ASSESSING THE VALUE OF INTELLECTUAL CAPITAL

    Directory of Open Access Journals (Sweden)

    E. D. Katulskij

    2016-01-01

    Full Text Available Presence at the enterprise znanievyh resources determines its capacity for sustainable and competitive development. The set of knowledge, skills and abilities (which has operational and management personnel, including transformed in intangible and other assets are considered to be the intellectual capital of the enterprise. Empirically, the presence of the intellectual capital of the enterprise can be identified by its success in the market and the ability to generate a high value added product. However, scientific and methodological point of view, approaches to assessing intellectual capital are currently not standardized and do not provide an objective valuation of the capital.This paper presents an overview of the methodological approaches to the valuation of the intellectual capital of companies and shows the problems of using these approaches in analytical procedures. Based on the materials conclusion about the necessity of further development of the intellectual capital evaluation methods enterprises it was made.The purpose / goal. The purpose of this article is to study the specifics of basic methodological approaches to the valuation of the intellectual capital of enterprises. Moreover, among the main tasks is to provide: an analysis of the most frequently used techniques in the Russian and international practice, assessment of intellectual capital.Methodology. The article is a content analysis of the theoretical and scientific-methodical positions, describing the key and the most frequently used Russian and international approaches to the evaluation of the intellectual capital of enterprises.Conclusions / relevance. The practical significance of this paper is to identify the main issues that arise in the evaluation of the intellectual capital of the enterprises, which determines the need for further scientific development and complement the currently used evaluation methods.

  7. Research Methodology in Global Strategy Research

    DEFF Research Database (Denmark)

    Cuervo-Cazurra, Alvaro; Mudambi, Ram; Pedersen, Torben

    2017-01-01

    We review advances in research methodology used in global strategy research and provide suggestions on how researchers can improve their analyses and arguments. Methodological advances in the extraction of information, such as computer-aided text analysis, and in the analysis of datasets......, such as differences-in-differences and propensity score matching, have helped deal with challenges (e.g., endogeneity and causality) that bedeviled earlier studies and resulted in conflicting findings. These methodological advances need to be considered as tools that complement theoretical arguments and well......-explained logics and mechanisms so that researchers can provide better and more relevant recommendations to managers designing the global strategies of their organizations....

  8. Comparative study on software development methodologies

    Directory of Open Access Journals (Sweden)

    Mihai Liviu DESPA

    2014-12-01

    Full Text Available This paper focuses on the current state of knowledge in the field of software development methodologies. It aims to set the stage for the formalization of a software development methodology dedicated to innovation orientated IT projects. The paper starts by depicting specific characteristics in software development project management. Managing software development projects involves techniques and skills that are proprietary to the IT industry. Also the software development project manager handles challenges and risks that are predominantly encountered in business and research areas that involve state of the art technology. Conventional software development stages are defined and briefly described. Development stages are the building blocks of any software development methodology so it is important to properly research this aspect. Current software development methodologies are presented. Development stages are defined for every showcased methodology. For each methodology a graphic representation is illustrated in order to better individualize its structure. Software development methodologies are compared by highlighting strengths and weaknesses from the stakeholder's point of view. Conclusions are formulated and a research direction aimed at formalizing a software development methodology dedicated to innovation orientated IT projects is enunciated.

  9. Learning challenges and sustainable development: A methodological perspective.

    Science.gov (United States)

    Seppänen, Laura

    2017-01-01

    Sustainable development requires learning, but the contents of learning are often complex and ambiguous. This requires new integrated approaches from research. It is argued that investigation of people's learning challenges in every-day work is beneficial for research on sustainable development. The aim of the paper is to describe a research method for examining learning challenges in promoting sustainable development. This method is illustrated with a case example from organic vegetable farming in Finland. The method, based on Activity Theory, combines historical analysis with qualitative analysis of need expressions in discourse data. The method linking local and subjective need expressions with general historical analysis is a promising way to overcome the gap between the individual and society, so much needed in research for sustainable development. Dialectically informed historical frameworks have practical value as tools in collaborative negotiations and participatory designs for sustainable development. The simultaneous use of systemic and subjective perspectives allows researchers to manage the complexity of practical work activities and to avoid too simplistic presumptions about sustainable development.

  10. Research and Development Projects with ICT and students as learning designers in Primary Schools: A methodological challenge

    DEFF Research Database (Denmark)

    Levinsen, Karin Ellen Tweddell; Sørensen, Birgitte Holm; Tosca, Susana

    of how: • ICT supports students learning, • ICT release time for more teaching, and • teachers digital literacy impact on the role of ICT in the educational practice. Further the call required collaboration between universities and university colleges in order to disseminate knowledge and new practices......In this paper we present some methodological challenges that emerged during the process of shaping the research design for the comprehensive and complex research project Children as learning designers in a digital school. The project is the realization of our proposal to a research call from...... the Danish Ministry of Education named Development projects and pilot school experiments (Udviklingsprojekter med demonstrationsskoleforsøg vedr. it i folkeskolen – see Undervisningsministeriet 2013) in the spring 2013. The call was based on a governmental decision to allocate 500 million DKR to increase...

  11. Evaluating the effects of the Dietary Guidelines for Americans on consumer behavior and health: methodological challenges.

    Science.gov (United States)

    Guthrie, Joanne F; Smallwood, David M

    2003-12-01

    The Dietary Guidelines for Americans is the official nutrition policy statement for the United States. Government involvement in providing information on private behavior, such as food choice, is justified by the high cost of poor diets, as measured in medical expenses and lost productivity. The Guidelines are intended to provide an up-to-date, consistent information base for federal nutrition education and information efforts and food assistance program regulations. Through these policy mechanisms, the Guidelines are assumed to improve dietary behavior, and, ultimately, health. By law, the Dietary Guidelines for Americans must be updated every five years; however, there is no mandate for evaluation. Evaluation could provide useful information to assess the extent to which the Guidelines positively influence health and provide insights into reasons for their successes and limitations. However, evaluation would also present considerable challenges. This paper discusses the critical data and methodological needs for improving evaluation of the Dietary Guidelines for Americans.

  12. CAGE IIIA Distributed Simulation Design Methodology

    Science.gov (United States)

    2014-05-01

    2 VHF Very High Frequency VLC Video LAN Codec – an Open-source cross-platform multimedia player and framework VM Virtual Machine VOIP Voice Over...Implementing Defence Experimentation (GUIDEx). The key challenges for this methodology are with understanding how to: • design it o define the...operation and to be available in the other nation’s simulations. The challenge for the CAGE campaign of experiments is to continue to build upon this

  13. Estimation of undernutrition and mean calorie intake in Africa: methodology, findings and implications

    Directory of Open Access Journals (Sweden)

    Nubé Maarten

    2009-06-01

    Full Text Available Abstract Background As poverty and hunger are basic yardsticks of underdevelopment and destitution, the need for reliable statistics in this domain is self-evident. While the measurement of poverty through surveys is relatively well documented in the literature, for hunger, information is much scarcer, particularly for adults, and very different methodologies are applied for children and adults. Our paper seeks to improve on this practice in two ways. One is that we estimate the prevalence of undernutrition in sub-Saharan Africa (SSA for both children and adults based on anthropometric data available at province or district level, and secondly, we estimate the mean calorie intake and implied calorie gap for SSA, also using anthropometric data on the same geographical aggregation level. Results Our main results are, first, that we find a much lower prevalence of hunger than presented in the Millennium Development reports (17.3% against 27.8% for the continent as a whole. Secondly, we find that there is much less spread in mean calorie intake across the continent than reported by the Food and Agricultural Organization (FAO in the State of Food and Agriculture, 2007, the only estimate that covers the whole of Africa. While FAO estimates for calorie availability vary from a low of 1760 Kcal/capita/day for Central Africa to a high of 2825 Kcal/capita/day for Southern Africa, our estimates lay in a range of 2245 Kcal/capita/day (Eastern Africa to 2618 Kcal/capita/day for Southern Africa. Thirdly, we validate the main data sources used (the Demographic and Health Surveys by comparing them over time and with other available data sources for various countries. Conclusion We conclude that the picture of Africa that emerges from anthropometric data is much less negative than that usually presented. Especially for Eastern and Central Africa, the nutritional status is less critical than commonly assumed and also mean calorie intake is higher, which implies

  14. Language barriers and qualitative nursing research: methodological considerations.

    Science.gov (United States)

    Squires, A

    2008-09-01

    This review of the literature synthesizes methodological recommendations for the use of translators and interpreters in cross-language qualitative research. Cross-language qualitative research involves the use of interpreters and translators to mediate a language barrier between researchers and participants. Qualitative nurse researchers successfully address language barriers between themselves and their participants when they systematically plan for how they will use interpreters and translators throughout the research process. Experienced qualitative researchers recognize that translators can generate qualitative data through translation processes and by participating in data analysis. Failure to address language barriers and the methodological challenges they present threatens the credibility, transferability, dependability and confirmability of cross-language qualitative nursing research. Through a synthesis of the cross-language qualitative methods literature, this article reviews the basics of language competence, translator and interpreter qualifications, and roles for each kind of qualitative research approach. Methodological and ethical considerations are also provided. By systematically addressing the methodological challenges cross-language research presents, nurse researchers can produce better evidence for nursing practice and policy making when working across different language groups. Findings from qualitative studies will also accurately represent the experiences of the participants without concern that the meaning was lost in translation.

  15. Establishing Equivalence: Methodological Progress in Group-Matching Design and Analysis

    Science.gov (United States)

    Kover, Sara T.; Atwood, Amy K.

    2013-01-01

    This methodological review draws attention to the challenges faced by intellectual and developmental disabilities researchers in the appropriate design and analysis of group comparison studies. We provide a brief overview of matching methodologies in the field, emphasizing group-matching designs used in behavioral research on cognition and…

  16. Postgraduate Conception of Research Methodology: Implications for Learning and Teaching

    Science.gov (United States)

    Daniel, Ben; Kumar, Vijay; Omar, Noritah

    2018-01-01

    This qualitative inquiry investigates postgraduate students' conceptions of research methodology and how it contributes to their learning. It explores factors likely to motivate student choice of research methodology and challenges in understanding research methods. The research was carried out at research-intensive universities in New Zealand and…

  17. Stellar parameters for the central star of the planetary nebula PRTM 1 using the German Astrophysical Virtual Observatory service TheoSSA

    Science.gov (United States)

    Rauch, T.; Demleitner, M.; Hoyer, D.; Werner, K.

    2018-04-01

    The German Astrophysical Virtual Observatory (GAVO) developed the registered service TheoSSA (theoretical stellar spectra access) and the supporting registered VO tool TMAW (Tübingen Model-Atmosphere WWW interface). These allow individual spectral analyses of hot, compact stars with state-of-the-art non-local thermodynamical equilibrium (NLTE) stellar-atmosphere models that presently consider opacities of the elements H, He, C, N, O, Ne, Na, and Mg, without requiring detailed knowledge about the involved background codes and procedures. Presently, TheoSSA provides easy access to about 150 000 pre-calculated stellar spectral energy distributions (SEDs) and is intended to ingest SEDs calculated by any model-atmosphere code. In the case of the exciting star of PN PRTM 1, we demonstrate the easy way to calculate individual NLTE stellar model-atmospheres to reproduce an observed optical spectrum. We measured T_eff = 98 000± 5 000 K, log (g / cm/s^2) = 5.0^{+0.3}_{-0.2}, and photospheric mass fractions of H =7.5 × 10-1 (1.02 times solar), He =2.4 × 10-1 (0.96), C =2.0 × 10-3 (0.84), N =3.2 × 10-4 (0.46), and O =8.5 × 10-3 (1.48) with uncertainties of ±0.2 dex. We determined the stellar mass and luminosity of 0.73^{+0.16}_{-0.15} M_{⊙} and log (L/L⊙) = 4.2 ± 0.4, respectively.

  18. Evaluating the impact of agricultural extension programmes in sub-Saharan Africa: Challenges and prospects

    OpenAIRE

    Hailemichael Taye

    2013-01-01

    Background: In sub-Saharan Africa (SSA), impact evaluation has been used to assess whether agricultural extension interventions have brought the intended result or to establish causal linkages between interventions and outcomes. However, there is some scepticism about the validity and reliability of the results of the impact evaluation reports due to some contradictory and exaggerated results. Objectives: This article analyses some impact evaluation studies conducted in SSA as to why cont...

  19. Documenting Sociolinguistic Variation in Lesser-Studied Indigenous Communities: Challenges and Practical Solutions

    Science.gov (United States)

    Mansfield, John; Stanford, James

    2017-01-01

    Documenting sociolinguistic variation in lesser-studied languages presents methodological challenges, but also offers important research opportunities. In this paper we examine three key methodological challenges commonly faced by researchers who are outsiders to the community. We then present practical solutions for successful variationist…

  20. Methodological developments in qualitative longitudinal research: the advantages and challenges of regular telephone contact with participants in a qualitative longitudinal interview study.

    Science.gov (United States)

    Carduff, Emma; Murray, Scott A; Kendall, Marilyn

    2015-04-11

    Qualitative longitudinal research is an evolving methodology, particularly within health care research. It facilitates a nuanced understanding of how phenomena change over time and is ripe for innovative approaches. However, methodological reflections which are tailored to health care research are scarce. This article provides a synthesised and practical account of the advantages and challenges of maintaining regular telephone contact between interviews with participants in a qualitative longitudinal study. Participants with metastatic colorectal cancer were interviewed at 3 time points over the course of a year. Half the group also received monthly telephone calls to explore the added value and the feasibility of capturing change as close to when it was occurring as possible. The data gathered from the telephone calls added context to the participants' overall narrative and informed subsequent interviews. The telephone calls meant we were able to capture change close to when it happened and there was a more evolved, and involved, relationship between the researcher and the participants who were called on a monthly basis. However, ethical challenges were amplified, boundaries of the participant/researcher relationship questioned, and there was the added analytical burden. The telephone calls facilitated a more nuanced understanding of the illness experience to emerge, when compared with the interview only group. The findings suggest that intensive telephone contact may be justified if retention is an issue, when the phenomena being studied is unpredictable and when participants feel disempowered or lack control. These are potential issues for research involving participants with long-term illness.

  1. In vitro cumulative gas production techniques: history, methodological considerations and challenges

    NARCIS (Netherlands)

    Rymer, C.; Huntington, J.A.; Williams, B.A.; Givens, D.I.

    2005-01-01

    Methodology used to measure in vitro gas production is reviewed to determine impacts of sources of variation on resultant gas production profiles (GPP). Current methods include measurement of gas production at constant pressure (e.g., use of gas tight syringes), a system that is inexpensive, but may

  2. Video ethnography during and after caesarean sections: methodological challenges.

    Science.gov (United States)

    Stevens, Jeni; Schmied, Virginia; Burns, Elaine; Dahlen, Hannah G

    2017-07-01

    To describe the challenges of, and steps taken to successfully collect video ethnographic data during and after caesarean sections. Video ethnographic research uses real-time video footage to study a cultural group or phenomenon in the natural environment. It allows researchers to discover previously undocumented practices, which in-turn provides insight into strengths and weaknesses in practice. This knowledge can be used to translate evidence-based interventions into practice. Video ethnographic design. A video ethnographic approach was used to observe the contact between mothers and babies immediately after elective caesarean sections in a tertiary hospital in Sydney, Australia. Women, their support people and staff participated in the study. Data were collected via video footage and field notes in the operating theatre, recovery and the postnatal ward. Challenges faced whilst conducting video ethnographic research included attaining ethics approval, recruiting vast numbers of staff members and 'vulnerable' pregnant women, and endeavouring to be a 'fly on the wall' and a 'complete observer'. There were disadvantages being an 'insider' whilst conducting the research because occasionally staff members requested help with clinical tasks whilst collecting data; however, it was an advantage as it enabled ease of access to the environment and staff members that were to be recruited. Despite the challenges, video ethnographic research enabled the provision of unique data that could not be attained by any other means. Video ethnographic data are beneficial as it provides exceptionally rich data for in-depth analysis of interactions between the environment, equipment and people in the hospital environment. The analysis of this type of data can then be used to inform improvements for future care. © 2016 John Wiley & Sons Ltd.

  3. Lean Six Sigma in health care and the challenge of implementation of Six Sigma methodologies at a Veterans Affairs Medical Center.

    Science.gov (United States)

    Pocha, Christine

    2010-01-01

    Six Sigma and Lean Thinking are quality initiatives initially deployed in industry to improve operational efficiency leading to better quality and subsequent cost savings. The financial rationale for embarking on this quality journey is clear; applying it to today's health care remains challenging. The cost of medical care is increasing at an alarming rate; most of these cost increases are attributed to an aging population and technological advances; therefore, largely beyond control. Furthermore, health care cost increases are caused by unnecessary operational inefficiency associated with the direct medical service delivery process. This article describes the challenging journey of implementing Six Sigma methodology at a tertiary care medical center. Many lessons were learned; however, of utmost importance were team approach, "buy in" of the stakeholders, and the willingness of team members to change daily practice and to adapt new and innovative ways how health care can be delivered. Six Sigma incorporated as part of the "company's or hospital's culture" would be most desirable but the learning curve will be steep.

  4. Research Methodology in Business: A Starter’s Guide

    OpenAIRE

    Ragab, Mohamed AF; Arisha, Amr

    2018-01-01

    A cardinal requisite of successful research lies in the proper selection of the research methodology applied to achieve research objectives using the available resources. In addition to acquiring sufficient knowledge of their specific research topic, researchers are urged to develop good understanding of alternative research methodologies at their disposal to be able to identify the best-suited methods to address the research question. This, however, often poses a challenge for novice researc...

  5. BOREAS HYD-8 DEM Data Over the NSA-MSA and SSA-MSA in the UTM Projection

    Science.gov (United States)

    Wang, Xue-Wen; Hall, Forrest G. (Editor); Knapp, David E. (Editor); Band, L. E.; Smith, David E. (Technical Monitor)

    2000-01-01

    The BOREAS HYD-8 team focused on describing the scaling behavior of water and carbon flux processes at local and regional scales. These DEMs were produced from digitized contours at a cell resolution of 100 meters. Vector contours of the area were used as input to a software package that interpolates between contours to create a DEM representing the terrain surface. The vector contours had a contour interval of 25 feet. The data cover the BOREAS MSAs of the SSA and NSA and are given in a UTM map projection. Most of the elevation data from which the DEM was produced were collected in the 1970s or 1980s. The data are stored in binary, image format files. The data files are available on a CD-ROM (see document number 20010000884) or from the Oak Ridge National Laboratory (ORNL) Distributed Active Archive Center (DAAC).

  6. Can Neuroscience Contribute to Practical Ethics? A Critical Review and Discussion of the Methodological and Translational Challenges of the Neuroscience of Ethics.

    Science.gov (United States)

    Racine, Eric; Dubljević, Veljko; Jox, Ralf J; Baertschi, Bernard; Christensen, Julia F; Farisco, Michele; Jotterand, Fabrice; Kahane, Guy; Müller, Sabine

    2017-06-01

    Neuroethics is an interdisciplinary field that arose in response to novel ethical challenges posed by advances in neuroscience. Historically, neuroethics has provided an opportunity to synergize different disciplines, notably proposing a two-way dialogue between an 'ethics of neuroscience' and a 'neuroscience of ethics'. However, questions surface as to whether a 'neuroscience of ethics' is a useful and unified branch of research and whether it can actually inform or lead to theoretical insights and transferable practical knowledge to help resolve ethical questions. In this article, we examine why the neuroscience of ethics is a promising area of research and summarize what we have learned so far regarding its most promising goals and contributions. We then review some of the key methodological challenges which may have hindered the use of results generated thus far by the neuroscience of ethics. Strategies are suggested to address these challenges and improve the quality of research and increase neuroscience's usefulness for applied ethics and society at large. Finally, we reflect on potential outcomes of a neuroscience of ethics and discuss the different strategies that could be used to support knowledge transfer to help different stakeholders integrate knowledge from the neuroscience of ethics. © 2017 John Wiley & Sons Ltd.

  7. The Child as a Surrogate for Diagnosis of Lupus in the Mother

    Directory of Open Access Journals (Sweden)

    Olufemi O. Adelowo

    2017-01-01

    Full Text Available Introduction. Neonatal lupus erythematosus (NLE is an acquired disease of the newborn caused by transplacental transfer of maternal anti-Ro/SSA, anti-La/SSB, and infrequently anti-U1 RNP antibodies. Methodology. This is a case report of a male infant delivered via Caesarean section at 36-week gestation following detection of fetal bradycardia during routine antenatal clinic visit. Results. The mother was seropositive for antinuclear antibody (ANA and anti-Ro/SSA and had elevated erythrocyte sedimentation rate. The baby was positive for ANA, extractable nuclear antigen (ENA, and anti-Ro/SSA. Pediatric echocardiography was abnormal and electrocardiography confirmed complete heart block.

  8. An Investigation of Global/Local Dynamics of Curriculum Transformation in Sub-Saharan Africa with Special Reference to the Republic of Mozambique

    Science.gov (United States)

    Alderuccio, Michela Chiara

    2010-01-01

    This paper focuses on investigating the dialectic between global and local educational agendas in shaping curriculum transformations in sub-Saharan Africa (SSA). Curriculum transformations are seen as a way to respond to the challenges of promoting Education for All (EFA), but also reflect SSA traditions, social and economic changes. In this…

  9. Applications of mixed-methods methodology in clinical pharmacy research.

    Science.gov (United States)

    Hadi, Muhammad Abdul; Closs, S José

    2016-06-01

    Introduction Mixed-methods methodology, as the name suggests refers to mixing of elements of both qualitative and quantitative methodologies in a single study. In the past decade, mixed-methods methodology has gained popularity among healthcare researchers as it promises to bring together the strengths of both qualitative and quantitative approaches. Methodology A number of mixed-methods designs are available in the literature and the four most commonly used designs in healthcare research are: the convergent parallel design, the embedded design, the exploratory design, and the explanatory design. Each has its own unique advantages, challenges and procedures and selection of a particular design should be guided by the research question. Guidance on designing, conducting and reporting mixed-methods research is available in the literature, so it is advisable to adhere to this to ensure methodological rigour. When to use it is best suited when the research questions require: triangulating findings from different methodologies to explain a single phenomenon; clarifying the results of one method using another method; informing the design of one method based on the findings of another method, development of a scale/questionnaire and answering different research questions within a single study. Two case studies have been presented to illustrate possible applications of mixed-methods methodology. Limitations Possessing the necessary knowledge and skills to undertake qualitative and quantitative data collection, analysis, interpretation and integration remains the biggest challenge for researchers conducting mixed-methods studies. Sequential study designs are often time consuming, being in two (or more) phases whereas concurrent study designs may require more than one data collector to collect both qualitative and quantitative data at the same time.

  10. Benefits of Applying Predictive Intelligence to the Space Situational Awareness (SSA) Mission

    Science.gov (United States)

    Lane, B.; Mann, B.; Millard, C.

    Recent events have heightened the interest in providing improved Space Situational Awareness (SSA) to the warfighter using novel techniques that are affordable and effective. The current Space Surveillance Network (SSN) detects, tracks, catalogs and identifies artificial objects orbiting earth and provides information on Resident Space Objects (RSO) as well as new foreign launch (NFL) satellites. The reactive nature of the SSN provides little to no warning on changes to the expected states of these RSOs or NFLs. This paper will detail the use of the historical data collected on RSOs to characterize what their steady state is, proactively help identify when changes or anomalies have occurred using a pattern-of-like activity based intelligence approach, and apply dynamic, adaptive mission planning to the observables that lead up to a NFL. Multiple hypotheses will be carried along with the intent or the changes to the steady state to assist the SSN in tasking the various sensors in the network to collect the relevant data needed to help prune the number of hypotheses by assigning likelihood to each of those activities. Depending on the hypothesis and thresholds set, these likelihoods will then be used in turn to alert the SSN operator with changes to the steady state, prioritize additional data collections, and provide a watch list of likely next activities.

  11. Preliminary Modelling of Mass Flux at the Surface of Plant Leaves within the MELiSSA Higher Plant Compartments

    Science.gov (United States)

    Holmberg, Madeleine; Paille, Christel; Lasseur, Christophe

    The ESA project Micro Ecological Life Support System Alternative (MELiSSA) is an ecosystem of micro-organisms and higher plants, constructed with the objective of being operated as a tool to understand artificial ecosystems to be used for a long-term or permanent manned planetary base (e.g. Moon or Mars). The purpose of such a system is to provide for generation of food, water recycling, atmospheric regeneration and waste management within defined standards of quality and reliability. As MELiSSA consists of individual compartments which are connected to each other, the robustness of the system is fully dependent on the control of each compartment, as well as the flow management between them. Quality of consumables and reliability of the ecosystem rely on the knowledge, understanding and control of each of the components. This includes the full understanding of all processes related to the higher plants. To progress in that direction, this paper focuses on the mechanical processes driving the gas and liquid exchanges between the plant leaf and its environment. The process responsible for the mass transfer on the surface of plant leaves is diffusion. The diffusion flux is dependent on the behaviour of the stoma of the leaf and also on the leaf boundary layer (BL). In this paper, the physiology of the leaf is briefly examined in order to relate parameters such as light quality, light quantity, CO2 concentration, temperature, leaf water potential, humidity, vapour pressure deficit (VPD) gradients and pollutants to the opening or closing of stomata. The diffusion process is described theoretically and the description is compared to empirical approaches. The variables of the BL are examined and the effect airflow in the compartment has on the BL is investigated. Also presented is the impact changes in different environmental parameters may have on the fluid exchanges. Finally, some tests, to evaluate the accuracy of the concluded model, are suggested.

  12. Challenges and Solutions for Mapping Innovation in a Large Emerging Economy

    DEFF Research Database (Denmark)

    Rai, Sudhanshu

    this paper is an outcome of my experience as a team member of the Euro-India Innovation mapping project. The project set out to map India’s IT Innovativeness over two years from January 2008-to December 2009. Here I bring to the fore the different methodologies that we reviewed in order...... to implement the innovation mapping project and our realization that each methodology in itself though useful may not be sufficient to address the complexity of the subject matter due to the vastness of India and its emerging nature. I outline some of the challenges faced by us when designing a methodology...... for mapping innovation in a large emerging economy. I discuss some solutions and report on how we solved the problem only to be faced with newer challenges. A methodological design is a challenging endeavor in the normal of time, when it comes to doing the same in a large emerging economy the problems becomes...

  13. Methodological challenges in carbohydrate analyses

    Directory of Open Access Journals (Sweden)

    Mary Beth Hall

    2007-07-01

    Full Text Available Carbohydrates can provide up to 80% of the dry matter in animal diets, yet their specific evaluation for research and diet formulation is only now becoming a focus in the animal sciences. Partitioning of dietary carbohydrates for nutritional purposes should reflect differences in digestion and fermentation characteristics and effects on animal performance. Key challenges to designating nutritionally important carbohydrate fractions include classifying the carbohydrates in terms of nutritional characteristics, and selecting analytical methods that describe the desired fraction. The relative lack of information on digestion characteristics of various carbohydrates and their interactions with other fractions in diets means that fractions will not soon be perfectly established. Developing a system of carbohydrate analysis that could be used across animal species could enhance the utility of analyses and amount of data we can obtain on dietary effects of carbohydrates. Based on quantities present in diets and apparent effects on animal performance, some nutritionally important classes of carbohydrates that may be valuable to measure include sugars, starch, fructans, insoluble fiber, and soluble fiber. Essential to selection of methods for these fractions is agreement on precisely what carbohydrates should be included in each. Each of these fractions has analyses that could potentially be used to measure them, but most of the available methods have weaknesses that must be evaluated to see if they are fatal and the assay is unusable, or if the assay still may be made workable. Factors we must consider as we seek to analyze carbohydrates to describe diets: Does the assay accurately measure the desired fraction? Is the assay for research, regulatory, or field use (affects considerations of acceptable costs and throughput? What are acceptable accuracy and variability of measures? Is the assay robust (enhances accuracy of values? For some carbohydrates, we

  14. Progress and challenges in the development and qualification of multi-level multi-physics coupled methodologies for reactor analysis

    International Nuclear Information System (INIS)

    Ivanov, K.; Avramova, M.

    2007-01-01

    Current trends in nuclear power generation and regulation as well as the design of next generation reactor concepts along with the continuing computer technology progress stimulate the development, qualification and application of multi-physics multi-scale coupled code systems. The efforts have been focused on extending the analysis capabilities by coupling models, which simulate different phenomena or system components, as well as on refining the scale and level of detail of the coupling. This paper reviews the progress made in this area and outlines the remaining challenges. The discussion is illustrated with examples based on neutronics/thermohydraulics coupling in the reactor core modeling. In both fields recent advances and developments are towards more physics-based high-fidelity simulations, which require implementation of improved and flexible coupling methodologies. First, the progresses in coupling of different physics codes along with the advances in multi-level techniques for coupled code simulations are discussed. Second, the issues related to the consistent qualification of coupled multi-physics and multi-scale code systems for design and safety evaluation are presented. The increased importance of uncertainty and sensitivity analysis are discussed along with approaches to propagate the uncertainty quantification between the codes. The incoming OECD LWR Uncertainty Analysis in Modeling (UAM) benchmark is the first international activity to address this issue and it is described in the paper. Finally, the remaining challenges with multi-physics coupling are outlined. (authors)

  15. Progress and challenges in the development and qualification of multi-level multi-physics coupled methodologies for reactor analysis

    Energy Technology Data Exchange (ETDEWEB)

    Ivanov, K.; Avramova, M. [Pennsylvania State Univ., University Park, PA (United States)

    2007-07-01

    Current trends in nuclear power generation and regulation as well as the design of next generation reactor concepts along with the continuing computer technology progress stimulate the development, qualification and application of multi-physics multi-scale coupled code systems. The efforts have been focused on extending the analysis capabilities by coupling models, which simulate different phenomena or system components, as well as on refining the scale and level of detail of the coupling. This paper reviews the progress made in this area and outlines the remaining challenges. The discussion is illustrated with examples based on neutronics/thermohydraulics coupling in the reactor core modeling. In both fields recent advances and developments are towards more physics-based high-fidelity simulations, which require implementation of improved and flexible coupling methodologies. First, the progresses in coupling of different physics codes along with the advances in multi-level techniques for coupled code simulations are discussed. Second, the issues related to the consistent qualification of coupled multi-physics and multi-scale code systems for design and safety evaluation are presented. The increased importance of uncertainty and sensitivity analysis are discussed along with approaches to propagate the uncertainty quantification between the codes. The incoming OECD LWR Uncertainty Analysis in Modeling (UAM) benchmark is the first international activity to address this issue and it is described in the paper. Finally, the remaining challenges with multi-physics coupling are outlined. (authors)

  16. Methodological update in Medicina Intensiva.

    Science.gov (United States)

    García Garmendia, J L

    2018-04-01

    Research in the critically ill is complex by the heterogeneity of patients, the difficulties to achieve representative sample sizes and the number of variables simultaneously involved. However, the quantity and quality of records is high as well as the relevance of the variables used, such as survival. The methodological tools have evolved to offering new perspectives and analysis models that allow extracting relevant information from the data that accompanies the critically ill patient. The need for training in methodology and interpretation of results is an important challenge for the intensivists who wish to be updated on the research developments and clinical advances in Intensive Medicine. Copyright © 2017 Elsevier España, S.L.U. y SEMNIM. All rights reserved.

  17. Scenario aggregation and analysis via Mean-Shift Methodology

    International Nuclear Information System (INIS)

    Mandelli, D.; Yilmaz, A.; Metzroth, K.; Aldemir, T.; Denning, R.

    2010-01-01

    A new generation of dynamic methodologies is being developed for nuclear reactor probabilistic risk assessment (PRA) which explicitly account for the time element in modeling the probabilistic system evolution and use numerical simulation tools to account for possible dependencies between failure events. The dynamic event tree (DET) approach is one of these methodologies. One challenge with dynamic PRA methodologies is the large amount of data they produce which may be difficult to analyze without appropriate software tools. The concept of 'data mining' is well known in the computer science community and several methodologies have been developed in order to extract useful information from a dataset with a large number of records. Using the dataset generated by the DET analysis of the reactor vessel auxiliary cooling system (RVACS) of an ABR-1000 for an aircraft crash recovery scenario and the Mean-Shift Methodology for data mining, it is shown how clusters of transients with common characteristics can be identified and classified. (authors)

  18. How to emerge from the conservatism in clinical research methodology?

    Science.gov (United States)

    Kotecki, Nuria; Penel, Nicolas; Awada, Ahmad

    2017-09-01

    Despite recent changes in clinical research methodology, many challenges remain in drug development methodology. Advances in molecular biology and cancer treatments have changed the clinical research landscape. Thus, we moved from empirical clinical oncology to molecular and immunological therapeutic approaches. Along with this move, adapted dose-limiting toxicities definitions, endpoints, and dose escalation methods have been proposed. Moreover, the classical frontier between phase I, phase II, and phase III has become unclear in particular for immunological approaches. So, investigators are facing major challenges in drug development methodology. We propose to individualize clinical research using innovative approaches to significantly improve patient outcomes and targeting what is considered unmet need. Integrating high level of translational research and performing well designed biomarker studies with great potential for clinical practice are of utmost importance. This could be performed within new models of clinical research networks and by building a strong collaboration between academic, cooperative groups, on-site investigators, and pharma.

  19. Management of disasters and complex emergencies in Africa: The challenges and constraints.

    Science.gov (United States)

    Aliyu, Alhaji

    2015-01-01

    Natural and man-made catastrophes have caused significant destruction and loss of lives throughout human history. Disasters accompany a wide variety of events with multiple causes and consequences often leading to a cascade of related events. African continent has not been spared of these events. A new phenomenon in the continent is terrorism that is fuelled by globalization of arms trade and has contributed significantly to escalation of conflicts in sub-Saharan Africa (SSA) resulting in complex emergencies and destruction of socioeconomic structures. The aim of this paper is to review relevant papers on management of disasters and complex emergencies in Africa and the challenges and constraints against the background of a weakened health system. Systematic search of published literature was conducted between 1990 and 2013. Grey literature (technical reports, government documents), published peer review journals, abstracts, relevant books and internet articles were reviewed. The review revealed that the frequency of both natural and man-made disasters in Africa is escalating. Complex emergencies are also on the increase since the Rwandan crisis in 1994. The impact of these events has overstretched and overwhelmed the health care system that is least prepared to handle and cope with the surge capacity and also render normal services. In conclusion, there is an urgent need for national emergency agencies/departments across Africa to develop a robust emergency preparedness and response plan. Every hospital most have a disaster management committee with flexible disaster management plan to respond to these catastrophes. There is a need for curriculum review in tertiary institutions across SSA to introduce and or expand training in disaster management.

  20. An adaptive process-based cloud infrastructure for space situational awareness applications

    Science.gov (United States)

    Liu, Bingwei; Chen, Yu; Shen, Dan; Chen, Genshe; Pham, Khanh; Blasch, Erik; Rubin, Bruce

    2014-06-01

    Space situational awareness (SSA) and defense space control capabilities are top priorities for groups that own or operate man-made spacecraft. Also, with the growing amount of space debris, there is an increase in demand for contextual understanding that necessitates the capability of collecting and processing a vast amount sensor data. Cloud computing, which features scalable and flexible storage and computing services, has been recognized as an ideal candidate that can meet the large data contextual challenges as needed by SSA. Cloud computing consists of physical service providers and middleware virtual machines together with infrastructure, platform, and software as service (IaaS, PaaS, SaaS) models. However, the typical Virtual Machine (VM) abstraction is on a per operating systems basis, which is at too low-level and limits the flexibility of a mission application architecture. In responding to this technical challenge, a novel adaptive process based cloud infrastructure for SSA applications is proposed in this paper. In addition, the details for the design rationale and a prototype is further examined. The SSA Cloud (SSAC) conceptual capability will potentially support space situation monitoring and tracking, object identification, and threat assessment. Lastly, the benefits of a more granular and flexible cloud computing resources allocation are illustrated for data processing and implementation considerations within a representative SSA system environment. We show that the container-based virtualization performs better than hypervisor-based virtualization technology in an SSA scenario.

  1. Campus Retrofitting (CARE) Methodology: A Way to Co-Create Future Learning Environments

    DEFF Research Database (Denmark)

    Nenonen, Suvi; Eriksson, Robert; Niemi, Olli

    2016-01-01

    (CARE)- methodology for user-centric and co- creative campus retrofitting processes. The campus development research in Nordic countries and co-creation in retrofitting processes are discussed. The campus retrofitting cases in different countries are described by emphasising especially the methods...... of resources in form of both teachers and university facilities is challenged by development of integration of learning, teaching and the spaces where it takes place. The challenges are shared among users and owners of campus, where retrofitting is needed too. This paper aims to describe Campus Retrofitting...... they used. Based on the analysis of the methods the framework for Campus retrofitting (CARE) - methodology is presented and discussed. CARE-methodology is a tool to capture new logic to learning environment design. It has three key activities: co-creating, co-financing and co-evaluating. The integrated...

  2. Methodology Development and Applications of Proliferation Resistance and Physical Protection Evaluation

    International Nuclear Information System (INIS)

    Bari, R.A.; Peterson, P.F.; Therios, I.U.; Whitlock, J.J.

    2010-01-01

    We present an overview of the program on the evaluation methodology for proliferation resistance and physical protection (PR and PP) of advanced nuclear energy systems (NESs) sponsored by the Generation IV International Forum (GIF). For a proposed NES design, the methodology defines a set of challenges, analyzes system response to these challenges, and assesses outcomes. The challenges to the NES are the threats posed by potential actors (proliferant States or sub-national adversaries). The characteristics of Generation IV systems, both technical and institutional, are used to evaluate the response of the system and to determine its resistance against proliferation threats and robustness against sabotage and terrorism threats. The outcomes of the system response are expressed in terms of a set of measures, which are the high-level PR and PP characteristics of the NES. The methodology is organized to allow evaluations to be performed at the earliest stages of system design and to become more detailed and more representative as the design progresses. It can thus be used to enable a program in safeguards by design or to enhance the conceptual design process of an NES with regard to intrinsic features for PR and PP.

  3. Methodology for evaluation of industrial CHP production

    International Nuclear Information System (INIS)

    Pavlovic, Nenad V.; Studovic, Milovan

    2000-01-01

    At the end of the century industry switched from exclusive power consumer into power consumer-producer which is one of the players on the deregulated power market. Consequently, goals of industrial plant optimization have to be changed, making new challenges that industrial management has to be faced with. In the paper is reviewed own methodology for evaluation of industrial power production on deregulated power market. The methodology recognizes economic efficiency of industrial CHP facilities as a main criterion for evaluation. Energy and ecological efficiency are used as additional criteria, in which implicit could be found social goals. Also, methodology recognizes key and limit factors for CHP production in industry. It could be successful applied, by use of available commercial software for energy simulation in CHP plants and economic evaluation. (Authors)

  4. Methodological Challenges of Identifying Ultimate Land Use Changes Caused by Biofuel Production

    DEFF Research Database (Denmark)

    Wenzel, Henrik; Kløverpris, Jesper; Nielsen, Per Henning

    2007-01-01

    that is only poorly dealt with by LCA methods. Even though the use of land, or change of land cover and its eco-systems, is acknowledged to be a very important impact of human activities, a methodology for assessing this impact category has not yet  been properly developed within LCA. Some LCA scientists have...... looked into methods for assessing the impacts of given changes of land use, i.e. the impact assessment component of the LCA, but very few have looked into how to actually do the inventory modelling, i.e. how to identify which land is ultimately affected by the decision and system under study. State...... in the systems being studied. The aims of this paper is to analyse the mechanisms influencing the long-term land use consequences of changes in crop demand and propose a methodological framework for identifying these consequences within a global scope. The outset of the paper is the principles of consequential...

  5. Canonical duality theory unified methodology for multidisciplinary study

    CERN Document Server

    Latorre, Vittorio; Ruan, Ning

    2017-01-01

    This book on canonical duality theory provides a comprehensive review of its philosophical origin, physics foundation, and mathematical statements in both finite- and infinite-dimensional spaces. A ground-breaking methodological theory, canonical duality theory can be used for modeling complex systems within a unified framework and for solving a large class of challenging problems in multidisciplinary fields in engineering, mathematics, and the sciences. This volume places a particular emphasis on canonical duality theory’s role in bridging the gap between non-convex analysis/mechanics and global optimization.  With 18 total chapters written by experts in their fields, this volume provides a nonconventional theory for unified understanding of the fundamental difficulties in large deformation mechanics, bifurcation/chaos in nonlinear science, and the NP-hard problems in global optimization. Additionally, readers will find a unified methodology and powerful algorithms for solving challenging problems in comp...

  6. 4STAR Sky-Scanning Retrievals of Aerosol Intensive Optical Properties from Multiple Field Campaigns with Detailed Comparisons of SSA Reported During SEAC4RS

    Science.gov (United States)

    Flynn, Connor; Dahlgren, R. P.; Dunagan, S.; Johnson, R.; Kacenelenbogen, M.; LeBlanc, S.; Livingston, J.; Redemann, J.; Schmid, B.; Segal Rozenhaimer, M.; hide

    2015-01-01

    The 4STAR (Spectrometer for Sky-Scanning, Sun-Tracking Atmospheric Research) instrument combines airborne sun tracking capabilities of the Ames Airborne Tracking Sun Photometer (AATS-14) with AERONET-like sky-scanning capability and adds state-of-the-art fiber-coupled grating spectrometry to yield hyper spectral measurements of direct solar irradiance and angularly resolved sky radiance. The combination of sun-tracking and sky-scanning capability enables retrievals of wavelength-dependent aerosol optical depth (AOD), mode-resolved aerosol size distribution (SD), asphericity, and complex refractive index, and thus also the scattering phase function, asymmetry parameter, single-scattering albedo (SSA), and absorption aerosol optical thickness (AAOT).From 2012 to 2014 4STAR participated in four major field campaigns: the U.S. Dept. of Energy TCAP I II campaigns, and NASAs SEAC4RS and ARISE campaigns. Establishing a strong performance record, 4STAR operated successfully on all flights conducted during each of these campaigns. Sky radiance spectra from scans in either constant azimuth (principal plane) or constant zenith angle (almucantar) were interspersed with direct beam measurements during level legs. During SEAC4RS and ARISE, 4STAR airborne measurements were augmented with flight-level albedo from the collocated Shortwave Spectral Flux Radiometer (SSFR) providing improved specification of below-aircraft radiative conditions for the retrieval. Calibrated radiances and retrieved products will be presented with particular emphasis on detailed comparisons of ambient SSA retrievals and measurements during SEAC4RS from 4STAR, AERONET, HSRL2, and from in situ measurements.

  7. The Child as a Surrogate for Diagnosis of Lupus in the Mother

    OpenAIRE

    Adelowo, Olufemi O.; Ohagwu, Kenneth A.; Aigbokhan, Ejiehi E.; Akintayo, Richard O.

    2017-01-01

    Introduction. Neonatal lupus erythematosus (NLE) is an acquired disease of the newborn caused by transplacental transfer of maternal anti-Ro/SSA, anti-La/SSB, and infrequently anti-U1 RNP antibodies. Methodology. This is a case report of a male infant delivered via Caesarean section at 36-week gestation following detection of fetal bradycardia during routine antenatal clinic visit. Results. The mother was seropositive for antinuclear antibody (ANA) and anti-Ro/SSA and had elevated erythrocyte...

  8. Gene Signature in Sessile Serrated Polyps Identifies Colon Cancer Subtype

    Science.gov (United States)

    Kanth, Priyanka; Bronner, Mary P.; Boucher, Kenneth M.; Burt, Randall W.; Neklason, Deborah W.; Hagedorn, Curt H.; Delker, Don A.

    2016-01-01

    Sessile serrated colon adenoma/polyps (SSA/Ps) are found during routine screening colonoscopy and may account for 20–30% of colon cancers. However, differentiating SSA/Ps from hyperplastic polyps (HP) with little risk of cancer is challenging and complementary molecular markers are needed. Additionally, the molecular mechanisms of colon cancer development from SSA/Ps are poorly understood. RNA sequencing was performed on 21 SSA/Ps, 10 HPs, 10 adenomas, 21 uninvolved colon and 20 control colon specimens. Differential expression and leave-one-out cross validation methods were used to define a unique gene signature of SSA/Ps. Our SSA/P gene signature was evaluated in colon cancer RNA-Seq data from The Cancer Genome Atlas (TCGA) to identify a subtype of colon cancers that may develop from SSA/Ps. A total of 1422 differentially expressed genes were found in SSA/Ps relative to controls. Serrated polyposis syndrome (n=12) and sporadic SSA/Ps (n=9) exhibited almost complete (96%) gene overlap. A 51-gene panel in SSA/P showed similar expression in a subset of TCGA colon cancers with high microsatellite instability (MSI-H). A smaller seven-gene panel showed high sensitivity and specificity in identifying BRAF mutant, CpG island methylator phenotype high (CIMP-H) and MLH1 silenced colon cancers. We describe a unique gene signature in SSA/Ps that identifies a subset of colon cancers likely to develop through the serrated pathway. These gene panels may be utilized for improved differentiation of SSA/Ps from HPs and provide insights into novel molecular pathways altered in colon cancer arising from the serrated pathway. PMID:27026680

  9. A review of multi-risk methodologies for natural hazards: Consequences and challenges for a climate change impact assessment.

    Science.gov (United States)

    Gallina, Valentina; Torresan, Silvia; Critto, Andrea; Sperotto, Anna; Glade, Thomas; Marcomini, Antonio

    2016-03-01

    This paper presents a review of existing multi-risk assessment concepts and tools applied by organisations and projects providing the basis for the development of a multi-risk methodology in a climate change perspective. Relevant initiatives were developed for the assessment of multiple natural hazards (e.g. floods, storm surges, droughts) affecting the same area in a defined timeframe (e.g. year, season, decade). Major research efforts were focused on the identification and aggregation of multiple hazard types (e.g. independent, correlated, cascading hazards) by means of quantitative and semi-quantitative approaches. Moreover, several methodologies aim to assess the vulnerability of multiple targets to specific natural hazards by means of vulnerability functions and indicators at the regional and local scale. The overall results of the review show that multi-risk approaches do not consider the effects of climate change and mostly rely on the analysis of static vulnerability (i.e. no time-dependent vulnerabilities, no changes among exposed elements). A relevant challenge is therefore to develop comprehensive formal approaches for the assessment of different climate-induced hazards and risks, including dynamic exposure and vulnerability. This requires the selection and aggregation of suitable hazard and vulnerability metrics to make a synthesis of information about multiple climate impacts, the spatial analysis and ranking of risks, including their visualization and communication to end-users. To face these issues, climate impact assessors should develop cross-sectorial collaborations among different expertise (e.g. modellers, natural scientists, economists) integrating information on climate change scenarios with sectorial climate impact assessment, towards the development of a comprehensive multi-risk assessment process. Copyright © 2015 Elsevier Ltd. All rights reserved.

  10. Themes and challenges in making supply chains socially sustainable

    DEFF Research Database (Denmark)

    Abbasi, Maisam

    2014-01-01

    Purpose Purpose of this paper is to explore and classify pattern of the currently discussed themes and challenges in making supply chains socially sustainable. Design/methodology/approach The methodology was based on a systematic review of the existing literature in order to explore what major...... themes and challenges have been discussed as well as the significant gaps where opportunities for further research can be found. Findings In total five categories of themes were identified, namely goods/service-centric, human-centric, organization-centric, corporate-centric, and management...... holistic view of the pattern of currently discussed themes and challenges may be beneficial in increasing the absorptive capacity of industrial and business practitioners when they design and operationalize innovative strategies in developing sustainable supply chains. Originality/value This paper may...

  11. Collaboration challenges in systematic reviews: a survey of health sciences librarians.

    Science.gov (United States)

    Nicholson, Joey; McCrillis, Aileen; Williams, Jeff D

    2017-10-01

    While many librarians have been asked to participate in systematic reviews with researchers, often these researchers are not familiar with the systematic review process or the appropriate role for librarians. The purpose of this study was to identify the challenges and barriers that librarians face when collaborating on systematic reviews. To take a wider view of the whole process of collaborating on systematic reviews, the authors deliberately focused on interpersonal and methodological issues other than searching itself. To characterize the biggest challenges that librarians face while collaborating on systematic review projects, we used a web-based survey. The thirteen-item survey included seventeen challenges grouped into two categories: methodological and interpersonal. Participants were required to indicate the frequency and difficulty of the challenges listed. Open-ended questions allowed survey participants to describe challenges not listed in the survey and to describe strategies used to overcome challenges. Of the 17 challenges listed in the survey, 8 were reported as common by over 40% of respondents. These included methodological issues around having too broad or narrow research questions, lacking eligibility criteria, having unclear research questions, and not following established methods. The remaining challenges were interpersonal, including issues around student-led projects and the size of the research team. Of the top 8 most frequent challenges, 5 were also ranked as most difficult to handle. Open-ended responses underscored many of the challenges included in the survey and revealed several additional challenges. These results suggest that the most frequent and challenging issues relate to development of the research question and general communication with team members. Clear protocols for collaboration on systematic reviews, as well as a culture of mentorship, can help librarians prevent and address these challenges.

  12. Perception-oriented methodology for robust motion estimation design

    NARCIS (Netherlands)

    Heinrich, A.; Vleuten, van der R.J.; Haan, de G.

    2014-01-01

    Optimizing a motion estimator (ME) for picture rate conversion is challenging. This is because there are many types of MEs and, within each type, many parameters, which makes subjective assessment of all the alternatives impractical. To solve this problem, we propose an automatic design methodology

  13. Adding fuel to the fire: alcohol's effect on the HIV epidemic in Sub-Saharan Africa.

    Science.gov (United States)

    Hahn, Judith A; Woolf-King, Sarah E; Muyindike, Winnie

    2011-09-01

    Alcohol consumption adds fuel to the HIV epidemic in sub-Saharan Africa (SSA). SSA has the highest prevalence of HIV infection and heavy episodic drinking in the world. Alcohol consumption is associated with behaviors such as unprotected sex and poor medication adherence, and biological factors such as increased susceptibility to infection, comorbid conditions, and infectiousness, which may synergistically increase HIV acquisition and onward transmission. Few interventions to decrease alcohol consumption and alcohol-related sexual risk behaviors have been developed or implemented in SSA, and few HIV or health policies or services in SSA address alcohol consumption. Structural interventions, such as regulating the availability, price, and advertising of alcohol, are challenging to implement due to the preponderance of homemade alcohol and beverage industry resistance. This article reviews the current knowledge on how alcohol impacts the HIV epidemic in SSA, summarizes current interventions and policies, and identifies areas for increased research and development.

  14. Methodological Reflections: Inter- ethnic Research

    DEFF Research Database (Denmark)

    Singla, Rashmi

    2010-01-01

    with both youth and the parental generation with ethnic minority background in Denmark. These reflections include implications and challenges related to researcher’s national, ethnic background and educational, professional position in encounter with   diverse ‘researched persons’ such as youth......This article reflects on the methodological and epistemological aspects of the ethical issues involved in encounters between researcher and research participants with ethnic minority background in contexts with diversity. Specific challenges involved in longitudinal research (10 - 15 years......) are also considered. The issues related to the social relevance of the research deriving from psycho political validity implying consideration of power dynamics in the personal, relational and collective domains are included. The primary basis for these reflections is a follow-up study concerning young...

  15. Emerging Concepts and Methodologies in Cancer Biomarker Discovery.

    Science.gov (United States)

    Lu, Meixia; Zhang, Jinxiang; Zhang, Lanjing

    2017-01-01

    Cancer biomarker discovery is a critical part of cancer prevention and treatment. Despite the decades of effort, only a small number of cancer biomarkers have been identified for and validated in clinical settings. Conceptual and methodological breakthroughs may help accelerate the discovery of additional cancer biomarkers, particularly their use for diagnostics. In this review, we have attempted to review the emerging concepts in cancer biomarker discovery, including real-world evidence, open access data, and data paucity in rare or uncommon cancers. We have also summarized the recent methodological progress in cancer biomarker discovery, such as high-throughput sequencing, liquid biopsy, big data, artificial intelligence (AI), and deep learning and neural networks. Much attention has been given to the methodological details and comparison of the methodologies. Notably, these concepts and methodologies interact with each other and will likely lead to synergistic effects when carefully combined. Newer, more innovative concepts and methodologies are emerging as the current emerging ones became mainstream and widely applied to the field. Some future challenges are also discussed. This review contributes to the development of future theoretical frameworks and technologies in cancer biomarker discovery and will contribute to the discovery of more useful cancer biomarkers.

  16. The Effect of External Debt on Economic Growth in Sub-Saharan Africa

    Directory of Open Access Journals (Sweden)

    Bernardin Senadza

    2018-01-01

    Full Text Available Purpose: This paper examines the effect of external debt on economic growth in Sub-Saharan Africa (SSA in view of an upsurge in the level of external debt in many countries on the continent. Design/methodology/approach: The paper uses annual data for 39 SSA countries from 1990 to 2013 and employs the System Generalised Methods of Moments (GMM estimation technique. Findings: The paper finds that external debt negatively affects economic growth in SSA. Categorization of countries based on per capita income however does not affect the external debt-growth nexus, neither does there exist a non-linear relationship between external debt and economic growth. Research limitations/implications: The finding of a negative relationship between external debt and growth does not necessarily imply that SSA countries should cut back on foreign borrowing in other to boost growth. Rather, given the huge savings gaps in some of the countries, what governments in SSA must do is to ensure that the foreign loans are invested in projects that would eventually generate enough returns to amortize the debt. Originality/value: Not only does the present paper extend to more recent data but we also apply one of the frontier econometric techniques - the system GMM approach - to unravel the external debt-economic growth dynamics in SSA.

  17. Cochrane Rehabilitation Methodology Committee: an international survey of priorities for future work.

    Science.gov (United States)

    Levack, William M; Meyer, Thorsten; Negrini, Stefano; Malmivaara, Antti

    2017-10-01

    Cochrane Rehabilitation aims to improve the application of evidence-based practice in rehabilitation. It also aims to support Cochrane in the production of reliable, clinically meaningful syntheses of evidence related to the practice of rehabilitation, while accommodating the many methodological challenges facing the field. To this end, Cochrane Rehabilitation established a Methodology Committee to examine, explore and find solutions for the methodological challenges related to evidence synthesis and knowledge translation in rehabilitation. We conducted an international online survey via Cochrane Rehabilitation networks to canvass opinions regarding the future work priorities for this committee and to seek information on people's current capabilities to assist with this work. The survey findings indicated strongest interest in work on how reviewers have interpreted and applied Cochrane methods in reviews on rehabilitation topics in the past, and on gathering a collection of existing publications on review methods for undertaking systematic reviews relevant to rehabilitation. Many people are already interested in contributing to the work of the Methodology Committee and there is a large amount of expertise for this work in the extended Cochrane Rehabilitation network already.

  18. Can baroreflex measurements with spontaneous sequence analysis be improved by also measuring breathing and by standardization of filtering strategies?

    International Nuclear Information System (INIS)

    Hollow, M R; Parkes, M J; Clutton-Brock, T H

    2011-01-01

    Baroreflex sensitivity (BRS) is known to be attenuated by inspiration and all the original BRS methodologies took this into account by measuring only in expiration. Spontaneous sequence analysis (SSA) is a non-invasive clinical tool widely used to estimate BRS in Man but does not take breathing into account. We have therefore modified it to test whether it too can detect inspiratory attenuation. Traditional SSA is also entangled with issues of distinguishing causal from random relationships between blood pressure and heart period and of the optimum choice of data filter settings. We have also tested whether the sequences our modified SSA rejects do behave as random relationships and show the limitations of the absence of filter standardization. SSA was performed on eupneic data from 1 h periods in 20 healthy subjects. Applying SSA traditionally produced a mean BRS of 23 ± 3 ms mmHg −1 . After modification to measure breathing, SSA detected significant inspiratory attenuation (11 ± 1 ms mmHg −1 ), and the mean expiratory BRS was significantly higher (26 ± 5 ms mmHg −1 ). Traditional SSA therefore underestimates BRS by an amount (3 ms mmHg −1 ) as big as the major physiological and clinical factors known to alter BRS. We show that the sequences rejected by SSA do behave like random associations between pressure and period. We also show the minimal effect of the r 2 filter and the biases that some pressure and heart period filters can introduce. We discuss whether SSA might be improved by standardization of filter settings and by also measuring breathing

  19. Methodology of teaching and new challenges in the training of professionals in the area of industrial radiology

    International Nuclear Information System (INIS)

    Lima, C.M. Araujo; Pelegrineli, S.Q.; Lima, A.R.

    2017-01-01

    One of the main causes of radiological accidents is the lack of knowledge in radiological protection of workers. In order to meet the needs of professionals in radiology techniques in training in industrial radiology and radiological protection, the Training Course in Industrial Radiology was created in 2009 by MAXIM, in partnership with the Casa Branca Faculty. The objective is to present the structure and methodology of teaching used in this course to reach the objectives of training professionals with solid knowledge in industrial radiology, as well as to mention the challenges of this training. For the elaboration of the study, a statistical data base and theoretical analysis of the teaching structure of the course was used. Professional training in industrial radiology is subdivided into basic, specific, practical and complementary modules, totaling a workload of 360 hours. It is noted that most of the professionals trained come from the great urban centers of the country, favoring employability in the port terminals and industries that are located in these regions. It is concluded, therefore, that it is necessary and of great importance for the growing industrial market, the formation of new professionals, mainly in cities of the interior

  20. Methodology for Measuring the Complexity of Enterprise Information Systems

    Directory of Open Access Journals (Sweden)

    Ilja Holub

    2016-07-01

    Full Text Available The complexity of enterprise information systems is currently a challenge faced not only by IT professionals and project managers, but also by the users of such systems. Current methodologies and frameworks used to design and implement information systems do not specifically deal with the issue of their complexity and, apart from few exceptions, do not at all attempt to simplify the complexity. This article presents the author's own methodology for managing complexity, which can be used to complement any other methodology and which helps limit the growth of complexity. It introduces its own definition and metric of complexity, which it defines as the sum of entities of the individual UML models of the given system, which are selected according to the MMDIS methodology so as to consistently describe all relevant content dimensions of the system. The main objective is to propose a methodology to manage information system complexity and to verify it in practice on a real-life SAP implementation project.

  1. The Virtual Observatory Service TheoSSA: Establishing a Database of Synthetic Stellar Flux Standards I. NLTE Spectral Analysis of the DA-Type White Dwarf G191-B2B *,**,***,****

    Science.gov (United States)

    Rauch, T.; Werner, K.; Bohlin, R.; Kruk, J. W.

    2013-01-01

    Hydrogen-rich, DA-type white dwarfs are particularly suited as primary standard stars for flux calibration. State-of-the-art NLTE models consider opacities of species up to trans-iron elements and provide reliable synthetic stellar-atmosphere spectra to compare with observations. Aims. We will establish a database of theoretical spectra of stellar flux standards that are easily accessible via a web interface. Methods. In the framework of the Virtual Observatory, the German Astrophysical Virtual Observatory developed the registered service TheoSSA. It provides easy access to stellar spectral energy distributions (SEDs) and is intended to ingest SEDs calculated by any model-atmosphere code. In case of the DA white dwarf G191-B2B, we demonstrate that the model reproduces not only its overall continuum shape but also the numerous metal lines exhibited in its ultraviolet spectrum. Results. TheoSSA is in operation and contains presently a variety of SEDs for DA-type white dwarfs. It will be extended in the near future and can host SEDs of all primary and secondary flux standards. The spectral analysis of G191-B2B has shown that our hydrostatic models reproduce the observations best at Teff =60 000 +/- 2000K and log g=7.60 +/- 0.05.We newly identified Fe vi, Ni vi, and Zn iv lines. For the first time, we determined the photospheric zinc abundance with a logarithmic mass fraction of -4.89 (7.5 × solar). The abundances of He (upper limit), C, N, O, Al, Si, O, P, S, Fe, Ni, Ge, and Sn were precisely determined. Upper abundance limits of about 10% solar were derived for Ti, Cr, Mn, and Co. Conclusions. The TheoSSA database of theoretical SEDs of stellar flux standards guarantees that the flux calibration of all astronomical data and cross-calibration between different instruments can be based on the same models and SEDs calculated with different model-atmosphere codes and are easy to compare.

  2. Customer satisfaction surveys: Methodological recommendations for financial service providers

    Directory of Open Access Journals (Sweden)

    Đorđić Marko

    2010-01-01

    Full Text Available This methodological article investigates practical challenges that emerge when conducting customer satisfaction surveys (CSS for financial service providers such as banks, insurance or leasing companies, and so forth. It displays methodological recommendations in reference with: (a survey design, (b sampling, (c survey method, (d questionnaire design, and (e data acquisition. Article provides appropriate explanations that usage of: two-stage survey design, SRS method, large samples, and rigorous fieldwork preparation can enhance the overall quality of CSS in financial services. Proposed methodological recommendations can primarily be applied to the primary quantitative marketing research in retail financial services. However, majority of them can be successfully applied when conducting primary quantitative marketing research in corporate financial services as well. .

  3. BOREAS AFM-08 ECMWF Hourly Surface and Upper Air Data for the SSA and NSA

    Science.gov (United States)

    Viterbo, Pedro; Betts, Alan; Hall, Forrest G. (Editor); Newcomer, Jeffrey A.; Smith, David E. (Technical Monitor)

    2000-01-01

    The Boreal Ecosystem-Atmosphere Study (BOREAS) Airborne Fluxes and Meteorology (AFM)-8 team focused on modeling efforts to improve the understanding of the diurnal evolution of the convective boundary layer over the boreal forest. This data set contains hourly data from the European Center for for Medium-Range Weather Forecasts (ECMWF) operational model from below the surface to the top of the atmosphere, including the model fluxes at the surface. Spatially, the data cover a pair of the points that enclose the rawinsonde sites at Candle Lake, Saskatchewan, in the Southern Study Area (SSA) and Thompson, Manitoba, in the Northern Study Area (NSA). Temporally, the data include the two time periods of 13 May 1994 to 30 Sept 1994 and 01 Mar 1996 to 31 Mar 1997. The data are stored in tabular ASCII files. The number of records in the upper air data files may exceed 20,000, causing a problem for some software packages. The ECMWF hourly surface and upper air data are available from the Earth Observing System Data and Information System (EOSDIS) Oak Ridge National Laboratory (ORNL) Distributed Active Archive Center (DAAC). The data files are available on a CD-ROM (see document number 20010000884).

  4. Identification of Nigerian English idioms: A methodological perspective

    African Journals Online (AJOL)

    The task becomes more challenging when the feature of interest involves figurative meaning such as idioms and idiomatic expressions. In a recently completed project that sought to examine idioms in Nigerian English, questions and issues about methodology were raised. Among these were the questions of how idioms in ...

  5. Toward "Age-Friendly Slums"? Health Challenges of Older Slum Dwellers in Nairobi and the Applicability of the Age-Friendly City Approach.

    Science.gov (United States)

    Aboderin, Isabella; Kano, Megumi; Owii, Hilda Akinyi

    2017-10-20

    A majority of urban residents in sub-Saharan Africa (SSA) and other developing regions live in informal settlements, or slums. Much of the discourse on slum health centres on younger generations, while an intensifying agenda on healthy ageing as yet lacks a systematic focus on slums. Similarly, the global age-friendly cities (AFC) movement does not, thus far, extend to slums. This paper examines the particular challenges that a slum-focused age-friendly initiative in SSA may need to address, and the relevance of present AFC indicators and domains for initiatives to advance the health and well-being of older slum dwellers. The analysis builds on the case of two slum communities in Nairobi, Kenya. It analyzes two bodies of relevant evidence from these settlements, namely on the health and social circumstances of older residents, and on the local application and measurement of AFC indicators. The findings point to a set of unsurprising, but also less obvious, core health and social adversities that an age-friendly initiative in such settlements would need to consider. The findings show, further, that the current AFC domains and indicators framework only partly capture these adversities, but that there is potential for adapting the framework to be meaningful for slum settings. The paper concludes by underscoring the need for, and opportunities inherent in, the pursuit of an "age-friendly slums" initiative going forward.

  6. HIV Risks, Testing, and Treatment in the Former Soviet Union: Challenges and Future Directions in Research and Methodology.

    Science.gov (United States)

    Saadat, Victoria M

    2015-01-01

    The dissolution of the USSR resulted in independence for constituent republics but left them battling an unstable economic environment and healthcare. Increases in injection drug use, prostitution, and migration were all widespread responses to this transition and have contributed to the emergence of an HIV epidemic in the countries of former Soviet Union. Researchers have begun to identify the risks of HIV infection as well as the barriers to HIV testing and treatment in the former Soviet Union. Significant methodological challenges have arisen and need to be addressed. The objective of this review is to determine common threads in HIV research in the former Soviet Union and provide useful recommendations for future research studies. In this systematic review of the literature, Pubmed was searched for English-language studies using the key search terms "HIV", "AIDS", "human immunodeficiency virus", "acquired immune deficiency syndrome", "Central Asia", "Kazakhstan", "Kyrgyzstan", "Uzbekistan", "Tajikistan", "Turkmenistan", "Russia", "Ukraine", "Armenia", "Azerbaijan", and "Georgia". Studies were evaluated against eligibility criteria for inclusion. Thirty-nine studies were identified across the two main topic areas of HIV risk and barriers to testing and treatment, themes subsequently referred to as "risk" and "barriers". Study design was predominantly cross-sectional. The most frequently used sampling methods were peer-to-peer and non-probabilistic sampling. The most frequently reported risks were condom misuse, risky intercourse, and unsafe practices among injection drug users. Common barriers to testing included that testing was inconvenient, and that results would not remain confidential. Frequent barriers to treatment were based on a distrust in the treatment system. The findings of this review reveal methodological limitations that span the existing studies. Small sample size, cross-sectional design, and non-probabilistic sampling methods were frequently

  7. La violencia en las mujeres usuarias de los servicios de salud en el IMSS y la SSA Violence in Mexican women using public health services

    OpenAIRE

    Héctor Gómez-Dantés; José Luis Vázquez-Martínez; Sonia B Fernández-Cantón

    2006-01-01

    OBJETIVO: Comparar la prevalencia y determinar los factores de riesgo asociados a la violencia entre las mujeres derechohabientes del IMSS y sin servicios de seguridad social (SSS). MATERIAL Y MÉTODOS: Se analizó la información sobre violencia doméstica de la ENVIM notificada por las mujeres usuarias de los servicios de salud del IMSS y de la población femenina sin servicios de seguridad social SSA y seguro popular. El análisis bivariado y multivariado se realizó en STATA V.7. RESULTADOS: La ...

  8. Methodological challenges in measurements of functional ability in gerontological research. A review

    DEFF Research Database (Denmark)

    Avlund, Kirsten

    1997-01-01

    This article addresses two important challenges in the measurement of functional ability in gerontological research: the first challenge is to connect measurements to a theoretical frame of reference which enhances our understanding and interpretation of the collected data; the second relates...... procedure, validity, discriminatory power, and responsiveness. In measures of functional ability it is recommended: 1) always to consider the theoretical frame of reference as part of the validation process (e.g., the theory of "The Disablement Process"; 2) always to assess whether the included activities...

  9. Taking a Distributed Perspective: Epistemological and Methodological Tradeoffs in Operationalizing the Leader-Plus Aspect

    Science.gov (United States)

    Spillane, James P.; Camburn, Eric M.; Pustejovsky, James; Pareja, Amber Stitziel; Lewis, Geoff

    2008-01-01

    Purpose: This paper is concerned with the epistemological and methodological challenges involved in studying the distribution of leadership across people within the school--the leader-plus aspect of a distributed perspective, which it aims to investigate. Design/methodology/approach: The paper examines the entailments of the distributed…

  10. Clinical Studies of Biofield Therapies: Summary, Methodological Challenges, and Recommendations

    Science.gov (United States)

    Hammerschlag, Richard; Mills, Paul; Cohen, Lorenzo; Krieger, Richard; Vieten, Cassandra; Lutgendorf, Susan

    2015-01-01

    Biofield therapies are noninvasive therapies in which the practitioner explicitly works with a client's biofield (interacting fields of energy and information that surround living systems) to stimulate healing responses in patients. While the practice of biofield therapies has existed in Eastern and Western cultures for thousands of years, empirical research on the effectiveness of biofield therapies is still relatively nascent. In this article, we provide a summary of the state of the evidence for biofield therapies for a number of different clinical conditions. We note specific methodological issues for research in biofield therapies that need to be addressed (including practitioner-based, outcomes-based, and research design considerations), as well as provide a list of suggested next steps for biofield researchers to consider. PMID:26665043

  11. Methodological Challenges to Economic Evaluations of Vaccines: Is a Common Approach Still Possible?

    Science.gov (United States)

    Jit, Mark; Hutubessy, Raymond

    2016-06-01

    Economic evaluation of vaccination is a key tool to inform effective spending on vaccines. However, many evaluations have been criticised for failing to capture features of vaccines which are relevant to decision makers. These include broader societal benefits (such as improved educational achievement, economic growth and political stability), reduced health disparities, medical innovation, reduced hospital beds pressures, greater peace of mind and synergies in economic benefits with non-vaccine interventions. Also, the fiscal implications of vaccination programmes are not always made explicit. Alternative methodological frameworks have been proposed to better capture these benefits. However, any broadening of the methodology for economic evaluation must also involve evaluations of non-vaccine interventions, and hence may not always benefit vaccines given a fixed health-care budget. The scope of an economic evaluation must consider the budget from which vaccines are funded, and the decision-maker's stated aims for that spending to achieve.

  12. Toward “Age-Friendly Slums”? Health Challenges of Older Slum Dwellers in Nairobi and the Applicability of the Age-Friendly City Approach

    Science.gov (United States)

    Aboderin, Isabella; Owii, Hilda Akinyi

    2017-01-01

    A majority of urban residents in sub-Saharan Africa (SSA) and other developing regions live in informal settlements, or slums. Much of the discourse on slum health centres on younger generations, while an intensifying agenda on healthy ageing as yet lacks a systematic focus on slums. Similarly, the global age-friendly cities (AFC) movement does not, thus far, extend to slums. This paper examines the particular challenges that a slum-focused age-friendly initiative in SSA may need to address, and the relevance of present AFC indicators and domains for initiatives to advance the health and well-being of older slum dwellers. The analysis builds on the case of two slum communities in Nairobi, Kenya. It analyzes two bodies of relevant evidence from these settlements, namely on the health and social circumstances of older residents, and on the local application and measurement of AFC indicators. The findings point to a set of unsurprising, but also less obvious, core health and social adversities that an age-friendly initiative in such settlements would need to consider. The findings show, further, that the current AFC domains and indicators framework only partly capture these adversities, but that there is potential for adapting the framework to be meaningful for slum settings. The paper concludes by underscoring the need for, and opportunities inherent in, the pursuit of an “age-friendly slums” initiative going forward. PMID:29053576

  13. Development of 3D pseudo pin-by-pin calculation methodology in ANC

    International Nuclear Information System (INIS)

    Zhang, B.; Mayhue, L.; Huria, H.; Ivanov, B.

    2012-01-01

    Advanced cores and fuel assembly designs have been developed to improve operational flexibility, economic performance and further enhance safety features of nuclear power plants. The simulation of these new designs, along with strong heterogeneous fuel loading, have brought new challenges to the reactor physics methodologies currently employed in the industrial codes for core analyses. Control rod insertion during normal operation is one operational feature in the AP1000 R plant of Westinghouse next generation Pressurized Water Reactor (PWR) design. This design improves its operational flexibility and efficiency but significantly challenges the conventional reactor physics methods, especially in pin power calculations. The mixture loading of fuel assemblies with significant neutron spectrums causes a strong interaction between different fuel assembly types that is not fully captured with the current core design codes. To overcome the weaknesses of the conventional methods, Westinghouse has developed a state-of-the-art 3D Pin-by-Pin Calculation Methodology (P3C) and successfully implemented in the Westinghouse core design code ANC. The new methodology has been qualified and licensed for pin power prediction. The 3D P3C methodology along with its application and validation will be discussed in the paper. (authors)

  14. The Challenge of Researching Violent Societies: Navigating Complexities in Ethnography

    Science.gov (United States)

    Tshabangu, Icarbord

    2009-01-01

    Through use of a recent study researching democratic education and citizenship in Zimbabwe, this paper examines the methodological dilemmas and challenges faced by an ethnographer, particularly by a research student in a violent context. The article posits a bricolage strategy to navigate some of the dangers and methodological dilemmas inherent so…

  15. Socioeconomic value of orthopedic devices: evidence and methodological challenges

    Directory of Open Access Journals (Sweden)

    Sorenson C

    2012-10-01

    Full Text Available Corinna Sorenson,1,2 Michael Drummond2,31LSE Health, London School of Economics, London, UK; 2European Health Technology Institute for Socioeconomic Research, Brussels, Belgium; 3Centre for Health Economics, University of York, York, UKAbstract: With continued technological advances in orthopedic devices and increasingly limited health care resources, greater attention will be placed on substantiating the socioeconomic value of these devices. Therefore, this study focused on a systematic review of available economic evaluations of selected orthopedic devices (n = 33 studies to assess their impact on different clinical and economic outcomes. The existing evidence suggests that they have important benefits to patients, including reduced risk of fractures, increased mobility and functioning, and enhanced quality of life, and do so cost effectively or with cost savings. However, we have identified several methodological obstacles to sufficient ascertainment of value, such as a lack of robust information on health economic outcomes and long-term evidence. We also identify areas where additional research is needed to assess more fully the value of orthopedic devices.Keywords: medical devices, orthopedics, health economic evaluation

  16. Benefits and challenges of qualitative methodologies in cross-cultural psychology studies

    NARCIS (Netherlands)

    de Quadros Rigoni, R.

    2016-01-01

    Qualitative research has been considered increasingly valuable for cross-cultural psychology studies, but its contributions and challenges to the field remain under discussed. This chapter does that by analysing a qualitative study which compares interpretive beliefs and behaviour of street-level

  17. Adverse Side Effects of Psychotropic Medication and Challenging Behavior: Pilot Work Assessing Impact.

    Science.gov (United States)

    Valdovinos, Maria G; Schieber, Elizabeth; McMahon, Meara; Beard, Lisa; Wilkinson, Alyssa; Carpenter, Jaimie

    2017-12-01

    Psychotropic medications are often prescribed to reduce challenging behavior in individuals with intellectual and developmental disabilities (IDD). Functional analyses (FAs) have demonstrated utility in assessing medication impact on behavior; however, the impact of adverse side effects (ASE) on challenging behavior is under-assessed. The purpose of this study was to develop a methodology, similar to FAs, to explore potential medication ASE impact on challenging behavior in seven individuals with IDD. Results revealed response rate differences in designed ASE conditions for most participants. Outcomes support further development and use of this methodology to assess the presence and impact of ASEs.

  18. The challenges facing ethnographic design research: A proposed methodological solution

    DEFF Research Database (Denmark)

    Cash, Philip; Hicks, Ben; Culley, Steve

    2009-01-01

    Central to improving and maintaining high levels of performance in emerging ethnographic design research is a fundamental requirement to address some of the problems associated with the subject. In particular seven core issues are identified and include the complexity of test development......, variability of methods, resource intensiveness, subjectivity, comparability, common metrics and industrial acceptance. To address these problems this paper describes a structured methodological approach in which three main areas are proposed, the modularisation of the research process, the standardisation...... of the dataset and the stratification of the research context. The paper then examines the fundamental requirements of this scheme and how these relate to a Design Observatory approach. Following this, the proposed solution is related back to the initial problem set and potential issues are discussed. Finally...

  19. Challenging the Concept of ''informal'' in Sub-Saharan African Cities

    DEFF Research Database (Denmark)

    Eskemose Andersen, Jørgen

    2014-01-01

    Current definitions of urbanity lead to claims that a large proportion (75% according to UN Habitat) of Sub-Saharan Africa’s (SSA) urban population is housed in ‘informal’ settlements with almost all new housing stock provided ‘informally’ in contradiction to the “formal” that is defined as planned......-modern (Folkers 2009, Hardoy 1990, Jenkins 2011, Nielsen 2008, Nguluma 2003, Mitlin, D. 2004, Koolhaas 2006). In 2003 the UN adopted a new terminology for what over decades used to be labelled as ‘informal’-, ‘squatter’-, ‘illegal’-, ‘unplanned’-, ‘spontaneous’ settlements, “shanty towns” with the term “slum” (UN...... habitat 2003). However, defining what slum implies is complex and this author consider the term as prejudiced and not covering the diversity most informal settlements represents Further the term stigmatises a remarkable share of any city population in SSA (Huchzermeyer 2011, Davis 2007, Harber 2011, Garau...

  20. Modeling energy consumption and CO2 emissions at the urban scale: Methodological challenges and insights from the United States

    International Nuclear Information System (INIS)

    Parshall, Lily; Gurney, Kevin; Hammer, Stephen A.; Mendoza, Daniel; Zhou, Yuyu; Geethakumar, Sarath

    2010-01-01

    Local policy makers could benefit from a national, high-resolution inventory of energy consumption and related carbon dioxide (CO 2 ) emissions based on the Vulcan data product, which plots emissions on a 100 km 2 grid. We evaluate the ability of Vulcan to measure energy consumption in urban areas, a scale of analysis required to support goals established as part of local energy, climate or sustainability initiatives. We highlight the methodological challenges of this type of analytical exercise and review alternative approaches. We find that between 37% and 86% of direct fuel consumption in buildings and industry and between 37% and 77% of on-road gasoline and diesel consumption occurs in urban areas, depending on how these areas are defined. We suggest that a county-based definition of urban is preferable to other common definitions since counties are the smallest political unit for which energy data are collected. Urban counties, account for 37% of direct energy consumption, or 50% if mixed urban counties are included. A county-based definition can also improve estimates of per-capita consumption.

  1. VCS-SSA Mainz Experiment. Measurement of the beam spin asymmetry in (e polarized p {yields} ep{gamma}) and (e polarized p {yields} ep{pi}{sup 0}). Final analysis - MEMO I

    Energy Technology Data Exchange (ETDEWEB)

    Fonvieille, H.; Bensafa, I. [LPC-Clermont-Fd, Universite Blaise Pascal, F-63170 Aubiere Cedex (France)

    2006-02-15

    This note gives details on the final analysis of the VCS-SSA experiment in terms of Beam Spin Asymmetry. It summarizes the changes between the first and second pass analysis. Then the measured asymmetry is presented for both channels e polarized p {yields} ep{gamma} and e polarized p {yields} ep{pi}{sup 0} including systematic studies. The final experimental result is briefly compared to some model predictions. (authors)

  2. Agile methodology selection criteria: IT start-up case study

    Science.gov (United States)

    Micic, Lj

    2017-05-01

    Project management in modern IT companies is often based on agile methodologies which have several advantages compared to traditional methodologies such is waterfall. Having in mind that clients sometimes change project during development it is crucial for an IT company to choose carefully which methodology is going to implement and is it going to be mostly based on one or is it going got be combination of several. There are several modern and often used methodologies but among those Scrum, Kanban and XP programming are usually the most common. Sometimes companies use mostly tools and procedures from one but quite often they use some of the combination of those methodologies. Having in mind that those methodologies are just a framework they allow companies to adapt it for their specific projects as well as for other limitations. These methodologies are in limited usage Bosnia but more and more IT companies are starting to use agile methodologies because it is practice and common not just for their clients abroad but also starting to be the only option in order to deliver quality product on time. However it is always challenging which methodology or combination of several companies should implement and how to connect it to its own project, organizational framework and HR management. This paper presents one case study based on local IT start up and delivers solution based on theoretical framework and practical limitations that case company has.

  3. A Quality-Driven Methodology for Information Systems Integration

    Directory of Open Access Journals (Sweden)

    Iyad Zikra

    2017-10-01

    Full Text Available Information systems integration is an essential instrument for organizations to attain advantage in today’s growing and fast changing business and technology landscapes. Integration solutions generate added value by combining the functionality and services of heterogeneous and diverse systems. Existing integration environments tend to rely heavily on technical, platform-dependent skills. Consequently, the solutions that they enable are not optimally aligned with the envisioned business goals of the organization. Furthermore, the gap between the goals and the solutions complicates the task of evaluating the quality of integration solutions. To address these challenges, we propose a quality-driven, model-driven methodology for designing and developing integration solutions. The methodology spans organizational and systems design details, providing a holistic view of the integration solution and its underlying business goals. A multi-view meta-model provides the basis for the integration design. Quality factors that affect various aspects of the integration solution guide and inform the progress of the methodology. An example business case is presented to demonstrate the application of the methodology.

  4. Interviewing with or without the partner present?--an underexposed dilemma between ethics and methodology in nursing research.

    Science.gov (United States)

    Norlyk, Annelise; Haahr, Anita; Hall, Elisabeth

    2016-04-01

    To discuss ethical and methodological challenges related to in-depth interviews with patients and partners when interviewed together or separately. Increased interest in exploring illness phenomena from both patients' and partners' perspectives has emerged. The decision about how to collect data is challenging. Patients and partners can be interviewed separately or together; in both scenarios researchers face complex questions of methodology and ethics. This paper contributes to the ongoing debate on individual or joint interviewing and the effect of absence/presence of the partner on data collection. Discussion paper that draws on data from three phenomenological studies. Referring to three cases from our phenomenological studies, we discuss the different types of ethical and methodological dilemmas faced when undertaking joint and separate interviews with couples. Furthermore, we discuss how the unexpected presence of the partner potentially influences the data gathered from the patient. The cases demonstrate the interrelatedness of ethics and methodology in studies based on in-depth interviews with couples. Nurse researchers may be caught up in a dilemma between ethical concerns and methodological considerations. We argue that the presence of the partner during an interview session might influence the data and favour expressions of shared rather than individual experiences of the phenomenon studied. Furthermore, we argue that ethical concerns must be given higher priority than methodology when interviewing couples. An increased awareness of the tension between ethical and methodological challenges in joint or individual interviewing with patients and partners is necessary, as this issue is underexposed. © 2015 John Wiley & Sons Ltd.

  5. Applications of landscape genetics in conservation biology: concepts and challenges

    Science.gov (United States)

    Gernot Segelbacher; Samuel A. Cushman; Bryan K. Epperson; Marie-Josee Fortin; Olivier Francois; Olivier J. Hardy; Rolf Holderegger; Stephanie Manel

    2010-01-01

    Landscape genetics plays an increasingly important role in the management and conservation of species. Here, we highlight some of the opportunities and challenges in using landscape genetic approaches in conservation biology. We first discuss challenges related to sampling design and introduce several recent methodological developments in landscape genetics (analyses...

  6. Challenges of youth participation in participatory action research

    DEFF Research Database (Denmark)

    Wattar, Laila; Fanous, Sandrine; Berliner, Peter

    2012-01-01

    Paamiut Youth Voice (PYV) is a Participatory Action Research (PAR) project, exploring youth perceptions, experiences, and the promotion of well-being in Paamiut, Greenland. Active youth participation remained a key challenge in the development of the local community through the locally initiated...... community mobilisation programme Paamiut Asasara. The challenges of youth participation in PYV are investigated in order to explore the implications of youth participation in PAR projects. The discussion of challenges is based on a methodological account of experiences from the research process clarifying...

  7. Study of microRNAs (miRNAs) that are predicted to target the autoantigens Ro/SSA and La/SSB in primary Sjögren’s Syndrome

    Science.gov (United States)

    Gourzi, V C; Kapsogeorgou, E K; Kyriakidis, N C; Tzioufas, A G

    2015-01-01

    The elevated tissue expression of Ro/SSA and La/SSB autoantigens appears to be crucial for the generation and perpetuation of autoimmune humoral responses against these autoantigens in Sjögren’s syndrome (SS). The mechanisms that govern their expression are not known. miRNAs, the post-transcriptional regulators of gene expression, might be implicated. We have identified previously the miRNAs let7b, miR16, miR181a, miR200b-3p, miR200b-5p, miR223 and miR483-5p that are predicted to target Ro/SSA [Ro52/tripartite motif-containing protein 21 (TRIM21), Ro60/TROVE domain family, member 2 (TROVE2)] and La/SSB mRNAs. To study possible associations with autoantigen mRNA expression and disease features, their expression was investigated in minor salivary gland (MSG) tissues, peripheral blood mononuclear cells (PBMC) and long-term cultured non-neoplastic salivary gland epithelial cells (SGEC) from 29 SS patients (20 of 29 positive for autoantibodies to Ro/SSA and La/SSB) and 24 sicca-complaining controls. The levels of miR16 were up-regulated in MSGs, miR200b-3p in SGECs and miR223 and miR483-5p in PBMCs of SS patients compared to sicca-complaining controls. The MSG levels of let7b, miR16, miR181a, miR223 and miR483-5p were correlated positively with Ro52/TRIM21-mRNA. miR181a and miR200b-3p were correlated negatively with Ro52/TRIM21 and Ro60/TROVE2 mRNAs in SGECs, respectively, whereas let7b, miR200b-5p and miR223 associated with La/SSB-mRNA. In PBMCs, let7b, miR16, miR181a and miR483-5p were correlated with Ro52/TRIM21, whereas let7b, miR16 and miR181a were also associated with La/SSB-mRNA expression. Significantly lower miR200b-5p levels were expressed in SS patients with mucosa-associated lymphoid tissue (MALT) lymphoma compared to those without. Our findings indicate that miR16, miR200b-3p, miR223 and miR483-5p are deregulated in SS, but the exact role of this deregulation in disease pathogenesis and autoantigen expression needs to be elucidated. PMID:26201309

  8. Measurement and verification of low income energy efficiency programs in Brazil: Methodological challenges

    Energy Technology Data Exchange (ETDEWEB)

    Martino Jannuzzi, Gilberto De; Rodrigues da Silva, Ana Lucia; Melo, Conrado Augustus de; Paccola, Jose Angelo; Dourado Maia Gomes, Rodolfo (State Univ. of Campinas, International Energy Initiative (Brazil))

    2009-07-01

    Electric utilities in Brazil are investing about 80 million dollars annually in low-income energy efficiency programs, about half of their total compulsory investments in end-use efficiency programs under current regulation. Since 2007 the regulator has enforced the need to provide evaluation plans for the programs delivered. This paper presents the measurement and verification (MandV) methodology that has been developed to accommodate the characteristics of lighting and refrigerator programs that have been introduced in the Brazilian urban and peri-urban slums. A combination of household surveys, end-use measurements and metering at the transformers and grid levels were performed before and after the program implementation. The methodology has to accommodate the dynamics, housing, electrical wiring and connections of the population as well as their ability to pay for the electricity and program participation. Results obtained in slums in Rio de Janeiro are presented. Impacts of the programs were evaluated in energy terms to households and utilities. Feedback from the evaluations performed also permitted the improvement in the design of new programs for low-income households.

  9. The Challenge of Integrating OHS into Industrial Project Risk Management: Proposal of a Methodological Approach to Guide Future Research (Case of Mining Projects in Quebec, Canada

    Directory of Open Access Journals (Sweden)

    Adel Badri

    2015-06-01

    Full Text Available Although risk management tools are put to good use in many industrial sectors, some large projects have been met with numerous problems due to failure to take occupational health and safety (OHS into consideration. In spite of the high level of risk and uncertainty associated with many industrial projects, the number of studies of methods for managing all known risks systematically remains small. Under effervescent economic conditions, industries must meet several challenges associated with frequent project start-ups. In highly complex and uncertain environments, rigorous management of risk remains indispensable for avoiding threats to the success of projects. Many businesses seek continually to create and improve integrated approaches to risk management. This article puts into perspective the complexity of the challenge of integrating OHS into industrial project risk management. A conceptual and methodological approach is proposed to guide future research focused on meeting this challenge. The approach is based on applying multi-disciplinary research modes to a complex industrial context in order to identify all scenarios likely to contain threats to humans or the environment. A case study is used to illustrate the potential of the proposed approach for application and its contribution to meeting the challenge of taking OHS into consideration. On-site researchers were able to develop a new approach that helped two mining companies in Quebec (Canada to achieve successful integration of OHS into expansion projects.

  10. Business coaching: challenges for an emerging industry

    NARCIS (Netherlands)

    Clegg, S.R.; Rhodes, C.G.; Kornberger, M.; Stilin, R.

    2005-01-01

    Purpose — To identify the distinguishing characteristics and future challenges for the business coaching industry in Australia. Design/methodology/approach — A telephone survey of business coaching firms was used to identify the main structural characteristics of the industry. Structured interviews

  11. Challenges in data science

    DEFF Research Database (Denmark)

    Carbone, Anna; Jensen, M.; Sato, Aki-Hiro

    2016-01-01

    of global properties from locally interacting data entities and clustering phenomena demand suitable approaches and methodologies recently developed in the foundational area of Data Science by taking a Complex Systems standpoint. Here, we deal with challenges that can be summarized by the question: "What...... can Complex Systems Science contribute to Big Data? ". Such question can be reversed and brought to a superior level of abstraction by asking "What Knowledge can be drawn from Big Data?" These aspects constitute the main motivation behind this article to introduce a volume containing a collection...... of papers presenting interdisciplinary advances in the Big Data area by methodologies and approaches typical of the Complex Systems Science, Nonlinear Systems Science and Statistical Physics. (C) 2016 Elsevier Ltd. All rights reserved....

  12. Improved best estimate plus uncertainty methodology, including advanced validation concepts, to license evolving nuclear reactors

    International Nuclear Information System (INIS)

    Unal, C.; Williams, B.; Hemez, F.; Atamturktur, S.H.; McClure, P.

    2011-01-01

    Research highlights: → The best estimate plus uncertainty methodology (BEPU) is one option in the licensing of nuclear reactors. → The challenges for extending the BEPU method for fuel qualification for an advanced reactor fuel are primarily driven by schedule, the need for data, and the sufficiency of the data. → In this paper we develop an extended BEPU methodology that can potentially be used to address these new challenges in the design and licensing of advanced nuclear reactors. → The main components of the proposed methodology are verification, validation, calibration, and uncertainty quantification. → The methodology includes a formalism to quantify an adequate level of validation (predictive maturity) with respect to existing data, so that required new testing can be minimized, saving cost by demonstrating that further testing will not enhance the quality of the predictive tools. - Abstract: Many evolving nuclear energy technologies use advanced predictive multiscale, multiphysics modeling and simulation (M and S) capabilities to reduce the cost and schedule of design and licensing. Historically, the role of experiments has been as a primary tool for the design and understanding of nuclear system behavior, while M and S played the subordinate role of supporting experiments. In the new era of multiscale, multiphysics computational-based technology development, this role has been reversed. The experiments will still be needed, but they will be performed at different scales to calibrate and validate the models leading to predictive simulations for design and licensing. Minimizing the required number of validation experiments produces cost and time savings. The use of multiscale, multiphysics models introduces challenges in validating these predictive tools - traditional methodologies will have to be modified to address these challenges. This paper gives the basic aspects of a methodology that can potentially be used to address these new challenges in

  13. Loyalty programs challenges in retail banking industry

    OpenAIRE

    Ivanauskienė, Neringa; Auruškevičienė, Viltė

    2009-01-01

    The purpose of this paper is to examine the challenges of loyalty programs in retail banks in Lithuania. Case study methodology was chosen to analyze the loyalty programs launched by various banks to show how banks are building the loyalty of individual customers and what challenges these banks face. The findings suggest that the majority of analyzed loyalty programs reward a repeat purchasing. Lithuanian retail banks launching loyalty programs for two customer segments - the potentially prof...

  14. HIV Risks, Testing, and Treatment in the Former Soviet Union: Challenges and Future Directions in Research and Methodology

    Directory of Open Access Journals (Sweden)

    Victoria M. Saadat

    2016-01-01

    Full Text Available Background. The dissolution of the USSR resulted in independence for constituent republics but left them battling an unstable economic environment and healthcare. Increases in injection drug use, prostitution, and migration were all widespread responses to this transition and have contributed to the emergence of an HIV epidemic in the countries of former Soviet Union. Researchers have begun to identify the risks of HIV infection as well as the barriers to HIV testing and treatment in the former Soviet Union. Significant methodological challenges have arisen and need to be addressed. The objective of this review is to determine common threads in HIV research in the former Soviet Union and provide useful recommendations for future research studies.Methods. In this systematic review of the literature, Pubmed was searched for English-language studies using the key search terms “HIV”, “AIDS”, “human immunodeficiency virus”, “acquired immune deficiency syndrome”, “Central Asia”, “Kazakhstan”, “Kyrgyzstan”, “Uzbekistan”, “Tajikistan”, “Turkmenistan”, “Russia”, “Ukraine”, “Armenia”, “Azerbaijan”, and “Georgia”. Studies were evaluated against eligibility criteria for inclusion.Results. Thirty-nine studies were identified across the two main topic areas of HIV risk and barriers to testing and treatment, themes subsequently referred to as “risk” and “barriers”. Study design was predominantly cross-sectional. The most frequently used sampling methods were peer-to-peer and non-probabilistic sampling. The most frequently reported risks were condom misuse, risky intercourse, and unsafe practices among injection drug users.  Common barriers to testing included that testing was inconvenient, and that results would not remain confidential.  Frequent barriers to treatment were based on a distrust in the treatment system. Conclusion. The findings of this review reveal methodological limitations

  15. The current situation and challenges of screening for and treating hepatitis B in sub-Saharan Africa.

    Science.gov (United States)

    Béguelin, Charles; Fall, Fatou; Seydi, Moussa; Wandeler, Gilles

    2018-05-16

    Hepatitis B virus (HBV) infection is the most important cause of hepatocellular carcinoma in sub-Saharan Africa (SSA). Although the tools to curb the epidemic are known, only a minority of HBV-infected persons are currently diagnosed and treated. Areas covered: We discuss HBV epidemiological trends in SSA, describe important determinants of its natural history, and summarize current knowledge on the continuum of HBV care. Using the results of a systematic review of the literature, we describe the proportion of patients with liver fibrosis at presentation for care. Throughout the manuscript, we highlight major research gaps and explore potential ways to improve uptake of HBV testing, evaluation of liver disease, access to antiviral therapy and monitoring of complications. Expert commentary: Less than 1% of HBV-infected individuals are diagnosed in SSA, despite the availability of rapid tests with good diagnostic accuracy. Up to 15% of individuals enter care with liver cirrhosis, a clear indication for antiviral therapy. Although the proportion of patients eligible for immediate antiviral treatment is generally below 20%, there are few published data from prospective cohort studies. The incidence of hepatocellular carcinoma could be reduced with improved access to antiviral therapy.

  16. Current Status and Challenges in Wind Energy Assessment

    DEFF Research Database (Denmark)

    Gryning, Sven-Erik; Badger, Jake; Hahmann, Andrea N.

    2014-01-01

    Here we discuss the status and challenges in the development of atlases for the assessment of the regional and global wind resources. The text more specifically describes a methodology that is under development at DTU Wind Energy in Denmark. As the wind assessment is based on mesoscale modelling,......, some of the specific challenges in mesoscale modelling for wind energy purposes are discussed such as wind profiles and long-term statistics of the wind speed time series. Solutions to these challenges will help secure an economic and effective deployment of wind energy....

  17. Mobility Turn in Contemporary Society as an Educational Challenge

    Directory of Open Access Journals (Sweden)

    Denys Svyrydenko

    2016-07-01

    Full Text Available The main idea of the research is to uncover the series of challenges produced by the social dynamics with one’s mobile nature. Using methodological potential of social philosophy author attempts to demonstrate the essence and logics of mobility turn as a metaphor of contemporary society development. Author shows the radical changes at social-cultural dynamics which are also concieved by the modern social sciences (sociology of mobilities, series of postmodern concepts such as nomad etc. Using methodological approaches of philosophy of education author formulates “order of the day” of the mobility challenges at higher education sphere. Author shows that educational sphere also becomes mobile transforming the character of one’s vital activity, but also actualizing some special phenomena such as academic mobility. Formulating “order of the day” of mobility challenges to modern higher education, author demonstrates the horizon of future researches due to complex nature of researched problem

  18. Strengthening public health education in population and reproductive health through an innovative academic partnership in Africa: the Gates partners experience.

    Science.gov (United States)

    Oni, Gbolahan; Fatusi, Adesegun; Tsui, Amy; Enquselassie, Fikre; Ojengbede, Oladosu; Agbenyega, Tsiri; Ojofeitimi, Ebenezer; Taulo, Frank; Quakyi, Isabella

    2011-01-01

    Poor reproductive health constitutes one of the leading public health problems in the world, particularly in sub-Saharan Africa (SSA). We report here an academic partnership that commenced in 2003 between a US institution and six universities in SSA. The partnership addresses the human resources development challenge in Africa by strengthening public health education and research capacity to improve population and reproductive health (PRH) outcomes in low-resource settings. The partnership's core activities focused on increasing access to quality education, strengthening health research capacity and translating scholarship and science into policy and practices. Partnership programmes focused on the educational dimension of the human resources equation provide students with improved learning facilities and enhanced work environments and also provide faculty with opportunities for professional development and an enhanced capacity for curriculum delivery. By 2007, 48 faculty members from the six universities in SSA attended PRH courses at Johns Hopkins University, 93 PRH courses were offered across the six universities, 625 of their master's students elected PRH concentrations and 158 had graduated. With the graduation of these and future student cohorts, the universities in SSA will systematically be expanding the number of public health practitioners and strengthening programme effectiveness to resolve reproductive health needs. Some challenges facing the partnership are described in this article.

  19. A multi-factor evaluation of Jatropha as a feedstock for biofuels: the case of sub-Saharan Africa

    Directory of Open Access Journals (Sweden)

    Raphael M. Jingura

    2015-09-01

    Full Text Available Sub-Saharan Africa (SSA is a geographical region consisting of 49 countries, out of which, 39 countries have experiences with the cultivation of Jatropha curcas L. Since the year 2000 Jatropha production escalated in the region and peaked in around 2007/2008. The major drivers of this trend were claims made about Jatropha including include its ability to grow on marginal lands, high seed and oil yields, and drought tolerant, amongst other attributes. However, the reality has shown that these attributes have not been realised.  The objective of the present paper is to analyse the performance of Jatropha as a biofuel feedstock in SSA based on agronomic, economic, social and environmental factors involved in its production. Evidences in SSA show that the major challenge with Jatropha cultivation has been low seed yields, ranging between 0.1 and 2 t/ha. This in turn has led to oil yields which are not sufficiently viable for use in production of biofuels such as biodiesel. There have also been reported challenges with production on wastelands, low use of inputs, unimproved planting materials and vulnerability to pests and diseases. These have negatively affected the performance of Jatropha causing the original claims made about this energy crop not materialised in the SSA.

  20. Status and challenges of residential and industrial non-intrusive load monitoring

    DEFF Research Database (Denmark)

    Adabi, Ali; Mantey, Patrick; Holmegaard, Emil

    2015-01-01

    in recent years due to improvement in algorithms and methodologies. Currently, the important challenges facing residential NILM are inaccessibility of electricity meter high sampling data, and lack of reliable high resolution datasets. For industrial NILM the identification is more challenging due......Non-Intrusive Load Monitoring (NILM) is the process of identification of loads from an aggregate power interface using disaggregation algorithms. This paper identifies the current status, methodologies and challenges of NILM in residential and industrial settings. NILM has advanced substantially...... to increased number of loads and the variability of equipment type, temporal patterns and industrial secrecy. From our examination of data and its use in NILM, we observe that the number of devices that can be recognized and the training period required to achiever recognition is not only a function...

  1. Automatic Satellite Telemetry Analysis for SSA using Artificial Intelligence Techniques

    Science.gov (United States)

    Stottler, R.; Mao, J.

    In April 2016, General Hyten, commander of Air Force Space Command, announced the Space Enterprise Vision (SEV) (http://www.af.mil/News/Article-Display/Article/719941/hyten-announces-space-enterprise-vision/). The SEV addresses increasing threats to space-related systems. The vision includes an integrated approach across all mission areas (communications, positioning, navigation and timing, missile warning, and weather data) and emphasizes improved access to data across the entire enterprise and the ability to protect space-related assets and capabilities. "The future space enterprise will maintain our nation's ability to deliver critical space effects throughout all phases of conflict," Hyten said. Satellite telemetry is going to become available to a new audience. While that telemetry information should be valuable for achieving Space Situational Awareness (SSA), these new satellite telemetry data consumers will not know how to utilize it. We were tasked with applying AI techniques to build an infrastructure to process satellite telemetry into higher abstraction level symbolic space situational awareness and to initially populate that infrastructure with useful data analysis methods. We are working with two organizations, Montana State University (MSU) and the Air Force Academy, both of whom control satellites and therefore currently analyze satellite telemetry to assess the health and circumstances of their satellites. The design which has resulted from our knowledge elicitation and cognitive task analysis is a hybrid approach which combines symbolic processing techniques of Case-Based Reasoning (CBR) and Behavior Transition Networks (BTNs) with current Machine Learning approaches. BTNs are used to represent the process and associated formulas to check telemetry values against anticipated problems and issues. CBR is used to represent and retrieve BTNs that represent an investigative process that should be applied to the telemetry in certain circumstances

  2. Readiness of Sub-Saharan Africa Healthcare Systems for the New Pandemic, Diabetes: A Systematic Review

    Directory of Open Access Journals (Sweden)

    Bernardo Nuche-Berenguer

    2018-01-01

    Full Text Available Background. Effective health systems are needed to care for the coming surge of diabetics in sub-Saharan Africa (SSA. Objective. We conducted a systematic review of literature to determine the capacity of SSA health systems to manage diabetes. Methodology. We used three different databases (Embase, Scopus, and PubMed to search for studies, published from 2004 to 2017, on diabetes care in SSA. Results. Fifty-five articles met the inclusion criteria, covering the different aspects related to diabetes care such as availability of drugs and diagnostic tools, the capacity of healthcare workers, and the integration of diabetes care into HIV and TB platforms. Conclusion. Although chronic care health systems in SSA have developed significantly in the last decade, the capacity for managing diabetes remains in its infancy. We identified pilot projects to enhance these capacities. The scale-up of these pilot interventions and the integration of diabetes care into existing robust chronic disease platforms may be a feasible approach to begin to tackle the upcoming pandemic in diabetes. Nonetheless, much more work needs to be done to address the health system-wide deficiencies in diabetes care. More research is also needed to determine how to integrate diabetes care into the healthcare system in SSA.

  3. Methodological challenges for the evaluation of clinical effectiveness in the context of accelerated regulatory approval: an overview.

    Science.gov (United States)

    Woolacott, Nerys; Corbett, Mark; Jones-Diette, Julie; Hodgson, Robert

    2017-10-01

    Regulatory authorities are approving innovative therapies with limited evidence. Although this level of data is sufficient for the regulator to establish an acceptable risk-benefit balance, it is problematic for downstream health technology assessment, where assessment of cost-effectiveness requires reliable estimates of effectiveness relative to existing clinical practice. Some key issues associated with a limited evidence base include using data, from nonrandomized studies, from small single-arm trials, or from single-center trials; and using surrogate end points. We examined these methodological challenges through a pragmatic review of the available literature. Methods to adjust nonrandomized studies for confounding are imperfect. The relative treatment effect generated from single-arm trials is uncertain and may be optimistic. Single-center trial results may not be generalizable. Surrogate end points, on average, overestimate treatment effects. Current methods for analyzing such data are limited, and effectiveness claims based on these suboptimal forms of evidence are likely to be subject to significant uncertainty. Assessments of cost-effectiveness, based on the modeling of such data, are likely to be subject to considerable uncertainty. This uncertainty must not be underestimated by decision makers: methods for its quantification are required and schemes to protect payers from the cost of uncertainty should be implemented. Crown Copyright © 2017. Published by Elsevier Inc. All rights reserved.

  4. Development of a computer-adaptive physical function instrument for Social Security Administration disability determination.

    Science.gov (United States)

    Ni, Pengsheng; McDonough, Christine M; Jette, Alan M; Bogusz, Kara; Marfeo, Elizabeth E; Rasch, Elizabeth K; Brandt, Diane E; Meterko, Mark; Haley, Stephen M; Chan, Leighton

    2013-09-01

    To develop and test an instrument to assess physical function for Social Security Administration (SSA) disability programs, the SSA-Physical Function (SSA-PF) instrument. Item response theory (IRT) analyses were used to (1) create a calibrated item bank for each of the factors identified in prior factor analyses, (2) assess the fit of the items within each scale, (3) develop separate computer-adaptive testing (CAT) instruments for each scale, and (4) conduct initial psychometric testing. Cross-sectional data collection; IRT analyses; CAT simulation. Telephone and Internet survey. Two samples: SSA claimants (n=1017) and adults from the U.S. general population (n=999). None. Model fit statistics, correlation, and reliability coefficients. IRT analyses resulted in 5 unidimensional SSA-PF scales: Changing & Maintaining Body Position, Whole Body Mobility, Upper Body Function, Upper Extremity Fine Motor, and Wheelchair Mobility for a total of 102 items. High CAT accuracy was demonstrated by strong correlations between simulated CAT scores and those from the full item banks. On comparing the simulated CATs with the full item banks, very little loss of reliability or precision was noted, except at the lower and upper ranges of each scale. No difference in response patterns by age or sex was noted. The distributions of claimant scores were shifted to the lower end of each scale compared with those of a sample of U.S. adults. The SSA-PF instrument contributes important new methodology for measuring the physical function of adults applying to the SSA disability programs. Initial evaluation revealed that the SSA-PF instrument achieved considerable breadth of coverage in each content domain and demonstrated noteworthy psychometric properties. Copyright © 2013 American Congress of Rehabilitation Medicine. Published by Elsevier Inc. All rights reserved.

  5. A data-driven prediction method for fast-slow systems

    Science.gov (United States)

    Groth, Andreas; Chekroun, Mickael; Kondrashov, Dmitri; Ghil, Michael

    2016-04-01

    In this work, we present a prediction method for processes that exhibit a mixture of variability on low and fast scales. The method relies on combining empirical model reduction (EMR) with singular spectrum analysis (SSA). EMR is a data-driven methodology for constructing stochastic low-dimensional models that account for nonlinearity and serial correlation in the estimated noise, while SSA provides a decomposition of the complex dynamics into low-order components that capture spatio-temporal behavior on different time scales. Our study focuses on the data-driven modeling of partial observations from dynamical systems that exhibit power spectra with broad peaks. The main result in this talk is that the combination of SSA pre-filtering with EMR modeling improves, under certain circumstances, the modeling and prediction skill of such a system, as compared to a standard EMR prediction based on raw data. Specifically, it is the separation into "fast" and "slow" temporal scales by the SSA pre-filtering that achieves the improvement. We show, in particular that the resulting EMR-SSA emulators help predict intermittent behavior such as rapid transitions between specific regions of the system's phase space. This capability of the EMR-SSA prediction will be demonstrated on two low-dimensional models: the Rössler system and a Lotka-Volterra model for interspecies competition. In either case, the chaotic dynamics is produced through a Shilnikov-type mechanism and we argue that the latter seems to be an important ingredient for the good prediction skills of EMR-SSA emulators. Shilnikov-type behavior has been shown to arise in various complex geophysical fluid models, such as baroclinic quasi-geostrophic flows in the mid-latitude atmosphere and wind-driven double-gyre ocean circulation models. This pervasiveness of the Shilnikow mechanism of fast-slow transition opens interesting perspectives for the extension of the proposed EMR-SSA approach to more realistic situations.

  6. Brucellosis in Sub-Saharan Africa: Current challenges for management, diagnosis and control.

    Science.gov (United States)

    Ducrotoy, M; Bertu, W J; Matope, G; Cadmus, S; Conde-Álvarez, R; Gusi, A M; Welburn, S; Ocholi, R; Blasco, J M; Moriyón, I

    2017-01-01

    Brucellosis is a highly contagious zoonosis caused by bacteria of the genus Brucella and affecting domestic and wild mammals. In this paper, the bacteriological and serological evidence of brucellosis in Sub-Saharan Africa (SSA) and its epidemiological characteristics are discussed. The tools available for the diagnosis and treatment of human brucellosis and for the diagnosis and control of animal brucellosis and their applicability in the context of SSA are presented and gaps identified. These gaps concern mostly the need for simpler and more affordable antimicrobial treatments against human brucellosis, the development of a B. melitensis vaccine that could circumvent the drawbacks of the currently available Rev 1 vaccine, and the investigation of serological diagnostic tests for camel brucellosis and wildlife. Strategies for the implementation of animal vaccination are also discussed. Copyright © 2015 The Authors. Published by Elsevier B.V. All rights reserved.

  7. Co-production of Snow Projections for a Study of Snow Persistence Projections for the American Wolverine Gulo gulo

    Science.gov (United States)

    Ray, A. J.; Barsugli, J. J.; Guinotte, J. M.; Livneh, B.; Dewes, C.; Rangwala, I.; Heldmyer, A.; Torbit, S.

    2017-12-01

    This presentation will describe the efforts of climate scientists to work with the US Fish and Wildlife Service (FWS) to provide analysis of future snow persistence to support a Species Status Assessment (SSA) for the American wolverine (Gulo gulo), under the Endangered Species Act (ESA). The project has been a research to application (R2A) study, aimed directly at the FWS needs, and in regular collaboration with FWS Region 6 personnel to discuss and agree on the choice downscaled projections to represent a range of plausible futures, and other methodological choices including use of high resolution (250m) physical hydrology modeling. FWS sought improved information on which to base a court-ordered re-evaluation of the conclusions of a previous SSA, due in 12 months, necessitating a quick turn-around for the snow research. The goal was to improve upon the the previous evaluation of snow persistence, both in understanding of the range of uncertainty and by using new snow modeling at spatial scales intended to be more relevant to both physical snowpack processes and to making inferences about potential wolverine denning opportunity. This project was embedded both in a specific legal/regulatory process and also in a broader FWS interest in building body of science for snow-dependent species that might support other ESA processes. Results of the co-production included new scientific questions and analytic approaches that arose from the interaction between climate scientists and ecologists. The fine spatial scales of the analysis compared to previous work allowed new hypotheses to be articulated, but also led to significant issues in the interpretation of the snow model output. This presentation will discuss key issues that arose in the collaboration between scientists and the managers developing the SSA, including the managing the independence of the science while remaining in a co-production mode, the challenges of the rapid time frame, and the challenges

  8. Novel Methodology for Functional Modeling and Simulation of Wireless Embedded Systems

    Directory of Open Access Journals (Sweden)

    Sosa Morales Emma

    2008-01-01

    Full Text Available Abstract A novel methodology is presented for the modeling and the simulation of wireless embedded systems. Tight interaction between the analog and the digital functionality makes the design and verification of such systems a real challenge. The applied methodology brings together the functional models of the baseband algorithms written in C language with the circuit descriptions at behavioral level in Verilog or Verilog-AMS for the system simulations in a single kernel environment. The physical layer of an ultrawideband system has been successfully modeled and simulated. The results confirm that this methodology provides a standardized framework in order to efficiently and accurately simulate complex mixed signal applications for embedded systems.

  9. Mixed-mode modelling mixing methodologies for organisational intervention

    CERN Document Server

    Clarke, Steve; Lehaney, Brian

    2001-01-01

    The 1980s and 1990s have seen a growing interest in research and practice in the use of methodologies within problem contexts characterised by a primary focus on technology, human issues, or power. During the last five to ten years, this has given rise to challenges regarding the ability of a single methodology to address all such contexts, and the consequent development of approaches which aim to mix methodologies within a single problem situation. This has been particularly so where the situation has called for a mix of technological (the so-called 'hard') and human­ centred (so-called 'soft') methods. The approach developed has been termed mixed-mode modelling. The area of mixed-mode modelling is relatively new, with the phrase being coined approximately four years ago by Brian Lehaney in a keynote paper published at the 1996 Annual Conference of the UK Operational Research Society. Mixed-mode modelling, as suggested above, is a new way of considering problem situations faced by organisations. Traditional...

  10. Research with Children: Challenges and Dilemmas as an Insider Researcher

    Science.gov (United States)

    Kim, Hye Won

    2012-01-01

    This paper explores the challenges and dilemmas raised by my own experience of researching an immigrant Korean child at an ethnic Sunday School where I taught. I review the ethical and methodological challenges raised in my interactions with the child as an insider researcher from the ways I approached consent forms through to interview…

  11. Using functional analysis in archival appraisal a practical and effective alternative to traditional appraisal methodologies

    CERN Document Server

    Robyns, Marcus C

    2014-01-01

    In an age of scarcity and the challenge of electronic records, can archivists and records managers continue to rely upon traditional methodology essentially unchanged since the early 1950s? Using Functional Analysis in Archival Appraisal: A Practical and Effective Alternative to Traditional Appraisal Methodologies shows how archivists in other countries are already using functional analysis, which offers a better, more effective, and imminently more practical alternative to traditional appraisal methodologies that rely upon an analysis of the records themselves.

  12. Exploring opportunities for rural livelihoods and food security in Central Mozambique

    OpenAIRE

    Leonardo, Wilson José

    2017-01-01

    Growing awareness of widespread hunger and poverty in many countries in the SSA is spurring a focus on productivity increase in smallholder farming systems. The rationale is that with current production systems many SSA countries are not keeping pace with population growth and changing of peoples’ lifestyles. To respond to this challenge the Government of Mozambique developed its Strategic Plan for Agricultural Development (PEDSA) aiming to improve agricultural productivity of the majority of...

  13. The Challenges to and the Need for International Research in Educational Leadership

    Science.gov (United States)

    Brooks, Melanie Carol; Jean-Marie, Gaetane

    2015-01-01

    Purpose: The purpose of this paper is twofold: to discuss methodological challenges facing US scholars when conducting international research; and to present personal reflections as educational leadership faculty in the USA conducting and publishing on research undertaken in Haiti and Thailand. Design/Methodology/Approach: This study drew from…

  14. HIV epidemic and human rights among men who have sex with men in sub-Saharan Africa: Implications for HIV prevention, care, and surveillance.

    Science.gov (United States)

    Abara, Winston E; Garba, Ibrahim

    2017-04-01

    Recent research has presented evidence that men who have sex with men (MSM) bear a disproportionate burden of HIV and are at increased risk for HIV in sub-Saharan Africa (SSA). However, many countries in SSA have failed to address the needs of MSM in national HIV/AIDS programmes. Furthermore, many MSM face structural barriers to HIV prevention and care, the most significant of which include laws that criminalise male-to-male sexual contact and facilitate stigma and discrimination. This in turn increases the vulnerability of MSM to acquiring HIV and presents barriers to HIV prevention, care, and surveillance. This relationship illustrates the link between human rights, social justice, and health outcomes and presents considerable challenges to addressing the HIV epidemic among MSM in SSA. The response to the HIV epidemic in SSA requires a non-discriminatory human rights approach to all at-risk groups, including MSM. Existing international human rights treaties, to which many SSA countries are signatories, and a 'health in all policies' approach provides a strong basis to reduce structural barriers to HIV prevention, care, surveillance, and research, and to ensure that all populations in SSA, including MSM, have access to the full range of rights that help ensure equal opportunities for health and wellness.

  15. Private events: from methodological behaviorism to interbehaviorism

    OpenAIRE

    Bueno, Roberto; Universidad de San Martín de Porres / Universidad Nacional Federico Villarreal

    2010-01-01

    As supposed events being accessible to a unique observer, private events posit an interesting challenge to a behavioristic psychology. Three historical variants of behaviorism dealt with the problem of private events: methodological behaviorism, radical behaviorism and interbehaviorism. The basic argument of the two last views, and that distinguishes them from the former, is that private events are comprised into the scope of an objective science of behavior. The analysis of these accounts pe...

  16. Sea Star Wasting Disease 2 Years On: What We know, What We Don't Yet Know, and What We are Doing Now to Understand the Disease

    Science.gov (United States)

    Hewson, I.

    2016-02-01

    Sea star wasting disease has affected over 20 species of asterozoa in waters from central Alaska to Baja California, causing extensive mortality and disappearance entirely from some areas. Combined viral, bacterial, eukaryotic microbial, and histological investigations identified the core nano- and micro-biome of sea stars, and elucidated that the Sea Star Associated Densovirus (SSaDV) was the most likely candidate microorganism involved in disease etiology. Direct challenge experiments using tissue homogenates from symptomatic animals injected into asymptomatic individuals revealed that the disease is caused by a virus-sized entity. However, there remains much to be learned about the disease, especially how disease symptoms are generated by SSaDV, how the virus is transmitted between infected and uninfected animals, and why SSaDV may cause disease recently. We performed inoculation trials on SSaDV-naïve sea stars collected from a geographically distant population away from disease-affected areas, and observed viral, bacterial, archaeal, and host transcriptomic responses over time. We also performed surveys of SSaDV in juveniles and larval plankton, as well as the environmental distribution and stability of SSaDV in key regions where SSWD has all but wiped out adults. Our results suggest that SSaDV must move around either on particles or by direct contact between animals, since decay rates exceed reasonable transmission times based on sea star abundance. Global surveys of sea star-associated viruses also elucidate that SSaDV may have been present in populations of sea stars from Hong Kong around the same time of the 2013-2015 epidemic.

  17. Dietary diversity, child nutrition and health in contemporary African communities.

    Science.gov (United States)

    Onyango, Adelheid W

    2003-09-01

    Many infants in sub-Saharan Africa (SSA) begin to receive cereal-based supplemental feeds well before the age (6 months) recommended for the introduction of 'safe and nutritionally adequate' complementary foods, or in rarer instances, do not receive these until the second year. The diets offered are monotonous and bulky, and rarely cover the shortfall left by breast milk in providing the energy and nutrients required to support rapid growth, build nutrient stores and assure resistance to infection. The pattern of growth and prevalence of malnutrition observed from birth through the first 5 years in SSA are suggestive of the nutrient inadequacies of the diet and the experience of infection. However, it is difficult to link poor growth and specific nutrient deficiencies in epidemiological studies because multiple nutrients are required for growth and deficiencies usually involve several nutrients. Moreover, accurate measurement of nutrient intakes is no small challenge. In this regard, qualitative and easier-to-measure characteristics of diet which are associated with nutrient adequacy could serve as alternative determinant factors in studies looking at causes of malnutrition. Dietary diversity is proposed as a candidate indicator of food security and predictor of nutritional status, but there is need for further research to standardize definitions and methodology before it can be applied widely.

  18. TheoSSA - Model WD Spectra on Demand: The Impact of Ne, Na, Mg, and Iron-group Elements on the Balmer Lines

    Science.gov (United States)

    Reindl, N.; Rauch, T.

    2015-06-01

    The registered German Astrophysical Virtual Observatory (GAVO) service TheoSSA provides easy access to synthetic stellar spectra. This GAVO database contains already ten thousands of these, which were calculated with different chemical compositions of the elements H to Ni. In addition to the database, it is possible to calculate individual spectra for hot, compact stars based on the Tübingen NLTE Model-Atmosphere Package (TMAP) via the TMAW service. The TMAW models were, in the pilot phase, restricted to the elements H, He, C, N, and O. Now, TMAW is extended to additionally consider opacities from Ne, Na, and Mg. Soon, TMAW will also be able to include the opacities from the so-called iron-group elements (Ca - Ni). We describe the improvements and show the impact of Ne, Na, Mg, and iron-group elements on the Balmer lines.

  19. Educational Policymaking and the Methodology of Positive Economics: A Theoretical Critique

    Science.gov (United States)

    Gilead, Tal

    2014-01-01

    By critically interrogating the methodological foundations of orthodox economic theory, Tal Gilead challenges the growing conviction in educational policymaking quarters that, being more scientific than other forms of educational investigation, inquiries grounded in orthodox economics should provide the basis for educational policymaking. He…

  20. A nationwide study on reproductive function, ovarian reserve, and risk of premature menopause in female survivors of childhood cancer: design and methodological challenges

    Directory of Open Access Journals (Sweden)

    Overbeek Annelies

    2012-08-01

    Full Text Available Abstract Background Advances in childhood cancer treatment over the past decades have significantly improved survival, resulting in a rapidly growing group of survivors. However, both chemo- and radiotherapy may adversely affect reproductive function. This paper describes the design and encountered methodological challenges of a nationwide study in the Netherlands investigating the effects of treatment on reproductive function, ovarian reserve, premature menopause and pregnancy outcomes in female childhood cancer survivors (CCS, the DCOG LATER-VEVO study. Methods The study is a retrospective cohort study consisting of two parts: a questionnaire assessing medical, menstrual, and obstetric history, and a clinical assessment evaluating ovarian and uterine function by hormonal analyses and transvaginal ultrasound measurements. The eligible study population consists of adult female 5-year survivors of childhood cancer treated in the Netherlands, whereas the control group consists of age-matched sisters of the participating CCS. To date, study invitations have been sent to 1611 CCS and 429 sister controls, of which 1215 (75% and 333 (78% have responded so far. Of these responders, the majority consented to participate in both parts of the study (53% vs. 65% for CCS and sister controls respectively. Several challenges were encountered involving the study population: dealing with bias due to the differences in characteristics of several types of (non- participants and finding an adequately sized and well-matched control group. Moreover, the challenges related to the data collection process included: differences in response rates between web-based and paper-based questionnaires, validity of self-reported outcomes, interpretation of clinical measurements of women using hormonal contraceptives, and inter- and intra-observer variation of the ultrasound measurements. Discussion The DCOG LATER-VEVO study will provide valuable information about the

  1. Sustainable Facility Development: Perceived Benefits and Challenges

    Science.gov (United States)

    Stinnett, Brad; Gibson, Fred

    2016-01-01

    Purpose: The purpose of this paper is to assess the perceived benefits and challenges of implementing sustainable initiatives in collegiate recreational sports facilities. Additionally, this paper intends to contribute to the evolving field of facility sustainability in higher education. Design/methodology/approach The design included qualitative…

  2. Developing a Design Methodology for Web 2.0 Mediated Learning

    DEFF Research Database (Denmark)

    Buus, Lillian; Georgsen, Marianne; Ryberg, Thomas

    2010-01-01

    Ed). We describe how this method has been adopted as part of a learning methodology building on concepts and models presented in the other symposium papers, in particular those of active, problem based learning and web 2.0-technologies. The challenge of designing on the basis of an explicit learning...

  3. Conceptual and methodological challenges for neuroimaging studies of autistic spectrum disorders

    OpenAIRE

    Mazzone, Luigi; Curatolo, Paolo

    2010-01-01

    Abstract Autistic Spectrum Disorders (ASDs) are a set of complex developmental disabilities defined by impairment in social interaction and communication, as well as by restricted interests or repetitive behaviors. Neuroimaging studies have substantially advanced our understanding of the neural mechanisms that underlie the core symptoms of ASDs. Nevertheless, a number of challenges still remain in the application of neuroimaging techniques to the study of ASDs. We review three major conceptua...

  4. Audit Methodology for IT Governance

    Directory of Open Access Journals (Sweden)

    Mirela GHEORGHE

    2010-01-01

    Full Text Available The continuous development of the new IT technologies was followed up by a rapid integration of them at the organization level. The management of the organizations face a new challenge: structural redefinition of the IT component in order to create plus value and to minimize IT risks through an efficient management of all IT resources of the organization. These changes have had a great impact on the governance of the IT component. The paper proposes an audit methodology of the IT Governance at the organization level. From this point of view the developed audit strategy is a strategy based on risks to enable IT auditor to study from the best angle efficiency and effectiveness of the IT Governance structure. The evaluation of the risks associated with IT Governance is a key process in planning the audit mission which will allow the identification of the segments with increased risks. With now ambition for completeness, the proposed methodology provides the auditor a useful tool in the accomplishment of his mission.

  5. Scrum of scrums solution for large size teams using scrum methodology

    OpenAIRE

    Qurashi, Saja Al; Qureshi, M. Rizwan Jameel

    2014-01-01

    Scrum is a structured framework to support complex product development. However, Scrum methodology faces a challenge of managing large teams. To address this challenge, in this paper we propose a solution called Scrum of Scrums. In Scrum of Scrums, we divide the Scrum team into teams of the right size, and then organize them hierarchically into a Scrum of Scrums. The main goals of the proposed solution are to optimize communication between teams in Scrum of Scrums; to make the system work aft...

  6. An alternative methodology for teaching English in the first cycle of primary education

    Directory of Open Access Journals (Sweden)

    Nery I. Calvet Valdés

    2005-03-01

    Full Text Available The implementation of English language programs in the first cycle of primary education makes it necessary to implement a methodology that leads enclosed in itself the challenge imposed on us every day to create a man more prepared in communicating in foreign languages. The article proposes a methodology that has as its core concepts characterization of the school, values education, communication and culture in learning conditions that encourage interaction.

  7. The challenges of being an insider in storytelling research.

    Science.gov (United States)

    Blythe, Stacy; Wilkes, Lesley; Jackson, Debra; Halcomb, Elizabeth

    2013-01-01

    To describe the challenges related to being an 'insider' researcher in a study that uses a feminist-informed storytelling research design and to discuss practical strategies to manage these challenges. The positioning of the researcher in qualitative research has numerous methodological implications. Often, qualitative researchers share similar experiences or characteristics with their participants. Such an 'insider' position provides challenges for the researcher in conducting the research. Understanding these challenges and planning how to manage them is beneficial for the researcher and for the conduct of the project. This paper is based on the research team's experience of undertaking a feminist-informed storytelling study exploring the experiences of Australian women providing long-term foster care. This paper provides a discussion of the methodology used in the investigation. Four challenges resulting from the insider status of the primary researcher were identified as affecting the research: assumed understanding, ensuring analytic objectivity, dealing with emotions and participants' expectations. Strategies to address these challenges include: 'participant probing', 'researcher reflexivity', review by an 'outsider' researcher, identifying the risk, debriefing, making the aims and use of study outcomes clear, and acknowledging participants' expectations. Methods to implement these strategies are described. The use of an insider researcher was beneficial to our study design and helped with recruitment and rapport, enabling collaboration and the generation of stories rich in content. By identifying the challenges associated with insider research and using strategies to mitigate them, researchers can effectively use an insider position in conjunction with a storytelling research design. ImplicaTIONS FOR FUTURE RESEARCH/PRACTICE: Further investigation of the insider in different qualitative research designs would be useful in identifying challenges and benefits

  8. Identifying health facilities outside the enterprise: challenges and strategies for supporting health reform and meaningful use.

    Science.gov (United States)

    Dixon, Brian E; Colvard, Cyril; Tierney, William M

    2014-06-24

    Objective: To support collation of data for disability determination, we sought to accurately identify facilities where care was delivered across multiple, independent hospitals and clinics. Methods: Data from various institutions' electronic health records were merged and delivered as continuity of care documents to the United States Social Security Administration (SSA). Results: Electronic records for nearly 8000 disability claimants were exchanged with SSA. Due to the lack of standard nomenclature for identifying the facilities in which patients received the care documented in the electronic records, SSA could not match the information received with information provided by disability claimants. Facility identifiers were generated arbitrarily by health care systems and therefore could not be mapped to the existing international standards. Discussion: We propose strategies for improving facility identification in electronic health records to support improved tracking of a patient's care between providers to better serve clinical care delivery, disability determination, health reform and meaningful use. Conclusion: Accurately identifying the facilities where health care is delivered to patients is important to a number of major health reform and improvement efforts underway in many nations. A standardized nomenclature for identifying health care facilities is needed to improve tracking of care and linking of electronic health records.

  9. A methodology to enlarge narrow stability windows

    Energy Technology Data Exchange (ETDEWEB)

    Araujo, Ewerton M.P.; Pastor, Jorge A.S.C.; Fontoura, Sergio A.B. [Pontificia Univ. Catolica do Rio de Janeiro (PUC-Rio), RJ (Brazil). Dept. de Engenharia Civil. Grupo de Tecnologia e Engenharia de Petroleo

    2004-07-01

    The stability window in a wellbore design is defined by the difference between fracture pressure and collapse pressure. Deep water environments typically present narrow stability windows, because rocks have low strength due to under-compaction process. Often also, horizontal wells are drilled to obtain a better development of reservoirs placed in thin layers of sandstone. In this scenario, several challenges are faced when drilling in deep water. The traditional approach for predicting instabilities is to determine collapses and fractures at borehole wall. However, the initiation of rupture does not indicate that the borehole fails to perform its function as a wellbore. Thus, a methodology in which the stability window may be enlarged is desirable. This paper presents one practical analytical methodology that consists in allowing wellbore pressures smaller than the conventional collapse pressure, i.e., based upon failure on the borehole wall. This means that a collapse region (shear failure) will be developed around the borehole wall. This collapse region is pre-defined and to estimate its size is used a failure criterion. The aforementioned methodology is implemented in a user-friendly software, which can perform analyses of stress, pore pressure, formation failure, mud weight and mud salinity design for drilling in shale formations. Simulations of a wellbore drilling in a narrow stability window environment are performed to demonstrate the improvements of using the methodology. (author)

  10. Toward methodological emancipation in applied health research.

    Science.gov (United States)

    Thorne, Sally

    2011-04-01

    In this article, I trace the historical groundings of what have become methodological conventions in the use of qualitative approaches to answer questions arising from the applied health disciplines and advocate an alternative logic more strategically grounded in the epistemological orientations of the professional health disciplines. I argue for an increasing emphasis on the modification of conventional qualitative approaches to the particular knowledge demands of the applied practice domain, challenging the merits of what may have become unwarranted attachment to theorizing. Reorienting our methodological toolkits toward the questions arising within an evidence-dominated policy agenda, I encourage my applied health disciplinary colleagues to make themselves useful to that larger project by illuminating that which quantitative research renders invisible, problematizing the assumptions on which it generates conclusions, and filling in the gaps in knowledge needed to make decisions on behalf of people and populations.

  11. Relative Hazard and Risk Measure Calculation Methodology Rev 1

    International Nuclear Information System (INIS)

    Stenner, Robert D.; White, Michael K.; Strenge, Dennis L.; Aaberg, Rosanne L.; Andrews, William B.

    2000-01-01

    Documentation of the methodology used to calculate relative hazard and risk measure results for the DOE complex wide risk profiles. This methodology is used on major site risk profiles. In February 1997, the Center for Risk Excellence (CRE) was created and charged as a technical, field-based partner to the Office of Science and Risk Policy (EM-52). One of the initial charges to the CRE is to assist the sites in the development of ''site risk profiles.'' These profiles are to be relatively short summaries (periodically updated) that present a broad perspective on the major risk related challenges that face the respective site. The risk profiles are intended to serve as a high-level communication tool for interested internal and external parties to enhance the understanding of these risk-related challenges. The risk profiles for each site have been designed to qualitatively present the following information: (1) a brief overview of the site, (2) a brief discussion on the historical mission of the site, (3) a quote from the site manager indicating the site's commitment to risk management, (4) a listing of the site's top risk-related challenges, (5) a brief discussion and detailed table presenting the site's current risk picture, (6) a brief discussion and detailed table presenting the site's future risk reduction picture, and (7) graphic illustrations of the projected management of the relative hazards at the site. The graphic illustrations were included to provide the reader of the risk profiles with a high-level mental picture to associate with all the qualitative information presented in the risk profile. Inclusion of these graphic illustrations presented the CRE with the challenge of how to fold this high-level qualitative risk information into a system to produce a numeric result that would depict the relative change in hazard, associated with each major risk management action, so it could be presented graphically. This report presents the methodology developed

  12. Highlights from 4STAR Sky-Scanning Retrievals of Aerosol Intensive Optical Properties from Multiple Field Campaigns with Detailed Comparisons of SSA Reported During SEAC4RS

    Science.gov (United States)

    Dunagan, Stephen E.

    2016-01-01

    The 4STAR (Spectrometer for Sky-Scanning, Sun-Tracking Atmospheric Research) instrument combines airborne sun tracking capabilities of the Ames Airborne Tracking Sun Photometer (AATS-14) with AERONET (Aerosol Robotic Network)-like sky-scanning capability and adds state-of-the-art fiber-coupled grating spectrometry to yield hyperspectral measurements of direct solar irradiance and angularly resolved sky radiance. The combination of sun-tracking and sky-scanning capability enables retrievals of wavelength-dependent aerosol optical depth (AOD), mode-resolved aerosol size distribution (SD), asphericity, and complex refractive index, and thus also the scattering phase function, asymmetry parameter, single-scattering albedo (SSA), and absorption aerosol optical thickness (AAOT). From 2012 to 2014 4STAR participated in four major field campaigns: the U.S. Dept. of Energy's TCAP (Two-Column Aerosol Project) I & II campaigns, and NASA's SEAC4RS (Studies of Emissions, Atmospheric Composition, Clouds and Climate Coupling by Regional Surveys) and ARISE (Arctic Radiation - IceBridge Sea & Ice Experiment) campaigns. Establishing a strong performance record, 4STAR operated successfully on all flights conducted during each of these campaigns. Sky radiance spectra from scans in either constant azimuth (principal plane) or constant zenith angle (almucantar) were interspersed with direct beam measurements during level legs. During SEAC4RS and ARISE, 4STAR airborne measurements were augmented with flight-level albedo from the collocated Shortwave Spectral Flux Radiometer (SSFR) providing improved specification of below-aircraft radiative conditions for the retrieval. Calibrated radiances and retrieved products will be presented with particular emphasis on detailed comparisons of ambient SSA retrievals and measurements during SEAC4RS from 4STAR, AERONET, HSRL2 (High Spectral Resolution Lidar), and from in situ measurements.

  13. Methodological triangulation in work life research

    DEFF Research Database (Denmark)

    Warring, Niels

    Based on examples from two research projects on preschool teachers' work, the paper will discuss potentials and challenges in methodological triangulation in work life research. Analysis of ethnographic and phenomenological inspired observations of everyday life in day care centers formed the basis...... for individual interviews and informal talks with employees. The interviews and conversations were based on a critical hermeneutic approach. The analysis of observations and interviews constituted a knowledge base as the project went in to the last phase: action research workshops. In the workshops findings from...

  14. Methodological Improvements in Combining TMS and Functional MRI

    OpenAIRE

    Moisa, Marius

    2011-01-01

    Since 1997, when Bohning and colleagues demonstrated for the first time the feasibility of interleaving transcranial magnetic stimulation (TMS) with blood oxygenation level dependency functional magnetic resonance imaging (BOLD fMRI), this combination became a very promising techniques to study brain connectivity. However, the implementation of a reliable setup for interleaved TMS/fMRI is still technically challenging. In this thesis, I intended to further explore and develop methodological i...

  15. Analysing Everyday Online Political Talk in China: Theoretical and Methodological Reflections

    NARCIS (Netherlands)

    Wright, Scott; Graham, Todd; Sun, Yu; Yang Wang, Wilfred; Luo, Xiantian; Carson, Andrea

    2016-01-01

    This article explores the theoretical and methodological challenges of collecting and analysing everyday online political talk in China, and our approach to defining and coding such talk. In so doing, the article is designed to encourage further research in this area, taking forward a new agenda for

  16. METHODOLOGICAL ISSUES OF CLINICAL TRIALS IN THE PEDIATRIC POPULATION

    Directory of Open Access Journals (Sweden)

    S.V. Topolyanskaya

    2010-01-01

    Full Text Available Conducting clinical trials on children population is a challenge both for organizers and pediatricians involved in trials. Difficulties in recruiting patients, a significant heterogenecity of the population, specific side reactions, difficulties in identifying the objective final points warrant the specific nature of designing clinical trials in pediatrics. The article illustrates key issues and methodology aspects: planning, design, control groups, patient recruitment. It stresses the need to carefully consider specific characteristics of a child’s system and multi-disciplinary approach involving a pediatrician at the early stages of planning, preliminary consultations with parent organizations, children and regulators.Key words: clinical trials, methodology, planning, design, patient recruitment, children. (Pediatric Pharmacology. – 2010; 7(5:6-10

  17. Trends and challenges toward integration of traditional medicine in formal health-care system: Historical perspectives and appraisal of education curricula in Sub-Sahara Africa

    Science.gov (United States)

    Innocent, Ester

    2016-01-01

    The population residing Sub-Sahara Africa (SSA) continues to suffer from communicable health problems such as HIV/AIDS, malaria, tuberculosis, and various neglected tropical as well as non-communicable diseases. The disease burden is aggravated by shortage of medical personnel and medical supplies such as medical devices and minimal access to essential medicine. For long time, human beings through observation and practical experiences learned to use different plant species that led to the emergence of traditional medicine (TM) systems. The ancient Pharaonic Egyptian TM system is one of the oldest documented forms of TM practice in Africa and the pioneer of world’s medical science. However, the medical practices diffused very fast to other continents being accelerated by advancement of technologies while leaving Africa lagging behind in the integration of the practice in formal health-care system. Challenging issues that drag back integration is the development of education curricula for training TM experts as the way of disseminating the traditional medical knowledge and practices imbedded in African culture. The few African countries such as Ghana managed to integrate TM products in the National Essential Medicine List while South Africa, Sierra Leone, and Tanzania have TM products being sold over the counters due to the availability of education training programs facilitated by research. This paper analyses the contribution of TM practice and products in modern medicine and gives recommendations that Africa should take in the integration process to safeguard the SSA population from disease burdens. PMID:27366358

  18. Trends and challenges toward integration of traditional medicine in formal health-care system: Historical perspectives and appraisal of education curricula in Sub-Sahara Africa.

    Science.gov (United States)

    Innocent, Ester

    2016-01-01

    The population residing Sub-Sahara Africa (SSA) continues to suffer from communicable health problems such as HIV/AIDS, malaria, tuberculosis, and various neglected tropical as well as non-communicable diseases. The disease burden is aggravated by shortage of medical personnel and medical supplies such as medical devices and minimal access to essential medicine. For long time, human beings through observation and practical experiences learned to use different plant species that led to the emergence of traditional medicine (TM) systems. The ancient Pharaonic Egyptian TM system is one of the oldest documented forms of TM practice in Africa and the pioneer of world's medical science. However, the medical practices diffused very fast to other continents being accelerated by advancement of technologies while leaving Africa lagging behind in the integration of the practice in formal health-care system. Challenging issues that drag back integration is the development of education curricula for training TM experts as the way of disseminating the traditional medical knowledge and practices imbedded in African culture. The few African countries such as Ghana managed to integrate TM products in the National Essential Medicine List while South Africa, Sierra Leone, and Tanzania have TM products being sold over the counters due to the availability of education training programs facilitated by research. This paper analyses the contribution of TM practice and products in modern medicine and gives recommendations that Africa should take in the integration process to safeguard the SSA population from disease burdens.

  19. Practice as research in drama and theatre: Introducing narrative supervision methodology

    Directory of Open Access Journals (Sweden)

    Heli Aaltonen

    2014-07-01

    Full Text Available For four decades, the Norwegian University of Science and Technology, NTNU Trondheim, has pioneered the field of drama and theatre in higher education in Norway. This article addresses educational, academic and artistic challenges that emerge when practice as research in the arts enters the academic field of humanities. In particular, the article examines narrative supervision methodology at the master’s level. The first part of the paper identifies the foundations of the contextual and methodological challenges. The main body of the article explores three discussion topics, each illustrated by case examples of practical-theoretical master’s projects. The first example investigates experiential and theoretical borderland tensions; the second addresses onto-epistemic questions; and the third explores the communication of complex narrative construction. Storytelling metaphors are used to advance our emphasis on narrative inquiry as practitioner-researchers and supervisors. The dilemmas outlined are relevant to the Nordic and international community currently navigating this relatively new research area.

  20. Plagiarism challenges at Ukrainian science and education

    Directory of Open Access Journals (Sweden)

    Denys Svyrydenko

    2016-12-01

    Full Text Available The article analyzes the types and severity of plagiarism violations at the modern educational and scientific spheres using the philosophic methodological approaches. The author analyzes Ukrainian context as well as global one and tries to formulate "order of the day" of plagiarism challenges. The plagiarism phenomenon is intuitively comprehensible for academicians but in reality it has a very complex nature and a lot of manifestation. Using approaches of ethics, philosophical anthropology, philosophy of science and education author formulates the series of recommendation for overcoming of plagiarism challenges at Ukrainian science and education.

  1. Contextual factors, methodological principles and teacher cognition

    Directory of Open Access Journals (Sweden)

    Rupert Walsh

    2014-01-01

    Full Text Available Teachers in various contexts worldwide are sometimes unfairly criticized for not putting teaching methods developed for the well-resourced classrooms of Western countries into practice. Factors such as the teachers’ “misconceptualizations” of “imported” methods, including Communicative Language Teaching (CLT, are often blamed, though the challenges imposed by “contextual demands,” such as large class sizes, are sometimes recognised. Meanwhile, there is sometimes an assumption that in the West there is a happy congruence between policy supportive of CLT or Task-Based Language Teaching, teacher education and supervision, and curriculum design with teachers’ cognitions and their practices. Our case study of three EFL teachers at a UK adult education college is motivated by a wish to question this assumption. Findings from observational and interview data suggest the practices of two teachers were largely consistent with their methodological principles, relating to stronger and weaker forms of CLT respectively, as well as to more general educational principles, such as a concern for learners; the supportive environment seemed to help. The third teacher appeared to put “difficult” contextual factors, for example, tests, ahead of methodological principles without, however, obviously benefiting. Implications highlight the important role of teacher cognition research in challenging cultural assumptions.

  2. Characteristic interviews, different strategies: Methodological challenges in qualitative interviewing among respondents with mild intellectual disabilities.

    Science.gov (United States)

    Sigstad, Hanne Marie Høybråten

    2014-06-01

    Conducting qualitative research interviews among individuals with intellectual disabilities, including cognitive limitations and difficulties in communication, presents particular research challenges. One question is whether the difficulties that informants encounter affect interviews to such an extent that the validity of the results is weakened. This article focuses on voluntary informed consent and the specific challenges with the greatest effects on such interviews. The discussion shows that complementary and meaningful descriptions from informants imply the need to employ alternative strategies and methods that may, in other contexts, challenge the traditional understanding of what is acceptable in research. © The Author(s) 2014.

  3. DRIVERS OF E-GOVERNMENT MATURITY IN TWO DEVELOPING REGIONS: FOCUS ON LATIN AMERICA AND SUB-SAHARAN AFRICA

    Directory of Open Access Journals (Sweden)

    Princely Ifinedo

    2012-04-01

    Full Text Available This research focuses on the determinants of e-government (E-gov maturity in two comparable regions of the world i.e. Latin America and Sub-Saharan Africa (LA&SSA. E-gov maturity refers to the growth levels in a country’s online services and its citizens’ online participation in governance. To date, few researchers have focused on the determinants of E-gov maturity in LA&SSA. Given the challenges faced by LA&SSA with regard to the implementations and deployment of technological innovations including E-gov, research such as this current one is needed to enrich insight in such contexts. Building on a prior framework and the modernization theory, the impacts of macro-environmental factors of political, economic, social, and technological dimensions on E-gov maturity in LA&SSA are examined. A 5-year panel data consisting of 160 observations or data points was used for analysis in conjunction with structural equation modeling. The data analysis underscored the pertinence of some of the factors on E-gov maturity in LA&SSA. The implications of the study’s findings for research and policy making are discussed.

  4. Temperature biofeedback and sleep: limited findings and methodological challenges

    Directory of Open Access Journals (Sweden)

    De Koninck J

    2012-10-01

    Full Text Available Geneviève Forest,1,2 Cameron van den Heuvel,3 Kurt Lushington,4 Joseph De Koninck21Sleep Laboratory, Département de Psychoéducation et de Psychologie, Université du Québec en Outaouais, Gatineau, Québec, Canada; 2Sleep and Dreams Laboratory, School of Psychology, University of Ottawa, Ottawa, Ontario, Canada; 3Research Branch University of Adelaide, South Australia, Australia; 4School of Psychology, Social Work and Social Policy, University of South Australia, South Australia, AustraliaAbstract: Given the close link between body temperature and sleep, the perspective of manipulating core and peripheral temperature by self-regulation techniques is very appealing. We report here on a series of attempts conducted independently in two laboratories to use self-regulation (biofeedback of oral (central and hand (peripheral temperature, and measured the impact on sleep-onset latency, sleep architecture, and circadian phase. We found that hand temperature was more successful than oral temperature biofeedback. Moreover, an increase in hand temperature was associated with reduced sleep-onset latency. However, most participants found the procedure difficult to implement. The temperature response to biofeedback was reduced in the aged and weakest at the time of sleep onset, and there was not a systematic relationship between the change in temperature and change in sleep latency. Methodological limitations and individual differences may account for these results. Recommendations for future research are presented.Keywords: biofeedback, core body temperature, sleep, circadian rhythm, sleep onset

  5. Development of Geometry Optimization Methodology with In-house CFD code, and Challenge in Applying to Fuel Assembly

    International Nuclear Information System (INIS)

    Jeong, J. H.; Lee, K. L.

    2016-01-01

    The wire spacer has important roles to avoid collisions between adjacent rods, to mitigate a vortex induced vibration, and to enhance convective heat transfer by wire spacer induced secondary flow. Many experimental and numerical works has been conducted to understand the thermal-hydraulics of the wire-wrapped fuel bundles. There has been enormous growth in computing capability. Recently, a huge increase of computer power allows to three-dimensional simulation of thermal-hydraulics of wire-wrapped fuel bundles. In this study, the geometry optimization methodology with RANS based in-house CFD (Computational Fluid Dynamics) code has been successfully developed in air condition. In order to apply the developed methodology to fuel assembly, GGI (General Grid Interface) function is developed for in-house CFD code. Furthermore, three-dimensional flow fields calculated with in-house CFD code are compared with those calculated with general purpose commercial CFD solver, CFX. The geometry optimization methodology with RANS based in-house CFD code has been successfully developed in air condition. In order to apply the developed methodology to fuel assembly, GGI function is developed for in-house CFD code as same as CFX. Even though both analyses are conducted with same computational meshes, numerical error due to GGI function locally occurred in only CFX solver around rod surface and boundary region between inner fluid region and outer fluid region.

  6. Life history theory and breast cancer risk: methodological and theoretical challenges: Response to "Is estrogen receptor negative breast cancer risk associated with a fast life history strategy?".

    Science.gov (United States)

    Aktipis, Athena

    2016-01-01

    In a meta-analysis published by myself and co-authors, we report differences in the life history risk factors for estrogen receptor negative (ER-) and estrogen receptor positive (ER+) breast cancers. Our meta-analysis did not find the association of ER- breast cancer risk with fast life history characteristics that Hidaka and Boddy suggest in their response to our article. There are a number of possible explanations for the differences between their conclusions and the conclusions we drew from our meta-analysis, including limitations of our meta-analysis and methodological challenges in measuring and categorizing estrogen receptor status. These challenges, along with the association of ER+ breast cancer with slow life history characteristics, may make it challenging to find a clear signal of ER- breast cancer with fast life history characteristics, even if that relationship does exist. The contradictory results regarding breast cancer risk and life history characteristics illustrate a more general challenge in evolutionary medicine: often different sub-theories in evolutionary biology make contradictory predictions about disease risk. In this case, life history models predict that breast cancer risk should increase with faster life history characteristics, while the evolutionary mismatch hypothesis predicts that breast cancer risk should increase with delayed reproduction. Whether life history tradeoffs contribute to ER- breast cancer is still an open question, but current models and several lines of evidence suggest that it is a possibility. © The Author(s) 2016. Published by Oxford University Press on behalf of the Foundation for Evolution, Medicine, and Public Health.

  7. Managing Forest Resources in Sub-Saharan Africa : Issues and Challenges

    OpenAIRE

    Narenda P. Sharma; Simon Reitbergen; Claude R. Heimo; Joti Patel

    1994-01-01

    The note summarizes the findings of the Africa Forest Strategy Paper, which responded to the problems confronting forest resources in the Sub-Saharan Africa (SSA), providing a comprehensive overview, and analysis of the forest sector, and mapping a set of actions for consideration by African countries. The diagnosis highlights the nexus between rapid population growth, environmental degrad...

  8. Cognitive models of executive functions development: methodological limitations and theoretical challenges

    Directory of Open Access Journals (Sweden)

    Florencia Stelzer

    2014-01-01

    Full Text Available Executive functions (EF have been defined as a series of higher-order cognitive processes which allow the control of thought, behavior and affection according to the achievement of a goal. Such processes present a lengthy postnatal development which matures completely by the end of adolescence. In this article we make a review of some of the main models of EF development during childhood. The aim of this work is to describe the state of the art related to the topic, identifying the main theoretical difficulties and methodological limitations associated with the different proposed paradigms. Finally, some suggestions are given to cope with such difficulties, emphasizing that the development of an ontology of EF could be a viable alternative to counter them. We believe that futture researches should guide their efforts toward the development of that ontology.

  9. SUSTAINABILITY ASSESSMENT IN URBAN PLANNING. A CHALLENGE FOR A METHODOLOGICAL CONSTRUCTION: MONTREAL AS CASE STUDY

    Directory of Open Access Journals (Sweden)

    María de Lourdes Flores Lucero

    2014-09-01

    Full Text Available In this paper we describe the methodological process for the qualitative evaluation of the concept of sustainability and its application in the island of Montreal. At the same time we present our theoretical approach and the main results issued of the assessment. We take as analytical tools the Montreal Urban Plan of 2004 and the Strategic Plan for Sustainable Development 2005. We conclude with two main points, first, that the theoretical and pragmatic aspects of urban sustainability in Montreal have been treated in an organic, complex, dynamic and flexible way, allowing social participation and the inclusion of the values of all stakeholders, which are both key elements to follow the path towards sustainability; and secondly, that the approach to an object with such features requires the construction of complex, organic and methodological processes.

  10. Monitoring challenges and innovative ideas

    Energy Technology Data Exchange (ETDEWEB)

    O' Neill, R.V.; Hunsaker, C.T.; Levine, D.A.

    1990-01-01

    Monitoring programs are difficult to design even when they focus on specific problems. Ecosystems are complex, and it is often impossible to predetermine what aspects of system structure or dynamics will respond to a specific insult. It is equally difficult to interpret whether a response is a stabilizing compensatory mechanism or a real loss of capacity to maintain the ecosystem. The problems are compounded in a broad monitoring program designed to assess ecosystem health'' at regional and continental scales. It is challenging in the extreme to monitor ecosystem response, at any scale, to past insults as well as an unknown future array of impacts. The present paper will examine some of the fundamental issues and challenges raised by large-scale monitoring efforts. The challenges will serve as a framework and as an excuse to discuss several important topics in more detail. Following the discussion of challenges, we suggest some basic innovations that could be important across a range of monitoring programs. The innovations include integrative measures, innovative methodology, and creative interpretation. 59 refs., 1 tab.

  11. Launching of New Pharmaceutical Product and Promotional Challenges

    OpenAIRE

    Manish Gunjan; Jegathambigai Rameshwar Naidu; Ishab Kumar; Yogesh Kumar

    2016-01-01

    ABSTRACT Purpose: The purpose of the study was to find out the basic challenges and major aspects in launching of new pharmaceutical products, and the usual way to overcome with the concerned challenges. The second most important purpose was to find out the role of innovative and creative way in promotion of new pharmaceutical product and its impact on their market value. Methodology: I went through questionnaire based survey on 10 medical representatives and 10 doctors respectively to find o...

  12. CHALLENGE TESTS WITH LISTERIA MONOCYTOGENES IN SALAMI: PRELIMINARY RESULTS

    Directory of Open Access Journals (Sweden)

    R. Mioni

    2013-02-01

    Full Text Available Challenge tests are the preferable methodology to study the behaviour of Listeria monocytogenes on ready to eat foods, according to Regulation (EC 2073/2005. Challenge testing using L. monocytogenes in seasoned salami from different food business operators showed, after seasoning of the product, a count reduction of the inoculated organisms without any further growth of the pathogen; however differences of L. monocytogenes behaviour could be observed according to different production protocols.

  13. Psychometric challenges and proposed solutions when scoring facial emotion expression codes

    OpenAIRE

    Olderbak, Sally; Hildebrandt, Andrea; Pinkpank, Thomas; Sommer, Werner; Wilhelm, Oliver

    2013-01-01

    Coding of facial emotion expressions is increasingly performed by automated emotion expression scoring software; however, there is limited discussion on how best to score the resulting codes. We present a discussion of facial emotion expression theories and a review of contemporary emotion expression coding methodology. We highlight methodological challenges pertinent to scoring software-coded facial emotion expression codes and present important psychometric research questions centered on co...

  14. Discovering the Effects-Endstate Linkage: Using Soft Systems Methodology to Perform EBO Mission Analysis

    National Research Council Canada - National Science Library

    Young, Jr, William E

    2005-01-01

    .... EBO mission analysis is shown to be more problem structuring than problem solving. A new mission analysis process is proposed using a modified version of Soft Systems Methodology to meet these challenges...

  15. Process evaluation of community monitoring under national health mission at Chandigarh, union territory: Methodology and challenges

    Directory of Open Access Journals (Sweden)

    Jaya Prasad Tripathy

    2015-01-01

    Full Text Available Background: Community monitoring was introduced on a pilot mode in 36 selected districts of India in a phased manner. In Chandigarh, it was introduced in the year 2009-2010. A preliminary evaluation of the program was undertaken with special emphasis on the inputs and the processes. Methodology: Quantitative methods included verification against checklists and record reviews. Nonparticipant observation was used to evaluate the conduct of trainings, interviews, and group discussions. Health system had trained health system functionaries (nursing students and Village Health Sanitation Committee [VHSC] members to generate village-based scorecards for assessing community needs. Community needs were assessed independently for two villages under the study area to validate the scores generated by the health system. Results: VHSCs were formed in all 22 villages but without a chairperson or convener. The involvement of VHSC members in the community monitoring process was minimal. The conduct of group discussions was below par due to poor moderation and unequal responses from the group. The community monitoring committees at the state level had limited representation from the non-health sector, lower committees, and the nongovernmental organizations/civil societies. Agreement between the report cards generated by the investigator and the health system in the selected villages was found to be to be fair (0.369 whereas weighted kappa (0.504 was moderate. Conclusion: In spite of all these limitations and challenges, the government has taken a valiant step by trying to involve the community in the monitoring of health services. The dynamic nature of the community warrants incorporation of an evaluation framework into the planning of such programs.

  16. Gotta survey somebody : Methodological challenges in population studies of older people

    OpenAIRE

    Kelfve, Susanne

    2015-01-01

    Conducting representative surveys of older people is challenging. This thesis aims to analyze a) the characteristics of individuals at risk of being underrepresented in surveys of older people, b) the systematic errors likely to occur as a result of these selections, and c) whether these systematic errors can be minimized by weighting adjustments.   In Study I, we investigated a) who would be missing from a survey that excluded those living in institutions and that did not use indirect interv...

  17. Methodology for Validation of Housing Standards - the Kitchen as an Example

    DEFF Research Database (Denmark)

    Helle, Tina; Iwarsson, Susanne; Brandt, Åse

    We will present a novel methodology to validate housing standards. Person-environment fit among older persons with different levels of mobility device dependence was investigated during performance of everyday activities in realistic environments. Observational and self-report data were compared...... difficulties in rating accessibility problems. The actual use of mobility devices form part of the activity performance. Some standards are not defined properly to enable activity performance in realistic environments. After attending this activity, participants will be: • Aware of some of the methodological...... challenges concerning sampling and the measurement of accessibility problems among older people with different levels of dependence in mobility device use • Aware of the implications of using observation versus self-report data in research on person-environment fit • Consider the methodological implications...

  18. Value-Creating Networks: Organizational Issues and Challenges

    Science.gov (United States)

    Allee, Verna

    2009-01-01

    Purpose: The purpose of this paper is to provide examples of evaluating value-creating networks and to address the organizational issues and challenges of a network orientation. Design/methodology/approach: Value network analysis was first developed in 1993 and was adapted in 1997 for intangible asset management. It has been applied from shopfloor…

  19. Intelligent systems engineering methodology

    Science.gov (United States)

    Fouse, Scott

    1990-01-01

    An added challenge for the designers of large scale systems such as Space Station Freedom is the appropriate incorporation of intelligent system technology (artificial intelligence, expert systems, knowledge-based systems, etc.) into their requirements and design. This presentation will describe a view of systems engineering which successfully addresses several aspects of this complex problem: design of large scale systems, design with requirements that are so complex they only completely unfold during the development of a baseline system and even then continue to evolve throughout the system's life cycle, design that involves the incorporation of new technologies, and design and development that takes place with many players in a distributed manner yet can be easily integrated to meet a single view of the requirements. The first generation of this methodology was developed and evolved jointly by ISX and the Lockheed Aeronautical Systems Company over the past five years on the Defense Advanced Research Projects Agency/Air Force Pilot's Associate Program, one of the largest, most complex, and most successful intelligent systems constructed to date. As the methodology has evolved it has also been applied successfully to a number of other projects. Some of the lessons learned from this experience may be applicable to Freedom.

  20. A hierarchical modeling methodology for the definition and selection of requirements

    Science.gov (United States)

    Dufresne, Stephane

    This dissertation describes the development of a requirements analysis methodology that takes into account the concept of operations and the hierarchical decomposition of aerospace systems. At the core of the methodology, the Analytic Network Process (ANP) is used to ensure the traceability between the qualitative and quantitative information present in the hierarchical model. The proposed methodology is implemented to the requirements definition of a hurricane tracker Unmanned Aerial Vehicle. Three research objectives are identified in this work; (1) improve the requirements mapping process by matching the stakeholder expectations with the concept of operations, systems and available resources; (2) reduce the epistemic uncertainty surrounding the requirements and requirements mapping; and (3) improve the requirements down-selection process by taking into account the level of importance of the criteria and the available resources. Several challenges are associated with the identification and definition of requirements. The complexity of the system implies that a large number of requirements are needed to define the systems. These requirements are defined early in the conceptual design, where the level of knowledge is relatively low and the level of uncertainty is large. The proposed methodology intends to increase the level of knowledge and reduce the level of uncertainty by guiding the design team through a structured process. To address these challenges, a new methodology is created to flow-down the requirements from the stakeholder expectations to the systems alternatives. A taxonomy of requirements is created to classify the information gathered during the problem definition. Subsequently, the operational and systems functions and measures of effectiveness are integrated to a hierarchical model to allow the traceability of the information. Monte Carlo methods are used to evaluate the variations of the hierarchical model elements and consequently reduce the

  1. Eco-analytical Methodology in Environmental Problems Monitoring

    Science.gov (United States)

    Agienko, M. I.; Bondareva, E. P.; Chistyakova, G. V.; Zhironkina, O. V.; Kalinina, O. I.

    2017-01-01

    Among the problems common to all mankind, which solutions influence the prospects of civilization, the problem of ecological situation monitoring takes very important place. Solution of this problem requires specific methodology based on eco-analytical comprehension of global issues. Eco-analytical methodology should help searching for the optimum balance between environmental problems and accelerating scientific and technical progress. The fact that Governments, corporations, scientists and nations focus on the production and consumption of material goods cause great damage to environment. As a result, the activity of environmentalists is developing quite spontaneously, as a complement to productive activities. Therefore, the challenge posed by the environmental problems for the science is the formation of geo-analytical reasoning and the monitoring of global problems common for the whole humanity. So it is expected to find the optimal trajectory of industrial development to prevent irreversible problems in the biosphere that could stop progress of civilization.

  2. Analysis of Challenges for Management Education in India Using Total Interpretive Structural Modelling

    Science.gov (United States)

    Mahajan, Ritika; Agrawal, Rajat; Sharma, Vinay; Nangia, Vinay

    2016-01-01

    Purpose: The purpose of this paper is to identify challenges for management education in India and explain their nature, significance and interrelations using total interpretive structural modelling (TISM), an innovative version of Warfield's interpretive structural modelling (ISM). Design/methodology/approach: The challenges have been drawn from…

  3. Water Footprint Symposium: where next for water footprint and water assessment methodology?

    NARCIS (Netherlands)

    Tillotson, M.R.; Kiu, J.; Guan, D.; Wu, P.; Zhao, Xu; Zhang, Guoping; Pfister, S.; Pahlow, Markus

    2014-01-01

    Recognizing the need for a comprehensive review of the tools and metrics for the quantification and assessment of water footprints, and allowing for the opportunity for open discussion on the challenges and future of water footprinting methodology, an international symposium on water footprint was

  4. Water Footprint Symposium : where next for water footprint and water assessment methodology?

    NARCIS (Netherlands)

    Tillotson, Martin R.; Liu, Junguo; Guan, Dabo; Wu, Pute; Zhao, Xu; Zhang, Guoping; Pfister, Stephan; Pahlow, Markus

    2014-01-01

    Recognizing the need for a comprehensive review of the tools and metrics for the quantification and assessment of water footprints, and allowing for the opportunity for open discussion on the challenges and future of water footprinting methodology, an international symposium on water footprint was

  5. Singing for respiratory health: theory, evidence and challenges.

    Science.gov (United States)

    Gick, Mary L; Nicol, Jennifer J

    2016-09-01

    The premise that singing is a health promoting activity for people with respiratory conditions of chronic obstructive pulmonary disease (COPD) and asthma is a growing area of interest being investigated by researchers from various disciplines. The preliminary evidence, a theoretical framework and identification of methodological challenges are discussed in this perspective article with an eye to recommendations for further research to advance knowledge. After a brief summary of main research findings on singing in healthy people to provide background context, research is reviewed on singing in people with COPD and asthma. Studies include published research and as yet unpublished work by the authors. Methodological challenges arising from the reviewed studies are identified such as attrition from singing or control groups based on weak and strong, respectively, beliefs about singing's effectiveness. Potential solutions for these problems are considered with further recommendations made for other singing research. © The Author 2015. Published by Oxford University Press. All rights reserved. For Permissions, please email: journals.permissions@oup.com.

  6. Challenges in data science: a complex systems perspective

    International Nuclear Information System (INIS)

    Carbone, Anna; Jensen, Meiko; Sato, Aki-Hiro

    2016-01-01

    The ability to process and manage large data volumes has been proven to be not enough to tackle the current challenges presented by “Big Data”. Deep insight is required for understanding interactions among connected systems, space- and time- dependent heterogeneous data structures. Emergence of global properties from locally interacting data entities and clustering phenomena demand suitable approaches and methodologies recently developed in the foundational area of Data Science by taking a Complex Systems standpoint. Here, we deal with challenges that can be summarized by the question: “What can Complex Systems Science contribute to Big Data? ”. Such question can be reversed and brought to a superior level of abstraction by asking “What Knowledge can be drawn from Big Data?” These aspects constitute the main motivation behind this article to introduce a volume containing a collection of papers presenting interdisciplinary advances in the Big Data area by methodologies and approaches typical of the Complex Systems Science, Nonlinear Systems Science and Statistical Physics.

  7. Open Government Data Publication Methodology

    Directory of Open Access Journals (Sweden)

    Jan Kucera

    2015-04-01

    Full Text Available Public sector bodies hold a significant amount of data that might be of potential interest to citizens and businesses. However the re-use potential of this data is still largely untapped because the data is not always published in a way that would allow its easy discovery, understanding and re-use. Open Government Data (OGD initiatives aim at increasing availability of machine-readable data provided under an open license and therefore these initiatives might facilitate re-use of the government data which in turn might lead to increased transparency and economic growth. However the recent studies show that still only a portion of data provided by the public sector bodies is truly open. Public sector bodies face a number of challenges when publishing OGD and they need to address the relevant risks. Therefore there is a need for best practices and methodologies for publication of OGD that would provide the responsible persons with a clear guidance on how the OGD initiatives should be implemented and how the known challenges and risks should be addressed.

  8. Narrative inquiry: a relational research methodology for medical education.

    Science.gov (United States)

    Clandinin, D Jean; Cave, Marie T; Berendonk, Charlotte

    2017-01-01

    Narrative research, an inclusive term for a range of methodologies, has rapidly become part of medical education scholarship. In this paper we identify narrative inquiry as a particular theoretical and methodological framework within narrative research and outline its characteristics. We briefly summarise how narrative research has been used in studying medical learners' identity making in medical education. We then turn to the uses of narrative inquiry in studying medical learners' professional identity making. With the turn to narrative inquiry, the shift is to thinking with stories instead of about stories. We highlight four challenges in engaging in narrative inquiry in medical education and point toward promising future research and practice possibilities. © 2016 John Wiley & Sons Ltd and The Association for the Study of Medical Education.

  9. Challenges of Postmodern Thought in Christian Higher Education Institutions: Implications for Ethical Leadership

    Science.gov (United States)

    Darroux, Dean A.

    2013-01-01

    The study investigated the question: What is the process that Christian higher education administrators and faculty members used when understanding the challenges of postmodern thought at the institutions, and what are the challenges for ethical leadership? Utilizing a grounded theory methodology, the researcher sought to develop a theory that…

  10. VCS-SSA Mainz Experiment. Measurement of the beam spin asymmetry in (e polarized p {yields} ep{gamma}) and (e polarized p {yields} ep{pi}{sup 0}). Final analysis - MEMO II

    Energy Technology Data Exchange (ETDEWEB)

    Fonvieille, H.; Bensafa, I. [LPC-Clermont-Fd, Universite Blaise Pascal, F-63170 Aubiere Cedex (France)

    2006-06-15

    MEMO-I was written in February 2006 to give details of the second pass analysis of the VCS-SSA experiment. Since then there was our VCS Meeting in March, the production of the PhD thesis by I. Bensafa in May, and complementary studies of the asymmetry which triggered some afterthoughts. Instead of updating MEMO-I which is long enough this memo summarizes these complementary remarks and proposes asymmetry results which are more finalized in view of publication. Various nomenclatures like cuts, variables,etc. have NOT been redefined: please read MEMO-I for that. (authors)

  11. Challenges to the Indicators on Science, Technology and Innovation Development

    OpenAIRE

    Chobanova, Rossitsa

    2006-01-01

    The paper attempts to define the challenges to the indicators on science, technology and innovation development which result from the contemporary dynamics of the global knowledge based economy progress and the pursued challenges of identification of the specific national priority dimensions for public funding research and innovation projects on the case of Bulgaria. It is argued that recent the most widespread methodologies of positioning science, technology and innovation indicators do not ...

  12. Robust Imaging Methodology for Challenging Environments: Wave Equation Dispersion Inversion of Surface Waves

    KAUST Repository

    Li, Jing; Schuster, Gerard T.; Zeng, Zhaofa

    2017-01-01

    A robust imaging technology is reviewed that provide subsurface information in challenging environments: wave-equation dispersion inversion (WD) of surface waves for the shear velocity model. We demonstrate the benefits and liabilities of the method

  13. Challenged assumptions and invisible effects

    DEFF Research Database (Denmark)

    Wimmelmann, Camilla Lawaetz; Vitus, Kathrine; Jervelund, Signe Smith

    2017-01-01

    for the implementation—different from the assumed conditions—not only challenge the implementation of the intervention but also potentially produce unanticipated yet valuable effects. Research implications – Newly arrived immigrants represent a hugely diverse and heterogeneous group of people with differing values......Purpose – The objective of this study was to examine any unanticipated effects of an educational intervention among newly arrived adult immigrants attending a language school in Denmark. Methodology – A qualitative case study was conducted including interviews with nine informants, observations....... In particular, the assumed (power) relations inherent in immigrant-oriented educational health interventions, in which immigrants are in a novice position, are challenged, as the immigrants are experienced adults (and parents) in regard to healthcare. The paper proposes that such unexpected conditions...

  14. Challenges and status of multi-unit PSA development in Canada

    International Nuclear Information System (INIS)

    Yalaoui, Smain

    2015-01-01

    Firstly, this paper discusses the issues and challenges related to the development of a Multi-Unit PSA (MU-PSA) and the general recommendations and conclusions from the MU-PSA Workshop organized by the CNSC in Ottawa, November 2014. This includes a discussion regarding the issue related to the methodological challenges in performing MU-PSA, the site-based risk metrics to be adopted, and the issue of risk aggregation across all hazards and all units. The paper also addresses the challenges for establishing site-based safety goals as the current safety goals were established on a per-unit basis. CNSC Staff efforts, both at the national and international level, on developing whole-site safety goals and guidance on MU-PSA and risk aggregation methodologies will also be discussed. Finally, the paper will provide a summary of the industry effort and road map for completing the pilot Whole-site PSA project for the Pickering Nuclear Generating Station, as requested by the Commission following to the public hearing for licence renewal in February 20 and May 29-31, 2013. (author)

  15. Organizational Culture and Scale Development: Methodological Challenges and Future Directions

    Directory of Open Access Journals (Sweden)

    Bavik Ali

    2014-12-01

    Full Text Available Defining and measuring organizational culture (OC is of paramount importance to organizations because a strong culture could potentially increase service quality and yield sustainable competitive advantages. However, such process could be challenging to managers because the scope of OC has been defined differently across disciplines and industries, which has led to the development of various scales for measuring OC. In addition, previously developed OC scales may also not be fully applicable in the hospitality and tourism context. Therefore, by highlighting the key factors affecting the business environment and the unique characteristics of hospitality industry, this paper aims to align the scope of OC closely with the industry and to put forth the need for a new OC scale that accurately responds to the context of the hospitality industry.

  16. Culturally Competent Social Work Research: Methodological Considerations for Research with Language Minorities

    Science.gov (United States)

    Casado, Banghwa Lee; Negi, Nalini Junko; Hong, Michin

    2012-01-01

    Despite the growing number of language minorities, foreign-born individuals with limited English proficiency, this population has been largely left out of social work research, often due to methodological challenges involved in conducting research with this population. Whereas the professional standard calls for cultural competence, a discussion…

  17. Turbofan Engine Core Compartment Vent Aerodynamic Configuration Development Methodology

    Science.gov (United States)

    Hebert, Leonard J.

    2006-01-01

    This paper presents an overview of the design methodology used in the development of the aerodynamic configuration of the nacelle core compartment vent for a typical Boeing commercial airplane together with design challenges for future design efforts. Core compartment vents exhaust engine subsystem flows from the space contained between the engine case and the nacelle of an airplane propulsion system. These subsystem flows typically consist of precooler, oil cooler, turbine case cooling, compartment cooling and nacelle leakage air. The design of core compartment vents is challenging due to stringent design requirements, mass flow sensitivity of the system to small changes in vent exit pressure ratio, and the need to maximize overall exhaust system performance at cruise conditions.

  18. The Health Behaviour in School-aged Children (HBSC) study: methodological developments and current tensions

    DEFF Research Database (Denmark)

    Roberts, Chris; Freeman, John; Samdal, Oddrun

    2009-01-01

    OBJECTIVES: To describe the methodological development of the HBSC survey since its inception and explore methodological tensions that need to be addressed in the ongoing work on this and other large-scale cross-national surveys. METHODS: Using archival data and conversations with members...... of the network, we collaboratively analysed our joint understandings of the survey's methodology. RESULTS: We identified four tensions that are likely to be present in upcoming survey cycles: (1) maintaining quality standards against a background of rapid growth, (2) continuous improvement with limited financial...... in working through such challenges renders it likely that HBSC can provide a model of other similar studies facing these tensions....

  19. Getting People Involved: The Benefit of Intellectual Capital Management for Addressing HR Challenges

    Science.gov (United States)

    Pook, Katja

    2011-01-01

    Purpose: This paper aims to explore the benefits of intellectual capital assessment for facing current challenges of human resources work and organizational development. Design/methodology/approach: The paper takes findings of studies on challenges in HR work and maps them with features of intellectual capital assessment methods. It is thus a…

  20. Methodological challenges and analytic opportunities for modeling and interpreting Big Healthcare Data.

    Science.gov (United States)

    Dinov, Ivo D

    2016-01-01

    Managing, processing and understanding big healthcare data is challenging, costly and demanding. Without a robust fundamental theory for representation, analysis and inference, a roadmap for uniform handling and analyzing of such complex data remains elusive. In this article, we outline various big data challenges, opportunities, modeling methods and software techniques for blending complex healthcare data, advanced analytic tools, and distributed scientific computing. Using imaging, genetic and healthcare data we provide examples of processing heterogeneous datasets using distributed cloud services, automated and semi-automated classification techniques, and open-science protocols. Despite substantial advances, new innovative technologies need to be developed that enhance, scale and optimize the management and processing of large, complex and heterogeneous data. Stakeholder investments in data acquisition, research and development, computational infrastructure and education will be critical to realize the huge potential of big data, to reap the expected information benefits and to build lasting knowledge assets. Multi-faceted proprietary, open-source, and community developments will be essential to enable broad, reliable, sustainable and efficient data-driven discovery and analytics. Big data will affect every sector of the economy and their hallmark will be 'team science'.

  1. Methodological challenges to multivariate syndromic surveillance: a case study using Swiss animal health data.

    Science.gov (United States)

    Vial, Flavie; Wei, Wei; Held, Leonhard

    2016-12-20

    potential to address more realistic surveillance scenarios through, for example, the inclusion of times series specific parameters, or of covariates known to have an impact on syndrome counts. Nevertheless, many methodological challenges to multivariate surveillance of animal SyS data still remain. Deciding on the amount of corroboration among data streams that is required to escalate into an alert is not a trivial task given the sparse data on the events under consideration (e.g. disease outbreaks).

  2. Comparative Studies: historical, epistemological and methodological notes

    Directory of Open Access Journals (Sweden)

    Juan Ignacio Piovani

    2017-09-01

    Full Text Available In this article some historical, epistemological and methodological issues related to comparative studies in the social sciences are addressed, with specific reference to the field of education. The starting point is a discussion of the meaning of comparison, its logical structure and its presence in science and in everyday life. It follows the presentation and critical appraisal of the perspectives regarding comparison as a scientific method. It is argued that, even rejecting this restrictive meaning of comparison as a method, there is some consensus on the specificity of comparative studies within the social sciences. And in relation to them, the article address in more detail those studies that can be defined as trans-contextual (cross-national and cross-cultural, with emphasis on the main methodological and technical challenges they face. The socio-historical comparative perspective, which has gained importance in recent years in the field of education, is also discussed.

  3. Methodological challenges in indirect treatment comparisons: spotlight on a recent comparison of long-acting injectable aripiprazole versus paliperidone palmitate in the treatment of schizophrenia.

    Science.gov (United States)

    Singh, Arun; Gopal, Srihari; Kim, Edward; Mathews, Maju; Kern-Sliwa, Jennifer; Turkoz, Ibrahim; Wooller, Annette; Berlin, Jesse

    2018-03-01

    In a recent study, an indirect treatment comparison was performed to examine the relative efficacy and tolerability of aripiprazole once monthly and paliperidone palmitate once monthly. The authors concluded that the results may suggest relative advantages for aripiprazole once monthly over paliperidone palmitate once monthly in the short-term treatment of schizophrenia. However, the validity of the study is compromised as an indirect treatment comparison using extant data may violate important assumptions. Other methodological issues identified further highlight the challenges of performing indirect treatment comparisons.This is an open-access article distributed under the terms of the Creative Commons Attribution-Non Commercial-No Derivatives License 4.0 (CCBY-NC-ND), where it is permissible to download and share the work provided it is properly cited. The work cannot be changed in any way or used commercially without permission from the journal. http://creativecommons.org/licenses/by-nc-nd/4.0/.

  4. Evaluating electronic performance support systems: A methodology focused on future use-in-practice

    NARCIS (Netherlands)

    Collis, Betty; Verwijs, C.A.

    1995-01-01

    Electronic performance support systems, as an emerging type of software environment, present many new challenges in relation to effective evaluation. In this paper, a global approach to a 'usage-orientated' evaluation methodology for software product is presented, followed by a specific example of

  5. Engaging Australian Aboriginal narratives to challenge attitudes and create empathy in health care: a methodological perspective.

    Science.gov (United States)

    Wain, Toni; Sim, Moira; Bessarab, Dawn; Mak, Donna; Hayward, Colleen; Rudd, Cobie

    2016-06-02

    Unconscious bias and negative attitudes towards minority groups have detrimental effects on the way health care is, or is not, provided to these groups. Recognition of racist attitudes and behaviours as well as understanding clients' experiences of health and health care are pivotal to developing better health care strategies to positively impact on the quality and safety of care provided to Indigenous people. Indigenous research demands inclusive research processes and the use of culturally appropriate methodologies. This paper presents a methodological account of collecting narratives which accurately and respectfully reflect Aboriginal Australians' experiences with health care in Western Australia. The purpose of these narratives is to provide health students and professionals with an opportunity to 'walk-in the shoes' of Aboriginal people where face-to-face interaction is not feasible. With the incorporation of Indigenous peoples' voices being an important link in cultural safety, the project was led by an Indigenous Reference group, who encouraged active participation of Aboriginal people in all areas of the project. Using a phenomenological approach and guided by the Indigenous Reference group, yarning data collection was implemented to collect stories focusing on Aboriginal people's experiences with health care services. An open-access, on-line website was established to host education resources developed from these "yarns". Yarning provided a rich source of information on personal experiences and encouraged the story provider to recognise their facilitative role in the research process. While the methodology used in this project was lengthy and labour-intensive it afforded a respectful manner for story collection and highlighted several innate flaws when Western methods are applied to an Indigenous context. Engagement of an Indigenous Reference Group was pivotal to designing an appropriate methodology that incorporated the voices of Aboriginal people in a

  6. Challenges and benefits of digital workflow implementation in aerospace manufacturing engineering

    OpenAIRE

    Rojo Abollado, Jaime; Shehab, Essam; Bamforth, P.

    2017-01-01

    Companies who operate in highly regulated industries have further challenges to the usual competition, continuous cost reduction and product development challenges. To address these requirements companies optimise their business processes and change their applications and information systems to support their evolving way of doing business. Workflow management technology eases the achievement of these necessities by providing methodologies, software and tools to support business process mo...

  7. Private events: from methodological behaviorism to interbehaviorism

    Directory of Open Access Journals (Sweden)

    Roberto Bueno

    2011-09-01

    Full Text Available As supposed events being accessible to a unique observer, private events posit an interesting challenge to a behavioristic psychology. Three historical variants of behaviorism dealt with the problem of private events: methodological behaviorism, radical behaviorism and interbehaviorism. The basic argument of the two last views, and that distinguishes them from the former, is that private events are comprised into the scope of an objective science of behavior. The analysis of these accounts permits us to confirm a gradual advance in behavior theory, in dealing with this issue, toward a totally monistic view.

  8. Effectiveness of infrastructure asset management: challenges for public agencies

    NARCIS (Netherlands)

    Schraven, Daan; Hartmann, Andreas; Dewulf, Geert P.M.R.

    2011-01-01

    Purpose: The aim of this research is to better understand the decisions in infrastructure asset management at public agencies and the challenges of these agencies to improve the effectiveness of their decision making. Design/methodology/approach: Based on a literature review on asset management at

  9. Controlling aflatoxins in maize in Africa: strategies, challenges and opportunities for improvement

    Science.gov (United States)

    Maize (Zea mays) is the most important food staple in sub-Saharan Africa (SSA), accounting for up to 70% of the total human calorific intake (Byerlee and Hiesey, 1996; Martin et al., 2000). In southern Africa, per capita annual consumption of maize remains well over 100 kg, with countries such as Ma...

  10. Role-Based Access Control for Coalition Partners in Maritime Domain Awareness

    National Research Council Canada - National Science Library

    McDaniel, Christopher R; Tardy, Matthew L

    2005-01-01

    The need for Shared Situational Awareness (SSA) in accomplishing joint missions by coalition militaries, law enforcement, the intelligence community, and the private sector creates a unique challenge to providing access control...

  11. Ethical and methodological issues in research with Sami experiencing disability.

    Science.gov (United States)

    Melbøe, Line; Hansen, Ketil Lenert; Johnsen, Bjørn-Eirik; Fedreheim, Gunn Elin; Dinesen, Tone; Minde, Gunn-Tove; Rustad, Marit

    2016-01-01

    A study of disability among the indigenous Sami people in Norway presented a number of ethical and methodological challenges rarely addressed in the literature. The main study was designed to examine and understand the everyday life, transitions between life stages and democratic participation of Norwegian Sami people experiencing disability. Hence, the purpose of this article is to increase the understanding of possible ethical and methodological issues in research within this field. The article describes and discusses ethical and methodological issues that arose when conducting our study and identifies some strategies for addressing issues like these. The ethical and methodological issues addressed in the article are based on a qualitative study among indigenous Norwegian Sami people experiencing disability. The data in this study were collected through 31 semi-structured in-depth interviews with altogether 24 Sami people experiencing disability and 13 next of kin of Sami people experiencing disability (8 mothers, 2 fathers, 2 sister and 1 guardian). The researchers identified 4 main areas of ethical and methodological issues. We present these issues chronologically as they emerged in the research process: 1) concept of knowledge when designing the study, 2) gaining access, 3) data collection and 4) analysis and accountability. The knowledge generated from this study has the potential to benefit future health research, specifically of Norwegian Sami people experiencing disability, as well as health research concerning indigenous people in general, providing scientific-based insight into important ethical and methodological issues in research with indigenous people experiencing disability.

  12. Human resource management and technological challenges

    CERN Document Server

    Davim, J

    2014-01-01

    This book focuses on the challenges and changes that new technologies bring to human resources (HR) of modern organizations. It examines the technological implications of the last changes taking place and how they affect the management and motivation of human resources belonging to these organizations. It looks for ways to understand and perceive how organizational HR, individually and as a team, conceptualize, invent, adapt, define and use organizational technology, as well as how they are constrained by features of it. The book provides discussion and the exchange of information on principles, strategies, models, techniques, methodologies and applications of human resources management and technological challenges and changes in the field of industry, commerce and services.

  13. A pragmatic trial in the Rio de Janeiro subway to capture smokers for a quitline: methodological challenges and opportunities.

    Science.gov (United States)

    Szklo, André Salem; da Silva Freire Coutinho, Evandro; Reichenheim, Michael Eduardo

    2012-01-01

    According to the World Health Organization, smoking is an important cause of death worldwide. To encourage smoking cessation, persuasive messages can be used to raise smokers' risk perception. This article discusses challenges and solutions in designing a study to evaluate the effect of two different communication strategies ("gains from quitting" vs. "losses from continuing smoking") in encouraging calls to a quitline. The authors conducted an intervention study in two subway stations for 4 weeks, considering only 1 strategy per station. Large posters containing non-age-specific images and texts, on the basis of the theme"shortness of breath," were displayed on central dividing columns on the boarding platforms. Call rates from the selected stations, and respective rate ratios, overall and per study week, were calculated. Passengers who were smokers, exposed to the positive-content message, called on average 1.7 times more often than did those exposed to the negative-content message (p = .01). Moreover, call rate ratios did not decline over the 4 weeks of the study (p = .40). The effectiveness findings suggest that antismoking campaigns could use positive-content messages in order to recruit a larger smoker population. The proposed methodology can also be used to evaluate effectiveness of messages for "capturing" individuals with other health problems (e.g., alcohol abuse), thereby increasing its potential impact.

  14. Cardiac fibroblast transcriptome analyses support a role for interferogenic, profibrotic, and inflammatory genes in anti-SSA/Ro-associated congenital heart block.

    Science.gov (United States)

    Clancy, Robert M; Markham, Androo J; Jackson, Tanisha; Rasmussen, Sara E; Blumenberg, Miroslav; Buyon, Jill P

    2017-09-01

    The signature lesion of SSA/Ro autoantibody-associated congenital heart block (CHB) is fibrosis and a macrophage infiltrate, supporting an experimental focus on cues influencing the fibroblast component. The transcriptomes of human fetal cardiac fibroblasts were analyzed using two complementary approaches. Cardiac injury conditions were simulated in vitro by incubating human fetal cardiac fibroblasts with supernatants from macrophages transfected with the SSA/Ro-associated noncoding Y ssRNA. The top 10 upregulated transcripts in the stimulated fibroblasts reflected a type I interferon (IFN) response [e.g., IFN-induced protein 44-like (IFI44L), of MX dynamin-like GTPase (MX)1, MX2, and radical S -adenosyl methionine domain containing 2 (Rsad2)]. Within the fibrotic pathway, transcript levels of endothelin-1 (EDN1), phosphodiesterase (PDE)4D, chemokine (C-X-C motif) ligand (CXCL)2, and CXCL3 were upregulated, while others, including adenomedullin, RAP guanine nucleotide exchange factor 3 (RAPGEF3), tissue inhibitor of metalloproteinase (TIMP)1, TIMP3, and dual specificity phosphatase 1, were downregulated. Agnostic Database for Annotation, Visualization and Integrated Discovery analysis revealed a significant increase in inflammatory genes, including complement C3A receptor 1 (C3AR1), F2R-like thrombin/trypsin receptor 3, and neutrophil cytosolic factor 2. In addition, stimulated fibroblasts expressed high levels of phospho-MADS box transcription enhancer factor 2 [a substrate of MAPK5 (ERK5)], which was inhibited by BIX-02189, a specific inhibitor of ERK5. Translation to human disease leveraged an unprecedented opportunity to interrogate the transcriptome of fibroblasts freshly isolated and cell sorted without stimulation from a fetal heart with CHB and a matched healthy heart. Consistent with the in vitro data, five IFN response genes were among the top 10 most highly expressed transcripts in CHB fibroblasts. In addition, the expression of matrix-related genes

  15. A methodology to measure the degre of managerial innovation

    Directory of Open Access Journals (Sweden)

    Mustafa Batuhan Ayhan

    2014-01-01

    Full Text Available Purpose: The main objective of this study is to introduce the concept of managerial innovation and to propose a quantitative methodology to measure the degree of managerial innovation capability by analyzing the evolution of the techniques used for management functions.Design/methodology/approach: The methodology mainly focuses on the different techniques used for each management functions namely; Planning, Organizing, Leading, Controlling and Coordinating. These functions are studied and the different techniques used for them are listed. Since the techniques used for these management functions evolve in time due to technological and social changes, a methodology is required to measure the degree of managerial innovation capability. This competency is measured through an analysis performed to point out which techniques used for each of these functions.Findings: To check the validity and applicability of this methodology, it is implemented to a manufacturing company. Depending on the results of the implementation, enhancements are suggested to the company for each function to survive in the changing managerial conditionsResearch limitations/implications: The primary limitation of this study is the implementation area. Although the study is implemented in just a single manufacturing company, it is welcomed to apply the same methodology to measure the managerial innovation capabilities of other manufacturing companies. Moreover, the model is ready to be adapted to different sectors although it is mainly prepared for manufacturing sector.Originality/value: Although innovation management is widely studied, managerial innovation is a new concept and introduced to measure the capability to challenge the changes occur in managerial functions. As a brief this methodology aims to be a pioneer in the field of managerial innovation regarding the evolution of management functions. Therefore it is expected to lead more studies to inspect the progress of

  16. The Use of Kanban to Alleviate Collaboration and Communication Challenges of Global Software Development

    Directory of Open Access Journals (Sweden)

    Maureen Tanner

    2017-05-01

    Full Text Available Aim/Purpose: This paper aims to describe how various Kanban elements can help alleviate two prominent types of challenges, communication and collaboration in Global Software Development (GSD. Background: Iterative and Lean development methodologies like Kanban have gained significance in the software development industry, both in the co-located and globally distributed contexts. However, little is known on how such methodologies can help mitigate various challenges in that occur in a globally distributed software development context. Methodology: The study was conducted using a single-case study based on a general inductive approach to analysis and theory development. Through the literature review, collaboration and communication challenges that GSD teams face were identified. Data collected through semi-structured interviews was then inductively analyzed to describe how the case-study teams employed various Kanban elements to mitigate communication and collaboration challenges they face during GSD. Findings: The study found that some Kanban elements, when properly employed, can help alleviate collaboration and communication challenges that occur within GSD teams. These relate to Inclusion Criteria, Reverse Items, Kanban Board, Policies, Avatars, and Backlog. Contribution: The paper contributes to knowledge by proposing two simple concept maps that detail the specific types of communication and collaboration challenges which can be alleviated by the aforementioned Kanban elements in GSD. Recommendations for Practitioners: This paper is relevant to GSD teams who are seeking ways to enhance their team collaboration and communication as these are the most important elements that contribute to GSD project success. It is recommended that relevant Kanban elements be used to that effect, depending on the challenges that they aim to alleviate. Future Research: Future research can investigate the same research questions (or similar ones using a

  17. Impact of dust and smoke mixing on column-integrated aerosol properties from observations during a severe wildfire episode over Valencia (Spain).

    Science.gov (United States)

    Gómez-Amo, J L; Estellés, V; Marcos, C; Segura, S; Esteve, A R; Pedrós, R; Utrillas, M P; Martínez-Lozano, J A

    2017-12-01

    The most destructive wildfire experienced in Spain since 2004 occurred close to Valencia in summer 2012. A total of 48.500ha were affected by two wildfires, which were mostly active during 29-30 June. The fresh smoke plume was detected at the Burjassot measurement station simultaneously to a severe dust episode. We propose an empirical method to evaluate the dust and smoke mixing and its impact on the microphysical and optical properties. For this, we combine direct-sun measurements with a Cimel CE-318 sun-photometer with an inversion methodology, and the Mie theory to derive the column-integrated size distribution, single scattering albedo (SSA) and asymmetry parameter (g). The mixing of dust and smoke greatly increased the aerosol load and modified the background aerosol properties. Mineral dust increased the aerosol optical depth (AOD) up to 1, while the smoke plume caused an extreme AOD peak of 8. The size distribution of the mixture was bimodal, with a fine and coarse modes dominated by the smoke particles and mineral dust, respectively. The SSA and g for the dust-smoke mixture show a marked sensitivity on the smoke mixing-ratio, mainly at longer wavelengths. Mineral dust and smoke share a similar SSA at 440nm (~0.90), but with opposite spectral dependency. A small dust contribution to the total AOD substantially affects the SSA of the mixture, and also SSA at 1020nm increases from 0.87 to 0.95. This leads to a different spectral behaviour of SSA that changes from positive (smoke plume) to negative (dust), depending on the dust and smoke mixing-ratio. Copyright © 2017 Elsevier B.V. All rights reserved.

  18. Challenges to the Learning Organization in the Context of Generational Diversity and Social Networks

    Science.gov (United States)

    Kaminska, Renata; Borzillo, Stefano

    2018-01-01

    Purpose: The purpose of this paper is to gain a better understanding of the challenges to the emergence of a learning organization (LO) posed by a context of generational diversity and an enterprise social networking system (ESNS). Design/methodology/approach: This study uses a qualitative methodology based on an analysis of 20 semi-structured…

  19. Corporate Universities in China: Processes, Issues and Challenges

    Science.gov (United States)

    Qiao, June Xuejun

    2009-01-01

    Purpose: This study is intended to investigate the current status of corporate universities in China. It aims to explore the processes and practices of corporate universities in China, and discover the issues and challenges involved in building and running a corporate university in China. Design/methodology/approach: The heads of 11 well-known…

  20. Shaped 3D Singular Spectrum Analysis for Quantifying Gene Expression, with Application to the Early Zebrafish Embryo

    Directory of Open Access Journals (Sweden)

    Alex Shlemov

    2015-01-01

    Full Text Available Recent progress in microscopy technologies, biological markers, and automated processing methods is making possible the development of gene expression atlases at cellular-level resolution over whole embryos. Raw data on gene expression is usually very noisy. This noise comes from both experimental (technical/methodological and true biological sources (from stochastic biochemical processes. In addition, the cells or nuclei being imaged are irregularly arranged in 3D space. This makes the processing, extraction, and study of expression signals and intrinsic biological noise a serious challenge for 3D data, requiring new computational approaches. Here, we present a new approach for studying gene expression in nuclei located in a thick layer around a spherical surface. The method includes depth equalization on the sphere, flattening, interpolation to a regular grid, pattern extraction by Shaped 3D singular spectrum analysis (SSA, and interpolation back to original nuclear positions. The approach is demonstrated on several examples of gene expression in the zebrafish egg (a model system in vertebrate development. The method is tested on several different data geometries (e.g., nuclear positions and different forms of gene expression patterns. Fully 3D datasets for developmental gene expression are becoming increasingly available; we discuss the prospects of applying 3D-SSA to data processing and analysis in this growing field.

  1. Key Methodological Aspects of Translators' Training in Ukraine and in the USA

    Science.gov (United States)

    Skyba, Kateryna

    2015-01-01

    The diversity of international relations in the globalized world has influenced the role of a translator that is becoming more and more important. Translators' training institutions today are to work out and to implement the best teaching methodology taking into consideration the new challenges of modern multinational and multicultural society.…

  2. Commonalities and differences in infant feeding attitudes and practices in the context of HIV in sub-Saharan Africa: a metasynthesis.

    Science.gov (United States)

    Tuthill, Emily; McGrath, Jacqueline; Young, Sera

    2014-02-01

    Exclusive breastfeeding (EBF) has been identified as a key intervention to promote infant health and to reduce the vertical transmission of HIV. Despite this knowledge and increased resources to promote EBF, the practice in sub-Saharan Africa (SSA) remains low among HIV+ women. Although a number of qualitative studies have been conducted throughout SSA, the influences on and consequences of infant feeding choices of HIV+ mothers' findings have not been regarded systematically. Therefore, our objective was to identify overarching themes, commonalities, and differences in infant feeding choices among qualitative studies with HIV+ mothers in SSA. Sixteen qualitative studies of infant feeding practices in the context of HIV were identified. Noblit and Hare's seven-step metasynthesis methodology was used to analyze the experiences of HIV+ women and those who provide infant feeding services/counseling. Data were available from approximately 920 participants (i.e., 750 HIV+ mothers, 109 health-care providers, and 62 family members) across 13 SSA countries from 2000 to 2011. From these data, five themes emerged within which 3-4 overarching key metaphors were identified. The consistency of key metaphors across a variety of geographic, economic, and cultural settings suggest the importance of approaching infant feeding holistically, within the context of maternal knowledge, health-care support, family resources, and cultural expectations. EBF campaigns in SSA are more likely to successfully support optimal health for infants and a safe supportive environment for their mothers when the impact of infant feeding decisions are evaluated across these themes.

  3. Using Six Sigma and Lean methodologies to improve OR throughput.

    Science.gov (United States)

    Fairbanks, Catharine B

    2007-07-01

    Improving patient flow in the perioperative environment is challenging, but it has positive implications for both staff members and for the facility. One facility in vermont improved patient throughput by incorporating Six Sigma and Lean methodologies for patients undergoing elective procedures. The results of the project were significantly improved patient flow and increased teamwork and pride among perioperative staff members. (c) AORN, Inc, 2007.

  4. New challenges and opportunities in the eddy-covariance methodology for long-term monitoring networks

    Science.gov (United States)

    Papale, Dario; Fratini, Gerardo

    2013-04-01

    Eddy-covariance is the most direct and most commonly applied methodology for measuring exchange fluxes of mass and energy between ecosystems and the atmosphere. In recent years, the number of environmental monitoring stations deploying eddy-covariance systems increased dramatically at the global level, exceeding 500 sites worldwide and covering most climatic and ecological regions. Several long-term environmental research infrastructures such as ICOS, NEON and AmeriFlux selected the eddy-covariance as a method to monitor GHG fluxes and are currently collaboratively working towards defining common measurements standards, data processing approaches, QA/QC procedures and uncertainty estimation strategies, to the aim of increasing defensibility of resulting fluxes and intra and inter-comparability of flux databases. In the meanwhile, the eddy-covariance research community keeps identifying technical and methodological flaws that, in some cases, can introduce - and can have introduced to date - significant biases in measured fluxes or increase their uncertainty. Among those, we identify three issues of presumably greater concern, namely: (1) strong underestimation of water vapour fluxes in closed-path systems, and its dependency on relative humidity; (2) flux biases induced by erroneous measurement of absolute gas concentrations; (3) and systematic errors due to underestimation of vertical wind variance in non-orthogonal anemometers. If not properly addressed, these issues can reduce the quality and reliability of the method, especially as a standard methodology in long-term monitoring networks. In this work, we review the status of the art regarding such problems, and propose new evidences based on field experiments as well as numerical simulations. Our analyses confirm the potential relevance of these issues but also hint at possible coping approaches, to minimize problems during setup design, data collection and post-field flux correction. Corrections are under

  5. Status of the Gen-IV Proliferation Resistance and Physical Protection (PRPP) Evaluation Methodology

    International Nuclear Information System (INIS)

    Whitlock, J.; Bari, R.; Peterson, P.; Padoani, F.; Cojazzi, G.G.M.; Renda, G.; ); Cazalet, J.; Haas, E.; Hori, K.; Kawakubo, Y.; Chang, S.; Kim, H.; Kwon, E.-H.; Yoo, H.; Chebeskov, A.; Pshakin, G.; Pilat, J.F.; Therios, I.; Bertel, E.

    2015-01-01

    Methodologies have been developed within the Generation IV International Forum (GIF) to support the assessment and improvement of system performance in the areas safeguards, security, economics and safety. Of these four areas, safeguards and security are the subjects of the GIF working group on Proliferation Resistance and Physical Protection (PRPP). Since the PRPP methodology (now at Revision 6) represents a mature, generic, and comprehensive evaluation approach, and is freely available on the GIF public website, several non-GIF technical groups have chosen to utilize the PRPP methodology for their own goals. Indeed, the results of the evaluations performed with the methodology are intended for three types of generic users: system designers, programme policy makers, and external stakeholders. The PRPP Working Group developed the methodology through a series of demonstration and case studies. In addition, over the past few years various national and international groups have applied the methodology to inform nuclear energy system designs, as well as to support the development of approaches to advanced safeguards. A number of international workshops have also been held which have introduced the methodology to design groups and other stakeholders. In this paper we summarize the technical progress and accomplishments of the PRPP evaluation methodology, including applications outside GIF, and we outline the PRPP methodology's relationship with the IAEA's INPRO methodology. Current challenges with the efficient implementation of the methodology are outlined, along with our path forward for increasing its accessibility to a broader stakeholder audience - including supporting the next generation of skilled professionals in the nuclear non-proliferation field. (author)

  6. Scalable Multi-core Architectures Design Methodologies and Tools

    CERN Document Server

    Jantsch, Axel

    2012-01-01

    As Moore’s law continues to unfold, two important trends have recently emerged. First, the growth of chip capacity is translated into a corresponding increase of number of cores. Second, the parallalization of the computation and 3D integration technologies lead to distributed memory architectures. This book provides a current snapshot of industrial and academic research, conducted as part of the European FP7 MOSART project, addressing urgent challenges in many-core architectures and application mapping.  It addresses the architectural design of many core chips, memory and data management, power management, design and programming methodologies. It also describes how new techniques have been applied in various industrial case studies. Describes trends towards distributed memory architectures and distributed power management; Integrates Network on Chip with distributed, shared memory architectures; Demonstrates novel design methodologies and frameworks for multi-core design space exploration; Shows how midll...

  7. A safety assessment methodology applied to CNS/ATM-based air traffic control system

    Energy Technology Data Exchange (ETDEWEB)

    Vismari, Lucio Flavio, E-mail: lucio.vismari@usp.b [Safety Analysis Group (GAS), School of Engineering at University of Sao Paulo (Poli-USP), Av. Prof. Luciano Gualberto, Trav.3, n.158, Predio da Engenharia de Eletricidade, Sala C2-32, CEP 05508-900, Sao Paulo (Brazil); Batista Camargo Junior, Joao, E-mail: joaocamargo@usp.b [Safety Analysis Group (GAS), School of Engineering at University of Sao Paulo (Poli-USP), Av. Prof. Luciano Gualberto, Trav.3, n.158, Predio da Engenharia de Eletricidade, Sala C2-32, CEP 05508-900, Sao Paulo (Brazil)

    2011-07-15

    In the last decades, the air traffic system has been changing to adapt itself to new social demands, mainly the safe growth of worldwide traffic capacity. Those changes are ruled by the Communication, Navigation, Surveillance/Air Traffic Management (CNS/ATM) paradigm , based on digital communication technologies (mainly satellites) as a way of improving communication, surveillance, navigation and air traffic management services. However, CNS/ATM poses new challenges and needs, mainly related to the safety assessment process. In face of these new challenges, and considering the main characteristics of the CNS/ATM, a methodology is proposed at this work by combining 'absolute' and 'relative' safety assessment methods adopted by the International Civil Aviation Organization (ICAO) in ICAO Doc.9689 , using Fluid Stochastic Petri Nets (FSPN) as the modeling formalism, and compares the safety metrics estimated from the simulation of both the proposed (in analysis) and the legacy system models. To demonstrate its usefulness, the proposed methodology was applied to the 'Automatic Dependent Surveillance-Broadcasting' (ADS-B) based air traffic control system. As conclusions, the proposed methodology assured to assess CNS/ATM system safety properties, in which FSPN formalism provides important modeling capabilities, and discrete event simulation allowing the estimation of the desired safety metric.

  8. A safety assessment methodology applied to CNS/ATM-based air traffic control system

    International Nuclear Information System (INIS)

    Vismari, Lucio Flavio; Batista Camargo Junior, Joao

    2011-01-01

    In the last decades, the air traffic system has been changing to adapt itself to new social demands, mainly the safe growth of worldwide traffic capacity. Those changes are ruled by the Communication, Navigation, Surveillance/Air Traffic Management (CNS/ATM) paradigm , based on digital communication technologies (mainly satellites) as a way of improving communication, surveillance, navigation and air traffic management services. However, CNS/ATM poses new challenges and needs, mainly related to the safety assessment process. In face of these new challenges, and considering the main characteristics of the CNS/ATM, a methodology is proposed at this work by combining 'absolute' and 'relative' safety assessment methods adopted by the International Civil Aviation Organization (ICAO) in ICAO Doc.9689 , using Fluid Stochastic Petri Nets (FSPN) as the modeling formalism, and compares the safety metrics estimated from the simulation of both the proposed (in analysis) and the legacy system models. To demonstrate its usefulness, the proposed methodology was applied to the 'Automatic Dependent Surveillance-Broadcasting' (ADS-B) based air traffic control system. As conclusions, the proposed methodology assured to assess CNS/ATM system safety properties, in which FSPN formalism provides important modeling capabilities, and discrete event simulation allowing the estimation of the desired safety metric.

  9. KLIMAT 'Best practice' methodology; KLIMAT 'Best practice' metodikk

    Energy Technology Data Exchange (ETDEWEB)

    Svanes, Erik; Moeller, Hanne

    2012-07-01

    This report summarizes the main lessons learned from the research The climate challenge of food products in a holistic environmental and life cycle perspective, abbreviated KLIMAT. This was a research project in the period 2009-2012, conducted by Oestfoldforskning with the assistance of researchers from UMB, SIK (Sweden), MTT (Finland) and Aalborg University (Denmark). The project was funded by the Norwegian Research Council and its partners BAMA, Coop Norway, Norway Group, Nortura and Tine. The main objective of the project was to develop a uniform and scientifically based methodology to quantify the carbon footprint of food products to allow a fair comparison of food crops climate performance. This report summarizes a number of recommendations with regard to methodological choices in the implementation of greenhouse trace analysis of foodstuffs. The recommendations are divided into system boundaries, functional unit, allocation, and data quality and data variability. During the project period, a number of national and international initiatives have been launched to develop the calculation methodology. Therefore the objective of creating a standardized methodology was adjusted to prepare input to the methodology in the form of articles and reports.(Author)

  10. Piecing Together—A Methodological Bricolage

    Directory of Open Access Journals (Sweden)

    Ainslie Yardley

    2008-05-01

    Full Text Available The use of narrative, reflective, and creative processes as interpretive tools has been considered by many critics to be naïvely humanistic and even romantically impulsive. This contribution challenges those views by putting performative research methods into practice—using the method to test the methodology. The meta-text, in which embedded texts (visual, audio-visual and literary challenge, inform and enhance each other's meaning, has at its heart a digital mapping system that acts as a guiding link that provides alternative interpretive angles and mediating possibilities. The inclusion here of many kinds of text acknowledges that there are multiple ways in which human cognitive networks process information and make creative leaps. This contribution directly presents the case for multi-layered narrative inquiry as a paradigm of ethical activity. The researcher is seen here as a bricoleur, a maker of patchwork, a weaver of stories; one who assembles a theoretical montage through which meaning is constructed and conveyed according to a narrative ethic that is neither naïvely humanistic, nor romantically impulsive—but rather one that stimulates an inclusive and dynamic dialogue between the researcher and her audience. URN: urn:nbn:de:0114-fqs0802315

  11. Risks and challenges associated with the design and construction of a nuclear power plant

    International Nuclear Information System (INIS)

    Liebana Martinez, B.; Armas Garcia, A.; Martinez Gozalo, I.

    2011-01-01

    The construction of a nuclear power plant project, considering the period prior to the operation of the plant, requires a very strict risk control to ensure compliance with a series of challenges. The present paper identifying the most important challenges facing the construct ability and license requirements of the process, identifying the interfaces and proposing a methodology of construction to meet the challenge of a construction process in 5 years.

  12. A multidisciplinary systematic literature review on frailty: Overview of the methodology used by the Canadian Initiative on Frailty and Aging

    Directory of Open Access Journals (Sweden)

    Bergman Howard

    2009-10-01

    Full Text Available Abstract Background Over the past two decades, there has been a substantial growth in the body of literature on frailty in older persons. However, there is no consensus on its definition or the criteria used to identify frailty. In response to this lack of consensus, the Canadian Initiative on Frailty and Aging carried out a set of systematic reviews of the literature in ten areas of frailty research: biological basis; social basis; prevalence; risk factors; impact; identification; prevention and management; environment and technology; health services; health and social policy. This paper describes the methodology that was developed for the systematic reviews. Methods A Central Coordination Group (CCG was responsible for developing the methodology. This involved the development of search strategies and keywords, article selection processes, quality assessment tools, and guidelines for the synthesis of results. Each review was conducted by two experts in the content area, with the assistance of methodologists and statisticians from the CCG. Results Conducting a series of systematic literature reviews involving a range of disciplines on a concept that does not have a universally accepted definition posed several conceptual and methodological challenges. The most important conceptual challenge was determining what would qualify as literature on frailty. The methodological challenges arose from our goal of structuring a consistent methodology for reviewing literature from diverse fields of research. At the outset, certain methodological guidelines were deemed essential to ensure the validity of all the reviews. Nevertheless, it was equally important to permit flexibility in the application of the proposed methodology to capture the essence of frailty research within the given fields. Conclusion The results of these reviews allowed us to establish the status of current knowledge on frailty and promote collaboration between disciplines. Conducting

  13. Challenges in Evaluating Psychosocial Interventions for Autistic Spectrum Disorders

    Science.gov (United States)

    Lord, Catherine; Wagner, Ann; Rogers, Sally; Szatmari, Peter; Aman, Michael; Charman, Tony; Dawson, Geraldine; Durand, V. Mark; Grossman, Lee; Guthrie, Donald; Harris, Sandra; Kasanri, Connie; Marcus, Lee; Murphy, Susan; Odom, Samuel; Pickles, Andrew; Scahill, Lawrence; Shaw, Evelyn; Siegel, Bryna; Sigman, Marian; Stone, Wendy; Smith, Tristram; Yoder, Paul

    2005-01-01

    In 2002, the National Institutes of Health sponsored a meeting concerning methodological challenges of research in psychosocial interventions in Autism Spectrum Disorders. This paper provides a summary of the presentations and the discussions that occurred during this meeting. Recommendations to federal and private agencies included the need for…

  14. Application and licensing requirements of the Framatome ANP RLBLOCA methodology

    International Nuclear Information System (INIS)

    Martin, R.P.; Dunn, B.M.

    2004-01-01

    The Framatome ANP Realistic Large-Break LOCA methodology (FANP RLBLOCA) is an analysis approach approved by the US NRC for supporting the licensing basis of 3- and 4-loop Westinghouse PWRs and CE 2x4 PWRs. It was developed consistent with the NRC's Code Scaling, Applicability, and Uncertainty (CSAU) methodology for performing best-estimate large-break LOCAs. The CSAU methodology consists of three key elements with the second and third element addressing uncertainty identification and application. Unique to the CSAU methodology is the use of engineering judgment and the Process Identification and Ranking Table (PIRT) defined in the first element to lay the groundwork for achieving the ultimate goal of quantifying the total uncertainty in predicted measures of interest associated with the large-break LOCA. It is the PIRT that not only directs the methodology development, but also directs the methodology review. While the FANP RLBLOCA methodology was generically approved, a plant-specific application is customized in two ways addressing how the unique plant characterization 1) is translated to code input and 2) relates to the unique methodology licensing requirements. Related to the former, plants are required by 10 CFR 50.36 to define a technical specification limiting condition for operation based on the following criteria: 1. Installed instrumentation that is used in the control room to detect, and indicate, a significant abnormal degradation of the reactor coolant pressure boundary. 2. A process variable, design feature, or operating restriction that is an initial condition of a design basis accident or transient analysis that either assumes the failure of or presents a challenge to the integrity of a fission product barrier. 3. A structure, system, or component that is part of the primary success path and which functions or actuates to mitigate a design basis accident or transient that either assumes the failure of or presents a challenge to the integrity of a

  15. PASSCAL Instrument Center Support for Cryoseismology: Methodologies, Challenges, Development and Instrumentation

    Science.gov (United States)

    Beaudoin, B. C.; Anderson, K. R.; Bilek, S. L.; Carpenter, P.; Childs, D.; Chung, P.; Huerta, A. D.; Lingutla, N.; Nikolaus, K.; Winberry, J. P.

    2017-12-01

    Remote portable seismic stations are, in most cases, constrained by logistics and cost. High latitude operations introduce environmental, technical and logistical challenges that require substantially more engineering work to ensure robust, high quality data return. Since 2006, IRIS PASSCAL has been funded by NSF to develop, deploy, and maintain a pool of polar specific seismic stations. At roughly the same time, PASSCAL began supporting experiments specifically targeting glacier dynamics such as the mechanisms of subglacial hydrology, basal shear stress, ice stream stick slip mechanisms, and glacier seismicity. Although much of the development for high-latitude deployments was directly applicable to cryoseismology, these new experiments introduced a unique series of challenges including high ablation, standing water, and moving stations. Our polar development objectives have focused on: Reducing station power requirements, size and weight; Extending the operational temperature of a station; Simplifying logistics; Engineering solutions that are cost effective, manufacturable, serviceable and reusable; And, developing high-latitude communications for both state-of-health and data transmission. To these ends, PASSCAL continues testing new power storage technology, refining established power systems for lighter and smaller power banks, and exploring telemetry solutions to increase high-bandwidth communication options and abilities for remote seismic stations. Further enhancing PASSCAL's ability to support cryoseismology is a recent NSF funded collaborative effort lead by Central Washing University joined by IRIS and New Mexico Tech to build a Geophysical Earth Observatory for Ice Covered Environments (GEOICE). The GEOICE instrument, power system and other integrated ancillary components are designed to require minimal installation time and logistical load (i.e., size and weight), while maximizing ease-of-use in the field and optimizing costs of instrumentation and

  16. Challenges in conducting qualitative research in health: A conceptual paper

    Science.gov (United States)

    Khankeh, Hamidreza; Ranjbar, Maryam; Khorasani-Zavareh, Davoud; Zargham-Boroujeni, Ali; Johansson, Eva

    2015-01-01

    Background: Qualitative research focuses on social world and provides the tools to study health phenomena from the perspective of those experiencing them. Identifying the problem, forming the question, and selecting an appropriate methodology and design are some of the initial challenges that researchers encounter in the early stages of any research project. These problems are particularly common for novices. Materials and Methods: This article describes the practical challenges of using qualitative inquiry in the field of health and the challenges of performing an interpretive research based on professional experience as a qualitative researcher and on available literature. Results: One of the main topics discussed is the nature of qualitative research, its inherent challenges, and how to overcome them. Some of those highlighted here include: identification of the research problem, formation of the research question/aim, and selecting an appropriate methodology and research design, which are the main concerns of qualitative researchers and need to be handled properly. Insights from real-life experiences in conducting qualitative research in health reveal these issues. Conclusions: The paper provides personal comments on the experiences of a researcher in conducting pure qualitative research in the field of health. It offers insights into the practical difficulties encountered when performing qualitative studies and offers solutions and alternatives applied by these authors, which may be of use to others. PMID:26793245

  17. Challenges in radon management at uranium mining operations

    International Nuclear Information System (INIS)

    Paulka, Sharon

    2011-01-01

    Full text: Radon and its radioactive decay products are present some unique challenges to radiation protection professionals working at the uranium mining operations. This paper will detail some examples of these challenges and methods that can be employed to ensure doses to workers and members of the public are kept As Low As Reasonably Achievable (ALARA). Examples will be presented for conventional open pit and underground mining and In Situ recovery operations. One of the challenges facing new operations seeking approval is the demonstration that radon and its radioactive decay products sourced from the operations will not adversely impact local populations, Methodologies recently employed in the most recent environmental impact statements from uranium mining companies seeking approval are reviewed. The International Commission of Radiological Protection are currently reviewing the dose conversion factors used radon and its decay products. The challenges this change will present to uranium mining operators are presented.

  18. Modeling Acute Traumatic Hemorrhagic Shock Injury: Challenges and Guidelines for Preclinical Studies.

    Science.gov (United States)

    Tremoleda, Jordi L; Watts, Sarah A; Reynolds, Penny S; Thiemermann, Christoph; Brohi, Karim

    2017-12-01

    Trauma is responsible for a large proportion of the world's burden of disease, and is by far the biggest killer of young adults. Hemorrhage is the leading cause of preventable death and its effects are directly correlated with the incidence multi-organ failure in survivors. Trauma research is challenging due to patient heterogeneity, limited randomized controlled trials, and in vitro studies that fail to mimic the systemic injury response. Preclinical research remains essential for mechanistic and therapeutic discovery. Yet modeling the multifaceted nature of traumatic injury poses important experimental and welfare challenges associated with the onset of injury and prehospital and intra-operative care, the limited inter-species validation of coagulation profiles, the use of anesthesia/analgesia, and its impact on the systemic response to trauma; and the challenge of sustaining intensive care in recovery models. Proper model selection depends on the purpose of a given model and the criteria by which the experimental readouts will be clinically relevant. Such complexity warrants further refinement of experimental methodology and outcome measures to improve its clinical efficacy, while ensuring animal well-being. We review the experimental methodologies currently used for modeling traumatic hemorrhagic shock and addressing their impact on clinical translation. The aim of the review is to improve transparency and form a consensus when reporting methodology in trauma modeling.

  19. The challenges of introducing internal social media

    DEFF Research Database (Denmark)

    Madsen, Vibeke Thøis

    2017-01-01

    Purpose – The purpose of this paper is to explore the challenges associated with introducing internal social media (ISM) into organizations in order to help them reap the benefits of coworker communication on ISM. Design/methodology/approach – The paper is based on an exploratory study in ten...... facilitators and sense-givers. Keywords Organizational communication, Internal communication, Coworker, Internal social media Paper type Research paper...

  20. Conceptualising and measuring collaborative critical thinking on asynchronous discussion forums: Challenges and possible solutions

    Directory of Open Access Journals (Sweden)

    Nazanin Ghodrati

    2015-04-01

    Full Text Available The use of asynchronous discussion forums (ADFs is thought to assist in enhancing students’ collaborative learning and critical thinking throughout higher education. However, previous research has mainly focused on individual critical thinking while the investigation of critical thinking during group work has been generally overlooked. Furthermore, few studies have investigated critical thinking processes of the individual and of the group in a single study to present a comprehensive picture of collaborative critical thinking (CCT. To address these gaps, I examined the demonstration of CCT on ADFs in a graduate subject at an Australian university over two academic semesters as students discussed topics online. In this paper, I discuss the ontological and methodological challenges in conducting the above research and present possible solutions to these challenges. At the ontological level, I discuss challenges in conceptualising and defining CCT. At the methodological level, I present challenges in constructing a coding scheme to measure the demonstration of CCT on ADFs. I then discuss ways to tackle the above challenges, propose an operational definition of CCT and present a synthetic coding scheme for measuring CCT in computer-supported collaborative learning contexts such as on ADFs.

  1. Globalization, Critical Post-Colonialism and Career and Technical Education in Africa: Challenges and Possibilities

    Science.gov (United States)

    Goura, Tairou

    2012-01-01

    In Sub-Saharan Africa (SSA), technical and vocational education and training (TVET) is central to political discourses and educational concerns as a means for economic development, poverty alleviation, youth employment, and social mobility. Yet, there is an intriguing contradiction between this consideration and the real attention dedicated to…

  2. Do systematic reviews on pediatric topics need special methodological considerations?

    OpenAIRE

    Farid-Kapadia, Mufiza; Askie, Lisa; Hartling, Lisa; Contopoulos-Ioannidis, Despina; Bhutta, Zulfiqar A.; Soll, Roger; Moher, David; Offringa, Martin

    2017-01-01

    Background Systematic reviews are key tools to enable decision making by healthcare providers and policymakers. Despite the availability of the evidence based Preferred Reporting Items for Systematic reviews and Meta-Analysis (PRISMA-2009 and PRISMA-P 2015) statements that were developed to improve the transparency and quality of reporting of systematic reviews, uncertainty on how to deal with pediatric-specific methodological challenges of systematic reviews impairs decision-making in child ...

  3. Challenges of Measuring Performance of the Sales and Operations Planning Process

    OpenAIRE

    Hulthén, Hana; Näslund, Dag; Norrman, Andreas

    2017-01-01

    The purpose of this study is to identify and structure challenges of measuring performance of the Sales and Operations Planning (S&OP) process. A multiple case study methodology was applied. Qualitative data was collected via 22 structured interviews with managers from six case companies in various industries. A process oriented framework was proposed by structuring the challenges based on two key areas of process performance (effectiveness and efficiency) and different maturity levels of the...

  4. On Methodology and (PostColonialism in Tourism Promotional Language

    Directory of Open Access Journals (Sweden)

    Ana Crăciunescu

    2016-07-01

    Full Text Available The greatest challenge of the present paper is the research paradox that tourism imbeds within its economic and historical realities. Whilst tributary to Western research methodologies, we realized that an impartial analysis of tourism studies, which is essentially postcolonial, presupposes a pertinent review of ''marginal'' state of the art in the field. As scholars argue, tourism has developed a language of its own in order to promote cultural patterns of authenticity. This universal lexicon is largely rooted in myth and otherness, which lead us to the exemplification from a semio-linguistic perspective of a paradisiacal destination −Jamaica − included in the categories of such by the normative Westerner. We also touch upon gender issues on the larger colonialist background that the relation Self-Other, Orient-Occident, Colonizer-Colonized raises even at a methodological level in recent literature.

  5. Silica sulfuric acid: a reusable solid catalyst for one pot synthesis of densely substituted pyrrole-fused isocoumarins under solvent-free conditions

    Directory of Open Access Journals (Sweden)

    Sudipta Pathak

    2013-11-01

    Full Text Available A convenient and efficient methodology for the synthesis of densely substituted pyrrole-fused isocoumarins, which employs solid-supported silica sulfuric acid (SSA as catalyst, has been developed. When the mixture of ninhydrin adducts of acetylacetone/ethyl acetoacetate and primary amines was heated on the solid surface of SSA under solvent-free conditions, the pyrrole-fused isocoumarins were formed in good yields. This synthetic method has several advantages such as the employment of solvent-free reaction conditions without the use of any toxic reagents and metal catalysts, the ease of product isolation, the use of a recyclable catalyst, the low cost, the easy availability of the starting materials, and the excellent yields of products.

  6. Methodologic assessment of radiation epidemiology studies

    International Nuclear Information System (INIS)

    Beebe, G.W.

    1983-01-01

    Epidemiologic studies of the late effects of ionizing radiation have utilized the entire spectrum of situations in which man has been exposed. These studies have provided insights into the dependence of human effects upon not only dose to target tissues but also other dimensions of exposure, host characteristics, and time following exposure. Over the past three decades studies have progressed from the mere identification of effects to their measurement. Because investigators of human effects have no control over the exposure situation, validity must be sought in the consistency of findings among independent studies and with accepted biologic principles. Because exposure may be confounded with factors that are hidden from view, bias may enter into any study of human exposure. Avoidance of bias and attainment of sufficient power to detect relationships that are real are methodologic challenges. Many methodologic issues, e.g., those associated with the definition and measurement of specific end-points, or with the selection of appropriate controls, permeate epidemiologic work in all fields. Others, especially those concerned with the measurement of exposure, the patterning of events in time after exposure, and the prediction of events beyond the scope of existing observations give radiation epidemiology its distinctive character

  7. Sensor-based activity recognition using extended belief rule-based inference methodology.

    Science.gov (United States)

    Calzada, A; Liu, J; Nugent, C D; Wang, H; Martinez, L

    2014-01-01

    The recently developed extended belief rule-based inference methodology (RIMER+) recognizes the need of modeling different types of information and uncertainty that usually coexist in real environments. A home setting with sensors located in different rooms and on different appliances can be considered as a particularly relevant example of such an environment, which brings a range of challenges for sensor-based activity recognition. Although RIMER+ has been designed as a generic decision model that could be applied in a wide range of situations, this paper discusses how this methodology can be adapted to recognize human activities using binary sensors within smart environments. The evaluation of RIMER+ against other state-of-the-art classifiers in terms of accuracy, efficiency and applicability was found to be significantly relevant, specially in situations of input data incompleteness, and it demonstrates the potential of this methodology and underpins the basis to develop further research on the topic.

  8. Effect of the Prevalence of HIV/AIDS and the Life Expectancy Rate on Economic Growth in SSA Countries: Difference GMM Approach.

    Science.gov (United States)

    Waziri, Salisu Ibrahim; Mohamed Nor, Norashidah; Raja Abdullah, Nik Mustapha; Adamu, Peter

    2015-09-01

    The productivity of countries around the globe is adversely affected by the health-related problems of their labour force. This study examined the effect of the prevalence of human immunodeficiency virus/acquired immune deficiency syndrome (HIV/AIDS) and life expectancy on the economic growth of 33 Sub-Saharan African (SSA) countries over a period of 11 years (2002-2012). The study employed a dynamic panel approach as opposed to the static traditional approach utilised in the literature. The dynamic approach became eminent because of the fact that HIV/AIDS is a dynamic variable as its prevalence today depends on the previous years. The result revealed that HIV/AIDS is negatively correlated with economic growth in the region, with a coefficient of 0.014, and significant at the 1% level. That is, a 10% increase in HIV/AIDS prevalence leads to a 0.14% decrease in the GDP of the region. Tackling HIV/AIDS is therefore imperative to the developing Sub-Saharan African region and all hands must be on deck to end the menace globally.

  9. Innovation and Integrity in Intervention Research: Conceptual Issues, Methodology, and Knowledge Translation.

    Science.gov (United States)

    Malti, Tina; Beelmann, Andreas; Noam, Gil G; Sommer, Simon

    2018-04-01

    In this article, we introduce the special issue entitled Innovation and Integrity in Intervention Science. Its focus is on essential problems and prospects for intervention research examining two related topics, i.e., methodological issues and research integrity, and challenges in the transfer of research knowledge into practice and policy. The main aims are to identify how to advance methodology in order to improve research quality, examine scientific integrity in the field of intervention science, and discuss future steps to enhance the transfer of knowledge about evidence-based intervention principles into sustained practice, routine activities, and policy decisions. Themes of the special issue are twofold. The first includes questions about research methodology in intervention science, both in terms of research design and methods, as well as data analyses and the reporting of findings. Second, the issue tackles questions surrounding the types of knowledge translation frameworks that might be beneficial to mobilize the transfer of research-based knowledge into practice and public policies. The issue argues that innovations in methodology and thoughtful approaches to knowledge translation can enable transparency, quality, and sustainability of intervention research.

  10. A novel fusion methodology to bridge GPS outages for land vehicle positioning

    International Nuclear Information System (INIS)

    Chen, Wei; Li, Xu; Song, Xiang; Xu, Qimin; Li, Bin; Song, Xianghui

    2015-01-01

    Many intelligent transportation system applications require accurate, reliable, and continuous vehicle position information whether in open-sky environments or in Global Positioning System (GPS) denied environments. However, there remains a challenging task for land vehicles to achieve such positioning performance using low-cost sensors, especially microelectromechanical system (MEMS) sensors. In this paper, a novel and cost-effective fusion methodology to bridge GPS outages is proposed and applied in the Inertial Navigation System (INS)/GPS/ compass integrated positioning system. In the implementation of the proposed methodology, a key data preprocessing algorithm is first developed to eliminate the noise in inertial sensors in order to provide more accurate information for subsequent modeling. Then, a novel hybrid strategy incorporating the designed autoregressive model (AR model)-based forward estimator (ARFE) with Kalman filter (KF) is presented to predict the INS position errors during GPS outages. To verify the feasibility and effectiveness of the proposed methodology, real road tests with various scenarios were performed. The proposed methodology illustrates significant improvement in positioning accuracy during GPS outages. (paper)

  11. Accomplishments and challenges in development of an autonomous operation system

    International Nuclear Information System (INIS)

    Endou, A.; Saiki, A.; Yoshikawa, S.; Okusa, K.; Suda, K.

    1994-01-01

    The authors are studying an autonomous operation system for nuclear power plants in which AI plays key roles as an alternative of plant operators and traditional controllers. In contrast with past studies dedicated to assist the operators, the ultimate target of development of the autonomous operation system is to operate the nuclear plants by AI. To realize humanlike decision-making process by means of AI, the authors used a model-based approach from multiple viewpoints and methodology diversity. A hierarchical distributed cooperative multi-agent system configuration is adopted to allow to incorporate diversified methodologies and to dynamically reorganize system functions. In the present paper, accomplishments to date in the course of the development are described. Challenges for developing methodologies to attain dynamic reorganization are also addressed. (author)

  12. Investigating DMOs through the Lens of Social Network Analysis: Theoretical Gaps, Methodological Challenges and Practitioner Perspectives

    Directory of Open Access Journals (Sweden)

    Dean HRISTOV

    2015-06-01

    Full Text Available The extant literature on networks in tourism management research has traditionally acknowledged destinations as the primary unit of analysis. This paper takes an alternative perspective and positions Destination Management Organisations (DMOs at the forefront of today’s tourism management research agenda. Whilst providing a relatively structured approach to generating enquiry, network research vis-à-vis Social Network Analysis (SNA in DMOs is often surrounded by serious impediments. Embedded in the network literature, this conceptual article aims to provide a practitioner perspective on addressing the obstacles to undertaking network studies in DMO organisations. A simple, three-step methodological framework for investigating DMOs as interorganisational networks of member organisations is proposed in response to complexities in network research. The rationale behind introducing such framework lies in the opportunity to trigger discussions and encourage further academic contributions embedded in both theory and practice. Academic and practitioner contributions are likely to yield insights into the importance of network methodologies applied to DMO organisations.

  13. Qualitative Approaches to Research in Counselling and Psychotherapy: Issues and Challenges.

    Science.gov (United States)

    McLeod, John

    1996-01-01

    Discusses key issues which address the distinctive dilemmas and challenges associated with qualitative approaches to evaluating counseling. Investigates such concerns as relationships with research participants, ethics, reflexivity, methodological choice, communicability, perspective, and obviousness. Makes some suggestions regarding the link…

  14. Practicing the Four Seasons of Ethnography Methodology while Searching for Identity in Mexico

    Science.gov (United States)

    Pitts, Margaret Jane

    2012-01-01

    This narrative is an account of my field experiences and challenges practicing Gonzalez's (2000) Four Seasons of Ethnography methodology in Mexico City. I describe the complexities and tensions inherent in managing two scientific paradigms: Western scientific logic vs. a more organic ontology. The experiential knowledge produced in this text is…

  15. The Visual Object Tracking VOT2015 Challenge Results

    KAUST Repository

    Kristan, Matej; Matas, Jiri; Leonardis, Ale; Felsberg, Michael; Cehovin, Luka; Fernandez, Gustavo; Vojir, Toma; Hager, Gustav; Nebehay, Georg; Pflugfelder, Roman; Gupta, Abhinav; Bibi, Adel Aamer; Lukezic, Alan; Garcia-Martin, Alvaro; Saffari, Amir; Petrosino, Alfredo; Montero, Andres Solıs; Varfolomieiev, Anton; Baskurt, Atilla; Zhao, Baojun; Ghanem, Bernard; Martinez, Brais; Lee, ByeongJu; Han, Bohyung; Wang, Chaohui; Garcia, Christophe; Zhang, Chunyuan; Schmid, Cordelia; Tao, Dacheng; Kim, Daijin; Huang, Dafei; Prokhorov, Danil; Du, Dawei; Yeung, Dit-Yan; Ribeiro, Eraldo; Khan, Fahad Shahbaz; Porikli, Fatih; Bunyak, Filiz; Zhu, Gao; Seetharaman, Guna; Kieritz, Hilke; Yau, Hing Tuen; Li, Hongdong; Qi, Honggang; Bischof, Horst; Possegger, Horst; Lee, Hyemin; Nam, Hyeonseob; Bogun, Ivan; Jeong, Jae-chan; Cho, Jae-il; Lee, Jae-Yeong; Zhu, Jianke; Shi, Jianping; Li, Jiatong; Jia, Jiaya; Feng, Jiayi; Gao, Jin; Choi, Jin Young; Kim, Ji-Wan; Lang, Jochen; Martinez, Jose M.; Choi, Jongwon; Xing, Junliang; Xue, Kai; Palaniappan, Kannappan; Lebeda, Karel; Alahari, Karteek; Gao, Ke; Yun, Kimin; Wong, Kin Hong; Luo, Lei; Ma, Liang; Ke, Lipeng; Wen, Longyin; Bertinetto, Luca; Pootschi, Mahdieh; Maresca, Mario; Danelljan, Martin; Wen, Mei; Zhang, Mengdan; Arens, Michael; Valstar, Michel; Tang, Ming; Chang, Ming-Ching; Khan, Muhammad Haris; Fan, Nana; Wang, Naiyan; Miksik, Ondrej; Torr, Philip H S; Wang, Qiang; Martin-Nieto, Rafael; Pelapur, Rengarajan; Bowden, Richard; Laganiere, Robert; Moujtahid, Salma; Hare, Sam; Hadfield, Simon; Lyu, Siwei; Li, Siyi; Zhu, Song-Chun; Becker, Stefan; Duffner, Stefan; Hicks, Stephen L; Golodetz, Stuart; Choi, Sunglok; Wu, Tianfu; Mauthner, Thomas; Pridmore, Tony; Hu, Weiming; Hubner, Wolfgang; Wang, Xiaomeng; Li, Xin; Shi, Xinchu; Zhao, Xu; Mei, Xue; Shizeng, Yao; Hua, Yang; Li, Yang; Lu, Yang; Li, Yuezun; Chen, Zhaoyun; Huang, Zehua; Chen, Zhe; Zhang, Zhe; He, Zhenyu; Hong, Zhibin

    2015-01-01

    The Visual Object Tracking challenge 2015, VOT2015, aims at comparing short-term single-object visual trackers that do not apply pre-learned models of object appearance. Results of 62 trackers are presented. The number of tested trackers makes VOT 2015 the largest benchmark on short-term tracking to date. For each participating tracker, a short description is provided in the appendix. Features of the VOT2015 challenge that go beyond its VOT2014 predecessor are: (i) a new VOT2015 dataset twice as large as in VOT2014 with full annotation of targets by rotated bounding boxes and per-frame attribute, (ii) extensions of the VOT2014 evaluation methodology by introduction of a new performance measure. The dataset, the evaluation kit as well as the results are publicly available at the challenge website.

  16. The Visual Object Tracking VOT2015 Challenge Results

    KAUST Repository

    Kristan, Matej

    2015-12-07

    The Visual Object Tracking challenge 2015, VOT2015, aims at comparing short-term single-object visual trackers that do not apply pre-learned models of object appearance. Results of 62 trackers are presented. The number of tested trackers makes VOT 2015 the largest benchmark on short-term tracking to date. For each participating tracker, a short description is provided in the appendix. Features of the VOT2015 challenge that go beyond its VOT2014 predecessor are: (i) a new VOT2015 dataset twice as large as in VOT2014 with full annotation of targets by rotated bounding boxes and per-frame attribute, (ii) extensions of the VOT2014 evaluation methodology by introduction of a new performance measure. The dataset, the evaluation kit as well as the results are publicly available at the challenge website.

  17. Brief report on a systematic review of youth violence prevention through media campaigns: Does the limited yield of strong evidence imply methodological challenges or absence of effect?

    Science.gov (United States)

    Cassidy, Tali; Bowman, Brett; McGrath, Chloe; Matzopoulos, Richard

    2016-10-01

    We present a brief report on a systematic review which identified, assessed and synthesized the existing evidence of the effectiveness of media campaigns in reducing youth violence. Search strategies made use of terms for youth, violence and a range of terms relating to the intervention. An array of academic databases and websites were searched. Although media campaigns to reduce violence are widespread, only six studies met the inclusion criteria. There is little strong evidence to support a direct link between media campaigns and a reduction in youth violence. Several studies measure proxies for violence such as empathy or opinions related to violence, but the link between these measures and violence perpetration is unclear. Nonetheless, some evidence suggests that a targeted and context-specific campaign, especially when combined with other measures, can reduce violence. However, such campaigns are less cost-effective to replicate over large populations than generalised campaigns. It is unclear whether the paucity of evidence represents a null effect or methodological challenges with evaluating media campaigns. Future studies need to be carefully planned to accommodate for methodological difficulties as well as to identify the specific elements of campaigns that work, especially in lower and middle income countries. Copyright © 2016 The Foundation for Professionals in Services for Adolescents. Published by Elsevier Ltd. All rights reserved.

  18. Methodology applied to develop the DHIE: applied methodology

    CSIR Research Space (South Africa)

    Herselman, Marlien

    2016-12-01

    Full Text Available This section will address the methodology that was applied to develop the South African Digital Health Innovation Ecosystem (DHIE). Each chapter under Section B represents a specific phase in the methodology....

  19. The virtual observatory service TheoSSA: Establishing a database of synthetic stellar flux standards. I. NLTE spectral analysis of the DA-type white dwarf G191-B2B

    Science.gov (United States)

    Rauch, T.; Werner, K.; Bohlin, R.; Kruk, J. W.

    2013-12-01

    Context. Hydrogen-rich, DA-type white dwarfs are particularly suited as primary standard stars for flux calibration. State-of-the-art NLTE models consider opacities of species up to trans-iron elements and provide reliable synthetic stellar-atmosphere spectra to compare with observations. Aims: We will establish a database of theoretical spectra of stellar flux standards that are easily accessible via a web interface. Methods: In the framework of the Virtual Observatory, the German Astrophysical Virtual Observatory developed the registered service TheoSSA. It provides easy access to stellar spectral energy distributions (SEDs) and is intended to ingest SEDs calculated by any model-atmosphere code. In case of the DA white dwarf G191-B2B, we demonstrate that the model reproduces not only its overall continuum shape but also the numerous metal lines exhibited in its ultraviolet spectrum. Results: TheoSSA is in operation and contains presently a variety of SEDs for DA-type white dwarfs. It will be extended in the near future and can host SEDs of all primary and secondary flux standards. The spectral analysis of G191-B2B has shown that our hydrostatic models reproduce the observations best at and log g = 7.60 ± 0.05. We newly identified Fe vi, Ni vi, and Zn iv lines. For the first time, we determined the photospheric zinc abundance with a logarithmic mass fraction of -4.89 (7.5 × solar). The abundances of He (upper limit), C, N, O, Al, Si, O, P, S, Fe, Ni, Ge, and Sn were precisely determined. Upper abundance limits of about 10% solar were derived for Ti, Cr, Mn, and Co. Conclusions: The TheoSSA database of theoretical SEDs of stellar flux standards guarantees that the flux calibration of all astronomical data and cross-calibration between different instruments can be based on the same models and SEDs calculated with different model-atmosphere codes and are easy to compare. Based on observations with the NASA/ESA Hubble Space Telescope, obtained at the Space Telescope

  20. Vertical variability of aerosol single-scattering albedo and equivalent black carbon concentration based on in-situ and remote sensing techniques during the iAREA campaigns in Ny-Ålesund

    Science.gov (United States)

    Markowicz, K. M.; Ritter, C.; Lisok, J.; Makuch, P.; Stachlewska, I. S.; Cappelletti, D.; Mazzola, M.; Chilinski, M. T.

    2017-09-01

    This work presents a methodology for obtaining vertical profiles of aerosol single scattering properties based on a combination of different measurement techniques. The presented data were obtained under the iAREA (Impact of absorbing aerosols on radiative forcing in the European Arctic) campaigns conducted in Ny-Ålesund (Spitsbergen) during the spring seasons of 2015-2017. The retrieval uses in-situ observations of black carbon concentration and absorption coefficient measured by a micro-aethalometer AE-51 mounted onboard a tethered balloon, as well as remote sensing data obtained from sun photometer and lidar measurements. From a combination of the balloon-borne in-situ and the lidar data, we derived profiles of single scattering albedo (SSA) as well as absorption, extinction, and aerosol number concentration. Results have been obtained in an altitude range from about 400 m up to 1600 m a.s.l. and for cases with increased aerosol load during the Arctic haze seasons of 2015 and 2016. The main results consist of the observation of increasing values of equivalent black carbon (EBC) and absorption coefficient with altitude, and the opposite trend for aerosol concentration for particles larger than 0.3 μm. SSA was retrieved with the use of lidar Raman and Klett algorithms for both 532 and 880 nm wavelengths. In most profiles, SSA shows relatively high temporal and altitude variability. Vertical variability of SSA computed from both methods is consistent; however, some discrepancy is related to Raman retrieval uncertainty and absorption coefficient estimation from AE-51. Typically, very low EBC concentration in Ny-Ålesund leads to large error in the absorbing coefficient. However, SSA uncertainty for both Raman and Klett algorithms seems to be reasonable, e.g. SSA of 0.98 and 0.95 relate to an error of ±0.01 and ± 0.025, respectively.

  1. Quantifying Averted Disability-Adjusted Life Years as a Performance Indicator for Water Quality Interventions: A Review of Current Methodologies and Challenges

    Directory of Open Access Journals (Sweden)

    Darcy M. Anderson

    2018-06-01

    Full Text Available Sustainable access to safe drinking water protects against infectious disease and promotes overall health. Despite considerable progress toward increasing water access, safe water quality and reliable service delivery remain a challenge. Traditional financing strategies pay implementers based on inputs and activities, with minimal incentives for water quality monitoring and sustained service operation. Pay-for-performance offers an alternative financing strategy that delivers all or a portion of payment based on performance indicators of desired outputs or outcomes. A pay-for-performance approach in the water sector could quantify and incentivize health impact. Averted disability-adjusted life years (ADALYs have been used as a performance indicator to measure the burden of disease averted due to environmental health interventions. Water-related disease burden can be measured for application as an ADALYs performance indicator following either comparative risk assessment or quantitative microbial risk assessment. Comparative risk assessment models disease burden using water source type as a proxy indicator of microbial water quality, while quantitative microbial risk assessment models disease burden using concentrations of indicator pathogens. This paper compares these risk assessment methodologies, and summarizes the limitations of applying these approaches toward quantifying ADALYs as a performance indicator for water quality interventions.

  2. Indigenous Methodology in Understanding Indigenous Nurse Graduate Transition to Practice

    Directory of Open Access Journals (Sweden)

    Donna L. M. Kurtz

    2017-10-01

    Full Text Available Increasing Indigenous health care professional presence in health care aims to reduce health inequities of Indigenous Peoples in Canada. Nurses are the largest health professional group and nurse graduates the main source of recruitment. The quality of graduate transition to practice is evident in the literature; however, little is reported about Indigenous new graduates. We describe using Indigenous methodology and two-eyed seeing (Indigenous and Western perspectives in exploring Indigenous transition experiences. Talking circles provided a safe environment for nurses, nurse educators and students, health managers, and policy makers to discuss Indigenous new graduate case scenarios. The methodology was critical in identifying challenges faced, recommendations for change, and a new collective commitment for cultural safety education, and ethical and respectful relationships within education, practice, and policy.

  3. Methodology, Algorithms, and Emerging Tool for Automated Design of Intelligent Integrated Multi-Sensor Systems

    Directory of Open Access Journals (Sweden)

    Andreas König

    2009-11-01

    Full Text Available The emergence of novel sensing elements, computing nodes, wireless communication and integration technology provides unprecedented possibilities for the design and application of intelligent systems. Each new application system must be designed from scratch, employing sophisticated methods ranging from conventional signal processing to computational intelligence. Currently, a significant part of this overall algorithmic chain of the computational system model still has to be assembled manually by experienced designers in a time and labor consuming process. In this research work, this challenge is picked up and a methodology and algorithms for automated design of intelligent integrated and resource-aware multi-sensor systems employing multi-objective evolutionary computation are introduced. The proposed methodology tackles the challenge of rapid-prototyping of such systems under realization constraints and, additionally, includes features of system instance specific self-correction for sustained operation of a large volume and in a dynamically changing environment. The extension of these concepts to the reconfigurable hardware platform renders so called self-x sensor systems, which stands, e.g., for self-monitoring, -calibrating, -trimming, and -repairing/-healing systems. Selected experimental results prove the applicability and effectiveness of our proposed methodology and emerging tool. By our approach, competitive results were achieved with regard to classification accuracy, flexibility, and design speed under additional design constraints.

  4. Challenges in the estimation of Net SURvival: The CENSUR working survival group.

    Science.gov (United States)

    Giorgi, R

    2016-10-01

    Net survival, the survival probability that would be observed, in a hypothetical world, where the cancer of interest would be the only possible cause of death, is a key indicator in population-based cancer studies. Accounting for mortality due to other causes, it allows cross-country comparisons or trends analysis and provides a useful indicator for public health decision-making. The objective of this study was to show how the creation and formalization of a network comprising established research teams, which already had substantial and complementary experience in both cancer survival analysis and methodological development, make it possible to meet challenges and thus provide more adequate tools, to improve the quality and the comparability of cancer survival data, and to promote methodological transfers in areas of emerging interest. The Challenges in the Estimation of Net SURvival (CENSUR) working survival group is composed of international researchers highly skilled in biostatistics, methodology, and epidemiology, from different research organizations in France, the United Kingdom, Italy, Slovenia, and Canada, and involved in French (FRANCIM) and European (EUROCARE) cancer registry networks. The expected advantages are an interdisciplinary, international, synergistic network capable of addressing problems in public health, for decision-makers at different levels; tools for those in charge of net survival analyses; a common methodology that makes unbiased cross-national comparisons of cancer survival feasible; transfer of methods for net survival estimations to other specific applications (clinical research, occupational epidemiology); and dissemination of results during an international training course. The formalization of the international CENSUR working survival group was motivated by a need felt by scientists conducting population-based cancer research to discuss, develop, and monitor implementation of a common methodology to analyze net survival in order

  5. Incomes and Outcomes: Social Security Disability Benefits in First-Episode Psychosis.

    Science.gov (United States)

    Rosenheck, Robert A; Estroff, Sue E; Sint, Kyaw; Lin, Haiqun; Mueser, Kim T; Robinson, Delbert G; Schooler, Nina R; Marcy, Patricia; Kane, John M

    2017-09-01

    Social Security Administration (SSA) disability benefits are an important source of income for people with psychoses and confer eligibility for health insurance. The authors examined the impact of coordinated specialty care on receipt of such benefits in first-episode psychosis, along with the correlates and consequences of receiving them. The Recovery After an Initial Schizophrenia Episode-Early Treatment Program (RAISE-ETP) study, a 34-site cluster-randomized trial, compared NAVIGATE, a coordinated specialty care program, to usual community care over 2 years. Receipt of SSA benefits and clinical outcomes were assessed at program entry and every 6 months for 2 years. Piecewise regression analysis was used to identify relative change in outcome trajectories after receipt of disability benefits. Among 399 RAISE-ETP participants, 36 (9%) were receiving SSA disability benefits at baseline; of the remainder, 124 (34.1%) obtained benefits during the 2-year study period. The NAVIGATE intervention improved quality of life, symptoms, and employment but did not significantly reduce the likelihood of receiving SSA disability benefits. Obtaining benefits was predicted by more severe psychotic symptoms and greater dysfunction and was followed by increased total income but fewer days of employment, reduced motivation (e.g., sense of purpose, greater anhedonia), and fewer days of intoxication. A 2-year coordinated specialty care intervention did not reduce receipt of SSA disability benefits. There were some advantages for those who obtained SSA disability benefits over the 2-year treatment period, but there were also some unintended adverse consequences. Providing income supports without impeding recovery remains an important policy challenge.

  6. Burden of end-stage renal disease in sub-Saharan Africa.

    Science.gov (United States)

    Naicker, S

    2010-11-01

    To review prevalence, causes and management of end-stage renal disease (ESRD) in sub-Saharan Africa (SSA). Review of literature and data. Approximately 70% of the least developed countries of the world are in SSA. Rapid urbanization is occurring in many parts of the continent, contributing to overcrowding and poverty. While infections and parasitic diseases are still the leading cause of death in Africa, non-communicable diseases are coming to the forefront. There is a continuing "brain drain" of healthcare workers (physicians and nurses) from Africa to more affluent regions. There are large rural areas of Africa that have no health professionals to serve these populations. There are no nephrologists in many parts of SSA; the numbers vary from 0.5 per million population (pmp) in Kenya to 0.6 pmp in Nigeria, 0.7 pmp in Sudan and 1.1 pmp in South Africa. Chronic kidney disease affects mainly young adults aged 20 - 50 years in SSA and is primarily due to hypertension and glomerular diseases. HIV- related glomerular disease often presents late, with patients requiring dialysis. Diabetes mellitus affects 9.4 million people in Africa. The prevalence of diabetic nephropathy is estimated to be 6 - 16% in SSA. The current dialysis treatment rate is Africa, Nigeria, Mauritius and Ghana, with most of the transplants being living donor transplants, except in South Africa where the majority are from deceased donors. Chronic kidney disease care is especially challenging in SSA, with large numbers of ESRD patients, inadequate facilities, funding and support.

  7. Cold air challenge and specific airway resistance in preschool children

    DEFF Research Database (Denmark)

    Nielsen, Kim Gjerum; Bisgaard, Hans

    2005-01-01

    prognosis in preschool children. Cold air challenge and plethysmographic measurement of specific airway resistance (sRaw) are feasible candidate methods for diagnosis, clinical monitoring and research during this critical period of lung growth and development. Methodology and practical aspects of cold air...... challenge and assessment of sRaw in preschool children are reviewed. Reference values are provided for sRaw and have allowed discrimination between health and respiratory disease, both in cross-sectional and longitudinal studies. Bronchial hyperresponsiveness can be determined with acceptable repeatability...

  8. The Challenges of Managing Transnational Education Partnerships: The Views of "Home-Based" Managers vs "In-Country" Managers

    Science.gov (United States)

    Healey, Nigel Martin

    2018-01-01

    Purpose: The purpose of this paper is to investigate the challenges of managing transnational education (TNE) partnerships from the perspective of the home university managers. Design/methodology/approach: The study adopts a qualitative, "insider researcher" methodology. It uses a sample set of eight mangers who operate from the home…

  9. A method comparison of photovoice and content analysis: research examining challenges and supports of family caregivers.

    Science.gov (United States)

    Faucher, Mary Ann; Garner, Shelby L

    2015-11-01

    The purpose of this manuscript is to compare methods and thematic representations of the challenges and supports of family caregivers identified with photovoice methodology contrasted with content analysis, a more traditional qualitative approach. Results from a photovoice study utilizing a participatory action research framework was compared to an analysis of the audio-transcripts from that study utilizing content analysis methodology. Major similarities between the results are identified with some notable differences. Content analysis provides a more in-depth and abstract elucidation of the nature of the challenges and supports of the family caregiver. The comparison provides evidence to support the trustworthiness of photovoice methodology with limitations identified. The enhanced elaboration of theme and categories with content analysis may have some advantages relevant to the utilization of this knowledge by health care professionals. Copyright © 2015 Elsevier Inc. All rights reserved.

  10. Challenges of local water governance

    DEFF Research Database (Denmark)

    Munk Ravnborg, Helle; Bustamante, Rocio; Cissé, Abdoulaye

    2012-01-01

    This article presents the results of comprehensive inventories made of water-related conflict and cooperation occurring in five districts in Africa, Asia and Latin America between 1997 and 2007. Following a description of the conceptual and methodological framework developed for undertaking...... these inventories, the article documents the extent, nature and intensity of water-related conflict and cooperation in the five districts. The article concludes by identifying three challenges relating to the magnitude, complexity and invisibility of local-level conflict and cooperation about water, which efforts...... to improve local water governance would have to address....

  11. Local receptive field constrained stacked sparse autoencoder for classification of hyperspectral images.

    Science.gov (United States)

    Wan, Xiaoqing; Zhao, Chunhui

    2017-06-01

    As a competitive machine learning algorithm, the stacked sparse autoencoder (SSA) has achieved outstanding popularity in exploiting high-level features for classification of hyperspectral images (HSIs). In general, in the SSA architecture, the nodes between adjacent layers are fully connected and need to be iteratively fine-tuned during the pretraining stage; however, the nodes of previous layers further away may be less likely to have a dense correlation to the given node of subsequent layers. Therefore, to reduce the classification error and increase the learning rate, this paper proposes the general framework of locally connected SSA; that is, the biologically inspired local receptive field (LRF) constrained SSA architecture is employed to simultaneously characterize the local correlations of spectral features and extract high-level feature representations of hyperspectral data. In addition, the appropriate receptive field constraint is concurrently updated by measuring the spatial distances from the neighbor nodes to the corresponding node. Finally, the efficient random forest classifier is cascaded to the last hidden layer of the SSA architecture as a benchmark classifier. Experimental results on two real HSI datasets demonstrate that the proposed hierarchical LRF constrained stacked sparse autoencoder and random forest (SSARF) provides encouraging results with respect to other contrastive methods, for instance, the improvements of overall accuracy in a range of 0.72%-10.87% for the Indian Pines dataset and 0.74%-7.90% for the Kennedy Space Center dataset; moreover, it generates lower running time compared with the result provided by similar SSARF based methodology.

  12. Addressing the challenges in using qualitative data in qualitative comparative analysis

    NARCIS (Netherlands)

    de Block, Debora; Vis, B.

    2017-01-01

    This paper addresses an issue that so far has received relatively little attention in methodological discussions about Qualitative Comparative Analysis (QCA), namely the challenges researchers face when using qualitative data in QCA analyses. Building on a literature review of 22 empirical studies

  13. Can action research strengthen district health management and improve health workforce performance? A research protocol.

    Science.gov (United States)

    Mshelia, C; Huss, R; Mirzoev, T; Elsey, H; Baine, S O; Aikins, M; Kamuzora, P; Bosch-Capblanch, X; Raven, J; Wyss, K; Green, A; Martineau, T

    2013-08-30

    The single biggest barrier for countries in sub-Saharan Africa (SSA) to scale up the necessary health services for addressing the three health-related Millennium Development Goals and achieving Universal Health Coverage is the lack of an adequate and well-performing health workforce. This deficit needs to be addressed both by training more new health personnel and by improving the performance of the existing and future health workforce. However, efforts have mostly been focused on training new staff and less on improving the performance of the existing health workforce. The purpose of this paper is to disseminate the protocol for the PERFORM project and reflect on the key challenges encountered during the development of this methodology and how they are being overcome. The overall aim of the PERFORM project is to identify ways of strengthening district management in order to address health workforce inadequacies by improving health workforce performance in SSA. The study will take place in three districts each in Ghana, Tanzania and Uganda using an action research approach. With the support of the country research teams, the district health management teams (DHMTs) will lead on planning, implementation, observation, reflection and redefinition of the activities in the study. Taking into account the national and local human resource (HR) and health systems (HS) policies and practices already in place, 'bundles' of HR/HS strategies that are feasible within the context and affordable within the districts' budget will be developed by the DHMTs to strengthen priority areas of health workforce performance. A comparative analysis of the findings from the three districts in each country will add new knowledge on the effects of these HR/HS bundles on DHMT management and workforce performance and the impact of an action research approach on improving the effectiveness of the DHMTs in implementing these interventions. Different challenges were faced during the development of

  14. Collaboration challenges in systematic reviews: a survey of health sciences librarians

    Directory of Open Access Journals (Sweden)

    Joey Nicholson

    2017-10-01

    Results: Of the 17 challenges listed in the survey, 8 were reported as common by over 40% of respondents. These included methodological issues around having too broad or narrow research questions, lacking eligibility criteria, having unclear research questions, and not following established methods. The remaining challenges were interpersonal, including issues around student-led projects and the size of the research team. Of the top 8 most frequent challenges, 5 were also ranked as most difficult to handle. Open-ended responses underscored many of the challenges included in the survey and revealed several additional challenges. Conclusions: These results suggest that the most frequent and challenging issues relate to development of the research question and general communication with team members. Clear protocols for collaboration on systematic reviews, as well as a culture of mentorship, can help librarians prevent and address these challenges.  This article has been approved for the Medical Library Association’s Independent Reading Program.

  15. The multi-copy simultaneous search methodology: a fundamental tool for structure-based drug design.

    Science.gov (United States)

    Schubert, Christian R; Stultz, Collin M

    2009-08-01

    Fragment-based ligand design approaches, such as the multi-copy simultaneous search (MCSS) methodology, have proven to be useful tools in the search for novel therapeutic compounds that bind pre-specified targets of known structure. MCSS offers a variety of advantages over more traditional high-throughput screening methods, and has been applied successfully to challenging targets. The methodology is quite general and can be used to construct functionality maps for proteins, DNA, and RNA. In this review, we describe the main aspects of the MCSS method and outline the general use of the methodology as a fundamental tool to guide the design of de novo lead compounds. We focus our discussion on the evaluation of MCSS results and the incorporation of protein flexibility into the methodology. In addition, we demonstrate on several specific examples how the information arising from the MCSS functionality maps has been successfully used to predict ligand binding to protein targets and RNA.

  16. Assessment of methodologies for radioactive waste management

    International Nuclear Information System (INIS)

    Hoos, I.R.

    1978-01-01

    No quantitative methodology is adequate to encompass and assess all the risks, no risk/benefit calculation is fine-tuned enough to supply decision-makers with the full range and all of the dimensions. Quality assurance cannot be conceived in terms of systems design alone, but must be maintained vigilantly and with integrity throughout the process. The responsibility of the NRC is fairly well established with respect to overall reactor safety. With respect to the management of radioactive wastes, its mission is not yet so clearly delineated. Herein lies a challenge and an opportunity. Where the known quantitative methodologies are restrictive and likely to have negative feedback effect on authority and public support, the broader lens and the bolder thrust are called for. The cozy cocoon of figures ultimately protects no one. The Commission, having acknowledged that the management of radioactive wastes is not merely a technological matter can now take the socially responsible position of exploring as fully and confronting as candidly as possible the total range of dimensions involved. Paradoxically, it is Charles J. Hitch, intellectual progenitor of the methodology, who observes that we may be missing the meaning of his message by relying too heavily on quantitative analysis and thus defining our task too narrowly. We live in a closed system, in which science and technology, politics and economics, and, above all, social and human elements interact, sometimes to create the problems, sometimes to articulate the questions, and sometimes to find viable solutions

  17. A Hybrid Short-Term Traffic Flow Prediction Model Based on Singular Spectrum Analysis and Kernel Extreme Learning Machine.

    Directory of Open Access Journals (Sweden)

    Qiang Shang

    Full Text Available Short-term traffic flow prediction is one of the most important issues in the field of intelligent transport system (ITS. Because of the uncertainty and nonlinearity, short-term traffic flow prediction is a challenging task. In order to improve the accuracy of short-time traffic flow prediction, a hybrid model (SSA-KELM is proposed based on singular spectrum analysis (SSA and kernel extreme learning machine (KELM. SSA is used to filter out the noise of traffic flow time series. Then, the filtered traffic flow data is used to train KELM model, the optimal input form of the proposed model is determined by phase space reconstruction, and parameters of the model are optimized by gravitational search algorithm (GSA. Finally, case validation is carried out using the measured data of an expressway in Xiamen, China. And the SSA-KELM model is compared with several well-known prediction models, including support vector machine, extreme learning machine, and single KLEM model. The experimental results demonstrate that performance of the proposed model is superior to that of the comparison models. Apart from accuracy improvement, the proposed model is more robust.

  18. The Visual Object Tracking VOT2016 Challenge Results

    KAUST Repository

    Kristan, Matej

    2016-11-02

    The Visual Object Tracking challenge VOT2016 aims at comparing short-term single-object visual trackers that do not apply pre-learned models of object appearance. Results of 70 trackers are presented, with a large number of trackers being published at major computer vision conferences and journals in the recent years. The number of tested state-of-the-art trackers makes the VOT 2016 the largest and most challenging benchmark on short-term tracking to date. For each participating tracker, a short description is provided in the Appendix. The VOT2016 goes beyond its predecessors by (i) introducing a new semi-automatic ground truth bounding box annotation methodology and (ii) extending the evaluation system with the no-reset experiment. The dataset, the evaluation kit as well as the results are publicly available at the challenge website (http://votchallenge.net).

  19. The Visual Object Tracking VOT2016 Challenge Results

    KAUST Repository

    Kristan, Matej; Leonardis, Aleš; Matas, Jiři; Felsberg, Michael; Pflugfelder, Roman; Čehovin, Luka; Vojí r̃, Tomá š; Hä ger, Gustav; Lukežič, Alan; Ferná ndez, Gustavo; Gupta, Abhinav; Petrosino, Alfredo; Memarmoghadam, Alireza; Garcia-Martin, Alvaro; Solí s Montero, André s; Vedaldi, Andrea; Robinson, Andreas; Ma, Andy J.; Varfolomieiev, Anton; Alatan, Aydin; Erdem, Aykut; Ghanem, Bernard; Liu, Bin; Han, Bohyung; Martinez, Brais; Chang, Chang-Ming; Xu, Changsheng; Sun, Chong; Kim, Daijin; Chen, Dapeng; Du, Dawei; Mishra, Deepak; Yeung, Dit-Yan; Gundogdu, Erhan; Erdem, Erkut; Khan, Fahad; Porikli, Fatih; Zhao, Fei; Bunyak, Filiz; Battistone, Francesco; Zhu, Gao; Roffo, Giorgio; Subrahmanyam, Gorthi R. K. Sai; Bastos, Guilherme; Seetharaman, Guna; Medeiros, Henry; Li, Hongdong; Qi, Honggang; Bischof, Horst; Possegger, Horst; Lu, Huchuan; Lee, Hyemin; Nam, Hyeonseob; Chang, Hyung Jin; Drummond, Isabela; Valmadre, Jack; Jeong, Jae-chan; Cho, Jae-il; Lee, Jae-Yeong; Zhu, Jianke; Feng, Jiayi; Gao, Jin; Choi, Jin Young; Xiao, Jingjing; Kim, Ji-Wan; Jeong, Jiyeoup; Henriques, Joã o F.; Lang, Jochen; Choi, Jongwon; Martinez, Jose M.; Xing, Junliang; Gao, Junyu; Palaniappan, Kannappan; Lebeda, Karel; Gao, Ke; Mikolajczyk, Krystian; Qin, Lei; Wang, Lijun; Wen, Longyin; Bertinetto, Luca; Rapuru, Madan Kumar; Poostchi, Mahdieh; Maresca, Mario; Danelljan, Martin; Mueller, Matthias; Zhang, Mengdan; Arens, Michael; Valstar, Michel; Tang, Ming; Baek, Mooyeol; Khan, Muhammad Haris; Wang, Naiyan; Fan, Nana; Al-Shakarji, Noor; Miksik, Ondrej; Akin, Osman; Moallem, Payman; Senna, Pedro; Torr, Philip H. S.; Yuen, Pong C.; Huang, Qingming; Martin-Nieto, Rafael; Pelapur, Rengarajan; Bowden, Richard; Laganiè re, Robert; Stolkin, Rustam; Walsh, Ryan; Krah, Sebastian B.; Li, Shengkun; Zhang, Shengping; Yao, Shizeng; Hadfield, Simon; Melzi, Simone; Lyu, Siwei; Li, Siyi; Becker, Stefan; Golodetz, Stuart; Kakanuru, Sumithra; Choi, Sunglok; Hu, Tao; Mauthner, Thomas; Zhang, Tianzhu; Pridmore, Tony; Santopietro, Vincenzo; Hu, Weiming; Li, Wenbo; Hü bner, Wolfgang; Lan, Xiangyuan; Wang, Xiaomeng; Li, Xin; Li, Yang; Demiris, Yiannis; Wang, Yifan; Qi, Yuankai; Yuan, Zejian; Cai, Zexiong; Xu, Zhan; He, Zhenyu; Chi, Zhizhen

    2016-01-01

    The Visual Object Tracking challenge VOT2016 aims at comparing short-term single-object visual trackers that do not apply pre-learned models of object appearance. Results of 70 trackers are presented, with a large number of trackers being published at major computer vision conferences and journals in the recent years. The number of tested state-of-the-art trackers makes the VOT 2016 the largest and most challenging benchmark on short-term tracking to date. For each participating tracker, a short description is provided in the Appendix. The VOT2016 goes beyond its predecessors by (i) introducing a new semi-automatic ground truth bounding box annotation methodology and (ii) extending the evaluation system with the no-reset experiment. The dataset, the evaluation kit as well as the results are publicly available at the challenge website (http://votchallenge.net).

  20. Scenario development methodologies

    International Nuclear Information System (INIS)

    Eng, T.; Hudson, J.; Stephansson, O.

    1994-11-01

    In the period 1981-1994, SKB has studied several methodologies to systematize and visualize all the features, events and processes (FEPs) that can influence a repository for radioactive waste in the future. All the work performed is based on the terminology and basic findings in the joint SKI/SKB work on scenario development presented in the SKB Technical Report 89-35. The methodologies studied are a) Event tree analysis, b) Influence diagrams and c) Rock Engineering Systems (RES) matrices. Each one of the methodologies is explained in this report as well as examples of applications. One chapter is devoted to a comparison between the two most promising methodologies, namely: Influence diagrams and the RES methodology. In conclusion a combination of parts of the Influence diagram and the RES methodology is likely to be a promising approach. 26 refs

  1. Do systematic reviews on pediatric topics need special methodological considerations?

    Science.gov (United States)

    Farid-Kapadia, Mufiza; Askie, Lisa; Hartling, Lisa; Contopoulos-Ioannidis, Despina; Bhutta, Zulfiqar A; Soll, Roger; Moher, David; Offringa, Martin

    2017-03-06

    Systematic reviews are key tools to enable decision making by healthcare providers and policymakers. Despite the availability of the evidence based Preferred Reporting Items for Systematic reviews and Meta-Analysis (PRISMA-2009 and PRISMA-P 2015) statements that were developed to improve the transparency and quality of reporting of systematic reviews, uncertainty on how to deal with pediatric-specific methodological challenges of systematic reviews impairs decision-making in child health. In this paper, we identify methodological challenges specific to the design, conduct and reporting of pediatric systematic reviews, and propose a process to address these challenges. One fundamental decision at the outset of a systematic review is whether to focus on a pediatric population only, or to include both adult and pediatric populations. Both from the policy and patient care point of view, the appropriateness of interventions and comparators administered to pre-defined pediatric age subgroup is critical. Decisions need to be based on the biological plausibility of differences in treatment effects across the developmental trajectory in children. Synthesis of evidence from different trials is often impaired by the use of outcomes and measurement instruments that differ between trials and are neither relevant nor validated in the pediatric population. Other issues specific to pediatric systematic reviews include lack of pediatric-sensitive search strategies and inconsistent choices of pediatric age subgroups in meta-analyses. In addition to these methodological issues generic to all pediatric systematic reviews, special considerations are required for reviews of health care interventions' safety and efficacy in neonatology, global health, comparative effectiveness interventions and individual participant data meta-analyses. To date, there is no standard approach available to overcome this problem. We propose to develop a consensus-based checklist of essential items which

  2. Spatial agent-based models for socio-ecological systems: challenges and prospects

    NARCIS (Netherlands)

    de Filatova, T.; Verburg, P.H.; Parker, D.C.; Stannard, S.R.

    2013-01-01

    Departing from the comprehensive reviews carried out in the field, we identify the key challenges that agent-based methodology faces when modeling coupled socio-ecological systems. Focusing primarily on the papers presented in this thematic issue, we review progress in spatial agent-based models

  3. Conceptual and Methodological Problems with Comparative Work on Artificial Language Learning

    OpenAIRE

    Jeffrey Watumull; Marc D. Hauser; Robert C. Berwick

    2014-01-01

    Several theoretical proposals for the evolution of language have sparked a renewed search for comparative data on human and non-human animal computational capacities. However, conceptual confusions still hinder the field, leading to experimental evidence that fails to test for comparable human competences. Here we focus on two conceptual and methodological challenges that affect the field generally: 1) properly characterizing the computational features of the faculty of language in the narrow...

  4. Sub-Saharan Africa’s rail freight transport system: Potential impact of densification on cost

    Directory of Open Access Journals (Sweden)

    Anneke de Bod

    2010-11-01

    Full Text Available The main response to sub-Saharan Africa’s (SSA challenges has been foreign aid. Yet, despite the large amounts received, the challenges remain. There is an opportunity to consider a different model with less focus on aid and more on investment. In the transport sector specifically, investment decisions should be informed by a longterm optimal balance between different transport modes. The research presented in this paper highlights the significant cost reduction opportunities possible through the densification of rail freight, especially over longer distances, with concomitant implications for increased profitability for rail operators. The densification opportunity should also place a core focus on transport corridors being developed throughout the region. SSA countries themselves can play a critical role in unlocking this potential through, inter alia, simplifying regional economic communities and taking the lead in structuring agreements with the international community.

  5. Challenges in Using Mix Methods in Evaluation

    OpenAIRE

    Stefan COJOCARU

    2010-01-01

    This article explores the debates between quantitative and qualitative methods in the evaluation process, analyzes the challenges about methodological mix in terms of credibility and validity of data and tools, and the evaluation findings. Beyond the epistemological contradictions, it seems that, in terms of usefulness, the mixing of methods is a practical solution, along with hybrids theories, able to provide information to improve the sufficiency of the program. Mixing methods is also a wa...

  6. Challenges of characterization of radioactive waste with High composition variability and their consequences measurement methodology

    International Nuclear Information System (INIS)

    Lexa, D.

    2014-01-01

    Radioactive waste characterization is a key step in every nuclear decommissioning project. It normally relies on a combination of facility operational history with results of destructive and non-destructive analysis. A particularly challenging situation arises when historical waste from a nuclear research facility is to be characterized, meaning little or no radiological information is available and the composition of the waste is highly variable. The nuclide vector concept is of limited utility, resulting in increased requirements placed on both the extent and performance of destructive and non-destructive analysis. Specific challenges are illustrated on an example of the decommissioning project underway at the Joint Research Center of the European Commission in Ispra. (author)

  7. Methodologies for Verification and Validation of Space Launch System (SLS) Structural Dynamic Models: Appendices

    Science.gov (United States)

    Coppolino, Robert N.

    2018-01-01

    Verification and validation (V&V) is a highly challenging undertaking for SLS structural dynamics models due to the magnitude and complexity of SLS subassemblies and subassemblies. Responses to challenges associated with V&V of Space Launch System (SLS) structural dynamics models are presented in Volume I of this paper. Four methodologies addressing specific requirements for V&V are discussed. (1) Residual Mode Augmentation (RMA). (2) Modified Guyan Reduction (MGR) and Harmonic Reduction (HR, introduced in 1976). (3) Mode Consolidation (MC). Finally, (4) Experimental Mode Verification (EMV). This document contains the appendices to Volume I.

  8. Developing a Design Methodology for Web 2.0 Mediated Learning

    DEFF Research Database (Denmark)

    Buus, Lillian; Georgsen, Marianne; Ryberg, Thomas

    In this paper we discuss the notion of a learning methodology and situate this within the wider frame of learning design or ?Designing for Learning?. We discuss existing work within this broad area by trying to categorize different approaches and interpretations and we present our development...... of particular ?mediating design artefacts?. We discuss what can be viewed as a lack of attention paid to integrating the preferred teaching styles and learning philosophies of practitioners into design tools, and present a particular method for learning design; the COllaborative E-learning Design method (Co......Ed). We describe how this method has been adopted as part of a learning methodology building on concepts and models presented in the other symposium papers, in particular those of active, problem based learning and web 2.0-technologies. The challenge of designing on the basis of an explicit learning...

  9. Developing a Design Methodology for Web 2.0 Mediated Learning

    DEFF Research Database (Denmark)

    Buus, Lillian; Georgsen, Marianne; Ryberg, Thomas

    2017-01-01

    In this paper we discuss the notion of a learning methodology and situate this within the wider frame of learning design or ?Designing for Learning?. We discuss existing work within this broad area by trying to categorize different approaches and interpretations and we present our development...... of particular ?mediating design artefacts?. We discuss what can be viewed as a lack of attention paid to integrating the preferred teaching styles and learning philosophies of practitioners into design tools, and present a particular method for learning design; the COllaborative E-learning Design method (Co......Ed). We describe how this method has been adopted as part of a learning methodology building on concepts and models presented in the other symposium papers, in particular those of active, problem based learning and web 2.0-technologies. The challenge of designing on the basis of an explicit learning...

  10. Human Ro60 (SSA2) genomic organization and sequence alterations, examined in cutaneous lupus erythematosus.

    Science.gov (United States)

    Millard, T P; Ashton, G H S; Kondeatis, E; Vaughan, R W; Hughes, G R V; Khamashta, M A; Hawk, J L M; McGregor, J M; McGrath, J A

    2002-02-01

    The Ro 60 kDa protein (Ro60 or SSA2) is the major component of the Ro ribonucleoprotein (Ro RNP) complex, to which an immune response is a specific feature of several autoimmune diseases. The genomic organization and any sequence variation within the DNA encoding Ro60 are unknown. To characterize the Ro60 gene structure and to assess whether any sequence alterations might be associated with serum anti-Ro antibody in subacute cutaneous lupus erythematosus (SCLE), thus potentially providing new insight into disease pathogenesis. The cDNA sequence for Ro60 was obtained from the NCBI database and used for a BLAST search for a clone containing the entire genomic sequence. The intron-exon borders were confirmed by designing intronic primer pairs to flank each exon, which were then used to amplify genomic DNA for automated sequencing from 36 caucasian patients with SCLE (anti-Ro positive) and 49 with discoid LE (DLE, anti-Ro negative), in addition to 36 healthy caucasian controls. Heteroduplex analysis of polymerase chain reaction (PCR) products from patients and controls spanning all Ro60 exons (1-8) revealed a common bandshift in the PCR products spanning exon 7. Sequencing of the corresponding PCR products demonstrated an A > G substitution at nucleotide position 1318-7, within the consensus acceptor splice site of exon 7 (GenBank XM001901). The allele frequencies were major allele A (0.71) and minor allele G (0.29) in 72 control chromosomes, with no significant differences found between SCLE patients, DLE patients and controls. The genomic organization of the DNA encoding the Ro60 protein is described, including a common polymorphism within the consensus acceptor splice site of exon 7. Our delineation of a strategy for the genomic amplification of Ro60 forms a basis for further examination of the pathological functions of the Ro RNP in autoimmune disease.

  11. Quantifying biopsychosocial aspects in everyday contexts: an integrative methodological approach from the behavioral sciences

    Science.gov (United States)

    Portell, Mariona; Anguera, M Teresa; Hernández-Mendo, Antonio; Jonsson, Gudberg K

    2015-01-01

    Contextual factors are crucial for evaluative research in psychology, as they provide insights into what works, for whom, in what circumstances, in what respects, and why. Studying behavior in context, however, poses numerous methodological challenges. Although a comprehensive framework for classifying methods seeking to quantify biopsychosocial aspects in everyday contexts was recently proposed, this framework does not contemplate contributions from observational methodology. The aim of this paper is to justify and propose a more general framework that includes observational methodology approaches. Our analysis is rooted in two general concepts: ecological validity and methodological complementarity. We performed a narrative review of the literature on research methods and techniques for studying daily life and describe their shared properties and requirements (collection of data in real time, on repeated occasions, and in natural settings) and classification criteria (eg, variables of interest and level of participant involvement in the data collection process). We provide several examples that illustrate why, despite their higher costs, studies of behavior and experience in everyday contexts offer insights that complement findings provided by other methodological approaches. We urge that observational methodology be included in classifications of research methods and techniques for studying everyday behavior and advocate a renewed commitment to prioritizing ecological validity in behavioral research seeking to quantify biopsychosocial aspects. PMID:26089708

  12. Archetype modeling methodology.

    Science.gov (United States)

    Moner, David; Maldonado, José Alberto; Robles, Montserrat

    2018-03-01

    Clinical Information Models (CIMs) expressed as archetypes play an essential role in the design and development of current Electronic Health Record (EHR) information structures. Although there exist many experiences about using archetypes in the literature, a comprehensive and formal methodology for archetype modeling does not exist. Having a modeling methodology is essential to develop quality archetypes, in order to guide the development of EHR systems and to allow the semantic interoperability of health data. In this work, an archetype modeling methodology is proposed. This paper describes its phases, the inputs and outputs of each phase, and the involved participants and tools. It also includes the description of the possible strategies to organize the modeling process. The proposed methodology is inspired by existing best practices of CIMs, software and ontology development. The methodology has been applied and evaluated in regional and national EHR projects. The application of the methodology provided useful feedback and improvements, and confirmed its advantages. The conclusion of this work is that having a formal methodology for archetype development facilitates the definition and adoption of interoperable archetypes, improves their quality, and facilitates their reuse among different information systems and EHR projects. Moreover, the proposed methodology can be also a reference for CIMs development using any other formalism. Copyright © 2018 Elsevier Inc. All rights reserved.

  13. Philippine Classroom Teachers as Researchers: Teachers' Perceptions, Motivations, and Challenges

    Science.gov (United States)

    Ulla, Mark B.; Barrera, Kenneth Ian B.; Acompanado, Meller M.

    2017-01-01

    This study explores teachers' perceptions and motivations, challenges, and needs of 50 teachers in Agusan del Norte, Philippines with regards to doing research. Methodologies used were survey questionnaire, and group and individual interviews. Findings revealed that teacher-respondents had a positive perceptions towards doing research and its…

  14. Using CASE tools to write engineering specifications

    Science.gov (United States)

    Henry, James E.; Howard, Robert W.; Iveland, Scott T.

    1993-08-01

    There are always a wide variety of obstacles to writing and maintaining engineering documentation. To combat these problems, documentation generation can be linked to the process of engineering development. The same graphics and communication tools used for structured system analysis and design (SSA/SSD) also form the basis for the documentation. The goal is to build a living document, such that as an engineering design changes, the documentation will `automatically' revise. `Automatic' is qualified by the need to maintain textual descriptions associated with the SSA/SSD graphics, and the need to generate new documents. This paper describes a methodology and a computer aided system engineering toolset that enables a relatively seamless transition into document generation for the development engineering team.

  15. Challenges in Distributed Leadership: Evidence from the Perspective of Headteachers

    Science.gov (United States)

    Tahir, Lokman Mohd; Lee, Sui Liang; Musah, Mohammed Borhandden; Jaffri, Hadijah; Said, Mohd Nihra Haruzuan Mohamad; Yasin, Mohd Hanafi Mohd

    2016-01-01

    Purpose: The purpose of this paper is to investigate the issues and challenges faced by headteachers in practicing the suggested distributed leadership (DL) approach in three primary schools to their middle layer leaders. Design/methodology/approach: The study employed a case study design and data were collected through semi-structured interviews.…

  16. Organizational information assets classification model and security architecture methodology

    Directory of Open Access Journals (Sweden)

    Mostafa Tamtaji

    2015-12-01

    Full Text Available Today's, Organizations are exposed with huge and diversity of information and information assets that are produced in different systems shuch as KMS, financial and accounting systems, official and industrial automation sysytems and so on and protection of these information is necessary. Cloud computing is a model for enabling ubiquitous, convenient, on-demand network access to a shared pool of configurable computing resources that can be rapidly provisioned and released.several benefits of this model cuses that organization has a great trend to implementing Cloud computing. Maintaining and management of information security is the main challenges in developing and accepting of this model. In this paper, at first, according to "design science research methodology" and compatible with "design process at information systems research", a complete categorization of organizational assets, including 355 different types of information assets in 7 groups and 3 level, is presented to managers be able to plan corresponding security controls according to importance of each groups. Then, for directing of organization to architect it’s information security in cloud computing environment, appropriate methodology is presented. Presented cloud computing security architecture , resulted proposed methodology, and presented classification model according to Delphi method and expers comments discussed and verified.

  17. Smart Industry Research in the Field of HRM : Resetting Job Design as an Example of Upcoming Challenges

    NARCIS (Netherlands)

    Habraken, Milou Maria Petronella; Bondarouk, Tatiana; Bondarouk, Tanya; Ruel, Huub; Parry, Emma

    2017-01-01

    Purpose – This chapter aims to encourage and guide Smart Industry HRM-related research by addressing upcoming challenges developed using a Job Design lens. Methodology/approach – The challenges are constructed based on a developed overview of the existing body of work related to Job Design and a

  18. Concept mapping methodology and community-engaged research: A perfect pairing.

    Science.gov (United States)

    Vaughn, Lisa M; Jones, Jennifer R; Booth, Emily; Burke, Jessica G

    2017-02-01

    Concept mapping methodology as refined by Trochim et al. is uniquely suited to engage communities in all aspects of research from project set-up to data collection to interpreting results to dissemination of results, and an increasing number of research studies have utilized the methodology for exploring complex health issues in communities. In the current manuscript, we present the results of a literature search of peer-reviewed articles in health-related research where concept mapping was used in collaboration with the community. A total of 103 articles met the inclusion criteria. We first address how community engagement was defined in the articles and then focus on the articles describing high community engagement and the associated community outcomes/benefits and methodological challenges. A majority (61%; n=63) of the articles were classified as low to moderate community engagement and participation while 38% (n=39) of the articles were classified as high community engagement and participation. The results of this literature review enhance our understanding of how concept mapping can be used in direct collaboration with communities and highlights the many potential benefits for both researchers and communities. Copyright © 2016 Elsevier Ltd. All rights reserved.

  19. Methodological challenges in collecting social and behavioural data regarding the HIV epidemic among gay and other men who have sex with men in Australia.

    Science.gov (United States)

    Zablotska, Iryna B; Frankland, Andrew; Holt, Martin; de Wit, John; Brown, Graham; Maycock, Bruce; Fairley, Christopher; Prestage, Garrett

    2014-01-01

    Behavioural surveillance and research among gay and other men who have sex with men (GMSM) commonly relies on non-random recruitment approaches. Methodological challenges limit their ability to accurately represent the population of adult GMSM. We compared the social and behavioural profiles of GMSM recruited via venue-based, online, and respondent-driven sampling (RDS) and discussed their utility for behavioural surveillance. Data from four studies were selected to reflect each recruitment method. We compared demographic characteristics and the prevalence of key indicators including sexual and HIV testing practices obtained from samples recruited through different methods, and population estimates from respondent-driven sampling partition analysis. Overall, the socio-demographic profile of GMSM was similar across samples, with some differences observed in age and sexual identification. Men recruited through time-location sampling appeared more connected to the gay community, reported a greater number of sexual partners, but engaged in less unprotected anal intercourse with regular (UAIR) or casual partners (UAIC). The RDS sample overestimated the proportion of HIV-positive men and appeared to recruit men with an overall higher number of sexual partners. A single-website survey recruited a sample with characteristics which differed considerably from the population estimates with regards to age, ethnically diversity and behaviour. Data acquired through time-location sampling underestimated the rates of UAIR and UAIC, while RDS and online sampling both generated samples that underestimated UAIR. Simulated composite samples combining recruits from time-location and multi-website online sampling may produce characteristics more consistent with the population estimates, particularly with regards to sexual practices. Respondent-driven sampling produced the sample that was most consistent to population estimates, but this methodology is complex and logistically demanding

  20. A methodology for Manufacturing Execution Systems (MES) implementation

    Science.gov (United States)

    Govindaraju, Rajesri; Putra, Krisna

    2016-02-01

    Manufacturing execution system is information systems (IS) application that bridges the gap between IS at the top level, namely enterprise resource planning (ERP), and IS at the lower levels, namely the automation systems. MES provides a media for optimizing the manufacturing process as a whole in a real time basis. By the use of MES in combination with the implementation of ERP and other automation systems, a manufacturing company is expected to have high competitiveness. In implementing MES, functional integration -making all the components of the manufacturing system able to work well together, is the most difficult challenge. For this, there has been an industry standard that specifies the sub-systems of a manufacturing execution systems and defines the boundaries between ERP systems, MES, and other automation systems. The standard is known as ISA-95. Although the advantages from the use of MES have been stated in some studies, not much research being done on how to implement MES effectively. The purpose of this study is to develop a methodology describing how MES implementation project should be managed, utilising the support of ISA- 95 reference model in the system development process. A proposed methodology was developed based on a general IS development methodology. The developed methodology were then revisited based on the understanding about the specific charateristics of MES implementation project found in an Indonesian steel manufacturing company implementation case. The case study highlighted the importance of applying an effective requirement elicitation method during innitial system assessment process, managing system interfaces and labor division in the design process, and performing a pilot deployment before putting the whole system into operation.