WorldWideScience

Sample records for metasequoia glyptostroboides miki

  1. Antioxidant and antidermatophytic activities of essential oil and extracts of Metasequoia glyptostroboides Miki ex Hu.

    Science.gov (United States)

    Bajpai, Vivek K; Yoon, Jung In; Chul Kang, Sun

    2009-06-01

    This study was undertaken to assess the antioxidant and antidermatophytic potential of the essential oil and extracts (hexane, chloroform, ethyl acetate and methanol) of Metasequoia glyptostroboides Miki ex Hu. Antioxidant activity was evaluated by using 1,1-diphenyl-2-picrylhydrazyl (DPPH) assay. The free radical scavenging activities of the oil and ethyl acetate extract were found to be superior (IC(50)=9.1 and 14.24 microg/ml, respectively) as compared to butylatedhydroxyanisole (BHA), (IC(50)=18.27 microg/ml). Also the ethyl acetate extract revealed the highest phenolic contents (93.26 mg/g of dry wt) as compared to the other extracts. Further, oil (1250 microg/disc) and extracts (1750 microg/disc) revealed 35.33-67.66 and 18.0-53.3% antidermatophytic effect, respectively, along with their respective MIC values (62.5-500 and 250-4000 microg/ml) against Trichophyton rubrum KCTC 6345, T. rubrum KCTC 6375, T. rubrum KCTC 6352, T. mentagrophytes KCTC 6085, T. mentagrophytes KCTC 6077, T. mentagrophytes KCTC 6316, Microsporum canis KCTC 6591, M. canis KCTC 6348 and M. canis KCTC 6349. The oil also had a strong detrimental effect on spore germination as well as concentration and time-dependent kinetic inhibition of M. canis KCTC 6591.

  2. The role of bioactive substances in controlling foodborne pathogens derived from Metasequoia glyptostroboides Miki ex Hu.

    Science.gov (United States)

    Bajpai, Vivek K; Na, Minkyun; Kang, Sun Chul

    2010-07-01

    In an attempt to isolate bioactive substances, ethyl acetate cone extract of Metasequoia glyptostroboides was subjected to a column chromatographic analysis that resulted in isolation of an abietane type diterpenoid, taxoquinone. Its structure was elucidated by spectroscopic means. In further, taxoquinone showed potential antibacterial effect as diameters of zones of inhibition against foodborne pathogenic bacteria such as Listeria monocytogenes ATCC 19166, Salmonella typhimurium KCTC 2515, Salmonella enteritidis KCTC 2021, Escherichia coli ATCC 8739, E. coli O157:H7 ATCC 43888, Enterobacter aerogenes KCTC2190, Staphylococcus aureus ATCC 6538 and S. aureus KCTC 1916, which were found in the range of 10.6-15.8mm. The minimum inhibitory concentration (MIC) and minimum bactericidal concentration (MBC) values of taxoquinone against the employed bacterial pathogens were found in the range of 62.5-250 and 125-500 microg/ml. Also the compound had strong antibacterial effect on the viable counts of the tested bacteria. Further, scanning electron microscopic study demonstrated potential detrimental effect of taxoquinone on the morphology of E. coli ATCC 8739. These findings indicate that bioactive compound taxoquinone present in M. glyptostroboides could be used as a promising antibacterial agent in food industry to inhibit the growth of certain important foodborne pathogens. 2010 Elsevier Ltd. All rights reserved.

  3. Antibacterial abietane-type diterpenoid, taxodone from Metasequoia glyptostroboides Miki ex Hu.

    Science.gov (United States)

    Bajpai, Vivek K; Kang, Sun Chul

    2010-12-01

    In an attempt to isolate bioactive constituents, ethyl acetate cone extract of Metasequoia glyptostroboides was subjected to a column chromatographic analysis that resulted in isolation of an abietane-type diterpenoid, taxodone. Its structure was elucidated by spectroscopic means. Further, taxodone showed potential antibacterial effect as diameters of zones of inhibition against foodborne pathogenic bacteria, such as Listeria monocytogenes ATCC 19166, Salmonella typhimurium KCTC 2515, S. enteritidis KCTC 2021, Escherichia coli ATCC 8739, E. coli O157:H7 ATCC 43888, Enterobacter aerogenes KCTC 2190, Staphylococcus aureus ATCC 6538 and S. aureus KCTC 1916, were found in the range of 9.4 to 14.2 mm. The minimum inhibitory concentration (MIC) and minimum bactericidal concentration (MBC) values of taxodone against the employed bacterial pathogens were found in the range of 250 to 1000 and 250 to less than 2000 microg/ml, respectively. Also the compound had a strong antibacterial effect on the viable counts of the tested bacteria. These findings indicate that the bioactive compound taxodone present in M. glyptostroboides could be used as an antibacterial agent in food industry to inhibit the growth of certain important foodborne pathogens.

  4. Synergistic effect of nisin and cone essential oil of Metasequoia glyptostroboides Miki ex Hu against Listeria monocytogenes in milk samples.

    Science.gov (United States)

    Yoon, Jung In; Bajpai, Vivek K; Kang, Sun Chul

    2011-01-01

    This study was undertaken to evaluate the effect of nisin and cone essential oil of Metasequoia glyptostroboides against Listeria monocytogenes ATCC 19116 inoculated in whole (8%), low (1%) and skim (no fat content) milks. Essential oil at the concentrations of 2% and 5% revealed strong antilisterial effect against L. monocytogenes ATCC 19116 in all categories of milks. Nisin at the concentrations of 250 and 500 IU/ml displayed a remarkable antilisterial effect as compared to the control group. Also, the synergistic combinations of cone essential oil (1% and 2%) and nisin (62.5, 125, 250 and 500 IU/ml) had a remarkable antilisterial activity in all categories of whole, low and skim milks after 14 days. Results of this study indicate that the cone essential oil of M. glyptostroboides might be a useful candidate for using in food industry to control the growth of pathogenic microorganisms. Copyright © 2010 Elsevier Ltd. All rights reserved.

  5. Antioxidant Capacity and Proanthocyanidin Composition of the Bark of Metasequoia glyptostroboides

    OpenAIRE

    Chen, Fengyang; Zhang, Lin; Zong, Shuling; Xu, Shifang; Li, Xiaoyu; Ye, Yiping

    2014-01-01

    Metasequoia glyptostroboides Hu et Cheng is the only living species in the genus Metasequoia Miki ex Hu et Cheng (Taxodiaceae), which is well known as a “living fossil” species. In the Chinese folk medicine, the leaves and bark of M. glyptostroboides are used as antimicrobic, analgesic, and anti-inflammatory drug for dermatic diseases. This study is the first to report the free radical scavenging capacity, antioxidant activity, and proanthocyanidin composition of the bark of M. glyptostroboid...

  6. Terpenoids and norlignans from Metasequoia glyptostroboides.

    Science.gov (United States)

    Dong, Liao-Bin; He, Juan; Wang, Yuan-Yuan; Wu, Xing-De; Deng, Xu; Pan, Zheng-Hong; Xu, Gang; Peng, Li-Yan; Zhao, Yu; Li, Yan; Gong, Xun; Zhao, Qin-Shi

    2011-02-25

    Four new terpenoids, metaseglyptorin A (1), metasequoic acid C (2), 12α-hydroxy-8,15-isopimaradien-18-oic acid (3), and (-)-acora-2,4(14),8-trien-15-oic acid (4), and three new norlignans, metasequirins D-F (5-7), were isolated from Metasequoia glyptostroboides, together with 15 known compounds. Structures of the new compounds were determined by analysis of their spectroscopic data, and the absolute configuration of 7 was established by the modified Mosher method. All of the compounds were evaluated for cytotoxicity against five human tumor cell lines.

  7. The complete chloroplast genome sequence of the relict woody plant Metasequoia glyptostroboides Hu et Cheng

    Directory of Open Access Journals (Sweden)

    Jinhui eChen

    2015-06-01

    Full Text Available Metasequoia glyptostroboides Hu et Cheng is the only species in the genus Metasequoia Miki ex Hu et Cheng, which belongs to the Cupressaceae family. There were around ten species in the Metasequoia genus, which were widely spread across the Northern Hemisphere during the Cretaceous of the Mesozoic and in the Cenozoic. M. glyptostroboides is the only remaining representative of this genus. Here, we report the complete chloroplast (cp genome sequence and the cp genomic features of M. glyptostroboides. The M. glyptostroboides cp genome is 131,887 bp in length, with a total of 117 genes comprised of 82 protein-coding genes, 31 tRNA genes and four rRNA genes. In this genome, 11 forward repeats, nine palindromic repeats and 15 tandem repeats were detected. A total of 188 perfect microsatellites were detected through simple sequence repeat (SSR analysis and these were distributed unevenly within the cp genome. Comparison of the cp genome structure and gene order to those of several other land plants indicated that a copy of the inverted repeat (IR region, which was found to be IR region A (IRA, was lost in the M. glyptostroboides cp ge-nome. The five most divergent and five most conserved genes were determined and further phylogenetic analysis was performed among plant species, especially for relat-ed species in conifers. Finally, phylogenetic analysis demonstrated that M. glyptostro-boides is a sister species to Cryptomeria japonica (L. F. D. Don and to Taiwania cryptomerioides Hayata. The complete cp genome sequence information of M. glyp-tostroboides will be great helpful for further investigations of this endemic relict woody plant and for in-depth understanding of the evolutionary history of the conif-erous cp genomes, especially for the position of M. glyptostroboides in plant systemat-ics and evolution.

  8. The complete chloroplast genome sequence of the relict woody plant Metasequoia glyptostroboides Hu et Cheng.

    Science.gov (United States)

    Chen, Jinhui; Hao, Zhaodong; Xu, Haibin; Yang, Liming; Liu, Guangxin; Sheng, Yu; Zheng, Chen; Zheng, Weiwei; Cheng, Tielong; Shi, Jisen

    2015-01-01

    Metasequoia glyptostroboides Hu et Cheng is the only species in the genus Metasequoia Miki ex Hu et Cheng, which belongs to the Cupressaceae family. There were around 10 species in the Metasequoia genus, which were widely spread across the Northern Hemisphere during the Cretaceous of the Mesozoic and in the Cenozoic. M. glyptostroboides is the only remaining representative of this genus. Here, we report the complete chloroplast (cp) genome sequence and the cp genomic features of M. glyptostroboides. The M. glyptostroboides cp genome is 131,887 bp in length, with a total of 117 genes comprised of 82 protein-coding genes, 31 tRNA genes and four rRNA genes. In this genome, 11 forward repeats, nine palindromic repeats, and 15 tandem repeats were detected. A total of 188 perfect microsatellites were detected through simple sequence repeat (SSR) analysis and these were distributed unevenly within the cp genome. Comparison of the cp genome structure and gene order to those of several other land plants indicated that a copy of the inverted repeat (IR) region, which was found to be IR region A (IRA), was lost in the M. glyptostroboides cp genome. The five most divergent and five most conserved genes were determined and further phylogenetic analysis was performed among plant species, especially for related species in conifers. Finally, phylogenetic analysis demonstrated that M. glyptostroboides is a sister species to Cryptomeria japonica (L. F.) D. Don and to Taiwania cryptomerioides Hayata. The complete cp genome sequence information of M. glyptostroboides will be great helpful for further investigations of this endemic relict woody plant and for in-depth understanding of the evolutionary history of the coniferous cp genomes, especially for the position of M. glyptostroboides in plant systematics and evolution.

  9. Antioxidant Capacity and Proanthocyanidin Composition of the Bark of Metasequoia glyptostroboides.

    Science.gov (United States)

    Chen, Fengyang; Zhang, Lin; Zong, Shuling; Xu, Shifang; Li, Xiaoyu; Ye, Yiping

    2014-01-01

    Metasequoia glyptostroboides Hu et Cheng is the only living species in the genus Metasequoia Miki ex Hu et Cheng (Taxodiaceae), which is well known as a "living fossil" species. In the Chinese folk medicine, the leaves and bark of M. glyptostroboides are used as antimicrobic, analgesic, and anti-inflammatory drug for dermatic diseases. This study is the first to report the free radical scavenging capacity, antioxidant activity, and proanthocyanidin composition of the bark of M. glyptostroboides. We observed total of six extracts and fractions, which were easily obtained by water-ethanol extraction and followed by a further separation with D101 resin column chromatography, had significant DPPH radical, superoxide anion radical, and hydroxyl radical scavenging capacity, total antioxidative capacity (T-AOC), lipid peroxidation inhibitory activity, and metal ions chelating capacity. The fraction MGEB, which was obtained by 60% ethanol extraction and followed by a further separation with D101 resin column chromatograph, possessed the highest proanthocyanidin content and the highest free radical scavenging and antioxidant activities. Furthermore, MGEB could significantly protect against CCl4 induced acute liver injury through inhibition of oxidative stress in mice. In addition, ten proanthocyanidins were isolated from MGEB, and six of them were firstly reported from this plant.

  10. Antioxidant Capacity and Proanthocyanidin Composition of the Bark of Metasequoia glyptostroboides

    Directory of Open Access Journals (Sweden)

    Fengyang Chen

    2014-01-01

    Full Text Available Metasequoia glyptostroboides Hu et Cheng is the only living species in the genus Metasequoia Miki ex Hu et Cheng (Taxodiaceae, which is well known as a “living fossil” species. In the Chinese folk medicine, the leaves and bark of M. glyptostroboides are used as antimicrobic, analgesic, and anti-inflammatory drug for dermatic diseases. This study is the first to report the free radical scavenging capacity, antioxidant activity, and proanthocyanidin composition of the bark of M. glyptostroboides. We observed total of six extracts and fractions, which were easily obtained by water-ethanol extraction and followed by a further separation with D101 resin column chromatography, had significant DPPH radical, superoxide anion radical, and hydroxyl radical scavenging capacity, total antioxidative capacity (T-AOC, lipid peroxidation inhibitory activity, and metal ions chelating capacity. The fraction MGEB, which was obtained by 60% ethanol extraction and followed by a further separation with D101 resin column chromatograph, possessed the highest proanthocyanidin content and the highest free radical scavenging and antioxidant activities. Furthermore, MGEB could significantly protect against CCl4 induced acute liver injury through inhibition of oxidative stress in mice. In addition, ten proanthocyanidins were isolated from MGEB, and six of them were firstly reported from this plant.

  11. Antiviral potential of a diterpenoid compound sugiol from Metasequoia glyptostroboides.

    Science.gov (United States)

    Bajpai, Vivek K; Kim, Na-Hyung; Kim, Kangmin; Kang, Sun Chul

    2016-05-01

    This research reports first time antiviral activity of sugiol, a diterpenoid isolated from Metasequoia glyptostroboides in terms of its ability to inhibit in vitro growth of H1N1 influenza virus. Antiviral potential of sugiol was evaluated through hcytopathogenic reduction assay using Madin-Darby canine kidney (MDCK) cell line. Sugiol (500 μg/ml) was found to exhibit considerable anti-cytopathic effect on MDCK cell line confirming its antiviral efficacy against H1N1 influenza virus. These findings strongly reinforce the suggestion that sugiol could be a candidate of choice in combinational regimen with potential antiviral efficacy.

  12. [Analysis of the chemical constituents of volatile oils of Metasequoia glyptostroboides leave].

    Science.gov (United States)

    Shong, E; Lui, R

    1997-10-01

    The chemical constituents of volatile oils of Metasequoia glyptostroboides leave were analyzed by GC-MS-DS. 27 constituents were identified, alpha-pinene (70.65%) and caryophyllene (10.38%) of them are main components.

  13. Cytogenetic studies on Metasequoia glyptostroboides, a living fossil species.

    Science.gov (United States)

    He, Zican; Li, Jianqiang; Cai, Qing; Li, Xiaodong; Huang, Hongwen

    2004-11-01

    The chromosome morphology and meiotic pairing behavior in the pollen mother cells (PMCs) of Metasequoia glyptostroboides were investigated. The results showed that: (1) The chromosome number of the PMCs was 2n = 22. (2) The PMCs developed in the successive manner, and the nucleoids in the dynamic development were similar to those of the other gymnosperms. (3) At prophase, most of the chromosomes were unable to be identified distinctively because the chromosomes were long and tangled together. The chromosome segments were paired non-synchronously. At pachytene, the interstitial or terminal regions of some bivalents did not form synapsis and the paired chromosomes showed difference in sizes, indicating that there were structure differences between the homologous chromosomes. (4) At diakinesis, the ring bivalents showed complicated configurations due to the differences in location and number of chiasmata. In addition, there were cross-linked bivalents. (5) At metaphase I, the chromosome configuration of each cell was 8.2II(0) + 1.1II + 1.3II+ + 0.8I. Most of the chromosomes were ring bivalents, but some were cross-linked bivalents, rod bivalents, or univalents. (6) 15% PMCs at anaphase I and 22% PMCs at anaphase II presented chromosome bridges, chromosome fragments, micronuclei, and lagging chromosomes. Twenty seven percent microspores finally moved into one to three micronuclei. Twenty five percent pollens were abortive. The results indicated that the observed individual of M. glyptostroboides was probably a paracentric inversion heterozygote, and there were structural and behavioral differences between the homologous chromosomes. The chromosomal aberration of M. glyptostroboides may play an important role in the evolution of this relict species, which is known as a living fossil. Further evidence is needed to test whether the differences between homologous chromosomes were due to hybridization.

  14. Sustainable Management of Metasequoia glyptostroboides Plantation Forests in Shanghai

    Directory of Open Access Journals (Sweden)

    Ji Zheng

    2018-01-01

    Full Text Available Urban forestry is increasingly used as a tool for climate change mitigation and for providing environmental services to inhabitants of urban areas. However, tree species used in urban forestry are usually different from the ones used in commercial forestry. As a consequence, available data on growth and yield under alternative management scenarios are usually scarce. As forest models can be used to explore potential forest futures, they are of special interest as decision-support tools in urban forestry. In this research, we used the FORECAST ecosystem-level forest model to define the management prescriptions for Metasequoia glyptostroboides plantations in Shanghai that reach the highest net primary productivity (NPP. In a first step, a battery of different stand densities (from 500 to 4000 stems ha−1 was used to identify those with the highest NPP at stand level. Then, different thinning regimes (with intensities ranging from 15% to 40% of trees removed and applied at stand age 5 to 20 years were simulated on those initial densities with the highest NPP (3000 and 4000 stems ha−1. Planting 4000 stems ha−1 and not applying thinning achieved the highest annual NPP (14.39 ± 3.92 Mg ha−1 yr−1 during the first rotation, but it was not significantly different from the NPP achieved with the same initial density but thinning 40% of trees at year 10. NPP was estimated to decrease with consecutive rotations, and for the second rotation thinning was needed to significantly increase NPP (10.11 ± 2.59 Mg ha−1 yr−1 with 4000 stems ha−1 and 25% thinning at year 10 above non-thinning management. For the third rotation, the highest NPP was reached with initial density 3000 stems ha−1 and 25% thinning at year 10. Nitrogen flows were also estimated to decrease with consecutive rotations. These results indicate the potential of managing M. glyptostroboides urban plantations to reach their maximum productivity potential, but also that additional

  15. An EST dataset for Metasequoia glyptostroboides buds: the first EST resource for molecular genomics studies in Metasequoia.

    Science.gov (United States)

    Zhao, Ying; Thammannagowda, Shivegowda; Staton, Margaret; Tang, Sha; Xia, Xinli; Yin, Weilun; Liang, Haiying

    2013-03-01

    The "living fossil" Metasequoia glyptostroboides Hu et Cheng, commonly known as dawn redwood or Chinese redwood, is the only living species in the genus and is valued for its essential oil and crude extracts that have great potential for anti-fungal activity. Despite its paleontological significance and economical value as a rare relict species, genomic resources of Metasequoia are very limited. In order to gain insight into the molecular mechanisms behind the formation of reproductive buds and the transition from vegetative phase to reproductive phase in Metasequoia, we performed sequencing of expressed sequence tags from Metasequoia vegetative buds and female buds. By using the 454 pyrosequencing technology, a total of 1,571,764 high-quality reads were generated, among which 733,128 were from vegetative buds and 775,636 were from female buds. These EST reads were clustered and assembled into 114,124 putative unique transcripts (PUTs) with an average length of 536 bp. The 97,565 PUTs that were at least 100 bp in length were functionally annotated by a similarity search against public databases and assigned with Gene Ontology (GO) terms. A total of 59 known floral gene families and 190 isotigs involved in hormone regulation were captured in the dataset. Furthermore, a set of PUTs differentially expressed in vegetative and reproductive buds, as well as SSR motifs and high confidence SNPs, were identified. This is the first large-scale expressed sequence tags ever generated in Metasequoia and the first evidence for floral genes in this critically endangered deciduous conifer species.

  16. Effect of forest structural change on carbon storage in a coastal Metasequoia glyptostroboides stand.

    Science.gov (United States)

    Cheng, Xiangrong; Yu, Mukui; Wu, Tonggui

    2013-01-01

    Forest structural change affects the forest's growth and the carbon storage. Two treatments, thinning (30% thinning intensity) and underplanting plus thinning, are being implemented in a coastal Metasequoia glyptostroboides forest shelterbelt in Eastern China. The vegetation carbon storage significantly increased in the underplanted and thinned treatments compared with that in the unthinned treatment (P 0.05). The soil light fraction organic carbon (LFOC) was significantly higher at the 0-15 cm soil layer in the thinned and underplanted stands compared with that in the unthinned stand (P < 0.05). The soil respiration of the underplanted treatment was significantly higher than that of the unthinned treatment only in July (P < 0.05). This study concludes that 30% thinning and underplanting after thinning could be more favorable to carbon sequestration for M. glyptostroboides plantations in the coastal areas of Eastern China.

  17. Effect of Forest Structural Change on Carbon Storage in a Coastal Metasequoia glyptostroboides Stand

    Directory of Open Access Journals (Sweden)

    Xiangrong Cheng

    2013-01-01

    Full Text Available Forest structural change affects the forest’s growth and the carbon storage. Two treatments, thinning (30% thinning intensity and underplanting plus thinning, are being implemented in a coastal Metasequoia glyptostroboides forest shelterbelt in Eastern China. The vegetation carbon storage significantly increased in the underplanted and thinned treatments compared with that in the unthinned treatment (P0.05. The soil light fraction organic carbon (LFOC was significantly higher at the 0–15 cm soil layer in the thinned and underplanted stands compared with that in the unthinned stand (P<0.05. The soil respiration of the underplanted treatment was significantly higher than that of the unthinned treatment only in July (P<0.05. This study concludes that 30% thinning and underplanting after thinning could be more favorable to carbon sequestration for M. glyptostroboides plantations in the coastal areas of Eastern China.

  18. A diterpenoid sugiol from Metasequoia glyptostroboides with α-glucosidase and tyrosinase inhibitory potential

    Directory of Open Access Journals (Sweden)

    Vivek K. Bajpai

    2014-08-01

    Full Text Available Nowadays use of plant derived natural compounds have become a topic of increasing interest in food and medicine industries due to their multitude of biological and therapeutic properties. In this study, a diterpenoid compound sugiol, isolated from Metasequoia glyptostroboides was evaluated for α–glucosidase and tyrosinase inhibitory efficacy in terms of its potent anti-diabetic and anti-melanogenesis potential, respectively. As a result, sugiol at the concentration range of (100-10,000 µg/mL and (20-500 µg/mL showed potent efficacy on inhibiting α-glucosidase and tyrosinase enzymes in vitro ranging from 12.34-63.47% and 28.22-67.43%, respectively. These findings confirm the therapeutic potential of diterpenoid compound sugiol from M. glyptostroboides as a novel candidate for using in food and medicine industry which may have practical potential to cure skin and diabetes mellitus type-2 related disorders.

  19. Lack of incorporation of tritiated uridine by nuclei of mature sieve elements in Metasequoia glyptostroboides and Sequoiadendron giganteum.

    Science.gov (United States)

    Hébant, C

    1975-01-01

    The majority of nuclei which persist in "mature" sieve elements of Metasequoia glyptostroboides Hu and Chen and Sequoiadendron giganteum Buchholz fail to incorporate tritiated uridine (10 μCi/ml; 7 hours incubation of stem fragments). This is interpreted as further evidence for the degenerated condition of these nuclei.

  20. Temporal and spatial characteristics of male cone development in Metasequoia glyptostroboides Hu et Cheng.

    Science.gov (United States)

    Jin, Biao; Tang, Liang; Lu, Yan; Wang, Di; Zhang, Min; Ma, Jiuxia

    2012-12-01

    Metasequoia glyptostroboides, a famous relic species of conifer that survived in China, has been successfully planted in large numbers across the world. However, limited information on male cone development in the species is available. In this study, we observed the morphological and anatomical changes that occur during male cone development in M. glyptostroboides using semi-thin sections and scanning electron microscopy. The male cones were borne oppositely on one-year-old twigs that were mainly located around the outer and sunlit parts of crown. Male cones were initiated from early September and shed pollen in the following February. Each cone consisted of spirally arranged microsporophylls subtended by decussate sterile scales, and each microsporophyll commonly consisted of three microsporangia and a phylloclade. The microsporangial wall was composed of an epidermis, endothecium, and tapetum. In mid-February, the endothecium and tapetum layers disintegrated, and in the epidermal layer the cell walls were thickened with inner protrusions. Subsequently, dehiscence of the microsporangia occurred through rupturing of the microsporangial wall along the dehiscence line. These results suggest that the structure, morphology, architecture and arrangement of male cones of M. glyptostroboides are mainly associated with the production, protection and dispersal of pollen for optimization of wind pollination.

  1. Development of 23 novel polymorphic EST-SSR markers for the endangered relict conifer Metasequoia glyptostroboides.

    Science.gov (United States)

    Jin, Yuqing; Bi, Quanxin; Guan, Wenbin; Mao, Jian-Feng

    2015-09-01

    Metasequoia glyptostroboides is an endangered relict conifer species endemic to China. In this study, expressed sequence tag-simple sequence repeat (EST-SSR) markers were developed using transcriptome mining for future genetic and functional studies. We collected 97,565 unigene sequences generated by 454 pyrosequencing. A bioinformatics analysis identified 2087 unique and putative microsatellites, from which 96 novel microsatellite markers were developed. Fifty-three of the 96 primer sets successfully amplified clear fragments of the expected sizes; 23 of those loci were polymorphic. The number of alleles per locus ranged from two to eight, with an average of three, and the observed and expected heterozygosity values ranged from 0 to 1.0 and 0.117 to 0.813, respectively. These microsatellite loci will enrich the genetic resources to develop functional studies and conservation strategies for this endangered relict species.

  2. [Latitude variation mechanism of leaf traits of Metasequoia glyptostroboides in eastern coastal China].

    Science.gov (United States)

    Guo, Wei Hong; Wang, Hua; Yu, Mu Kui; Wu, Tong Gui; Han, You Zhi

    2017-03-18

    We analyzed the rules of Metasequoia glyptostroboides along with latitude, including leaf length, leaf width, leaf perimeter, leaf area, ratio of leaf length to width, specific leaf area (SLA), and leaf dry mass based on eight stands growing at different latitudes in the coastal area of eastern China, as well as their relationships with climatic and soil factors. The results showed that the leaf length, leaf width and leaf perimeter increased with increasing latitude, while the leaf area and SLA firstly increased and then decreased. The mean annual temperature and annual precipitation were the major environmental factors affecting the leaf traits along latitude gradient. With the increase of soil N content, the SLA decreased firstly and then increased, while the leaf mass decreased significantly. With the increase of soil P content, the SLA increased, and the leaf mass decreased significantly.

  3. Impacts of elevated ozone on growth and photosynthesis of Metasequoia glyptostroboides Hu et Cheng.

    Science.gov (United States)

    Zhang, Weiwei; Feng, Zhaozhong; Wang, Xiaoke; Niu, Junfeng

    2014-09-01

    One-year-old Metasequoia glyptostroboides seedlings were exposed to non-filtered ambient air (NF) and elevated ozone (E-O3, NF+60 ppb) in open-top chambers for two years. E-O3 accelerated leaf senescence, as indicated by significant decreases in photosynthetic pigment contents with the elongation of O3 exposure. E-O3 significantly affected gas exchange and carboxylation, inducing reductions in light-saturated photosynthesis (Asat), the maximum activity of Rubisco (Vc,max) and the maximum electron transport rate (Jmax). Chl a/b, Vc,max/Jmax and stomatal limitation (l) were not affected. Stomatal conductance (gs) was significantly decreased by E-O3 in the first year, but remained unchanged in the second year. It can be inferred that the decrease in Asat by E-O3 was mainly attributed to the changes in non-stomatal factors. After two years' exposure, E-O3 caused significant decreases in canopy photosynthesis and leaf mass per area, and a significant increase in the number of branches, but induced slight, not significant decreases in growth and biomass. Therefore, it can be concluded that the carbon accumulation of the species M. glyptostroboides could be negatively affected after long-term exposure to high O3 concentration. Copyright © 2014 Elsevier Ireland Ltd. All rights reserved.

  4. α-Glucosidase and tyrosinase inhibitory effects of an abietane type diterpenoid taxoquinone from Metasequoia glyptostroboides.

    Science.gov (United States)

    Bajpai, Vivek K; Park, Yong-Ha; Na, MinKyun; Kang, Sun Chul

    2015-03-26

    Nowadays plant derived natural compounds have gained huge amount of research attention especially in food and medicine industries due to their multitude of biological and therapeutic properties as alternative medicines. In this study, a diterpenoid compound taxoquinone, isolated from Metasequoia glyptostroboides was evaluated for its α-glucosidase and tyrosinase inhibitory efficacy in terms of its potent anti-diabetic and depigmentation potential, respectively. As a result, taxoquinone at the concentration range of 100-3,000 μg/mL and 200-1,000 μg/mL showed potent efficacy on inhibiting α-glucosidase and tyrosinase enzymes by 9.24-51.32% and 11.14-52.32%, respectively. The findings of this study clearly evident potent therapeutic efficacy of an abietane diterpenoid taxoquinone isolated from M. glyptostroboides with a possibility for using it as a novel candidate in food and medicine industry as a natural alternative medicine to prevent diabetes mellitus type-2 related disorders and as a depigmentation agent.

  5. A diterpenoid taxodone from Metasequoia glyptostroboides with antimycotic potential against clinical isolates of Candida species.

    Science.gov (United States)

    Bajpai, V K; Park, Y-H; Kang, S C

    2015-03-01

    The increasing importance of clinical isolates of Candida species and emerging resistance of Candida species to current synthetic antifungal agents have stimulated the search for safer and more effective alternative drugs from natural sources. This study was directed towards exploring the antimycotic potential of a diterpenoid compound taxodone isolated from Metasequoia glyptostroboides against pathogenic isolates of Candida species. Antimycotic efficacy of taxodone was evaluated by disc diffusion assay, determination of minimum inhibitory (MIC) and minimum fungicidal (MFC) concentrations, and cell viability assay. To confirm a partial antimycotic mode of action of taxodone, the efficacy of taxodone was determined by measuring the release of 260 nm absorbing materials from the selected Candida species as compared to control. The taxodone at the concentration of 400 μg/disc displayed potential antimycotic effect against the tested clinical and pathogenic isolates of Candida species as diameters of zones of inhibitions, which were found in the range of 11 ± 0.0 to 12.6 ± 0.5mm. The MIC and MFC values of taxodone against the tested clinical isolates were found in the range of 250 to 1000 and 500 to 2000μ g/mL, respectively. On the other hand, the MIC and MFC values of positive control (amphotericin B) against the tested Candida isolates were found in the range of 62.5 to 250 and 500 to 2000 μg/mL. On the viable counts of the tested fungal isolates, the taxodone exerted significant antimycotic effect. Elaborative study of partial mode of action conducted onto the release of 260nm materials (DNA and RNA) revealed potential detrimental effect of taxodone on the membrane integrity of the tested pathogens at MIC concentration. With respect to the antimycotic effect of taxodone against pathogenic and clinical isolates of Candida species, it might be confirmed that bioactive compound taxodone present in M. glyptostroboides holds therapeutic value of medicinal

  6. Antimycotic potential of a diterpenoid taxoquinone against Candida species isolated from Metasequoia glyptostroboides

    Directory of Open Access Journals (Sweden)

    Vivek K. Bajpai

    2014-06-01

    Full Text Available The objective of this study was to confirm the antimycotic potential of a diterpenoid compound taxoquinone, isolated from Metasequoia glyptostroboides against pathogenic isolates of Candida species. The taxoquinone (100 μg/disc displayed potential anticandidal effect against Candia albicans KBN06P00076, KBN06P00074, C. glabrata KBN06P00066, KBN06P00068, C. tropicalis KBN06P00682, KBN06P00058, C. parapsilosis KBN06P00060, KBN06P00055, and C. guilliermondii KBN06P00492 and KBN06P00867 as a diameter of zones of inhibition, found in the range of 10 ± 0.6 to 13 ± 1.1 mm. The minimum inhibitory and minimum fungicidal concentrations of taxoquinone against the tested clinical isolates were found in the range of 125 to 500 and 125 to 1,000 μg/mL, respectively. On the viable counts of the tested fungal isolates, the taxoquinone evoked a remarkable anticandidal effect. Elaborative study of SEM revealed potential detrimental effect of taxoquinone on the morphology of C. parapsilosis KBN06P00060 at MIC concentration. These findings confirmed therapeutic potential of taxoquinone.

  7. 6-carboxydihydroresveratrol 3-O-β-glucopyranoside--a novel natural product from the Cretaceous relict Metasequoia glyptostroboides.

    Science.gov (United States)

    Nguyen, Xuan Hong Thy; Juvik, Ole Johan; Øvstedal, Dag Olav; Fossen, Torgils

    2014-06-01

    Metasequoia glyptostroboides, a tree native to China, is described as a living fossil and has existed for millions of years. The oldest fossils recorded have been dated to the late Cretaceous era. During the time of its existence, the molecular defence system of the tree has apparently resisted millions of generations of pathogens, which encouraged search for novel natural product from this source. Eight compounds have been characterised from needles of M. glyptostroboides, including the novel natural product 6-carboxydihydroresveratrol 3-O-β-glucopyranoside. The structure determinations were based on extensive use of 2D NMR spectroscopic techniques and high-resolution mass spectrometry. Copyright © 2014 Elsevier B.V. All rights reserved.

  8. Anti-listerial synergism of leaf essential oil of Metasequoia glyptostroboides with nisin in whole, low and skim milks.

    Science.gov (United States)

    Bajpai, Vivek K; Yoon, Jung In; Bhardwaj, Monika; Kang, Sun Chul

    2014-08-01

    To examine the individual and synergistic anti-listerial effect of nisin and leaf essential oil of Metasequoia glyptostroboides (M. glyptostroboides) against one of the leading foodborne pathogens Listeria monocytogenes (L. monocytogenes) ATCC 19116 in milk samples. The whole (8%), low (1%) and skim (no fat content) milk samples were inoculated with L. monocytogenes ATCC 19116 along with leaf essential oil of M. glyptostroboides or nisin alone as well in combinations. In this study, the leaf essential oil at the concentrations of 2% and 5% revealed strong anti-listerial effect against L. monocytogenes ATCC 19116 in all categories of milk samples. Nisin at the concentrations of 250 and 500 IU/mL displayed a strong inhibitory effect against ATCC 19116 as compared to the control group. Additionally, synergistic combinations of leaf essential oil (1%) and nisin (62.5, 125, 250 and 500 IU/mL) also had a remarkable anti-listerial synergism in all the tested milk samples including whole, low and skim milk after 14 days. As a major finding, the leaf essential oil of M. glyptostroboides might be a useful candidate for using in food industry to control the growth of foodborne pathogenic bacteria as confirmed by its potent anti-listerial synergistic effect with nisin against L. monocytogenes ATCC 19116 in different milk samples. Copyright © 2014 Hainan Medical College. Published by Elsevier B.V. All rights reserved.

  9. Antioxidant, lipid peroxidation inhibition and free radical scavenging efficacy of a diterpenoid compound sugiol isolated from Metasequoia glyptostroboides.

    Science.gov (United States)

    Bajpai, Vivek K; Sharma, Ajay; Kang, Sun Chul; Baek, Kwang-Hyun

    2014-01-01

    To investigate the antioxidant efficacy of a biologically active diterpenoid compound sugiol isolated from Metasequoia glyptostroboides (M. glyptostroboides) in various antioxidant models. An abietane type diterpenoid sugiol, isolated from ethyl acetate extract of M. glyptostroboides cones, was analyzed for its antioxidant efficacy as reducing power ability and lipid peroxidation inhibition as well as its ability to scavenge free radicals such as 1,1-diphenyl-2-picryl hydrazyl, nitric oxide, superoxide and hydroxyl radicals. The sugiol showed significant and concentration-dependent antioxidant and free radical scavenging activities. Consequently, the sugiol exerted lipid peroxidation inhibitory effect by 76.5% as compared to α-tocopherol (80.13%) and butylated hydroxyanisole (76.59%). In addition, the sugiol had significant scavenging activities of 1,1-diphenyl-2-picryl hydrazyl, nitric oxide, superoxide and hydroxyl free radicals in a concentration-dependent manner by 78.83%, 72.42%, 72.99% and 85.04%, when compared to the standard compound ascorbic acid (81.69%, 74.62%, 73.00% and 73.79%) and α-tocopherol/butylated hydroxyanisole (84.09%, 78.61%, 74.45% and 70.02%), respectively. These findings justify the biological and traditional uses of M. glyptostroboides or its secondary metabolites as confirmed by its promising antioxidant efficacy. Copyright © 2014 Hainan Medical College. Published by Elsevier B.V. All rights reserved.

  10. Growing with dinosaurs: natural products from the Cretaceous relict Metasequoia glyptostroboides Hu & Cheng-a molecular reservoir from the ancient world with potential in modern medicine.

    Science.gov (United States)

    Juvik, Ole Johan; Nguyen, Xuan Hong Thy; Andersen, Heidi Lie; Fossen, Torgils

    2016-01-01

    After the sensational rediscovery of living exemplars of the Cretaceous relict Metasequoia glyptostroboides -a tree previously known exclusively from fossils from various locations in the northern hemisphere, there has been an increasing interest in discovery of novel natural products from this unique plant source. This article includes the first complete compilation of natural products reported from M. glyptostroboides during the entire period in which the tree has been investigated (1954-2014) with main focus on the compounds specific to this plant source. Studies on the biological activity of pure compounds and extracts derived from M. glyptostroboides are reviewed for the first time. The unique potential of M. glyptostroboides as a source of bioactive constituents is founded on the fact that the tree seems to have survived unchanged since the Cretaceous era. Since then, its molecular defense system has resisted the attacks of millions of generations of pathogens. In line with this, some recent landmarks in Metasequoia paleobotany are covered. Initial spectral analysis of recently discovered intact 53 million year old wood and amber of Metasequoia strongly indicate that the tree has remained unchanged for millions of years at the molecular level.

  11. Development of 23 novel polymorphic EST-SSR markers for the endangered relict conifer Metasequoia glyptostroboides1

    Science.gov (United States)

    Jin, Yuqing; Bi, Quanxin; Guan, Wenbin; Mao, Jian-Feng

    2015-01-01

    Premise of the study: Metasequoia glyptostroboides is an endangered relict conifer species endemic to China. In this study, expressed sequence tag–simple sequence repeat (EST-SSR) markers were developed using transcriptome mining for future genetic and functional studies. Methods and Results: We collected 97,565 unigene sequences generated by 454 pyrosequencing. A bioinformatics analysis identified 2087 unique and putative microsatellites, from which 96 novel microsatellite markers were developed. Fifty-three of the 96 primer sets successfully amplified clear fragments of the expected sizes; 23 of those loci were polymorphic. The number of alleles per locus ranged from two to eight, with an average of three, and the observed and expected heterozygosity values ranged from 0 to 1.0 and 0.117 to 0.813, respectively. Conclusions: These microsatellite loci will enrich the genetic resources to develop functional studies and conservation strategies for this endangered relict species. PMID:26421250

  12. Growing with dinosaurs: natural products from the Cretaceous relict Metasequoia glyptostroboides Hu & Cheng?a molecular reservoir from the ancient world with potential in modern medicine

    OpenAIRE

    Juvik, Ole Johan; Nguyen, Xuan Hong Thy; Andersen, Heidi Lie; Fossen, Torgils

    2015-01-01

    After the sensational rediscovery of living exemplars of the Cretaceous relict Metasequoia glyptostroboides—a tree previously known exclusively from fossils from various locations in the northern hemisphere, there has been an increasing interest in discovery of novel natural products from this unique plant source. This article includes the first complete compilation of natural products reported from M. glyptostroboides during the entire period in which the tree has been investigated (1954–201...

  13. Endogenous indole-3-acetic acid and ethylene evolution in tilted Metasequoia glyptostroboides stems in relation to compression-wood formation.

    Science.gov (United States)

    Du, Sheng; Sugano, Mami; Tsushima, Miho; Nakamura, Teruko; Yamamoto, Fukuju

    2004-04-01

    Eight-year-old Metasequoia glyptostroboides seedlings were tilted at a 45 degrees angle to induce compression-wood formation on the lower side of the stems. After 2 weeks of treatment, half of the seedlings were sampled and the remaining half were tilted to the opposite orientation to exchange the upper and lower sides and were kept for 2 more weeks until sampled. Cambium-emitted ethylene was analyzed by gas chromatography with flame-ionization detection. Endogenous indole-3-acetic acid (IAA) was measured by gas chromatography-mass spectrometry. Tracheid production and compression-wood formation were determined by light microscopy. Anatomical studies showed that tracheid production was promoted and compression-wood tracheids always developed on the gravitationally lower side of tilted stems in both the original tilting and the subsequent reverse-tilting periods. These were accompanied by an increase in IAA content in and an accelerated ethylene-evolution rate from the cambial region of the same side.

  14. Activities of some enzymes of lignin formation in reaction wood of Thuja orientalis, Metasequoia glyptostroboides and Robinia pseudoacacia.

    Science.gov (United States)

    Kutsuki, H; Higuchi, T

    1981-07-01

    The activities of the following five enzymes which are involved in the formation of lignin have been compared in reaction wood and in opposite wood: phenylalanine ammonia lyase (EC 4.3.1.5), caffeate 3-O-methyltransferase (EC 2.1.1.-), p-hydroxycinnamate: CoA ligase (EC 6.2.1.12), cinnamyl alcohol dehydrogenase (EC 1.1.1.-) and peroxidase (EC 1.11.1.7). The activities of the four first-named enzymes in the compression wood of Thuja orientalis L. and Metasequoia glyptostroboides Hu et Cheng were 2.8±1.4-fold and 2.6±1.5-fold higher than those in opposite wood, respectively, whereas peroxidase had the same level of activity in either type of wood. On the other hand, no differences were observed in the activities of the five enzymes between tension and opposite woods of Robinia pseudoacacia L. These findings are well in accord with the chemical structure of lignin in the compression and tension woods of the three species studied: high content of lignin rich in condensed units in compression wood, and little difference in lignin between tension and opposite woods.

  15. Research Advance on Metasequoia: Applications of New Technology

    Science.gov (United States)

    Leng, Qin; Yang, Hong; Wang, Li

    2010-10-01

    The plant genus Metasequoia Miki, 1941 and its sole living relict species Metasequoia glyptostroboides Hu et Cheng, 1948 have been of special interest for both the public and scientists since 1941 when the genus was established. Due to its unique discovery history (fossils discovered earlier than the living species) and incomparable scientific value in the research of plant evolution and its relationship with environmental and climatic changes, Metasequoia becomes arguably the most comprehensively studied higher plant in both fossil and living forms. This paper summarized recent advance in Metasequoia research by reviewing the research history of Metasequoia and the scientific value of this genus, while paid special attention to the application of new methods and techniques in the research field of Metasequoia in the recent decades. The application of biogeochemical (organic geochemistry and stable isotope) analysis as well as the new and innovated methods of preparing large-sized cuticular membrane from leaves with originally thin and fragile cuticles further secure Metasequoia's super star status for the research of palaeoclimatic reconstruction.

  16. Metasequoia glyptostroboides and its Utility in Paleoecological Reconstruction of Eocene High Latitude Forests

    Science.gov (United States)

    Williams, C. J.; LePage, B. A.; Vann, D. R.; Johnson, A. H.

    2001-05-01

    Abundant fossil plant remains are preserved in the Eocene-aged deposits of the Buchanan Lake formation on Axel Heiberg Island, Nunavut, Canada. Intact leaf litter, logs, and stumps preserved in situ as mummified remains present an opportunity to determine forest composition, structure, and productivity of a Taxodiaceae-dominated forest that once grew north of the Arctic Circle (paleolatitude 75-80° N). We excavated 37 tree stems for dimensional analysis from mudstone and channel-sand deposits. Stem length ranged from 1.0 m to 14.8 m (average = 3.2 m). Stem diameter ranged from less than 10 cm to greater than 75 cm (average = 32.2 cm). All stem wood was tentatively identified to genus as Metasequoia sp. The diameters and parabolic shape of the preserved tree trunks indicate that the Metasequoia were about 39 m tall across a wide range of diameters. The allometric relationships we derived for modern Metasequoia (n=70) allowed independent predictions of Metasequoia height given the stand density and stump diameters of the fossil forest. The two height estimates of 40 and 40.5 m match the results obtained from measurements of the Eocene trees. We used stump diameter data (n =107, diameter > 20 cm) and an uniform canopy height of 39 m to calculate parabolic stem volume and stem biomass for a 0.22 ha area of fossil forest. Stem volume equaled 2065 m3 ha-1 and stem biomass equaled 560 Mg ha-1 . In the Eocene forest, as determined from length of stems that were free of protruding branches and from 7 exhumed tree tops, the uppermost 9 m of the trees carried live branches with foliage. In living conifers, branch weights and the amount of foliage carried by branches are well correlated with branch diameters measured where the branch joins the main stem. To determine the biomass in branches and foliage in the Eocene forest, we used relationships derived from large modern Metasequoia. Based on the regression of branch weight v. branch diameter (r2 = 0.97) and foliar biomass v

  17. Proanthocyanidins from the bark of Metasequoia glyptostroboides ameliorate allergic contact dermatitis through directly inhibiting T cells activation and Th1/Th17 responses.

    Science.gov (United States)

    Chen, Fengyang; Ye, Xiaodi; Yang, Yadong; Teng, Tianli; Li, Xiaoyu; Xu, Shifang; Ye, Yiping

    2015-04-15

    The leaves and bark of Metasequoia glyptostroboides are used as anti-microbic, analgesic and anti-inflammatory drug for dermatic diseases in Chinese folk medicine. However, the pharmacological effects and material basis responsible for the therapeutic use of this herb have not yet been well studied. The objectives of this study were to evaluate the anti-inflammatory effects of the proanthocyanidin fraction from the bark of M. glyptostroboides (MGEB) and to elucidate its immunological mechanisms. The anti-inflammatory activity of MGEB was evaluated using 2,4-dinitrofluorobenzene (DNFB)-induced allergic contact dermatitis (ACD) in mice. Its potential mechanisms were further investigated by determining its effects on Con A-induced T cell activation and Th1/Th17 responses in vitro. Both intraperitoneal injection and oral administration of MGEB significantly reduced the ear swelling in DNFB-induced ACD mice. MGEB inhibited Con A-induced proliferation and the expression levels of cell surface molecules CD69 and CD25 of T cells in vitro. MGEB also significantly decreased the production of Th1/Th17 specific cytokines (IL-2, IFN-γ and IL-17) and down-regulated their mRNA expression levels in activated T-cells. MGEB could ameliorate ACD, at least in part, through directly inhibiting T cells activation and Th1/Th17 responses. Copyright © 2015 Elsevier GmbH. All rights reserved.

  18. Seasonal Variation in Soil Greenhouse Gas Emissions at Three Age-Stages of Dawn Redwood (Metasequoia glyptostroboides Stands in an Alluvial Island, Eastern China

    Directory of Open Access Journals (Sweden)

    Shan Yin

    2016-11-01

    Full Text Available Greenhouse gas (GHG emissions are an important part of the carbon (C and nitrogen (N cycle in forest soil. However, soil greenhouse gas emissions in dawn redwood (Metasequoia glyptostroboides stands of different ages are poorly understood. To elucidate the effect of plantation age and environmental factors on soil GHG emissions, we used static chamber/gas chromatography (GC system to measure soil GHG emissions in an alluvial island in eastern China for two consecutive years. The soil was a source of CO2 and N2O and a sink of CH4 with annual emissions of 5.5–7.1 Mg C ha−1 year−1, 0.15–0.36 kg N ha−1 year−1, and 1.7–4.5 kg C ha−1 year−1, respectively. A clear exponential correlation was found between soil temperature and CO2 emission, but a negative linear correlation was found between soil water content and CO2 emission. Soil temperature had a significantly positive effect on CH4 uptake and N2O emission, whereas no significant correlation was found between CH4 uptake and soil water content, and N2O emission and soil water content. These results implied that older forest stands might cause more GHG emissions from the soil into the atmosphere because of higher litter/root biomass and soil carbon/nitrogen content compared with younger stands.

  19. The impact of long-term water stress on relative growth rate and morphology of needles and shoots of Metasequoia glyptostroboides seedlings: research toward identifying mechanistic models.

    Science.gov (United States)

    Zhang, Yanxiang; Equiza, Maria Alejandra; Zheng, Quanshui; Tyree, Melvin T

    2011-09-01

    Leaf morphology in the upper canopy of trees tends to be different from that lower down. The effect of long-term water stress on leaf growth and morphology was studied in seedlings of Metasequoia glyptostroboides to understand how tree height might affect leaf morphology in larger trees. Tree height increases water stress on growing leaves through increased hydraulic resistance to water flow and increased gravitational potential, hence we assume that water stress imposed by soil dehydration will have an effect equivalent to stress induced by height. Seedlings were subjected to well-watered and two constant levels of long-term water stress treatments. Drought treatment significantly reduced final needle count, area and mass per area (leaf mass area, LMA) and increased needle density. Needles from water-stressed plants had lower maximum volumetric elastic modulus (ε(max)), osmotic potential at full turgor (Ψ¹⁰⁰(π)) (and at zero turgor (Ψ⁰(π)) (than those from well-watered plants. Palisade and spongy mesophyll cell size and upper epidermal cell size decreased significantly in drought treatments. Needle relative growth rate, needle length and cell sizes were linear functions of the daily average water potential at the time of leaf growth (r² 0.88-0.999). We conclude that water stress alone does mimic the direction and magnitude of changes in leaf morphology observed in tall trees. The results are discussed in terms of various models for leaf growth rate. Copyright © Physiologia Plantarum 2011.

  20. The impact of xylem cavitation on water potential isotherms measured by the pressure chamber technique in Metasequoia glyptostroboides Hu & W.C. Cheng.

    Science.gov (United States)

    Yang, Dongmei; Pan, Shaoan; Tyree, Melvin T

    2016-08-01

    Pressure-volume (PV) curve analysis is the most common and accurate way of estimating all components of the water relationships in leaves (water potential isotherms) as summarized in the Höfler diagram. PV curve analysis yields values of osmotic pressure, turgor pressure, and elastic modulus of cell walls as a function of relative water content. It allows the computation of symplasmic/apoplastic water content partitioning. For about 20 years, cavitation in xylem has been postulated as a possible source of error when estimating the above parameters, but, to the best of the authors' knowledge, no one has ever previously quantified its influence. Results in this paper provide independent estimates of osmotic pressure by PV curve analysis and by thermocouple psychrometer measurement. An anatomical evaluation was also used for the first time to compare apoplastic water fraction estimates from PV analysis with anatomical values. Conclusions include: (i) PV curve values of osmotic pressure are underestimated prior to correcting osmotic pressure for water loss by cavitation in Metasequoia glyptostroboides; (ii) psychrometer estimates of osmotic pressure obtained in tissues killed by freezing or heating agreed with PV values before correction for apoplastic water dilution; (iii) after correction for dilution effects, a solute concentration enhancement (0.27MPa or 0.11 osmolal) was revealed. The possible sources of solute enhancement were starch hydrolysis and release of ions from the Donnan free space of needle cell walls. © The Author 2016. Published by Oxford University Press on behalf of the Society for Experimental Biology. All rights reserved. For permissions, please email: journals.permissions@oup.com.

  1. Experimental evidence for negative turgor pressure in small leaf cells of Robinia pseudoacacia L versus large cells of Metasequoia glyptostroboides Hu et W.C.Cheng. 1. Evidence from pressure-volume curve analysis of dead tissue.

    Science.gov (United States)

    Yang, Dongmei; Pan, Shaoan; Ding, Yiting; Tyree, Melvin T

    2017-03-01

    This paper provides a mini-review of evidence for negative turgor pressure in leaf cells starting with experimental evidence in the late 1950s and ending with biomechanical models published in 2014. In the present study, biomechanical models were used to predict how negative turgor pressure might be manifested in dead tissue, and experiments were conducted to test the predictions. The main findings were as follows: (i) Tissues killed by heating to 60 or 80 °C or by freezing in liquid nitrogen all became equally leaky to cell sap solutes and all seemed to pass freely through the cell walls. (ii) Once cell sap solutes could freely pass the cell walls, the shape of pressure-volume curves was dramatically altered between living and dead cells. (iii) Pressure-volume curves of dead tissue seem to measure negative turgor defined as negative when inside minus outside pressure is negative. (iv) Robinia pseudoacacia leaves with small palisade cells had more negative turgor than Metasequoia glyptostroboides with large cells. (v) The absolute difference in negative turgor between R. pseudoacacia and M. glyptostroboides approached as much as 1.0 MPa in some cases. The differences in the manifestation of negative turgor in living versus dead tissue are discussed. © 2016 John Wiley & Sons Ltd.

  2. Physiological responses of three deciduous conifers (Metasequoia glyptostroboides, Taxodium distichum and Larix laricina) to continuous light: adaptive implications for the early Tertiary polar summer.

    Science.gov (United States)

    Equiza, M Alejandra; Day, Michael E; Jagels, Richard

    2006-03-01

    Polar regions were covered with extensive forests during the Cretaceous and early Tertiary, and supported trees comparable in size and productivity to those of present-day temperate forests. With a winter of total or near darkness and a summer of continuous, low-angle illumination, these temperate, high-latitude forests were characterized by a light regime without a contemporary counterpart. Although maximum irradiances were much lower than at mid-latitudes, the 24-h photoperiod provided similar integrated light flux. Taxodium, Larix and Metasequoia, three genera of deciduous conifers that occurred in paleoarctic wet forests, have extant, closely related descendents. However, the contemporary relative abundance of these genera differs greatly from that in the paleoarctic. To provide insight into attributes that favor competitive success in a continuous-light environment, we subjected saplings of these genera to a natural photoperiod or a 24-h photoperiod and measured gas exchange, chlorophyll fluorescence, non-structural carbohydrate concentrations, biomass production and carbon allocation. Exposure to continuous light significantly decreased photosynthetic capacity and quantum efficiency of photosystem II in Taxodium and Larix, but had minimal influence in Metasequoia. In midsummer, foliar starch concentration substantially increased in both Taxodium and Larix saplings grown in continuous light, which may have contributed to end-product down-regulation of photosynthetic capacity. In contrast, Metasequoia allocated photosynthate to continuous production of new foliar biomass. This difference in carbon allocation may have provided Metasequoia with a two fold advantage in the paleoarctic by minimizing depression of photosynthetic capacity and increasing photosynthetic surface.

  3. Digital gene expression analysis of male and female bud transition in Metasequoia reveals high activity of MADS-box transcription factors and hormone-mediated sugar pathways

    OpenAIRE

    Zhao, Ying; Liang, Haiying; Li, Lan; Tang, Sha; Han, Xiao; Wang, Congpeng; Xia, Xinli; Yin, Weilun

    2015-01-01

    Metasequoia glyptostroboides is a famous redwood tree of ecological and economic importance, and requires more than 20 years of juvenile-to-adult transition before producing female and male cones. Previously, we induced reproductive buds using a hormone solution in juvenile Metasequoia trees as young as 5-to-7 years old. In the current study, hormone-treated shoots found in female and male buds were used to identify candidate genes involved in reproductive bud transition in Metasequoia. Sampl...

  4. Atrial natriuretic-like peptide and its prohormone within metasequoia.

    Science.gov (United States)

    Yang, Q; Gower, W R; Li, C; Chen, P; Vesely, D L

    1999-07-01

    Metasequoia glyptostroboides was one of the dominant conifers in North America, Asia, and Europe for more than 100 million years since the late Cretaceous Albian Age, but Quaternary glaciations drove the Metasequoia population to apparent extinction. A small pocket of Metasequoia, however, was found in central China in the 1940s representing the only surviving population of this "living fossil" species. Atrial natriuretic peptide, a 28-amino-acid peptide hormone that causes sodium and water excretion in animals, has been found to be part of the first peptide hormonal system in lower plants. The existence of this hormonal system has never been examined within trees of any genus. High-performance gel permeation chromatography of the leaves and stems (i.e., branches) of Metasequoia followed by atrial natriuretic peptide radioimmunoassay revealed an ANP-like peptide and its prohormone (i.e., approximately 13,000 mol wt) were present in both leaves and stems of this conifer. The elution profile of ANP-like peptide in stems of Metasequoia had a shoulder to the left of where pure synthetic ANP elutes suggesting the possibility of a slightly larger peptide eluting within this shoulder secondary to alternate processing of the ANP-like prohormone and similar to what occurs with the kidney of animals. The elution profile of ANP-like peptide in the leaves of Metasequoia revealed two peaks; one where ANP elutes and a second peak suggesting a smaller peptide that has been metabolically processed. The presence of the ANP-like prohormone strongly suggests that ANP-like gene expression is occurring in both leaves and stems of Metasequoia since this prohormone is the gene product of this hormonal system. The presence of the ANP-like hormonal system in trees implies that this hormonal system may have been present early in land plant evolution to allow trees to reach heights of greater than 30 feet where a water flow-enhancing substance is absolutely necessary for water flow to occur

  5. Palaeo-adaptive properties of the xylem of Metasequoia: mechanical/hydraulic compromises.

    Science.gov (United States)

    Jagels, Richard; Visscher, George E; Lucas, John; Goodell, Barry

    2003-07-01

    The xylem of Metasequoia glyptostroboides Hu et Cheng is characterized by very low density (average specific gravity = 0.27) and tracheids with relatively large dimensions (length and diameter). The microfibril angle in the S2 layer of tracheid walls is large, even in outer rings, suggesting a cambial response to compressive rather than tensile stresses. In some cases, this compressive stress is converted to irreversible strain (plastic deformation), as evidenced by cell wall corrugations. The heartwood is moderately decay resistant, helping to prevent Brazier buckling. These xylem properties are referenced to the measured bending properties of modulus of rupture and modulus of elasticity, and compared with other low-to-moderate density conifers. The design strategy for Metasequoia is to produce a mechanically weak but hydraulically efficient xylem that permits rapid height growth and crown development to capture and dominate a wet site environment. The adaptability of these features to a high-latitude Eocene palaeoenvironment is discussed.

  6. Palaeo‐adaptive Properties of the Xylem of Metasequoia: Mechanical/Hydraulic Compromises

    Science.gov (United States)

    JAGELS, RICHARD; VISSCHER, GEORGE E.; LUCAS, JOHN; GOODELL, BARRY

    2003-01-01

    The xylem of Metasequoia glyptostroboides Hu et Cheng is characterized by very low density (average specific gravity = 0·27) and tracheids with relatively large dimensions (length and diameter). The microfibril angle in the S2 layer of tracheid walls is large, even in outer rings, suggesting a cambial response to compressive rather than tensile stresses. In some cases, this compressive stress is converted to irreversible strain (plastic deformation), as evidenced by cell wall corrugations. The heartwood is moderately decay resistant, helping to prevent Brazier buckling. These xylem properties are referenced to the measured bending properties of modulus of rupture and modulus of elasticity, and compared with other low‐to‐moderate density conifers. The design strategy for Metasequoia is to produce a mechanically weak but hydraulically efficient xylem that permits rapid height growth and crown development to capture and dominate a wet site environment. The adaptability of these features to a high‐latitude Eocene palaeoenvironment is discussed. PMID:12763758

  7. Miki ja Rosa hõivasid Tartu / Ants Juske

    Index Scriptorium Estoniae

    Juske, Ants, 1956-2016

    2001-01-01

    Lühidalt viiest kunstinäitusest - Vaikust lõhestas vali kärgatus (Peeter Allik), Küla, mida on põletanud punased õhtud (Imat Suumann), Rosa Permanente (Ruth Huimerind), Miki-Hiire kirik (Erki Meister, Christer Hägglund), Aledoia (Andrus Joonas)

  8. Anatomical studies on the development of Metasequoia glyptostroboides Hu et Cheng wood

    Directory of Open Access Journals (Sweden)

    Alina Hejnowicz

    2015-01-01

    Full Text Available Variability of anatomical characters within a 15 year old stem is presented by the method of contour lines, where against a schematic longitudinal section of a stem points corresponding to the same values for a character are joined by lines, similarly as altitudes in cartography. The method permits prediction of future trends in character changes. It was thus established that tracheid dimensions and diameter of bordered pits in early wood tracheids increase with age of tree and do not reach maximal values before the 15th year. The annual ring width and the height of the rays attain maximal values before the 15th year while the dimensions of ray cells and the percentage of late wood reach almost constant values during the first year or two.

  9. Two ways of legumin-precursor processing in conifers. Characterization and evolutionary relationships of Metasequoia cDNAs representing two divergent legumin gene subfamilies.

    Science.gov (United States)

    Häger, K P; Wind, C

    1997-06-15

    Subunit monomers and oligomers of crystalloid-type legumins are major components of SDS-soluble fractions from Metasequoia glyptostroboides (Dawn redwood, Taxodiaceae) seed proteins. The subunits are made up of disulfide linked alpha-polypeptides and beta-polypeptides with molecular masses of 33 kDa and 23-25 kDa, respectively. Unusually for legumins, those from Metasequoia are glycosylated and the carbohydrate moieties are residing in the C-terminal region of the respective beta-polypeptides. A Metasequoia endosperm cDNA library has been constructed and legumin-encoding transcripts representing two divergent gene subfamilies have been characterized. Intersubfamily comparisons reveal 75% identity at the amino acid level and the values range from 53-35% when the legumin precursors deduced were compared with those from angiosperms. The predicted sequences together with data from amino acid sequencing prove that post-translational processing of Metasequoia prolegumins is directed to two different processing sites, each of them specific for one of the legumin subfamilies. The sites involved differ in their relative position and in the junction to be cleaved: Metasequoia legumin precursors MgLeg18 and MgLeg26 contain the conventional post-translational Asn-Gly processing site, which is generally regarded as highly conserved. In contrast, the MgLeg4 precursor is lacking this site and post-translational cleavage is directed to an unusual Asn-Thr processing site located in its hypervariable region, causing N-terminal extension of the beta-polypeptide relative to those hitherto known. Evidence is given that the unusual variant of processing also occurs in other conifers. Phylogenetic analysis reveals the precursors concerned as representatives of a distinct legumin subfamily, originating from duplication of an ancestral gene prior to or at the beginning of Taxodiaceae diversification.

  10. Digital gene expression analysis of male and female bud transition in Metasequoia reveals high activity of MADS-box transcription factors and hormone-mediated sugar pathways.

    Science.gov (United States)

    Zhao, Ying; Liang, Haiying; Li, Lan; Tang, Sha; Han, Xiao; Wang, Congpeng; Xia, Xinli; Yin, Weilun

    2015-01-01

    Metasequoia glyptostroboides is a famous redwood tree of ecological and economic importance, and requires more than 20 years of juvenile-to-adult transition before producing female and male cones. Previously, we induced reproductive buds using a hormone solution in juvenile Metasequoia trees as young as 5-to-7 years old. In the current study, hormone-treated shoots found in female and male buds were used to identify candidate genes involved in reproductive bud transition in Metasequoia. Samples from hormone-treated cone reproductive shoots and naturally occurring non-cone setting shoots were analyzed using 24 digital gene expression (DGE) tag profiles using Illumina, generating a total of 69,520 putative transcripts. Next, 32 differentially and specifically expressed transcripts were determined using quantitative real-time polymerase chain reaction, including the upregulation of MADS-box transcription factors involved in male bud transition and flowering time control proteins involved in female bud transition. These differentially expressed transcripts were associated with 243 KEGG pathways. Among the significantly changed pathways, sugar pathways were mediated by hormone signals during the vegetative-to-reproductive phase transition, including glycolysis/gluconeogenesis and sucrose and starch metabolism pathways. Key enzymes were identified in these pathways, including alcohol dehydrogenase (NAD) and glutathione dehydrogenase for the glycolysis/gluconeogenesis pathway, and glucanphosphorylase for sucrose and starch metabolism pathways. Our results increase our understanding of the reproductive bud transition in gymnosperms. In addition, these studies on hormone-mediated sugar pathways increase our understanding of the relationship between sugar and hormone signaling during female and male bud initiation in Metasequoia.

  11. Pengaruh Bauran Promosi Terhadap Keputusan Konsumen Berkunjung ke Mikie Holiday Fundland Berastagi Medan

    OpenAIRE

    Aprilya, Fetty

    2016-01-01

    This study aimed to analyze the influence of advertising, sales promotion, public relations, personal selling, and direct marketing to decision purchase. This research collects empirical evidence. This research was conducted at Mikie Holiday Fundland, Jamin Ginting street, 50 km Pecen village, Berastagi, North Sumatra, with a total sample of 100 respondents. Based on the research, the results of significance test the effect simultaneously with the F test, the variable of advertising, sales pr...

  12. The human being : when philosophy meets history. Miki Kiyoshi, Watsuji Tetsuro and their quest for a New Ningen

    NARCIS (Netherlands)

    Brivio, Chiara

    2009-01-01

    This thesis analyses the concept of the 'human being' (ningen) in the philosophies of the two modern Japanese intellectuals Miki Kiyoshi and Watsuji Tetsuro. I demonstrate that their philosophical systems, based on the idea that the creation of a new Japanese human being should have coincided with

  13. Generalized Knizhnik-Zamolodchikov equation for Ding-Iohara-Miki algebra

    Science.gov (United States)

    Awata, Hidetoshi; Kanno, Hiroaki; Mironov, Andrei; Morozov, Alexei; Morozov, Andrey; Ohkubo, Yusuke; Zenkevich, Yegor

    2017-07-01

    We derive the generalization of the Knizhnik-Zamolodchikov equation (KZE) associated with the Ding-Iohara-Miki algebra Uq ,t(gl^ ^ 1) . We demonstrate that certain refined topological string amplitudes satisfy these equations and find that the braiding transformations are performed by the R matrix of Uq ,t(gl^ ^ 1) . The resulting system is the uplifting of the u^1 Wess-Zumino-Witten model. The solutions to the (q ,t ) KZE are identified with the (spectral dual of) building blocks of the Nekrasov partition function for five-dimensional linear quiver gauge theories. We also construct an elliptic version of the KZE and discuss its modular and monodromy properties, the latter being related to a dual version of the KZE.

  14. Pb isotopes during crustal melting and magma mingling - A cautionary tale from the Miki Fjord macrodike, central east Greenland

    DEFF Research Database (Denmark)

    Waight, Tod Earle; Lesher, Charles

    2010-01-01

    Pb isotopic data are presented for hybrid rocks formed by mingling between mantle-derived tholeiitic magma of the Eocene Miki Fjord macrodike (East Greenland) and melt derived from the adjacent Precambrian basement. Bulk mixing and AFC processes between end-members readily identified in the field...... grain boundaries during disequilibrium melting of the host rock by the mafic magma. The crustal melt involved in magma interactions was therefore heterogeneous with respect to Pb isotopes on a metre-scale. These results illustrate the difficulties inherent in interpreting isotopic variations...... in contaminated mafic magmas even when the end-members are well constrained by field relations. We show that the Pb isotopic composition of the crustal contaminants and contamination trajectories for the Miki Fjord hybrid magmatic lithologies are markedly different from regional basement gneisses and contaminated...

  15. Impact of suspended sediments on the survival of seagrass: Halodule pinifolia (Miki den Hartog

    Directory of Open Access Journals (Sweden)

    Satumanatpan, S.

    2006-07-01

    Full Text Available The research aimed to study the level of suspended sediments on the survival of Halodule pinifolia (Miki den Hartog. Three experiments were conducted. Broad concentration of suspended sediments covering the level found in nature were employed in the first experiment. The impact concentration of suspended sediments on the survival of H. pinifolia was extended in more detail in the second and third experiments. H. pinifolia was planted by washing off the mud and holding it with a grating. An air pump was used to stir the sediment in suspension during the experiments and necessary water parameters were strictly control. The suspended sediment was spread by siphon and conducted in a period of 30 days for the first and second experiments, and 45 days for the third experiment. The result indicated that suspended sediments with a concentration of 1-64 mg/l had no impact on the survival of H. pinifolia within 30 days. Initially, suspended sediments of 66 mg/l lowered H. pinifolia's survival to 95% at day 30. Concentration of suspended sediments higher than 66 mg/l affected the survival of H. pinifolia. The decreasing survival was noticed during days 20 -25 of the experiment and all died during days 40-45. However, the life span of H. pinifolia, would be very important and might also affect the survival of H. pinifolia after 30 days.

  16. The Life of Medical Historian(醫史學者 Miki Sakae, and the

    Directory of Open Access Journals (Sweden)

    KIM Ho

    2005-12-01

    Full Text Available Miki Sakae was a Medical historian, who is well known for his studies of Korean medicine. He authored the renowned trilogy which dealt with subjects of Korean medicine and diseases, namely the , , and , during the Japanese Occupation period. He was born in 1903 in Osaka, Japan, and graduated from the Kyushu(九州 College of Medicine. In 1928 he was assigned to the Gyeongseong Imperial University's College of Medicine as a professor, and also served as Chief of the Suweon Provincial Hospital while he was staying in Korea. During the 18-year period of his stay, he widely collected medical books of Korea and also thoroughly studied them. He returned to Japan in 1944 due to the illness of his father, but continued his studies of Korean medicine, and in 1955 published the for the first time. Following such accomplishment, was published in 1956, the next year, and finally was published a few decades later, in 1985. Since the 1950s, aside of continuing to study and author the history of Korean medicine, he had also engaged himself in a joint effort associated with the members of the Medical History Association of Japan in a group study of Huseya Soteki 伏屋素狄 the first Japanese Experimental Physiologist. He also attempted at establishing an academic branch which could be referred to as Experimental Historical Studies of Medicine, by recreating the experiments of Huseya Sotek 伏屋素狄 with his own son 三木謙. Later he also expanded his interest and studies to the medical history of the world and also the area of Medical Ethics. But his ultimate interest and passion were always targeted at the Medicine of Korea, and the one consistent position he maintained during his entire life regarding the Korean medicine, was that 'One can only talk about the medicine of China and Japan when he or she is well versed in the medicine of Korea'. And his lifetime achievement, was authored upon the basis established by such conviction and philosophy. First

  17. Taxonomic Revision of Pinus fujiii (Yasui Miki (Pinaceae and Its Implications for the Phytogeography of the Section Trifoliae in East Asia.

    Directory of Open Access Journals (Sweden)

    Toshihiro Yamada

    Full Text Available Pinus trifolia Miki 1939 (Pinaceae was originally proposed based on seed cones from the upper Miocene of Aichi and Gifu Prefectures, central Japan. However, before the publication of P. trifolia, a different name (Pinus fujiii (Yasui Miki was given to a female cone with the same morphology. On the other hand, P. fujiii auct. non (Yasui Miki has been used for seed cones with different morphologies from Yasui's holotype, i.e., apophyses arranged in 5:8 parastichies and a perexcentromucronate slightly-pointed umbo. As a result of re-examination on the Miki and Yasui specimens, we concluded that P. trifolia was a synonym for P. fujiii and proposed here Pinus mikii sp. nov. for cones assigned to P. fujiii auct. non (Yasui Miki. We also emended the diagnosis of P. fujiii based on these specimens. Pinus fujiii is characterized by a large female cone in which the apophyses with a centromucronate prickle-like umbo are arranged in 8:13 parastichies, and deciduous seed wings. These characters suggest that P. fujiii belongs to the section Trifoliae of the subgenus Pinus, which is now restricted to North and Central America and the Caribbean islands. Fossil data suggest that the P. fujiii lineage firstly appeared in Japan around the Eocene/Oligocene boundary. We speculate that the P. fujiii lineage might have moved southward to Japan from a refugium located elsewhere in high-latitude areas in response to the late Eocene cooling event, as occurred with other Trifoliae species in North America.

  18. Paleovegetation reconstruction of fossil forests dominated by Metasequoia and Glyptostrobus from the late Pliocene Kobiwako Group, central Japan

    OpenAIRE

    CHIYOMI, YAMAKAWA; ARATA, MOMOHARA; TOMOO, NUNOTANI; MIDORI, MATSUMOTO; YASUYUKI, WATANO; Lake Biwa Museum; Graduate School of Horticulture, Chiba University; Lake Biwa Museum; Graduate School of Science, Chiba University; Graduate School of Science, Chiba University

    2008-01-01

    A late Pliocene (1.8-1.9 Ma) wetland fossil forest community that was dominated by Metasequoia and Glyptostrobus was reconstructed based on the species composition of the stumps and other plant macrofossil assemblages. The plant fossils were recovered from a fossil forest preserved in deposits of the Kobiwako Group that are exposed in the Echi River, Shiga Prefecture, central Japan. Fossil wood of Metasequoia and Glyptostrobus was distinguished based on anatomical characteristics. Apportionme...

  19. Reflection states in Ding-Iohara-Miki algebra and brane-web for D-type quiver

    Science.gov (United States)

    Bourgine, J.-E.; Fukuda, M.; Matsuo, Y.; Zhu, R.-D.

    2017-12-01

    Reflection states are introduced in the vertical and horizontal modules of the Ding-Iohara-Miki (DIM) algebra (quantum toroidal gl_1 ). Webs of DIM representations are in correspondence with ( p, q)-web diagrams of type IIB string theory, under the identification of the algebraic intertwiner of Awata, Feigin and Shiraishi with the refined topological vertex. Extending the correspondence to the vertical reflection states, it is possible to engineer the N=1 quiver gauge theory of D-type (with unitary gauge groups). In this way, the Nekrasov instanton partition function is reproduced from the evaluation of expectation values of intertwiners. This computation leads to the identification of the vertical reflection state with the orientifold plane of string theory. We also provide a translation of this construction in the Iqbal-Kozcaz-Vafa refined topological vertex formalism.

  20. Development and evaluation of height diameter at breast models for native Chinese Metasequoia.

    Science.gov (United States)

    Liu, Mu; Feng, Zhongke; Zhang, Zhixiang; Ma, Chenghui; Wang, Mingming; Lian, Bo-Ling; Sun, Renjie; Zhang, Li

    2017-01-01

    Accurate tree height and diameter at breast height (dbh) are important input variables for growth and yield models. A total of 5503 Chinese Metasequoia trees were used in this study. We studied 53 fitted models, of which 7 were linear models and 46 were non-linear models. These models were divided into two groups of single models and multivariate models according to the number of independent variables. The results show that the allometry equation of tree height which has diameter at breast height as independent variable can better reflect the change of tree height; in addition the prediction accuracy of the multivariate composite models is higher than that of the single variable models. Although tree age is not the most important variable in the study of the relationship between tree height and dbh, the consideration of tree age when choosing models and parameters in model selection can make the prediction of tree height more accurate. The amount of data is also an important parameter what can improve the reliability of models. Other variables such as tree height, main dbh and altitude, etc can also affect models. In this study, the method of developing the recommended models for predicting the tree height of native Metasequoias aged 50-485 years is statistically reliable and can be used for reference in predicting the growth and production of mature native Metasequoia.

  1. Development and evaluation of height diameter at breast models for native Chinese Metasequoia.

    Directory of Open Access Journals (Sweden)

    Mu Liu

    Full Text Available Accurate tree height and diameter at breast height (dbh are important input variables for growth and yield models. A total of 5503 Chinese Metasequoia trees were used in this study. We studied 53 fitted models, of which 7 were linear models and 46 were non-linear models. These models were divided into two groups of single models and multivariate models according to the number of independent variables. The results show that the allometry equation of tree height which has diameter at breast height as independent variable can better reflect the change of tree height; in addition the prediction accuracy of the multivariate composite models is higher than that of the single variable models. Although tree age is not the most important variable in the study of the relationship between tree height and dbh, the consideration of tree age when choosing models and parameters in model selection can make the prediction of tree height more accurate. The amount of data is also an important parameter what can improve the reliability of models. Other variables such as tree height, main dbh and altitude, etc can also affect models. In this study, the method of developing the recommended models for predicting the tree height of native Metasequoias aged 50-485 years is statistically reliable and can be used for reference in predicting the growth and production of mature native Metasequoia.

  2. Cytological and ultrastructural preservation in Eocene Metasequoia leaves from the Canadian high Arctic

    Energy Technology Data Exchange (ETDEWEB)

    Schoenhut, K.; Vann, D.R.; LePage, B.A. [University of Pennsylvania, Philadelphia, PA (United States). Dept. of Earth & Environmental Science

    2004-06-01

    The ultrastructural examination by transmission electron microscopy of 45-million-year-old mummified leaves of Metasequoia extracted from the Upper Coal member of the Buchanan Lake Formation in Napartulik on Axel Heiberg Island revealed the preservation of intact chloroplasts and chloroplast components. Abundant tanniferous cell inclusions may indicate that the 3-mo period of constant daylight during the Arctic summer induced high concentrations of tannins in the leaf tissues, which may have arrested microbial degradation of the litter. Quantified differences in the extent of chloroplast preservation through a vertical section of the lignite suggest that short-term shifts in the depositional environment took place, perhaps influencing the exposure of the leaf tissues to conditions that would either promote or inhibit decomposition.

  3. Cytological and ultrastructural preservation in Eocene Metasequoia leaves from the Canadian High Arctic.

    Science.gov (United States)

    Schoenhut, Karimah; Vann, David R; Lepage, Ben A

    2004-06-01

    The ultrastructural examination by transmission electron microscopy of 45-million-year-old mummified leaves of Metasequoia extracted from the Upper Coal member of the Buchanan Lake Formation in Napartulik on Axel Heiberg Island revealed the preservation of intact chloroplasts and chloroplast components. Abundant tanniferous cell inclusions may indicate that the 3-mo period of constant daylight during the Artic summer induced high concentrations of tannins in the leaf tissues, which may have arrested microbial degradation of the litter. Quantified differences in the extent of chloroplast preservation through a vertical section of the lignite suggest that short-term shifts in the depositional environment took place, perhaps influencing the exposure of the leaf tissues to conditions that would either promote or inhibit decomposition.

  4. [The life of medical historian Miki Sakae, and the "history of Korean medicine and of diseases in Korea"].

    Science.gov (United States)

    Kim, Ho

    2005-12-01

    Miki Sakae was a Medical historian, who is well known for his studies of Korean medicine. He authored the renowned trilogy which dealt with subjects of Korean medicine and diseases, namely the "History of Korean Medicine and of Diseases in Korea", "Bibliography of Korean Medical Books", and "The Chronological Table of Medical Events in Korea"), during the Japanese Occupation period. He was born in 1903 in Osaka, Japan, and graduated from the Kyushu College of Medicine. In 1928 he was assigned to the Gyeongseong Imperial University's College of Medicine as a professor, and also served as Chief of the Suweon Provincial Hospital while he was staying in Korea. During the 18-year period of his stay, he widely collected medical books of Korea and also thoroughly studied them. He returned to Japan in 1944 due to the illness of his father, but continued his studies of Korean medicine, and in 1955 published the "History of Korean Medicine and of Diseases in Korea" for the first time. Following such accomplishment, "Bibliography of Korean Medical Books" was published in 1956, the next year, and finally "The Chronological Table of Medical Events in Korea" was published a few decades later, in 1985. Since the 1950s, aside of continuing to study and author the history of Korean medicine, he had also engaged himself in a joint effort associated with the members of the Medical History Association of Japan (which also included the alumni of the Kyushu College of Medicine) in a group study of Huseya Soteki, the first Japanese Experimental Physiologist. He also attempted at establishing an academic branch which could be referred to as Experimental Historical Studies of Medicine, by recreating the experiments of Huseya Soteki with his own son. Later he also expanded his interest and studies to the medical history of the world and also the area of Medical Ethics. But his ultimate interest and passion were always targeted at the Medicine of Korea, and the one consistent position he

  5. Evolutionary History of Atmospheric CO2 during the Late Cenozoic from Fossilized Metasequoia Needles.

    Directory of Open Access Journals (Sweden)

    Yuqing Wang

    Full Text Available The change in ancient atmospheric CO2 concentrations provides important clues for understanding the relationship between the atmospheric CO2 concentration and global temperature. However, the lack of CO2 evolution curves estimated from a single terrestrial proxy prevents the understanding of climatic and environmental impacts due to variations in data. Thus, based on the stomatal index of fossilized Metasequoia needles, we reconstructed a history of atmospheric CO2 concentrations from middle Miocene to late Early Pleistocene when the climate changed dramatically. According to this research, atmospheric CO2 concentration was stabile around 330-350 ppmv in the middle and late Miocene, then it decreased to 278-284 ppmv during the Late Pliocene and to 277-279 ppmv during the Early Pleistocene, which was almost the same range as in preindustrial time. According to former research, this is a time when global temperature decreased sharply. Our results also indicated that from middle Miocene to Pleistocene, global CO2 level decreased by more than 50 ppmv, which may suggest that CO2 decrease and temperature decrease are coupled.

  6. Climatic signals registered as Carbon isotopic values in Metasequoia leaf tissues: A statistical analysis

    Science.gov (United States)

    Yang, H.; Blais, B.; Perez, G.; Pagani, M.

    2006-12-01

    To examine climatic signals registered as carbon isotopic values in leaf tissues of C3 plants, we collected mature leaf tissues from sun and shade leaves of Metasequoia trees germinated from the 1947 batch of seeds from China and planted along a latitudinal gradient of the United States. Samples from 40 individual trees, along with fossilized material from the early Tertiary of the Canadian Arctic, were analyzed for C and concentration and isotopic values using EA-IRMS after the removal of free lipids. The generated datasets were then merged with climate data compiled from each tree site recorded as average values over the past thirty years (1971-2002, NOAA database). When the isotope data were cross plotted against each geographic and climatic indicator, Latitude, Mean Annual Temperature (MAT), Average Summer Mean Temperature (ASMT)(June-August), Mean Annual Precipitation (MAP), and Average Summer Mean Precipitation (ASMP) respectively correlation patterns were revealed. The best correlating trend was obtained between temperature parameters and C isotopic values, and this correlation is stronger in the northern leaf samples than the southern samples. We discovered a strong positive correlation between latitude and the offset of C isotopic values between shade and sun leaves. This investigation represents a comprehensive examination on climatic signals registered as C isotopic values on a single species that is marked by single genetic source. The results bear implications on paleoclimatic interpretations of C isotopic signals obtained from fossil plant tissues.

  7. Evolutionary History of Atmospheric CO2 during the Late Cenozoic from Fossilized Metasequoia Needles.

    Science.gov (United States)

    Wang, Yuqing; Momohara, Arata; Wang, Li; Lebreton-Anberrée, Julie; Zhou, Zhekun

    2015-01-01

    The change in ancient atmospheric CO2 concentrations provides important clues for understanding the relationship between the atmospheric CO2 concentration and global temperature. However, the lack of CO2 evolution curves estimated from a single terrestrial proxy prevents the understanding of climatic and environmental impacts due to variations in data. Thus, based on the stomatal index of fossilized Metasequoia needles, we reconstructed a history of atmospheric CO2 concentrations from middle Miocene to late Early Pleistocene when the climate changed dramatically. According to this research, atmospheric CO2 concentration was stabile around 330-350 ppmv in the middle and late Miocene, then it decreased to 278-284 ppmv during the Late Pliocene and to 277-279 ppmv during the Early Pleistocene, which was almost the same range as in preindustrial time. According to former research, this is a time when global temperature decreased sharply. Our results also indicated that from middle Miocene to Pleistocene, global CO2 level decreased by more than 50 ppmv, which may suggest that CO2 decrease and temperature decrease are coupled.

  8. In situ fossil seedlings of a Metasequoia-like taxodiaceous conifer from Paleocene river floodplain deposits of central Alberta, Canada.

    Science.gov (United States)

    Falder, A B; Stockey, R A; Rothwell, G W

    1999-06-01

    Fossil seeds and seedlings of a Metasequoia-like taxodiaceous conifer occur in Paleocene deposits at the Munce's Hill and Gao Mine localities of central Alberta, Canada. Compression/impression specimens are preserved in upright growth positions among seedlings of the cercidiphyllaceous dicot Joffrea speirsii Crane & Stockey. There are a large number of seeds, a few of which were buried while germinating and show a radicle or short primary root. More than 500 Metasequoia-like seedlings have been identified that have two linear cotyledons with parallel margins and rounded tips. Three specimens have been found that display three cotyledons. Slightly older seedlings show decussate pairs of leaves attached to the stem distal to the cotyledons. Still older seedlings have axillary branches that show varying sizes and numbers of opposite leaves arranged in a single plane distal to the opposite pairs. These specimens reveal that both Joffrea and this extinct taxodiaceous conifer were early colonizers of North American floodplain communities at the beginning of the Tertiary.

  9. Preservation of Plant Biomolecules and the Relevance to the Interpretation of Paleoenvironmental Signals: Tertiary Metasequoia Fossils as Examples

    Science.gov (United States)

    Yang, H.; Leng, Q.

    2004-12-01

    The degradation and preservation of biomolecules in plant tissues not only affects the inference on paleoecology of ancient plants but also bears significance in the interpretation of paleoenvironmental signals. Using a combined SEM and geochemical approach, we are able to show the source, liability, and preservation of structural biopolymers from morphologically well-preserved Metasequoia tissues from three Tertiary deposits. We detected a continuum of biomolecular preservation in this evolutionarily-conserved conifer. Pyrolysis-gas chromatography-mass spectrometry (Py-GC-MS) was applied to solvent-extracted residues from both fossil leaf and wood remains in comparison with tissues from their living counterparts. The late Paleocene-early Eocene leaves from Ellesmere Island, Canadian Arctic Archipelago, exhibit the best quality of biochemical preservation and show pyrolysis products derived from labile biomolecules characterized by large amounts of polysaccharides. These labile biomolecules are the oldest record of these kinds so far characterized by the pyrolysis technology. The middle Eocene leaf tissues from Axel Heiberg Island, Canadian Arctic Archipelago, yielded slightly lesser amounts of polysaccharide moieties, but the lignin products are similar to those identified from the Ellesmere Island fossils. Compared with these Arctic materials, the Metasequoia leaves from Miocene Clarkia, Idaho, USA, show the lowest quality of molecular preservation, characterized by a dramatic reduction of polysaccharides. This continuum of relative quality of biomolecular preservation is further confirmed by SEM observations of transverse sections of these fossil leaves. The investigation revealed tissue-specific degradation, and our data support the in-situ polymerization hypothesis for the origin of long-chain homologous pairs of aliphatic n-alk-1-enes/n-alkanes as leaf alteration products. The preferential degradation and selective removal of polysaccharides may be

  10. [Effect of BSA on random amplified polymorphic DNA (RAPD) in plants].

    Science.gov (United States)

    Bian, Cai-Miao; Li, Jun-Min; Jin, Ze-Xin; Ge, Ming-Ju

    2002-05-01

    Using Metasequoia glyptostroboides and Heptacodium miconioides DNA as templates,the effect of bovine serum albumin (BSA) on RAPD in plants was studied. The results showed that suitable concentrations of BSA used in Metasequoia glyptostroboides and Heptacodium miconioides RAPD were different, which were 0.6 microg/microl and 1 microg/microl, respectively. The inhibition of acetylated BSA on the amplification of plant RAPD could be relieved by BSA. BSA could reduce the dosage of Taq DNA polymerase.

  11. AcEST: DK944756 [AcEST

    Lifescience Database Archive (English)

    Full Text Available L Legumin OS=Magnolia salicifolia PE=2 SV=1 99 2e-19 tr|O04690|O04690_METGY Legumin (Fragment) OS=Metasequoia... glyptos... 98 3e-19 tr|O04689|O04689_METGY Legumin OS=Metasequoia glyptostroboi...la... 94 4e-18 tr|O04691|O04691_METGY Legumin OS=Metasequoia glyptostroboides G... 94 5e-18 tr|A7PYN6|A7PYN6

  12. Digital gene expression analysis of male and female bud transition in Metasequoia reveals high activity of MADS-box transcription factors and hormone-mediated sugar pathways

    Directory of Open Access Journals (Sweden)

    Ying eZhao

    2015-06-01

    Full Text Available Metasequoiaglyptostroboidies is a famous redwood tree of ecological and economic importance, and requires more than 20 years of juvenile-to-adult transition before producing female and male cones. Previously, we induced reproductive buds using a hormone solution in juvenile Metasequoia trees as young as5-to-7years old. In the current study, hormone-treated shoots found in female and male buds were used to identify candidate genes involved in reproductive bud transition in Metasequoia. Samples from hormone-treated cone reproductive shoots and naturally occurring non-cone setting shoots were analyzed using 24 digital gene expression (DGE tag profiles using Illumina, generating a total of 69,520 putative transcripts. Next, 32 differentially and specifically expressed transcripts were determined using quantitative real-time polymerase chain reaction, including the upregulation of MADS-box transcription factors involved in male bud transition and flowering time control proteins involved in female bud transition. These differentially expressed transcripts were associated with 243 KEGG pathways. Among the significantly changed pathways, sugar pathways were mediated by hormone signals during the vegetative-to-reproductive phase transition, including glycolysis/gluconeogenesis and sucrose and starch metabolism pathways. Key enzymes were identified in these pathways, including alcohol dehydrogenase (NAD and glutathione dehydrogenase for the glycolysis/gluconeogenesis pathway, and glucanphosphorylase for sucrose and starch metabolism pathways. Our results increase our understanding of the reproductive bud transition in gymnosperms. In addition, these studies on hormone-mediated sugar pathways increase our understanding of the relationship between sugar and hormone signaling during female and male bud initiation in Metasequoia.

  13. High-resolution reconstruction of Arctic paleoclimate derived from 53 million year old kimberlite-hosted Metasequoia wood

    Science.gov (United States)

    Walker, J. J.; Halfar, J.; Schulze, D.; Gedalof, Z.; Moore, G. W. K.

    2009-04-01

    The recovery of exceptionally well preserved Eocene wood from kimberlite pipes in the Lac de Gras region of the Northwest Territories, Canada, has allowed for the characterization of the local temperature and hydrologic patterns on an annual scale for this arctic ecosystem (present day latitude: 64 deg N). Wood fragments of ancient Metasequoia sp. trees mixed into the crater facies during kimberlite emplacement were recovered from the Ekati and Diavik diamond mines. Wood recovered from the Ekati "Panda" pipe, which has been dated using Rb-Sr age determination at 53.3 +/- 0.6 million years, is unique in that it exhibits extremely low vitrinite reflectance values, comparable to that of modern near-surface peats. The implication is that the wood has undergone minimal thermal or compressional alteration, thus preserving the geochemical signatures originally formed during growth. Ring width measurements representing over 100 years of climate data show congruence between multiple samples, thus enabling the development of a floating master chronology. Patterns contained in this chronology are of particular interest as the early Eocene was characterized by a period of unusual warming that has been compared to modern day climate change. Wood cellulose does not exchange atoms with its surroundings after formation, making it an ideal candidate for stable isotope analysis once it has been separated from associated whole-wood components. A robotic micromilling device was used to collect whole wood samples of latewood from annual tree rings. The α-cellulose in the samples will be isolated and analyzed for δ13C and δ18O, generating a 34-year floating chronology that can be used to reconstruct decadal scale temperature and humidity patterns. Successful application of this technique suggests that a longer Eocene chronology, using additional wood samples recovered from the Panda pipe as well as samples from neighbouring pipes in the Lac de Gras region, can be developed.

  14. Patterns of Storage, Synthesis and Changing Light Levels Revealed by Carbon Isotope Microsampling within Eocene Metasequoia Tree Rings

    Science.gov (United States)

    Jahren, H.; Sternberg, L.

    2005-12-01

    Fossil tree rings from Axel Heiberg Island were microanalyzed for δ13C value in order to assess patterns of tree growth and carbon storage within the Middle Eocene (~45 Ma) Arctic paleoenvironment. Wood from four Metasequoia-type individuals was subsampled for analysis: each individual fossil consisted of between 4 and 10 large (~1 cm thick) consecutive tree rings. One of the fossils displayed an obvious concentric pattern, allowing for the determination of the direction of growth with isotopic pattern. Each ring was divided into ~1 mm thick subsamples, resulting in 5-10 δ13C value determinations per period of ring growth (i.e., growing season). All rings revealed a distinct pattern that was characteristic across growing seasons and across individual fossils. Early in the season, δ13C was at its highest value but descended systematically and sharply to its lowest value at the end of the growing season. Total decrease ranged between 3 and 5 ‰ over the course of each growing season. Identical patterns were observed in the δ13C value of alpha-cellulose isolated from each subsample, indicating that the trends observed did not represent changing levels of secondary metabolites, but rather a seasonal adjustment in the bulk source of carbon used during biosynthesis. Our results are consistent with the following annual pattern of wood synthesis 1.) complete dependence on the mobilization of stored carbon compounds early in the growing season; 2.) systematically increasing use of actively-acquired photosynthate during the growing season; 3.) complete reliance on active photosynthate by the end of the growing season. An additional and significant source of 13C discrimination is declining light levels late in the growing season, and likely contributes to the extreme pattern of δ13C decrease seen across each ring. Our results mimic those seen from modern broadleaf deciduous trees (Helle & Schlesser 2004), but differ from those seen in modern conifers (Barbour et al 2002

  15. Experimental evidence for negative turgor pressure in small leaf cells of Robinia pseudoacacia L versus large cells of Metasequoia glyptostroboides Hu et W.C. Cheng. 2. Höfler diagrams below the volume of zero turgor and the theoretical implication for pressure-volume curves of living cells.

    Science.gov (United States)

    Yang, Dongmei; Li, Junhui; Ding, Yiting; Tyree, Melvin T

    2017-03-01

    The physiological advantages of negative turgor pressure, P t , in leaf cells are water saving and homeostasis of reactants. This paper advances methods for detecting the occurrence of negative P t in leaves. Biomechanical models of pressure-volume (PV) curves predict that negative P t does not change the linearity of PV curve plots of inverse balance pressure, P B , versus relative water loss, but it does predict changes in either the y-intercept or the x-intercept of the plots depending on where cell collapse occurs in the P B domain because of negative P t . PV curve analysis of Robinia leaves revealed a shift in the x-intercept (x-axis is relative water loss) of PV curves, caused by negative P t of palisade cells. The low x-intercept of the PV curve was explained by the non-collapse of palisade cells in Robinia in the P B domain. Non-collapse means that P t smoothly falls from positive to negative values with decreasing cell volume without a dramatic change in slope. The magnitude of negative turgor in non-collapsing living cells was as low as -1.3 MPa and the relative volume of the non-collapsing cell equaled 58% of the total leaf cell volume. This study adds to the growing evidence for negative P t . © 2016 John Wiley & Sons Ltd.

  16. AcEST: DK950521 [AcEST

    Lifescience Database Archive (English)

    Full Text Available AA 374 >tr|O04691|O04691_METGY Legumin OS=Metasequoia glyptostroboides GN=Leg4 PE=2 SV=1 Length = 500 Score ...asequoia glyptostroboides G... 43 0.016 tr|Q40933|Q40933...curren... 49 3e-04 tr|Q39521|Q39521_CRYJA Legumin OS=Cryptomeria japonica GN=Leg31 ... 43 0.016 tr|O04691|O04691_METGY Legumin OS=Met

  17. X ray microanalysis of leaf and seed elemental composition among four species of living fossil gymnosperm

    International Nuclear Information System (INIS)

    Chang Chongyan; Li Yongliang; Chen Xiaoduan; Liu Jinying; Zhou Yunlong

    2002-01-01

    The leaf and seed elemental composition and average mass fraction are analysed or four species of living fossil gymnosperm: Ginkgo biloba L., Cathaya argyrophylla Chun et Kuang, Glyptostrobus pensilis (D. Don) Koch and Metasequoia glyptostroboides Hu et Cheng by SEM X ray microanalysis method. The results show that the elemental composition is different and the elemental average mass fraction is evidently different between the seed and leaf for the same species. The elemental composition and average mass fraction between seed and seed wing is different in Cathaya argyrophylla and Metasequoia glyptostroboides. Among three type leaf of Glyptostrobus pensilis, the elemental composition is the same, but average mass fraction is very different

  18. Gene : CBRC-SARA-01-1996 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-1996 Novel UN D UNKNOWN NU2C_ANTFO 0.004 26% gb|AAQ05281.1| NADH dehydrogenase subunit B [Metas...equoia glyptostroboides] 0.044 26% MILMLFLLGSSPRSLIHPRAILKTFPIVCCCLYAFCSLTSLILSLAVL

  19. Separating active and passive influences on stomatal control of transpiration.

    Science.gov (United States)

    McAdam, Scott A M; Brodribb, Timothy J

    2014-04-01

    Motivated by studies suggesting that the stomata of ferns and lycophytes do not conform to the standard active abscisic acid (ABA) -mediated stomatal control model, we examined stomatal behavior in a conifer species (Metasequoia glyptostroboides) that is phylogenetically midway between the fern and angiosperm clades. Similar to ferns, daytime stomatal closure in response to moderate water stress seemed to be a passive hydraulic process in M. glyptostroboides immediately alleviated by rehydrating excised shoots. Only after prolonged exposure to more extreme water stress did active ABA-mediated stomatal closure become important, because foliar ABA production was triggered after leaf turgor loss. The influence of foliar ABA on stomatal conductance and stomatal aperture was highly predictable and additive with the passive hydraulic influence. M. glyptostroboides thus occupies a stomatal behavior type intermediate between the passively controlled ferns and the characteristic ABA-dependent stomatal closure described in angiosperm herbs. These results highlight the importance of considering phylogeny as a major determinant of stomatal behavior.

  20. Estimating Latest Cretaceous and Tertiary Atmospheric PCO2 from Stomatal Indices

    Science.gov (United States)

    Royer, D. L.; Wing, S. L.; Beerling, D. J.

    2001-05-01

    Most modern C3 seed plants show an inverse relationship between PCO2 and stomatal index (SI), where SI is the proportion of epidermal cells that are stomatal packages. This plant-atmosphere response therefore provides a reliable approach for estimating paleo-CO2 levels. Since stomatal responses to CO2 are generally species-specific, one is limited in paleo-reconstructions to species that exist both in the fossil record and living today. Fossils morphologically similar to living Ginkgo biloba and Metasequoia glyptostroboides extend back to the early and late Cretaceous, respectively, indicating that the fossil and living forms are very closely related. Measurements of SI made on fossil Ginkgo and Metasequoia were calibrated with historical collections of G. biloba and M. glyptostroboides leaves from sites that developed during the anthropogenically-driven CO2 increases of the past 145 years (288-369 ppmv) and with saplings of G. biloba and M. glyptostroboides grown in CO2 controlled growth chambers (350-800 ppmv). Both nonlinear regressions are highly significant (Ginkgo: n = 40, r2 = 0.91; Metasequoia: n = 18; r2 = 0.85). Results from a sequence of 23 latest Cretaceous to early Eocene-aged Ginkgo-bearing sites indicate that CO2 remained between 300 and 450 ppmv with the exception of one high estimate ( ~800 ppmv) near the Paleocene/Eocene boundary, and results from 4 middle Miocene-aged Ginkgo- and Metasequoia-bearing sites indicate that CO2 was between 320 and 400 ppmv. If correct, the CO2 values estimated here are too low to explain via the CO2 greenhouse effect alone the higher global mean temperatures (e.g., 3-4 ° C for the early Eocene) inferred from models and geological data for these two intervals.

  1. On the occurrence of nuclei in mature sieve elements.

    Science.gov (United States)

    Event, R F; Davis, J D; Tucker, C M; Alfieri, F J

    1970-12-01

    The secondary phloem of 3 species of the Taxodiaceae and 13 species of woody dicotyledons was examined for the occurrence of nuclei in mature sieve elements. Nuclei were found in all mature sieve cells of Metasequoia glyptostroboides, Sequoia sempervirens and Taxodium distichum, and in some mature sieve-tube members in 12 of the 13 species of woody dicotyledons. Except for nuclei of sieve cells undergoing cessation of function, the nuclei in mature sieve cells of M. glyptostroboides, S. sempervirens and T. distichum were normal in appearance. The occurrence and morphology of nuclei in mature sieve-tube members of the woody dicotyledons were quite variable. Only 3 species, Robinia pseudoacacia, Ulmus americana and Vitis riparia, contained some mature sieve elements with apparently normal nuclei.

  2. Paleobotanical Evidence for Near Present-Day Levels of Atmospheric CO2 During Part of the Tertiary

    Science.gov (United States)

    Royer, Dana L.; Wing, Scott L.; Beerling, David J.; Jolley, David W.; Koch, Paul L.; Hickey, Leo J.; Berner, Robert A.

    2001-06-01

    Understanding the link between the greenhouse gas carbon dioxide (CO2) and Earth's temperature underpins much of paleoclimatology and our predictions of future global warming. Here, we use the inverse relationship between leaf stomatal indices and the partial pressure of CO2 in modern Ginkgo biloba and Metasequoia glyptostroboides to develop a CO2 reconstruction based on fossil Ginkgo and Metasequoia cuticles for the middle Paleocene to early Eocene and middle Miocene. Our reconstruction indicates that CO2 remained between 300 and 450 parts per million by volume for these intervals with the exception of a single high estimate near the Paleocene/Eocene boundary. These results suggest that factors in addition to CO2 are required to explain these past intervals of global warmth.

  3. Skin tests of pollen grains of taxodiaceae and cupressaceae in children with bronchial asthma.

    Science.gov (United States)

    Midoro-Horiuti, T; Nouno, S; Seino, Y

    1992-10-01

    Atmospheric cedar pollen in the southern region of Okayama Prefecture (situated in south-western Japan) has been counted since 1988. Pollen of different species of the Taxodiaceae family (Cryptomeria japonica, Sequoia sempervirens and Metasequoia glyptostroboides) and Japanese juniper (Juniperus rigida) in the Cupressaceae family, which are propagated mainly in the southern region of Okayama Prefecture, were found among the atmospheric pollen. Scratch tests using the pollen extract from Taxodiaceae and Cupressaceae were performed on children with bronchial asthma. Forty (25%) and 30 (18.8%) of the 160 patients reacted positively to an allergen extract from the pollen grains of Japanese cedar (Cryptomeria japonica) and Japanese juniper, respectively.

  4. Separating Active and Passive Influences on Stomatal Control of Transpiration[OPEN

    Science.gov (United States)

    McAdam, Scott A.M.; Brodribb, Timothy J.

    2014-01-01

    Motivated by studies suggesting that the stomata of ferns and lycophytes do not conform to the standard active abscisic acid (ABA) -mediated stomatal control model, we examined stomatal behavior in a conifer species (Metasequoia glyptostroboides) that is phylogenetically midway between the fern and angiosperm clades. Similar to ferns, daytime stomatal closure in response to moderate water stress seemed to be a passive hydraulic process in M. glyptostroboides immediately alleviated by rehydrating excised shoots. Only after prolonged exposure to more extreme water stress did active ABA-mediated stomatal closure become important, because foliar ABA production was triggered after leaf turgor loss. The influence of foliar ABA on stomatal conductance and stomatal aperture was highly predictable and additive with the passive hydraulic influence. M. glyptostroboides thus occupies a stomatal behavior type intermediate between the passively controlled ferns and the characteristic ABA-dependent stomatal closure described in angiosperm herbs. These results highlight the importance of considering phylogeny as a major determinant of stomatal behavior. PMID:24488969

  5. Retrato de un grupo teatral: La fura dels Baus y Miki Espuma

    Directory of Open Access Journals (Sweden)

    Urša Geršak

    1992-12-01

    Full Text Available Invadieron las calles, el metro, los mataderos, los jardines y las fábricas. El día 20 de octubre pasaron nueve años desde que La fura dels Baus conquistó par primera vez las letras calientes de los periódicos con su espectaculo Accions que fue estrenado en el festival internacional del teatro de Sitges. La furiosa destrucción de Ia carroceria del cache que al final fue sacrificada a las llamas, dejó a los dioses satisfechos. Nació un teatro lleno de energía y dinamismo.

  6. Depositional characteristics of atmospheric polybrominated diphenyl ethers on tree barks

    Directory of Open Access Journals (Sweden)

    Man Young Chun

    2014-07-01

    Full Text Available Objectives This study was conducted to determine the depositional characteristics of several tree barks, including Ginkgo (Ginkgo biloba, Pine (Pinus densiflora, Platanus (Platanus, and Metasequoia (Metasequoia glyptostroboides. These were used as passive air sampler (PAS of atmospheric polybrominated diphenyl ethers (PBDEs. Methods Tree barks were sampled from the same site. PBDEs were analyzed by highresolution gas chromatography/high-resolution mass spectrometer, and the lipid content was measured using the gravimetric method by n-hexane extraction. Results Gingko contained the highest lipid content (7.82 mg/g dry, whereas pine (4.85 mg/g dry, Platanus (3.61 mg/g dry, and Metasequoia (0.97 mg/g dry had relatively lower content. The highest total PBDEs concentration was observed in Metasequoia (83,159.0 pg/g dry, followed by Ginkgo (53,538.4 pg/g dry, Pine (20,266.4 pg/g dry, and Platanus (12,572.0 pg/g dry. There were poor correlations between lipid content and total PBDE concentrations in tree barks (R2=0.1011, p =0.682. Among the PBDE congeners, BDE 206, 207 and 209 were highly brominated PBDEs that are sorbed to particulates in ambient air, which accounted for 90.5% (84.3-95.6% of the concentration and were therefore identified as the main PBDE congener. The concentrations of particulate PBDEs deposited on tree barks were dependent on morphological characteristics such as surface area or roughness of barks. Conclusions Therefore, when using the tree barks as the PAS of the atmospheric PBDEs, samples belonging to same tree species should be collected to reduce errors and to obtain reliable data.

  7. Depositional characteristics of atmospheric polybrominated diphenyl ethers on tree barks.

    Science.gov (United States)

    Chun, Man Young

    2014-07-17

    This study was conducted to determine the depositional characteristics of several tree barks, including Ginkgo (Ginkgo biloba), Pine (Pinus densiflora), Platanus (Platanus), and Metasequoia (Metasequoia glyptostroboides). These were used as passive air sampler (PAS) of atmospheric polybrominated diphenyl ethers (PBDEs). Tree barks were sampled from the same site. PBDEs were analyzed by highresolution gas chromatography/high-resolution mass spectrometer, and the lipid content was measured using the gravimetric method by n-hexane extraction. Gingko contained the highest lipid content (7.82 mg/g dry), whereas pine (4.85 mg/g dry), Platanus (3.61 mg/g dry), and Metasequoia (0.97 mg/g dry) had relatively lower content. The highest total PBDEs concentration was observed in Metasequoia (83,159.0 pg/g dry), followed by Ginkgo (53,538.4 pg/g dry), Pine (20,266.4 pg/g dry), and Platanus (12,572.0 pg/g dry). There were poor correlations between lipid content and total PBDE concentrations in tree barks (R(2)=0.1011, p =0.682). Among the PBDE congeners, BDE 206, 207 and 209 were highly brominated PBDEs that are sorbed to particulates in ambient air, which accounted for 90.5% (84.3-95.6%) of the concentration and were therefore identified as the main PBDE congener. The concentrations of particulate PBDEs deposited on tree barks were dependent on morphological characteristics such as surface area or roughness of barks. Therefore, when using the tree barks as the PAS of the atmospheric PBDEs, samples belonging to same tree species should be collected to reduce errors and to obtain reliable data.

  8. Biophysical control of whole tree transpiration under an urban environment in Northern China

    Science.gov (United States)

    Chen, Lixin; Zhang, Zhiqiang; Li, Zhandong; Tang, Jianwu; Caldwell, Peter; Zhang, Wenjuan

    2011-05-01

    SummaryUrban reforestation in China has led to increasing debate about the impact of urban trees and forests on water resources. Although transpiration is the largest water flux leaving terrestrial ecosystems, little is known regarding whole tree transpiration in urban environments. In this study, we quantified urban tree transpiration at various temporal scales and examined the biophysical control of the transpiration pattern under different water conditions to understand how trees survive in an urban environment. Concurrent with microclimate and soil moisture measurements, transpiration from C edrus deodara(Roxb)Loud ., Zelkova schneideriana Hend.-Mazz., Euonymus bungeanus Maxim., and Metasequoia glyptostroboides Hu et cheng was measured over a 2-year period using thermal dissipation probe (TDP) techniques. The average monthly transpiration rates reached 12.78 ± 0.73 (S.E.) mm, 1.79 ± 0.16 mm, 10.18 ± 0.55 mm and 19.28 ± 2.24 mm for C. deodara, Z.schneideriana, E. bungeanus and M. glyptostroboides, respectively. Transpiration rates from M. glyptostroboides reported here may need further study as this species showed much higher sap flows and greater transpiration fluctuation under different environmental conditions than other species. Because of deep soil moisture supply, summer dry spells did not reduce transpiration rates even when tree transpiration exceeded rainfall. While vapor pressure deficit ( VPD) was the dominant environmental factor on transpiration, trees controlled canopy conductance effectively to limit transpiration in times of water stress. Our results provide evidence that urban trees could adopt strong physiological control over transpiration under high evaporative demands to avoid dehydration and can make use of water in deeper soil layers to survive summer dry spells. Moreover, urban trees have the ability to make the best use of precipitation when it is limited, and are sensitive to soil and air dryness.

  9. Interpretation of Forest Resources at the Individual Tree Level at Purple Mountain, Nanjing City, China, Using WorldView-2 Imagery by Combining GPS, RS and GIS Technologies

    Directory of Open Access Journals (Sweden)

    Songqiu Deng

    2013-12-01

    Full Text Available This study attempted to measure forest resources at the individual tree level using high-resolution images by combining GPS, RS, and Geographic Information System (GIS technologies. The images were acquired by the WorldView-2 satellite with a resolution of 0.5 m in the panchromatic band and 2.0 m in the multispectral bands. Field data of 90 plots were used to verify the interpreted accuracy. The tops of trees in three groups, namely ≥10 cm, ≥15 cm, and ≥20 cm DBH (diameter at breast height, were extracted by the individual tree crown (ITC approach using filters with moving windows of 3 × 3 pixels, 5 × 5 pixels and 7 × 7 pixels, respectively. In the study area, there were 1,203,970 trees of DBH over 10 cm, and the interpreted accuracy was 73.68 ± 15.14% averaged over the 90 plots. The numbers of the trees that were ≥15 cm and ≥20 cm DBH were 727,887 and 548,919, with an average accuracy of 68.74 ± 17.21% and 71.92 ± 18.03%, respectively. The pixel-based classification showed that the classified accuracies of the 16 classes obtained using the eight multispectral bands were higher than those obtained using only the four standard bands. The increments ranged from 0.1% for the water class to 17.0% for Metasequoia glyptostroboides, with an average value of 4.8% for the 16 classes. In addition, to overcome the “mixed pixels” problem, a crown-based supervised classification, which can improve the classified accuracy of both dominant species and smaller classes, was used for generating a thematic map of tree species. The improvements of the crown- to pixel-based classification ranged from −1.6% for the open forest class to 34.3% for Metasequoia glyptostroboides, with an average value of 20.3% for the 10 classes. All tree tops were then annotated with the species attributes from the map, and a tree count of different species indicated that the forest of Purple Mountain is mainly dominated by Quercus acutissima, Liquidambar formosana

  10. Carbon and hydrogen isotope fractionation under continuous light: implications for paleoenvironmental interpretations of the High Arctic during Paleogene warming.

    Science.gov (United States)

    Yang, Hong; Pagani, Mark; Briggs, Derek E G; Equiza, M A; Jagels, Richard; Leng, Qin; Lepage, Ben A

    2009-06-01

    The effect of low intensity continuous light, e.g., in the High Arctic summer, on plant carbon and hydrogen isotope fractionations is unknown. We conducted greenhouse experiments to test the impact of light quantity and duration on both carbon and hydrogen isotope compositions of three deciduous conifers whose fossil counterparts were components of Paleogene Arctic floras: Metasequoia glyptostroboides, Taxodium distichum, and Larix laricina. We found that plant leaf bulk carbon isotopic values of the examined species were 1.75-4.63 per thousand more negative under continuous light (CL) than under diurnal light (DL). Hydrogen isotope values of leaf n-alkanes under continuous light conditions revealed a D-enriched hydrogen isotope composition of up to 40 per thousand higher than in diurnal light conditions. The isotope offsets between the two light regimes is explained by a higher ratio of intercellular to atmospheric CO(2) concentration (C (i)/C (a)) and more water loss for plants under continuous light conditions during a 24-h transpiration cycle. Apparent hydrogen isotope fractionations between source water and individual lipids (epsilon(lipid-water)) range from -62 per thousand (Metasequoia C(27) and C(29)) to -87 per thousand (Larix C(29)) in leaves under continuous light. We applied these hydrogen fractionation factors to hydrogen isotope compositions of in situ n-alkanes from well-preserved Paleogene deciduous conifer fossils from the Arctic region to estimate the deltaD value in ancient precipitation. Precipitation in the summer growing season yielded a deltaD of -186 per thousand for late Paleocene, -157 per thousand for early middle Eocene, and -182 per thousand for late middle Eocene. We propose that high-latitude summer precipitation in this region was supplemented by moisture derived from regionally recycled transpiration of the polar forests that grew during the Paleogene warming.

  11. A synchronous increase in hydraulic conductive capacity and mechanical support in conifers with relatively uniform xylem structure.

    Science.gov (United States)

    Jagels, Richard; Visscher, George E

    2006-02-01

    The dual function provided by longitudinal tracheids in conifers has led to a generally held trade-off concept that increasing wall thickness and/or volume of latewood tracheids improves mechanical support, while increasing cell diameter and/or volume of earlywood tracheids enhances conductive potential. Yet, some conifers have either uniform cell structure across the growth ring or, at most, a small amount of latewood. How do these trees accomplish the needs for increasing support and conduction with height growth? We examined Metasequoia glyptostroboides, a species that we previously demonstrated improves its mechanical properties with increasing age without a change in specific gravity or secondary wall microfibril angle. In this paper, we showed that lignin and extractive contents are not contributing factors, and through composite structure analysis, we eliminated a role for tracheid length. Using micromorphometric analysis, we demonstrated that as cell diameter increases, total primary wall decreases, secondary wall increases, and strength and conductive capacity increase with no change in specific gravity. Meta-analysis using other species of Cupressaceae, Podocarpaceae, and Araucariaceae provided strong corroborative evidence for this design strategy.

  12. Flavanol binding of nuclei from tree species.

    Science.gov (United States)

    Feucht, W; Treutter, D; Polster, J

    2004-01-01

    Light microscopy was used to examine the nuclei of five tree species with respect to the presence of flavanols. Flavanols develop a blue colouration in the presence of a special p-dimethylaminocinnamaldehyde (DMACA) reagent that enables those nuclei loaded with flavanols to be recognized. Staining of the nuclei was most pronounced in both Tsuga canadensis and Taxus baccata, variable in Metasequoia glyptostroboides, faint in Coffea arabica and minimal in Prunus avium. HPLC analysis showed that the five species contained substantial amounts of different flavanols such as catechin, epicatechin and proanthocyanidins. Quantitatively, total flavanols were quite different among the species. The nuclei themselves, as studied in Tsuga seed wings, were found to contain mainly catechin, much lower amounts of epicatechin and traces of proanthocyanidins. Blue-coloured nuclei located centrally in small cells were often found to maximally occupy up to 90% of a cell's radius, and the surrounding small rim of cytoplasm was visibly free of flavanols. A survey of 34 gymnosperm and angiosperm species indicated that the first group has much higher nuclear binding capacities for flavanols than the second group.

  13. [Environmental responses of four urban tree species transpiration in northern China].

    Science.gov (United States)

    Chen, Li-xin; Li, Zhan-dong; Zhang, Zhi-qiang; Zhang, Wen-juan; Zhang, Xiao-fang; Dong, Ke-yu; Wang, Guo-yu

    2009-12-01

    By using thermal dissipation probes (TDP), this paper monitored the sap flow of four tree species (Cedrus deodara, Zelkova schneideriana, Euonymus bungeanus, and Metasequoia glyptostroboides) at the Laodong Park in Dalian City from June to August 2008, and the soil moisture content and micrometeorological variables were mehsured simultaneously. Due to the absence of water-stress in the habitat, the sap flow of all sampled trees had no significant correlation with soil moisture content (R2 0.211, n=1296). The correlation coefficient between solar radiation and sap flow reached 0.624-0.773 (P = 0.00, n=1296) despite the existing hysteresis. Solar radiation had major effect (R2 > 0.700, P 0.660, P < 0.05, n=1872), vapor pressure deficit (VPD) had a correlation coefficient as high as 0.650-0.823 (P = 0.00, n=1296) with the sap flow in whole-day scale. Meanwhile, the models constructed on the basis of VPD were able to explain 90% of daily sap flow change (P = 0.00). The correlation coefficient between sap flow and wind speed was relatively smaller than the previous two (R2 < 0.380, P = 0.00, n=1296), though showing significant correlation in affecting sap flow. Observations also detected the saturation phenomenon of sap flow to the environmental demands.

  14. Modeled dosage-response relationship on the net photosynthetic rate for the sensitivity to acid rain of 21 plant species.

    Science.gov (United States)

    Deng, Shihuai; Gou, Shuzhen; Sun, Baiye; Lv, Wenlin; Li, Yuanwei; Peng, Hong; Xiao, Hong; Yang, Gang; Wang, Yingjun

    2012-08-01

    This study investigated the sensitivity of plant species to acid rain based on the modeled dosage-response relationship on the net photosynthetic rate (P (N)) of 21 types of plant species, subjected to the exposure of simulated acid rain (SAR) for 5 times during a period of 50 days. Variable responses of P (N) to SAR occurred depending on the type of plant. A majority (13 species) of the dosage-response relationship could be described by an S-shaped curve and be fitted with the Boltzmann model. Model fitting allowed quantitative evaluation of the dosage-response relationship and an accurate estimation of the EC(10), termed as the pH of the acid rain resulting in a P (N) 10 % lower than the reference value. The top 9 species (Camellia sasanqua, Cinnamomum camphora, etc. EC(10) ≤ 3.0) are highly endurable to very acid rain. The rare, relict plant Metasequoia glyptostroboides was the most sensitive species (EC(10) = 5.1) recommended for protection.

  15. Exposure experiments of trees to sulfur dioxide gas. Part I

    Energy Technology Data Exchange (ETDEWEB)

    Otani, A.

    1974-12-01

    The effects of gaseous sulfur dioxide on trees were studied. Twenty species of plant seedlings (70 cm in height) including Cedrus deodara, Metasequoia glyptostroboides, Ginkgo biloba, Celmus parvifolia var. albo-marginata, Pinus thumbergii, P. densiflora, Cryptomeria japonica, and Quercus myrsinaefolia, were exposed in a room to gaseous sulfur dioxide at 0.8 ppm for 7.5 hr/day (from 9 am to 4:30 pm) for 24 days at a temperature of 20-35 deg C and RH of 55-75%. Visible damage to plants was lighter in C.j. and Chamae cyparis obtusa, more severe in P.t., G.b., and C.d. The damage appeared earlier in G.b., Cinnamomum camphona, and Ilex rotunda, and the change of early symptoms was smaller in P.t., C.j., and C.o. The leaves of the 4-5th positions from the sprout were apt to be damaged. Although the sulfur content of exposed leaves increased markedly, that in other parts did not increase. Because of the high concentration of the gas and the short period of exposure, the absorption of sulfur into leaves should have differed from the situation in fields where longer exposure to lower concentrations of the gas would be expected. 6 references.

  16. A method of detecting carbonyl compounds in tree leaves in China.

    Science.gov (United States)

    Huang, Juan; Feng, Yanli; Fu, Jiamo; Sheng, Guoying

    2010-06-01

    Carbonyl compounds have been paid more and more attention because some carbonyl species have been proven to be carcinogenic or a risk for human health. Plant leaves are both an important emission source and an important sink of carbonyl compounds. But the research on carbonyl compounds from plant leaves is very scarce. In order to make an approach to the emission mechanism of plant leaves, a new method was established to extract carbonyl compounds from fresh plant leaves. The procedure combining derivatization with ultrasonication was developed for the fast extraction of carbonyl compounds from tree leaves. Fresh leaves (Metasequoia glyptostroboides), were selected and extracted by this method. Seven carbonyl compounds, including formaldehyde, acetaldehyde, acetone, acrolein, p-tolualdehyde, m/o-tolualdehyde, and hexaldehyde were determined and quantified. The most common carbonyl species of the four tree leaves were formaldehyde, acrolein, and m/o-tolualdehyde. They accounted for 67.3% in cedar, 50.8% in sweet olive, 45.8% in dawn redwood, and 44.6% in camphor tree, respectively. Camphor tree had the highest leaf level of m/o-tolualdehyde with 15.0 +/- 3.4 microg g(-1)(fresh leaf weight), which indicated that camphor tree may be a bioindicator of the level of tolualdehyde or xylene in the atmosphere. By analyzing carbonyl compounds from different tree leaves, it is not only helpful for further studying the relationship between sink and emission of carbonyls from plants, but also helpful for exploring optimum plant population in urban greening.

  17. Urban tree species show the same hydraulic response to vapor pressure deficit across varying tree size and environmental conditions.

    Directory of Open Access Journals (Sweden)

    Lixin Chen

    Full Text Available The functional convergence of tree transpiration has rarely been tested for tree species growing under urban conditions even though it is of significance to elucidate the relationship between functional convergence and species differences of urban trees for establishing sustainable urban forests in the context of forest water relations.We measured sap flux of four urban tree species including Cedrus deodara, Zelkova schneideriana, Euonymus bungeanus and Metasequoia glyptostroboides in an urban park by using thermal dissipation probes (TDP. The concurrent microclimate conditions and soil moisture content were also measured. Our objectives were to examine 1 the influence of tree species and size on transpiration, and 2 the hydraulic control of urban trees under different environmental conditions over the transpiration in response to VPD as represented by canopy conductance. The results showed that the functional convergence between tree diameter at breast height (DBH and tree canopy transpiration amount (E(c was not reliable to predict stand transpiration and there were species differences within same DBH class. Species differed in transpiration patterns to seasonal weather progression and soil water stress as a result of varied sensitivity to water availability. Species differences were also found in their potential maximum transpiration rate and reaction to light. However, a same theoretical hydraulic relationship between G(c at VPD = 1 kPa (G(cref and the G(c sensitivity to VPD (-dG(c/dlnVPD across studied species as well as under contrasting soil water and R(s conditions in the urban area.We concluded that urban trees show the same hydraulic regulation over response to VPD across varying tree size and environmental conditions and thus tree transpiration could be predicted with appropriate assessment of G(cref.

  18. Urban tree species show the same hydraulic response to vapor pressure deficit across varying tree size and environmental conditions.

    Science.gov (United States)

    Chen, Lixin; Zhang, Zhiqiang; Ewers, Brent E

    2012-01-01

    The functional convergence of tree transpiration has rarely been tested for tree species growing under urban conditions even though it is of significance to elucidate the relationship between functional convergence and species differences of urban trees for establishing sustainable urban forests in the context of forest water relations. We measured sap flux of four urban tree species including Cedrus deodara, Zelkova schneideriana, Euonymus bungeanus and Metasequoia glyptostroboides in an urban park by using thermal dissipation probes (TDP). The concurrent microclimate conditions and soil moisture content were also measured. Our objectives were to examine 1) the influence of tree species and size on transpiration, and 2) the hydraulic control of urban trees under different environmental conditions over the transpiration in response to VPD as represented by canopy conductance. The results showed that the functional convergence between tree diameter at breast height (DBH) and tree canopy transpiration amount (E(c)) was not reliable to predict stand transpiration and there were species differences within same DBH class. Species differed in transpiration patterns to seasonal weather progression and soil water stress as a result of varied sensitivity to water availability. Species differences were also found in their potential maximum transpiration rate and reaction to light. However, a same theoretical hydraulic relationship between G(c) at VPD = 1 kPa (G(cref)) and the G(c) sensitivity to VPD (-dG(c)/dlnVPD) across studied species as well as under contrasting soil water and R(s) conditions in the urban area. We concluded that urban trees show the same hydraulic regulation over response to VPD across varying tree size and environmental conditions and thus tree transpiration could be predicted with appropriate assessment of G(cref).

  19. Water-use responses of ‘living fossil’ conifers to CO2 enrichment in a simulated Cretaceous polar environment

    Science.gov (United States)

    Llorens, Laura; Osborne, Colin P.; Beerling, David J.

    2009-01-01

    Background and Aims During the Mesozoic, the polar regions supported coniferous forests that experienced warm climates, a CO2-rich atmosphere and extreme seasonal variations in daylight. How the interaction between the last two factors might have influenced water use of these conifers was investigated. An experimental approach was used to test the following hypotheses: (1) the expected beneficial effects of elevated [CO2] on water-use efficiency (WUE) are reduced or lost during the 24-h light of the high-latitude summer; and (2) elevated [CO2] reduces plant water use over the growing season. Methods Measurements of leaf and whole-plant gas exchange, and leaf-stable carbon isotope composition were made on one evergreen (Sequoia sempervirens) and two deciduous (Metasequoia glyptostroboides and Taxodium distichum) ‘living fossil’ coniferous species after 3 years' growth in controlled-environment simulated Cretaceous Arctic (69°N) conditions at either ambient (400 µmol mol−1) or elevated (800 µmol mol−1) [CO2]. Key Results Stimulation of whole-plant WUE (WUEP) by CO2 enrichment was maintained over the growing season for the three studied species but this pattern was not reflected in patterns of WUE inferred from leaf-scale gas exchange measurements (iWUEL) and δ13C of foliage (tWUEL). This response was driven largely by increased rates of carbon uptake, because there was no overall CO2 effect on daily whole-plant transpiration or whole-plant water loss integrated over the study period. Seasonal patterns of tWUEL differed from those measured for iWUEL. The results suggest caution against over simplistic interpretations of WUEP based on leaf isotopic composition. Conclusions The data suggest that the efficiency of whole-tree water use may be improved by CO2 enrichment in a simulated high-latitude environment, but that transpiration is relatively insensitive to atmospheric CO2 in the living fossil species investigated. PMID:19447810

  20. Isoginkgetin inhibits tumor cell invasion by regulating phosphatidylinositol 3-kinase/Akt-dependent matrix metalloproteinase-9 expression.

    Science.gov (United States)

    Yoon, Sang-Oh; Shin, Sejeong; Lee, Ho-Jae; Chun, Hyo-Kon; Chung, An-Sik

    2006-11-01

    Matrix metalloproteinase (MMP)-9 plays a key role in tumor invasion. Inhibitors of MMP-9 were screened from Metasequoia glyptostroboides (Dawn redwood) and one potent inhibitor, isoginkgetin, a biflavonoid, was identified. Noncytotoxic levels of isoginkgetin decreased MMP-9 production profoundly, but up-regulated the level of tissue inhibitor of metalloproteinase (TIMP)-1, an inhibitor of MMP-9, in HT1080 human fibrosarcoma cells. The major mechanism of Ras-dependent MMP-9 production in HT1080 cells was phosphatidylinositol 3-kinase (PI3K)/Akt/nuclear factor-kappaB (NF-kappaB) activation. Expression of dominant-active H-Ras and p85 (a subunit of PI3K) increased MMP-9 activity, whereas dominant-negative forms of these molecules decreased the level of MMP-9. H-Ras did not increase MMP-9 in the presence of a PI3K inhibitor, LY294002, and a NF-kappaB inhibitor, SN50. Further studies showed that isoginkgetin regulated MMP-9 production via PI3K/Akt/NF-kappaB pathway, as evidenced by the findings that isoginkgetin inhibited activities of both Akt and NF-kappaB. PI3K/Akt is a well-known key pathway for cell invasion, and isoginkgetin inhibited HT1080 tumor cell invasion substantially. Isoginkgetin was also quite effective in inhibiting the activities of Akt and MMP-9 in MDA-MB-231 breast carcinomas and B16F10 melanoma. Moreover, isoginkgetin treatment resulted in marked decrease in invasion of these cells. In summary, PI3K/Akt is a major pathway for MMP-9 expression and isoginkgetin markedly decreased MMP-9 expression and invasion through inhibition of this pathway. This suggests that isoginkgetin could be a potential candidate as a therapeutic agent against tumor invasion.

  1. Water-use responses of 'living fossil' conifers to CO2 enrichment in a simulated Cretaceous polar environment.

    Science.gov (United States)

    Llorens, Laura; Osborne, Colin P; Beerling, David J

    2009-07-01

    During the Mesozoic, the polar regions supported coniferous forests that experienced warm climates, a CO(2)-rich atmosphere and extreme seasonal variations in daylight. How the interaction between the last two factors might have influenced water use of these conifers was investigated. An experimental approach was used to test the following hypotheses: (1) the expected beneficial effects of elevated [CO(2)] on water-use efficiency (WUE) are reduced or lost during the 24-h light of the high-latitude summer; and (2) elevated [CO(2)] reduces plant water use over the growing season. Measurements of leaf and whole-plant gas exchange, and leaf-stable carbon isotope composition were made on one evergreen (Sequoia sempervirens) and two deciduous (Metasequoia glyptostroboides and Taxodium distichum) 'living fossil' coniferous species after 3 years' growth in controlled-environment simulated Cretaceous Arctic (69 degrees N) conditions at either ambient (400 micromol mol(-1)) or elevated (800 micromol mol(-1)) [CO(2)]. Stimulation of whole-plant WUE (WUE(P)) by CO(2) enrichment was maintained over the growing season for the three studied species but this pattern was not reflected in patterns of WUE inferred from leaf-scale gas exchange measurements (iWUE(L)) and delta(13)C of foliage (tWUE(L)). This response was driven largely by increased rates of carbon uptake, because there was no overall CO(2) effect on daily whole-plant transpiration or whole-plant water loss integrated over the study period. Seasonal patterns of tWUE(L) differed from those measured for iWUE(L). The results suggest caution against over simplistic interpretations of WUE(P) based on leaf isotopic composition. The data suggest that the efficiency of whole-tree water use may be improved by CO(2) enrichment in a simulated high-latitude environment, but that transpiration is relatively insensitive to atmospheric CO(2) in the living fossil species investigated.

  2. Perspectives on screening winter-flood-tolerant woody species in the riparian protection forests of the three gorges reservoir.

    Science.gov (United States)

    Yang, Fan; Wang, Yong; Chan, Zhulong

    2014-01-01

    The establishment of riparian protection forests in the Three Gorges Reservoir (TGR) is an ideal measure to cope with the eco-environmental problems of the water-level fluctuation zone (WLFZ). Thus, the information for screening winter-flood-tolerant woody plant species is useful for the recovery and re-establishment of the riparian protection forests in the TGR WLFZ. Therefore, we discussed the possibilities of constructing and popularizing riparian protection forests in the TGR WLFZ from several aspects, including the woody plant species distribution in the WLFZ, the survival rate analyses of suitable candidate woody species under controlled flooding conditions, the survival rate investigation of some woody plant species planted in the TGR WLFZ, and the physiological responses of some woody plant species during the recovery stage after winter floods. The results of woody species investigation showed that most woody plant species that existed as annual seedlings in the TGR WLFZ are not suitable candidates for the riparian protection forests. However, arbor species (e.g., Salix matsudana, Populus×canadensis, Morus alba, Pterocarya stenoptera, Taxodium ascendens, and Metasequoia glyptostroboides) and shrub species (e.g., Salix variegata, Distylium chinensis, Lycium chinense, Myricaria laxiflora, and Rosa multiflora) might be considered suitable candidates for the riparian protection forests in the TGR WLFZ by survival rate analyses under controlled winter flooding conditions, and survival rate investigations of woody plant species planted in the TGR WLFZ, respectively. Physiological analyses showed that P.×canadensis, M. alba, L. chinense, and S. variegata could develop specific self-repairing mechanisms to stimulate biomass accumulation and carbohydrate synthesis via the increases in chlorophyll pigments and photosynthesis during recovery after winter floods. Our results suggested these woody plant species could endure the winter flooding stress and recover well

  3. Perspectives on screening winter-flood-tolerant woody species in the riparian protection forests of the three gorges reservoir.

    Directory of Open Access Journals (Sweden)

    Fan Yang

    Full Text Available The establishment of riparian protection forests in the Three Gorges Reservoir (TGR is an ideal measure to cope with the eco-environmental problems of the water-level fluctuation zone (WLFZ. Thus, the information for screening winter-flood-tolerant woody plant species is useful for the recovery and re-establishment of the riparian protection forests in the TGR WLFZ. Therefore, we discussed the possibilities of constructing and popularizing riparian protection forests in the TGR WLFZ from several aspects, including the woody plant species distribution in the WLFZ, the survival rate analyses of suitable candidate woody species under controlled flooding conditions, the survival rate investigation of some woody plant species planted in the TGR WLFZ, and the physiological responses of some woody plant species during the recovery stage after winter floods. The results of woody species investigation showed that most woody plant species that existed as annual seedlings in the TGR WLFZ are not suitable candidates for the riparian protection forests. However, arbor species (e.g., Salix matsudana, Populus×canadensis, Morus alba, Pterocarya stenoptera, Taxodium ascendens, and Metasequoia glyptostroboides and shrub species (e.g., Salix variegata, Distylium chinensis, Lycium chinense, Myricaria laxiflora, and Rosa multiflora might be considered suitable candidates for the riparian protection forests in the TGR WLFZ by survival rate analyses under controlled winter flooding conditions, and survival rate investigations of woody plant species planted in the TGR WLFZ, respectively. Physiological analyses showed that P.×canadensis, M. alba, L. chinense, and S. variegata could develop specific self-repairing mechanisms to stimulate biomass accumulation and carbohydrate synthesis via the increases in chlorophyll pigments and photosynthesis during recovery after winter floods. Our results suggested these woody plant species could endure the winter flooding stress

  4. The penalty of a long, hot summer. Photosynthetic acclimation to high CO2 and continuous light in "living fossil" conifers.

    Science.gov (United States)

    Osborne, Colin P; Beerling, David J

    2003-10-01

    Deciduous forests covered the ice-free polar regions 280 to 40 million years ago under warm "greenhouse" climates and high atmospheric pCO2. Their deciduous habit is frequently interpreted as an adaptation for minimizing carbon losses during winter, but experiments with "living fossils" in a simulated warm polar environment refute this explanation. Measured carbon losses through leaf abscission of deciduous trees are significantly greater than losses through winter respiration in evergreens, yet annual rates of primary productivity are similar in all species. Here, we investigate mechanisms underlying this apparent paradox by measuring the seasonal patterns of leaf photosynthesis (A) under pCO2 enrichment in the same trees. During spring, A increased significantly in coastal redwood (Sequoia sempervirens), dawn redwood (Metasequoia glyptostroboides), and swamp cypress (Taxodium distichum) at an elevated pCO2 of 80 Pa compared with controls at 40 Pa. However, strong acclimation in Rubisco carboxylation capacity (Vc,max) completely offset the CO2 response of A in all species by the end of 6 weeks of continuous illumination in the simulated polar summer. Further measurements demonstrated the temporary nature of acclimation, with increases in Vc,max during autumn restoring the CO2 sensitivity of A. Contrary to expectations, the acclimation of Vc,max was not always accompanied by accumulation of leaf carbohydrates, but was associated with a decline in leaf nitrogen in summer, suggesting an alteration of the balance in plant sources and sinks for carbon and nitrogen. Preliminary calculations using A indicated that winter carbon losses through deciduous leaf abscission and respiration were recovered by 10 to 25 d of canopy carbon fixation during summer, thereby explaining the productivity paradox.

  5. Changes in radiocesium contamination from Fukushima in foliar parts of 10 common tree species in Japan between 2011 and 2013

    International Nuclear Information System (INIS)

    Yoshihara, Toshihiro; Matsumura, Hideyuki; Tsuzaki, Masaharu; Wakamatsu, Takashi; Kobayashi, Takuya; Hashida, Shin-nosuke; Nagaoka, Toru; Goto, Fumiyuki

    2014-01-01

    Yearly changes in radiocesium ( 137 Cs) contamination, primarily due to the Fukushima accident of March 2011, were observed in the foliar parts of 10 common woody species in Japan (Chamaecyparis obtusa, Cedrus deodara, Pinus densiflora, Cryptomeria japonica, Phyllostachys pubescens, Cinnamomum camphora, Metasequoia glyptostroboides, Prunus × yedoensis, Acer buergerianum, and Aesculus hippocastanum). The samples were obtained from Abiko (approximately 200 km SSW of the Fukushima Dai-ichi Nuclear Power Plant) during each growing season between 2011 and 2013, and the foliar parts were examined based on their year of expansion and location in each trees. The radiocesium concentrations generally decreased with time; however, the concentrations and rates of decrease varied among species, age of foliar parts, and locations. The radiocesium concentrations in the 2012 current-year foliar parts were 29%–220% of those from 2011, while those from 2013 fell to between 14% and 42% of the 2011 values. The net decontamination in the foliage was higher in evergreen species than in deciduous species. The radiocesium concentrations in the upper foliar parts were higher than those in the lower parts particularly in C. japonica. In addition, the radiocesium concentrations were higher in the current-year foliar parts than in the 1-year-old foliar parts, particularly in 2013. Thus, the influence of the direct deposition of the fallout was reduced with time, and the translocation ability of radiocesium from old to new tissues became more influential. Similar to the behavior of potassium in trees, Cs redistribution probably occurred primarily due to internal nutrient translocation mechanisms. - Highlights: • 137 Cs concentrations of foliar parts expanded in 2013 was 14–42% of those in 2011. • The rates of decrease varied with the species, sampling part, and position. • Newly expanded foliar parts contain higher 137 Cs concentrations than older parts. • 137 Cs translocation

  6. Changes in radiocesium contamination from Fukushima in foliar parts of 10 common tree species in Japan between 2011 and 2013.

    Science.gov (United States)

    Yoshihara, Toshihiro; Matsumura, Hideyuki; Tsuzaki, Masaharu; Wakamatsu, Takashi; Kobayashi, Takuya; Hashida, Shin-Nosuke; Nagaoka, Toru; Goto, Fumiyuki

    2014-12-01

    Yearly changes in radiocesium ((137)Cs) contamination, primarily due to the Fukushima accident of March 2011, were observed in the foliar parts of 10 common woody species in Japan (Chamaecyparis obtusa, Cedrus deodara, Pinus densiflora, Cryptomeria japonica, Phyllostachys pubescens, Cinnamomum camphora, Metasequoia glyptostroboides, Prunus × yedoensis, Acer buergerianum, and Aesculus hippocastanum). The samples were obtained from Abiko (approximately 200 km SSW of the Fukushima Dai-ichi Nuclear Power Plant) during each growing season between 2011 and 2013, and the foliar parts were examined based on their year of expansion and location in each trees. The radiocesium concentrations generally decreased with time; however, the concentrations and rates of decrease varied among species, age of foliar parts, and locations. The radiocesium concentrations in the 2012 current-year foliar parts were 29%-220% of those from 2011, while those from 2013 fell to between 14% and 42% of the 2011 values. The net decontamination in the foliage was higher in evergreen species than in deciduous species. The radiocesium concentrations in the upper foliar parts were higher than those in the lower parts particularly in C. japonica. In addition, the radiocesium concentrations were higher in the current-year foliar parts than in the 1-year-old foliar parts, particularly in 2013. Thus, the influence of the direct deposition of the fallout was reduced with time, and the translocation ability of radiocesium from old to new tissues became more influential. Similar to the behavior of potassium in trees, Cs redistribution probably occurred primarily due to internal nutrient translocation mechanisms. Copyright © 2014 The Authors. Published by Elsevier Ltd.. All rights reserved.

  7. The Penalty of a Long, Hot Summer. Photosynthetic Acclimation to High CO2 and Continuous Light in “Living Fossil” Conifers1

    Science.gov (United States)

    Osborne, Colin P.; Beerling, David J.

    2003-01-01

    Deciduous forests covered the ice-free polar regions 280 to 40 million years ago under warm “greenhouse” climates and high atmospheric pCO2. Their deciduous habit is frequently interpreted as an adaptation for minimizing carbon losses during winter, but experiments with “living fossils” in a simulated warm polar environment refute this explanation. Measured carbon losses through leaf abscission of deciduous trees are significantly greater than losses through winter respiration in evergreens, yet annual rates of primary productivity are similar in all species. Here, we investigate mechanisms underlying this apparent paradox by measuring the seasonal patterns of leaf photosynthesis (A) under pCO2 enrichment in the same trees. During spring, A increased significantly in coastal redwood (Sequoia sempervirens), dawn redwood (Metasequoia glyptostroboides), and swamp cypress (Taxodium distichum) at an elevated pCO2 of 80 Pa compared with controls at 40 Pa. However, strong acclimation in Rubisco carboxylation capacity (Vc,max) completely offset the CO2 response of A in all species by the end of 6 weeks of continuous illumination in the simulated polar summer. Further measurements demonstrated the temporary nature of acclimation, with increases in Vc,max during autumn restoring the CO2 sensitivity of A. Contrary to expectations, the acclimation of Vc,max was not always accompanied by accumulation of leaf carbohydrates, but was associated with a decline in leaf nitrogen in summer, suggesting an alteration of the balance in plant sources and sinks for carbon and nitrogen. Preliminary calculations using A indicated that winter carbon losses through deciduous leaf abscission and respiration were recovered by 10 to 25 d of canopy carbon fixation during summer, thereby explaining the productivity paradox. PMID:12972654

  8. Mesocosm-Scale Experimental Quantification of Plant-Fungi Associations on Carbon Fluxes and Mineral Weathering

    Science.gov (United States)

    Andrews, M. Y.; Palmer, B.; Leake, J. R.; Banwart, S. A.; Beerling, D. J.

    2009-12-01

    The rise of land plants in the Paleozoic is classically implicated as driving lower atmospheric CO2 levels through enhanced weathering of Ca and Mg bearing silicate minerals. However, this view overlooks the fact that plants coevolved with associated mycorrhizal fungi over this time, with many of the weathering processes usually ascribed to plants actually being driven by the combined activities of roots and mycorrhizal fungi. Here we present initial results from a novel mesocosm-scale laboratory experiment designed to allow investigation of plant-driven carbon flux and mineral weathering at different soil depths under ambient (400 ppm) and elevated (1500 ppm) atmospheric CO2. Four species of plants were chosen to address evolutionary trends in symbiotic mycorrhizal association and rooting depth on biologically driven silicate weathering under the different CO2 regimes. Gymnosperms were used to investigate potential differences in weathering capabilities of two fungal symbioses: Sequoia sempervirens and Metasequoia glyptostroboides (arbuscular mycorrhizal, AM) and Pinus sylvestris (ectomycorrhizal, EM), and the shallow rooted ancient fern, Osmunda regalis, used to provide a contrast to the three more deeply rooted trees. Plants were grown in a cylindrical mesocosm with four horizontal inserts at each depth. These inserts are a mesh-covered dual-core unit whereby an inner core containing silicate minerals can be rotated within an outer core. The mesh excludes roots from the cylinders allowing fungal-rock pairings to be examined at each depth. Each core contains either basalt or granite, each with severed (rotated cores) or intact (static cores) mycorrhizae. This system provides a unique opportunity to examine the ability of a plant to weather minerals with and without its symbiotic fungi. Preliminary results indicate marked differences in nutritional and water requirements, and response to elevated CO2 between the species. The bulk solution chemistries (p

  9. Re-evaluating the isotopic divide between angiosperms and gymnosperms using n-alkane δ13C values

    Science.gov (United States)

    Bush, R. T.; McInerney, F. A.

    2009-12-01

    Angiosperm δ13C values are typically 1-3‰ more negative than those of co-occurring gymnosperms. This is known for both bulk leaf and compound-specific values from n-alkanes, which are stable, straight-chain hydrocarbons (C23-C35) found in the epicuticular leaf wax of vascular plants. For n-alkanes, there is a second distinction between the δ13C values of angiosperms and gymnosperms—δ13C values generally decrease with increasing chain-length in angiosperms, while in gymnosperms they increase. These two distinctions have been used to support the ‘plant community change hypothesis’ explaining the difference between the terrestrial and marine carbon isotope excursions during the Paleocene-Eocene Thermal Maximum (PETM.) Preserved n-alkanes from terrestrial paleosols in the Bighorn Basin, Wyoming reveal a negative carbon isotope excursion during the PETM of 4-5‰, which is 1-2‰ greater than the excursion recorded by marine carbonates. The local plant community, known from macrofossils as well as palynoflora, shifted from a deciduous, mixed angiosperm/gymnosperm flora to a suite of evergreen angiosperm species during the PETM. At the end of the PETM, the community returned to a mixed deciduous flora very similar to the original. This change in the plant community could thus magnify the terrestrial negative carbon isotope excursion to the degree necessary to explain its divergence from the marine record. However, the comparison between modern angiosperms and gymnosperms has been made mostly between broadleaf, deciduous angiosperms and evergreen, coniferous gymnosperms. New data analyzing deciduous, coniferous gymnosperms, including Metasequoia glyptostroboides and Taxodium distichum, suggests that the division previously ascribed to taxonomy may actually be based on leaf habit and physiology, specifically broadleaf, deciduous versus needle-leaf, evergreen plants. If differences in n-alkane δ13C values can be described not as angiosperms versus gymnosperms

  10. Experimental insights into angiosperm origins.

    Science.gov (United States)

    Lomax, Barry; Lee, Alex; Smilie, Ian; Knight, Charles; Upchurch, Garland

    2017-04-01

    The angiosperms occupy almost every habitat type on Earth and comprise nearly 90% of extant plant species. Yet this ascendency is a relatively recent (geological) phenomenon. Palaeobotanical evidence indicates a likely first occurrence in the Early Cretaceous followed by a relatively rapid increase in diversity with their rise to dominance marking the onset of modern world. Understanding this diversification event has been a key research question since Darwin commented on this "abominable mystery", and it remains one of the most significant unanswered questions in plant biology. Sequencing work shows that the diversification and radiation was accompanied by successive whole genome duplication (WGD) events. Furthermore proxy data and predictions from long-term carbon cycle models indicate that the angiosperm diversification was accompanied by a decline in atmospheric CO2. These observation raise the intriguing possibility that declining atmospheric CO2 concentration and capacity to undergo polyploidy could have given angiosperms a competitive advantage when compared to other plant groups. Using comparative ecophysiology we set out to test the effects of declining atmospheric CO2 by growing a six species (Ranunculus acris and Polypodium vulgare, chosen to represent Cretaceous understorey angiosperms and pteridophytes respectively. Liquidambar styraciflua and Laurus nobilis represented canopy angiosperms and Ginkgo biloba and Metasequoia glyptostroboides canopy gymnosperms) in controlled conditions across a CO2 gradient (2000, 1200, 800 and 400 ppm) to simulate Cretaceous CO2decline. To test for WGDs we use the relationship between guard cell size and genome size to reconstruct angiosperm genome size as they radiated. Analysis of our fossil dataset shows that earliest angiosperms had a small genome size. Our experimental work shows that angiosperms have a greater capacity for acclimation suggesting that declining CO2 could have acted as a trigger for the angiosperm

  11. Special issue on Ecology, evolution, and conservation of plants in China: Introduction and some considerations

    Directory of Open Access Journals (Sweden)

    Liu, J. Q.

    2015-12-01

    Full Text Available China has one of the world’s richest floras with around 33,000 vascular plants, of which up to 17,000 are endemic. Besides these astonishing figures, the Chinese flora is very interesting from the point of view of evolution, as it shows a strong relictual character with some truly “living fossils” such as Ginkgo biloba or Metasequoia glyptostroboides. At the same time, China probably harbours the most important ‘‘evolutionary front’’ of the world’s temperate flora, the Hengduan Mountains. Unfortunately, the flora of China also includes a high number of threatened species (with nearly 4000, mostly due to the destruction of natural habitats and the over-exploitation of natural resources. This special issue, which corresponds to volume 34 of Collectanea Botanica, is aimed to contribute to the knowledge of Chinese flora through a series of contributions (seven full-length articles and one short note spanning several topics such as biogeography, conservation, demography, ecology, evolution, and plant-animal interactions.China tiene una de las floras más ricas del mundo con alrededor 33.000 plantas vasculares, de las cuales hasta 17.000 son endémicas. Además de estas cifras asombrosas, la flora china es muy interesante desde el punto de vista de la evolución, ya que muestra un fuerte carácter relictual con algunos auténticos «fósiles vivientes» como Ginkgo biloba o Metasequoia glyptostroboides. Al mismo tiempo, China probablemente alberga el «frente evolutivo» más importante de las floras templadas del mundo, las montañas Hengduan. Por desgracia, la flora de China también destaca por el elevado número de especies amenazadas (casi 4000, sobre todo debido a la destrucción de los hábitats y la sobreexplotación de los recursos naturales. Este número especial, que corresponde al volumen 34 de Collectanea Botanica, tiene como objetivo contribuir al conocimiento de la flora de China a través de una serie de contribuciones

  12. Forest Resources of the Caucasian Black Sea Coast: Problems and Prospects of Rational Use

    Directory of Open Access Journals (Sweden)

    S. M. Bebia

    2015-02-01

    1750 m3/ha, Metasequoia glyptostroboides Hu et Cheng in the same crop forms 1478 m3/ha, Liquidambar styraciflua L. 1000 m3/ha, Liriodendron tulipifera L. forms 852 m3/ha. The most productive local tree species Abies nordmanniana (Stev. Spach of 50 year age forms a tree stand with timber stock of 350 m3/ha. It is noted that the negative impact on the state of forests and forestry in the region has a significant impact on management of forest resources, as well as global climate change of the planet, and example of which is desiccation of fir forests as a result of climate warming. For efficient use of forest resources, an environmentally and socio-economically sound development strategy for the forest industry in the region must be developed.More than 70 % of the Caucasian Black Sea Coast (CBSC forests grow in mountainous conditions of the Colchis phytogeographical province and perform primary environmental functions. In these forests for a long period of time excessively intense logging has been in practice, which caused serious damage to their health. The main issues of forestry here are the introduction of effective methods of harvesting, using rational technology in logging operations, restoring native forest types at past logging sites, increasing the productivity and sustainability of forests on the bioecological biogeocenotical level, and preserving the riparian-protective role of forests. In the article, the author analyzes the results of many years of research in forests of the CBSC, that consider the question of condition of forests, peculiarity the multifunctional values and priority direction forestry in them. The author also considers the basic conformity of structure and com-position of forest stands, and presents evidence about the natural renewal of logging sites in fir and beech forests. It has been established that high intensity selective logging more than 50 % canopy cover and bringing the stand after logging 0.5 and below leads to degradation of

  13. Nussbaumile muuseum Osnabrückis

    Index Scriptorium Estoniae

    1998-01-01

    Saksamaal avatud juudi maalikunstniku Felix Nussbaumi (1904-1944) muuseumi projekteeris USA arhitekt Daniel Liebeskind. Esimene välisnäitus - Art Spiegelmani Miki-Hiire koomiksiraamatute väljapanek

  14. Piilupart Donald sai tähe Hollywoodi kuulsuste alleel

    Index Scriptorium Estoniae

    2004-01-01

    Walt Disney joonistatud Piilupart ilmus ekraanile esmakordselt 1934. aastal joonisfilmis "Tark tibu". Nüüd sai ka tema Hollywoodi tähtede alleel oma staaritähe Miki-Hiire, Pluuto ja Daisy kõrvale

  15. Donalda Daka udostoili zvezdõ

    Index Scriptorium Estoniae

    2004-01-01

    Walt Disney joonistatud Piilupart ilmus ekraanile esmakordselt 1934. aastal joonisfilmis "Tark tibu". Nüüd sai ka tema Hollywoodi tähtede alleel oma staaritähe Miki-Hiire, Pluuto ja Daisy kõrvale

  16. AcEST: DK962363 [AcEST

    Lifescience Database Archive (English)

    Full Text Available asequoia glyptostroboides PE=2 SV=1 Length = 319 Score =...LASRSA Sbjct: 124 TTDGKKMVDVLVEQKIVPGIKVDKGLVPLVGSNDESWCQGLDGLASRSA 172 >tr|Q8LK59|Q8LK59_METGY Fructose-bisphosphate aldolase OS=Met

  17. AcEST: BP917160 [AcEST

    Lifescience Database Archive (English)

    Full Text Available sequoia glyptostroboides PE=2 SV=1 Length = 319 Score = ...jct: 64 GRGILAMDESNATCGKRLASIGLENTEANRQAYRTLLVTAPGLGQYISGSILFEETLY 121 >tr|Q8LK59|Q8LK59_METGY Fructose-bisphosphate aldolase OS=Meta

  18. Chemical Properties, Decomposition, and Methane Production of Tertiary Relict Plant Litters: Implications for Atmospheric Trace Gas Production in the Early Tertiary

    Science.gov (United States)

    Yavitt, J. B.; Bartella, T. M.; Williams, C. J.

    2006-12-01

    Throughout the early Tertiary (ca. 65-38 Ma) Taxodiaceae-dominated (redwood) wetland forests occupied the high latitudes and were circumpolar in their distribution. Many of these forests had high standing biomass with moderate primary productivity. The geographic extent and amount of Tertiary coals and fossil forests throughout Arctic Canada suggests large areas of wetland forests that may have cycled substantial quantities of carbon, particularly methane until they were replaced by cold tolerant Pinus, Picea, and Larix following climatic cooling associated with the Terminal Eocene Event. To test this hypothesis we compared physiochemical properties, decomposition, and trace gas production of litter from extant Metasequoia, Pinus, Picea, and Larix. Initial results from plantation-grown trees indicate Metasequoia litter is a better source of labile organic substrate than pinaceous litter. Metasequoia litter contained the least lignin and highest amounts of water-soluble compounds of the four litter types studied. Analysis of the lignin structure using cupric oxide oxidation indicates that Metasequoia lignin is enriched in 4'-hydroxyacetophenone and 4'- Hydroxy-3'-methoxyacetophenone relative to the pinaceous litter. In a 12-month decomposition study using litterbags, average litter mass loss was greater for Metasequoia litter (62%) compared to the pinaceous species (50%). Moreover, Metasequoia litter incubated under anoxic conditions produced nearly twice as much CO2 (ca. 4.2 umol/g.day) and CH4 (2.1 umol/g.day) as the pinaceous litter (2.4 umol/g.day for CO2; 1.2 umol/g.day for CH4). Our results support the idea of greater decomposability and palatability of Metasequoia litter as compared to Larix, Picea, or Pinus. Provided that the biochemical properties of Metasequoia have remained relatively stable through geologic time, it appears that early Tertiary Metasequoia-dominated wetland forests may have had higher microbial driven trace gas production than the

  19. Identification of twenty novel polymorphic microsatellite DNA ...

    Indian Academy of Sciences (India)

    China Sea Pearl', accounting for over 90% production of the total marine pearls produced in ... longer reads (>75 bp) at lower cost (Kawahara-Miki et al. 2011; Ward et al. 2012). ..... culture Research System (grant no. CARS-48), Special Fund ...

  20. Damage Assessment of a Full-Scale Six-Story wood-frame Building Following Triaxial shake Table Tests

    Science.gov (United States)

    John W. van de Lindt; Rakesh Gupta; Shiling Pei; Kazuki Tachibana; Yasuhiro Araki; Douglas Rammer; Hiroshi Isoda

    2012-01-01

    In the summer of 2009, a full-scale midrise wood-frame building was tested under a series of simulated earthquakes on the world's largest shake table in Miki City, Japan. The objective of this series of tests was to validate a performance-based seismic design approach by qualitatively and quantitatively examining the building's seismic performance in terms of...

  1. Whittaker Vector of Deformed Virasoro Algebra and Macdonald Symmetric Functions

    Science.gov (United States)

    Yanagida, Shintarou

    2016-03-01

    We give a proof of Awata and Yamada's conjecture for the explicit formula of Whittaker vector of the deformed Virasoro algebra realized in the Fock space. The formula is expressed as a summation over Macdonald symmetric functions with factored coefficients. In the proof, we fully use currents appearing in the Fock representation of Ding-Iohara-Miki quantum algebra.

  2. Pakendidisain : ühekordne alumiiniumlusikas / Triin Ojari

    Index Scriptorium Estoniae

    Ojari, Triin, 1974-

    2005-01-01

    Eesti Kunstiakadeemia tootedisaini osakonna IV kursuse üliõpilane Riho Tiivel võitis Itaalias toimunud disainikonkursi ReAL 13 (Recycling Aluminium) "Eating Anywhere" peapreemia oma alumiiniumist lusikaga "Spoon Container". II - Giulio Iacchetti, III - Miki Astori, Linda Bigatti, ergutuspreemia - Sam Sannia. 4 ill

  3. Lighting Control System (ILCS)

    African Journals Online (AJOL)

    2017-08-08

    Aug 8, 2017 ... function blocks CNC machining protocol. Advanced Materials Research, 2014, 845:779-785. [2] Miki M, Nagano M, Yoshimi M, Yonemoto H, Yoshida K. Intelligent lighting system with an additional energy-saving mechanism. In IEEE International Conference on Systems,. Man, and Cybernetics, 2012, pp.

  4. Speaking without words: Zorba's dance

    Directory of Open Access Journals (Sweden)

    Hnaraki Maria

    2009-01-01

    Full Text Available Anthony Quinn 'teaching dance' on the island of Crete to the music of Mikis Theodorakis is a popular image that portrays Greeks as extremely emotional passionate and spontaneous. This paper shows the importance of dancing in Greek culture and how Greeks talk through their body by examining Kazantzakis character, Zorba, who 'has many things to say but would rather dance them'.

  5. Een 20-jarige man met een luxatie van de grote teen

    NARCIS (Netherlands)

    Doornberg, Job N.; Postma, Ingri L.; Struijs, Peter A. A.

    2014-01-01

    A 20-year-old student came to our Emergency Department with a dislocated great toe with interposition of the sesamoid bone on the plantair side of the proximal phalanx (Miki Type 2 dislocation). Attempts of closed reduction at the Emergency Room were unsuccessful and open reduction and K-wire

  6. [The introduction of compendium of materia medica and praxis in the late Joseon dynasty].

    Science.gov (United States)

    Oh, Chaekun; Kim, Yongjin

    2011-06-30

    Sakae Miki said Classified Emergency Materia Medica had been the dominant standard of herbology throughout Joseon Dynasty, and that Compendium of Materia Medica had only been accepted so lately that a few books used herbological result of it in the late Joseon Dynasty. But according to Visiting Old Beijing Diary written by Munjoong Seo in 1690, Compendium of Materia Medica was in fact introduced before the year 1712, the year Miki Sakae argued to be the year Compendium of Materia Medica was accepted to Joseon officially. Now, we can assume that the introducing year of Compendium of Materia Medica was faster than Miki Sakae's opinion by the following reasons; the effort of Joseon government and intellectuals to buy new books of Ming & Ching; the publishing year of the book for living in countryside regarded as the first citing literature of Compendium of Materia Medica. And the True Records of the Joseon Dynasty and many collections written by intellectuals in the 18th century show that the herbological knowledge from Compendium of Materia Medica had already spread to the corners of Joseon Dynasty. Thus we can make the following assumption: Classified Emergency Materia Medica and Compendium of Materia Medica had coexisted in the late Joseon Dynasty. Sakae Miki suggested 6 examples which used Compendium of Materia Medica in the late Joseon Dynasty. I reviewed two of them in this paper, Essentials of Materia Medica & Handbook of Prescriptions from Materia Medica. Essentials of Materia Medica quoted Compendium of Materia Medica briefly focusing clinical use, and Handbook of Prescriptions from Materia Medica also re-compiled Compendium of Materia Medica to practical use according to the form of Treasured Mirror of Eastern Medicine. It means that the results of Compendium of Materia Medica have been used positively, based on the herbology of materia medica from countryside. From this point of view, the hyphothesis there weren't any herbological progress after accepting

  7. AcEST: DK958897 [AcEST

    Lifescience Database Archive (English)

    Full Text Available RFTRCTDTPSS 417 GCSK + T P++ Sbjct: 59 ETTGCSKMWDNLTCWPTT 76 >sp|Q71L24|RR7_METGY 30S ribosomal protein S7, chloroplastic OS=Metasequ...oia glyptostroboides GN=rps7 PE=3 SV=1 Length = 155 Score = 33.1 bits (74), Expect

  8. AcEST: DK962439 [AcEST

    Lifescience Database Archive (English)

    Full Text Available sequoia glyptostroboides PE=2 SV=1 Length = 319 Score = 261 bits (667), Expect = 3e...GLASRSAAYYQQGARFAK 183 Query: 637 WRTVV 651 WRTVV Sbjct: 184 WRTVV 188 >tr|Q8LK59|Q8LK59_METGY Fructose-bisphosphate aldolase OS=Meta

  9. AcEST: DK958537 [AcEST

    Lifescience Database Archive (English)

    Full Text Available AISQDNGLVPI Sbjct: 184 WRTVVSIPNGPSALAVKEAAWGLARYAAISQDNGLVPI 221 >tr|Q8LK59|Q8LK59_METGY Fructose-bisphosphate aldolase OS=Metasequo...ia glyptostroboides PE=2 SV=1 Length = 319 Score = 322 bits (825), Expect = 1e-86 I

  10. Fulltext PDF

    Indian Academy of Sciences (India)

    MADHU

    ... activity as “natural products” with a role in plant defense against bacteria, fungi ... properties of organic extracts and essential oils from M. glyptostroboides such as ..... Polyalthia longifolia seeds; Fitoterapia 76 336–339. Peres M T, Delle ...

  11. Converting Sabine absorption coefficients to random incidence absorption coefficients

    DEFF Research Database (Denmark)

    Jeong, Cheol-Ho

    2013-01-01

    are suggested: An optimization method for the surface impedances for locally reacting absorbers, the flow resistivity for extendedly reacting absorbers, and the flow resistance for fabrics. With four porous type absorbers, the conversion methods are validated. For absorbers backed by a rigid wall, the surface...... coefficients to random incidence absorption coefficients are proposed. The overestimations of the Sabine absorption coefficient are investigated theoretically based on Miki's model for porous absorbers backed by a rigid wall or an air cavity, resulting in conversion factors. Additionally, three optimizations...... impedance optimization produces the best results, while the flow resistivity optimization also yields reasonable results. The flow resistivity and flow resistance optimization for extendedly reacting absorbers are also found to be successful. However, the theoretical conversion factors based on Miki's model...

  12. Superkangelased, kommertshiired ja sõjakad idaeurooplased / Joonas Sildre

    Index Scriptorium Estoniae

    Sildre, Joonas

    2003-01-01

    Rahvusvaheline koomiksifestival Berliinis 27.-31. VIII. Tuntumaid esinejaid - Roger Sabin. Näitused: "Ümber maailma 80 pildiga - rahvusvaheline koomiksikunst", "Kinderkids in Wonderland", "Miki ja Donaldi maailm läbi aegade", Art Spiegelmani "Kisses from New York", Helge Reumanni väljapanek. Eesti koomiks (Veiko Tammjärve, Joonas Sildre tööd) on esindatud Sloveenia koomiksikirjastuse Strip Core väljaannetes

  13. Transitioning Client Based NALCOMIS to a Multi Function Web Based Application

    Science.gov (United States)

    2016-09-23

    computer science. Lastly, there are not enough thanks that can go to my wife, Chie, and daughter, Miki, for putting up with an absentee husband/father...based NALCOMIS. Examples of widely used web server products are Apache Tomcat (used in this proof of concept) [9] and Microsoft Internet Information...provides online tutorials for many of its products , one of which, JDBC, is an important component of this research. "JDBC is an application program in

  14. Reference: 295 [Arabidopsis Phenome Database[Archive

    Lifescience Database Archive (English)

    Full Text Available 295 http://metadb.riken.jp/db/SciNetS_ria224i/cria224u4ria224u16284313i Fujita Yas...ng that enhances drought stress tolerance in Arabidopsis. 12 3470-88 16284313 200...5 Dec The Plant cell Fujita Miki|Fujita Yasunari|Hiratsu Keiichiro|Maruyama Kyonoshin|Ohme-Takagi Masaru|Par

  15. Refined toric branes, surface operators and factorization of generalized Macdonald polynomials

    Science.gov (United States)

    Zenkevich, Yegor

    2017-09-01

    We find new universal factorization identities for generalized Macdonald polynomials on the topological locus. We prove the identities (which include all previously known forumlas of this kind) using factorization identities for matrix model averages, which are themselves consequences of Ding-Iohara-Miki constraints. Factorized expressions for generalized Macdonald polynomials are identified with refined topological string amplitudes containing a toric brane on an intermediate preferred leg, surface operators in gauge theory and certain degenerate CFT vertex operators.

  16. Identification of a common microdeletion cluster in 7q21.3 subband among patients with myeloid leukemia and myelodysplastic syndrome

    Energy Technology Data Exchange (ETDEWEB)

    Asou, Hiroya; Matsui, Hirotaka; Ozaki, Yuko; Nagamachi, Akiko; Nakamura, Megumi; Aki, Daisuke [Department of Molecular Oncology and Leukemia Program Project, Research Institute for Radiation Biology and Medicine, Hiroshima University, 1-2-3 Kasumi, Minami-ku, Hiroshima 734-8553 (Japan); Inaba, Toshiya, E-mail: tinaba@hiroshima-u.ac.jp [Department of Molecular Oncology and Leukemia Program Project, Research Institute for Radiation Biology and Medicine, Hiroshima University, 1-2-3 Kasumi, Minami-ku, Hiroshima 734-8553 (Japan)

    2009-05-29

    Monosomy 7 and interstitial deletions in the long arm of chromosome 7 (-7/7q-) is a common nonrandom chromosomal abnormality found frequently in myeloid disorders including acute myeloid leukemia (AML), myelodysplastic syndrome (MDS), and juvenile myelomonocytic leukemia (JMML). Using a short probe-based microarray comparative genomic hybridization (mCGH) technology, we identified a common microdeletion cluster in 7q21.3 subband, which is adjacent to 'hot deletion region' thus far identified by conventional methods. This common microdeletion cluster contains three poorly characterized genes; Samd9, Samd9L, and a putative gene LOC253012, which we named Miki. Gene copy number assessment of three genes by real-time PCR revealed heterozygous deletion of these three genes in adult patients with AML and MDS at high frequency, in addition to JMML patients. Miki locates to mitotic spindles and centrosomes and downregulation of Miki by RNA interference induced abnormalities in mitosis and nuclear morphology, similar to myelodysplasia. In addition, a recent report indicated Samd9 as a tumor suppressor. These findings indicate the usefulness of the short probe-based CGH to detect microdeletions. The three genes located to 7q21.3 would be candidates for myeloid tumor-suppressor genes on 7q.

  17. Style and ideology: The cold war 'blend' in Greece

    Directory of Open Access Journals (Sweden)

    Romanu Keti

    2008-01-01

    Full Text Available This paper describes cultural policy in Greece from the end of World War II up to the fall of the junta of colonels in 1974. The writer's object is to show how the Cold War favoured defeated Western countries, which participated effectively in the globalisation of American culture, as in the Western world de-nazification was transformed into a purge of communism. Using the careers of three composers active in communist resistance organizations as examples (Iannis Xenakis, Mikis Theodorakis and Alecos Xenos, the writer describes the repercussions of this phenomenon in Greek musical life and creativity.

  18. A Blueprint for Collaborative Lawmaking

    Directory of Open Access Journals (Sweden)

    Miki Kashtan

    2016-03-01

    Full Text Available Miki Kashtan, a consultant at the Center for Efficient Collaboration, describes how her Convergent Facilitation method of collaborative decision-making brought together contentiously divided stakeholders in an effort to redraft child custody legislation in Minnesota, resulting in a near-unanimous new bill that completely changes the approach to child custody. This breakthrough surprised many. It depended on reframing the goals of the legislative effort to find legislation that all could wholeheartedly embrace, based on what mattered to all parties. A commitment to those goals carried the group through two years of an intensive and yet non-adversarial process.

  19. [Soil meso- and micro-fauna community structures in different urban forest types in Shanghai, China.

    Science.gov (United States)

    Jin, Shi Ke; Wang, Juan Juan; Zhu, Sha; Zhang, Qi; Li, Xiang; Zheng, Wen Jing; You, Wen Hui

    2016-07-01

    Soil meso- and micro-fauna of four urban forest types in Shanghai were investigated in four months which include April 2014, July 2014, October 2014 and January 2015. A total of 2190 soil fauna individuals which belong to 6 phyla, 15 classes and 22 groups were collected. The dominant groups were Nematoda and Arcari, accounting for 56.0% and 21.8% of the total in terms of individual numbers respectively. The common groups were Enchytraeidae, Rotatoria, Collembola and Hymenoptera and they accounted for 18.7% of the total in terms of individual numbers. There was a significant difference (PMetasequoia glyptostroboides forest, the smallest in Cinnamomum camphora forest. The largest groupe number was found in near-nature forest, the smallest was found in M. glyptostroboides forest. There was obvious seasonal dynamics in each urban forest type and green space which had larger density in autumn and larger groupe number in summer and autumn. In soil profiles, the degree of surface accumulation of soil meso- and micro-fauna in C. camphora forest was higher than in other forests and the vertical distribution of soil meso- and micro-fauna in near-nature forest was relatively homogeneous in four layers. Density-group index was ranked as: near-nature forest (6.953)> C. camphora forest (6.351)> Platanus forest (6.313)>M. glyptostroboides forest (5.910). The community diversity of soil fauna in each vegetation type could be displayed preferably by this index. It could be inferred through redundancy analysis (RDA) that the soil bulk density, organic matter and total nitrogen were the main environmental factors influencing soil meso- and micro-fauna community structure in urban forest. The positive correlations occurred between the individual number of Arcari, Enchytraeidae and soil organic matter and total nitrogen, as well as between the individual number of Diptera larvae, Rotatoria and soil water content.

  20. Effects of submergence on growth and survival of saplings of three wetland trees differing in adaptive mechanisms for flood tolerance

    Directory of Open Access Journals (Sweden)

    Fumiko Iwanaga

    2015-04-01

    Full Text Available Aim of study: Withstanding total submergence and reaeration following submergence is essential for the survival and establishment of wetland species. We focused on “LOES–low oxygen escape syndrome” and “LOQS–low oxygen quiescence syndrome” and compared tolerances to total submergence among wetland woody species differing in morphological adaptation to soil flooding. Area of study, materials and methods: This study examined the survival of 2-year-old saplings of Taxodium distichum and Metasequioia glyptostroboides (LOQS species, and Alnus japonica (LOES species, during and after total submergence. Saplings were completely submerged, then de-submerged to determine trends in survival and growth Main results: The M. glyptostroboides and A. japonica saplings could not survive prolonged submergence for more than 8 weeks, whereas saplings of T. distichum survived for over 2 years. Submerged saplings of all species showed no significant growth or modifications in morphology and anatomy under water, such as shoot elongation, adventitious root formation, and/or aerenchyma development. All T. distichum saplings that were de-submerged in the second year had the same pattern of shoot growth regardless of differences in timing and seasonality of de-submergence. Wood formation in T. distichum saplings ceased during submergence and resumed after de-submergence in spring and summer, but not in autumn. Research highlights: T. distichum saplings, which survived longer submergence periods than A. japonica and M. glyptostroboides, had physiological characteristics, such as suspension of growth and metabolism, which allowed survival of protracted total submergence (at least 2 years when saplings were immersed during the dormant stage before leaf flushing.

  1. Fluctuations in the East Asian monsoon recorded by pollen assemblages in sediments from the Japan Sea off the southwestern coast of Hokkaido, Japan, from 4.3 Ma to the present

    Science.gov (United States)

    Igarashi, Yaeko; Irino, Tomohisa; Sawada, Ken; Song, Lu; Furota, Satoshi

    2018-04-01

    We reconstructed fluctuations in the East Asian monsoon and vegetation in the Japan Sea region since the middle Pliocene based on pollen data obtained from sediments collected by the Integrated Ocean Drilling Program off the southwestern coast of northern Japan. Taxodiaceae conifers Metasequoia and Cryptomeria and Sciadopityacere conifer Sciadopitys are excellent indicators of a humid climate during the monsoon. The pollen temperature index (Tp) can be used as a proxy for relative air temperature. Based on changes in vegetation and reconstructed climate over a period of 4.3 Ma, we classified the sediment sequence into six pollen zones. From 4.3 to 3.8 Ma (Zone 1), the climate fluctuated between cool/moist and warm/moist climatic conditions. Vegetation changed between warm temperate mixed forest and cool temperate conifer forest. The Neogene type tree Carya recovered under a warm/moist climate. The period from 3.8 to 2.5 Ma (Zone 2) was characterized by increased Metasequoia pollen concentration. Warm temperate mixed forest vegetation developed under a cool/moist climate. The period from 2.5 to 2.2 Ma (Zone 3) was characterized by an abrupt increase in Metasequoia and/or Cryptomeria pollen and a decrease in warm broadleaf tree pollen, indicating a cool/humid climate. The Zone 4 period (2.2-1.7 Ma) was characterized by a decrease in Metasequoia and/or Cryptomeria pollen and an increase in cool temperate conifer Picea and Tsuga pollen, indicating a cool/moist climate. The period from 1.7 to 0.3 Ma (Zone 5) was characterized by orbital-scale climate fluctuations. Cycles of abrupt increases and decreases in Cryptomeria and Picea pollen and in Tp values indicated changes between warm/humid and cold/dry climates. The alpine fern Selaginella selaginoides appeared as of 1.6 Ma. Vegetation alternated among warm mixed, cool mixed, and cool temperate conifer forests. Zone 6 (0.3 Ma to present) was characterized by a decrease in Cryptomeria pollen. The warm temperate broadleaf

  2. Humidity estimate for the middle Eocene Arctic rain forest

    Science.gov (United States)

    Jahren, A. Hope; Silveira Lobo Sternberg, Leonel

    2003-05-01

    The exquisite preservation of fossilized Metasequoia trees that grew near 80°N latitude during the middle Eocene (ca. 45 Ma) in Nunavut, Canada, allowed for δD and δ18O analyses of cellulose, techniques previously restricted to wood <30,000 yr old. From the isotopic results, we determined that the middle Eocene Arctic atmosphere contained ˜2× the water found in the region's atmosphere today. This water vapor contributed to a middle Eocene greenhouse effect that insulated the polar region during dark polar winters.

  3. Influence of seasonal changes and vigor on appearance of trees

    International Nuclear Information System (INIS)

    Miura, T.; Tobioka, J.

    1995-01-01

    The seasonal changes in trees are highly dependant on their health and growth rate. Monitoring the vigor of trees at every season provides basic data which can be used at trees planting to predict the physiological characteristics of their seasonal change. In this study, 3 kinds of trees ; zelkova, camphor and metasequoia were monthly observed from April to December, using an infrared television camera. The vigor of the trees was evaluated in each season and the relationship between their image and the evaluation in each season was investigated. The data shows that there is a high correlation between the vigor and the seasonal evaluations

  4. Creating understanding of reproductive health. Exchanges.

    Science.gov (United States)

    1997-02-01

    Yoko Komiyama, senior commentator of the Japan Broadcasting Corporation; Miyuki Nakamura, senior staff writer of Nihon Keizai Shimbun's Lifestyle News Department; and Miki Morimoto, staff writer for the Center for Research and Analysis on Global Issues Project 21, Asahi Shimbun, were introduced to population and reproductive health issues and the situation of women in Nepal during a December 8-16 interregional study tour. JOICFP selected the participants and organized an itinerary which provided insights into multilateral cooperation between UNFPA and the Ministry of Health (MOH) of Nepal, bilateral assistance between the Japan International Cooperation Agency and MOH, and nongovernmental organization collaboration between the Family Planning Association of Nepal and JOICFP. Upon returning to Japan, these representatives of three of Japan's major mass media groups shared their experiences with the general public through reports in newspapers, and on radio and television.

  5. Guideline for Adopting the Local Reaction Assumption for Porous Absorbers in Terms of Random Incidence Absorption Coefficients

    DEFF Research Database (Denmark)

    Jeong, Cheol-Ho

    2011-01-01

    resistivity and the absorber thickness on the difference between the two surface reaction models are examined and discussed. For a porous absorber backed by a rigid surface, the assumption of local reaction always underestimates the random incidence absorption coefficient and the local reaction models give...... incidence acoustical characteristics of typical building elements made of porous materials assuming extended and local reaction. For each surface reaction, five well-established wave propagation models, the Delany-Bazley, Miki, Beranek, Allard-Champoux, and Biot model, are employed. Effects of the flow...... errors of less than 10% if the thickness exceeds 120 mm for a flow resistivity of 5000 Nm-4s. As the flow resistivity doubles, a decrease in the required thickness by 25 mm is observed to achieve the same amount of error. For an absorber backed by an air gap, the thickness ratio between the material...

  6. Random incidence absorption coefficients of porous absorbers based on local and extended reaction models

    DEFF Research Database (Denmark)

    Jeong, Cheol-Ho

    2011-01-01

    resistivity and the absorber thickness on the difference between the two surface reaction models are examined and discussed. For a porous absorber backed by a rigid surface, the local reaction models give errors of less than 10% if the thickness exceeds 120 mm for a flow resistivity of 5000 Nm-4s. As the flow...... incidence acoustical characteristics of typical building elements made of porous materials assuming extended and local reaction. For each surface reaction, five well-established wave propagation models, the Delany-Bazley, Miki, Beranek, Allard-Champoux, and Biot model, are employed. Effects of the flow...... resistivity doubles, a decrease in the required thickness by 25 mm is observed to achieve the same amount of error. For an absorber backed by an air gap, the thickness ratio between the material and air cavity is important. If the absorber thickness is approximately 40% of the cavity depth, the local reaction...

  7. Multiple Meixner polynomials and non-Hermitian oscillator Hamiltonians

    International Nuclear Information System (INIS)

    Ndayiragije, F; Van Assche, W

    2013-01-01

    Multiple Meixner polynomials are polynomials in one variable which satisfy orthogonality relations with respect to r > 1 different negative binomial distributions (Pascal distributions). There are two kinds of multiple Meixner polynomials, depending on the selection of the parameters in the negative binomial distribution. We recall their definition and some formulas and give generating functions and explicit expressions for the coefficients in the nearest neighbor recurrence relation. Following a recent construction of Miki, Tsujimoto, Vinet and Zhedanov (for multiple Meixner polynomials of the first kind), we construct r > 1 non-Hermitian oscillator Hamiltonians in r dimensions which are simultaneously diagonalizable and for which the common eigenstates are expressed in terms of multiple Meixner polynomials of the second kind. (paper)

  8. On factorization of generalized Macdonald polynomials

    International Nuclear Information System (INIS)

    Kononov, Ya.; Morozov, A.

    2016-01-01

    A remarkable feature of Schur functions - the common eigenfunctions of cut-and-join operators from W ∞ - is that they factorize at the peculiar two-parametric topological locus in the space of time variables, which is known as the hook formula for quantum dimensions of representations of U q (SL N ) and which plays a big role in various applications. This factorization survives at the level of Macdonald polynomials. We look for its further generalization to generalized Macdonald polynomials (GMPs), associated in the same way with the toroidal Ding-Iohara-Miki algebras, which play the central role in modern studies in Seiberg-Witten-Nekrasov theory. In the simplest case of the first-coproduct eigenfunctions, where GMP depend on just two sets of time variables, we discover a weak factorization - on a one- (rather than four-) parametric slice of the topological locus, which is already a very non-trivial property, calling for proof and better understanding. (orig.)

  9. Quantitative comparison of the in situ microbial communities in different biomes

    Energy Technology Data Exchange (ETDEWEB)

    White, D.C. [Tennessee Univ., Knoxville, TN (United States)]|[Oak Ridge National Lab., TN (United States); Ringelberg, D.B.; Palmer, R.J. [Tennessee Univ., Knoxville, TN (United States). Center for Environmental Biotechnology

    1995-12-31

    A system to define microbial communities in different biomes requires the application of non-traditional methodology. Classical microbiological methods have severe limitations for the analysis of environmental samples. Pure-culture isolation, biochemical testing, and/or enumeration by direct microscopic counting are not well suited for the estimation of total biomass or the assessment of community composition within environmental samples. Such methods provide little insight into the in situ phenotypic activity of the extant microbiota since these techniques are dependent on microbial growth and thus select against many environmental microorganisms which are non- culturable under a wide range of conditions. It has been repeatedly documented in the literature that viable counts or direct counts of bacteria attached to sediment grains are difficult to quantitative and may grossly underestimate the extent of the existing community. The traditional tests provide little indication of the in situ nutritional status or for evidence of toxicity within the microbial community. A more recent development (MIDI Microbial Identification System), measure free and ester-linked fatty acids from isolated microorganisms. Bacterial isolates are identified by comparing their fatty acid profiles to the MIKI database which contains over 8000 entries. The application of the MIKI system to the analysis of environmental samples however, has significant drawbacks. The MIDI system was developed to identify clinical microorganisms and requires their isolation and culture on trypticase soy agar at 27{degrees}C. Since many isolates are unable to grow at these restrictive growth conditions, the system does not lend itself to identification of some environmental organisms. A more applicable methodology for environmental microbial analysis is based on the liquid extrication and separation of microbial lipids from environmental samples, followed by quantitative analysis using gas chromatography/

  10. Evolution of green plants as deduced from 5S rRNA sequences.

    Science.gov (United States)

    Hori, H; Lim, B L; Osawa, S

    1985-02-01

    We have constructed a phylogenic tree for green plants by comparing 5S rRNA sequences. The tree suggests that the emergence of most of the uni- and multicellular green algae such as Chlamydomonas, Spirogyra, Ulva, and Chlorella occurred in the early stage of green plant evolution. The branching point of Nitella is a little earlier than that of land plants and much later than that of the above green algae, supporting the view that Nitella-like green algae may be the direct precursor to land plants. The Bryophyta and the Pteridophyta separated from each other after emergence of the Spermatophyta. The result is consistent with the view that the Bryophyta evolved from ferns by degeneration. In the Pteridophyta, Psilotum (whisk fern) separated first, and a little later Lycopodium (club moss) separated from the ancestor common to Equisetum (horsetail) and Dryopteris (fern). This order is in accordance with the classical view. During the Spermatophyta evolution, the gymnosperms (Cycas, Ginkgo, and Metasequoia have been studied here) and the angiosperms (flowering plants) separated, and this was followed by the separation of Metasequoia and Cycas (cycad)/Ginkgo (maidenhair tree) on one branch and various flowering plants on the other.

  11. [Phylogenetic relationships among the genera of Taxodiaceae and Cupressaceae from 28S rDNA sequences].

    Science.gov (United States)

    Li, Chun-Xiang; Yang, Qun

    2003-03-01

    DNA sequences from 28S rDNA were used to assess relationships between and within traditional Taxodiaceae and Cupressaceae s.s. The MP tree and NJ tree generally are similar to one another. The results show that Taxodiaceae and Cupressaceae s.s. form a monophyletic conifer lineage excluding Sciadopitys. In the Taxodiaceae-Cupressaceae s.s. monophyletic group, the Taxodiaceae is paraphyletic. Taxodium, Glyptostrobus and Cryptomeria forming a clade(Taxodioideae), in which Glyptostrobus and Taxodium are closely related and sister to Cryptomeria; Sequoia, Sequoiadendron and Metasequoia are closely related to each other, forming another clade (Sequoioideae), in which Sequoia and Sequoiadendron are closely related and sister to Metasequoia; the seven genera of Cupressaceae s.s. are found to be closely related to form a monophyletic lineage (Cupressoideae). These results are basically similar to analyses from chloroplast gene data. But the relationships among Taiwania, Sequoioideae, Taxodioideae, and Cupressoideae remain unclear because of the slow evolution rate of 28S rDNA, which might best be answered by sequencing more rapidly evolving nuclear genes.

  12. [Simulation of lung lobe resection with personal computer].

    Science.gov (United States)

    Onuki, T; Murasugi, M; Mae, M; Koyama, K; Ikeda, T; Shimizu, T

    2005-09-01

    Various patterns of branching are seen for pulmonary arteries and veins in the lung hilum. However, thoracic surgeons usually cannot expect to discern much anatomical detail preoperatively. If the surgeon can gain an understanding of individual patterns preoperatively, the risks inherent in exposing the pulmonary vessels in the hilum can be avoided, reducing invasiveness. This software will meet the increasing needs of them in video-assisted thoracoscopic surgery (VATS) which prefer lesser dissections of the vessels and bronchus of hilum. We have produced free application software, where we can mark on pulmonary arteries, vein, bronchus and tumor of the successive images of computed tomography (CT). After receiving a compact disk containing 60 images of 2 mm CT slices, from tumor to hilum, in DICOM format, we required only 1 hour to obtain 3-dimensional images for a patient with other free software (Metasequoia LE). Furthermore, with Metasequoia LE, we can simulate cut the vessels and change the figure of them 3-dimensionally. Although the picture image leaves much room for improvement, we believe it is very attractive for residents because they can simulate operations.

  13. Pristine Early Eocene wood buried deeply in kimberlite from northern Canada.

    Science.gov (United States)

    Wolfe, Alexander P; Csank, Adam Z; Reyes, Alberto V; McKellar, Ryan C; Tappert, Ralf; Muehlenbachs, Karlis

    2012-01-01

    We report exceptional preservation of fossil wood buried deeply in a kimberlite pipe that intruded northwestern Canada's Slave Province 53.3±0.6 million years ago (Ma), revealed during excavation of diamond source rock. The wood originated from forest surrounding the eruption zone and collapsed into the diatreme before resettling in volcaniclastic kimberlite to depths >300 m, where it was mummified in a sterile environment. Anatomy of the unpermineralized wood permits conclusive identification to the genus Metasequoia (Cupressaceae). The wood yields genuine cellulose and occluded amber, both of which have been characterized spectroscopically and isotopically. From cellulose δ(18)O and δ(2)H measurements, we infer that Early Eocene paleoclimates in the western Canadian subarctic were 12-17°C warmer and four times wetter than present. Canadian kimberlites offer Lagerstätte-quality preservation of wood from a region with limited alternate sources of paleobotanical information.

  14. Pristine Early Eocene wood buried deeply in kimberlite from northern Canada.

    Directory of Open Access Journals (Sweden)

    Alexander P Wolfe

    Full Text Available We report exceptional preservation of fossil wood buried deeply in a kimberlite pipe that intruded northwestern Canada's Slave Province 53.3±0.6 million years ago (Ma, revealed during excavation of diamond source rock. The wood originated from forest surrounding the eruption zone and collapsed into the diatreme before resettling in volcaniclastic kimberlite to depths >300 m, where it was mummified in a sterile environment. Anatomy of the unpermineralized wood permits conclusive identification to the genus Metasequoia (Cupressaceae. The wood yields genuine cellulose and occluded amber, both of which have been characterized spectroscopically and isotopically. From cellulose δ(18O and δ(2H measurements, we infer that Early Eocene paleoclimates in the western Canadian subarctic were 12-17°C warmer and four times wetter than present. Canadian kimberlites offer Lagerstätte-quality preservation of wood from a region with limited alternate sources of paleobotanical information.

  15. [Virtual reality in video-assisted thoracoscopic lung segmentectomy].

    Science.gov (United States)

    Onuki, Takamasa

    2009-07-01

    The branching patterns of pulmonary arteries and veins vary greatly in the pulmonary hilar region and are very complicated. We attempted to reconstruct anatomically correct images using a freeware program. After uploading the images to a personal computer, bronchi, pulmonary arteries and veins were traced by moving up and down in the images and the location and thickness of the bronchi and pulmonary vasculture were indicated as different-sized cylinders. Next, based on the resulting numerical data, a 3D image was reconstructed using Metasequoia shareware. The reconstructed images can be manipulated by virtual surgical procedures such as reshaping, cutting and moving. These system would be very helpful in complicated video-assisted thoracic surgery such as lung segmentectomy.

  16. A new proposal concerning the botanical origin of Baltic amber.

    Science.gov (United States)

    Wolfe, Alexander P; Tappert, Ralf; Muehlenbachs, Karlis; Boudreau, Marc; McKellar, Ryan C; Basinger, James F; Garrett, Amber

    2009-10-07

    Baltic amber constitutes the largest known deposit of fossil plant resin and the richest repository of fossil insects of any age. Despite a remarkable legacy of archaeological, geochemical and palaeobiological investigation, the botanical origin of this exceptional resource remains controversial. Here, we use taxonomically explicit applications of solid-state Fourier-transform infrared (FTIR) microspectroscopy, coupled with multivariate clustering and palaeobotanical observations, to propose that conifers of the family Sciadopityaceae, closely allied to the sole extant representative, Sciadopitys verticillata, were involved in the genesis of Baltic amber. The fidelity of FTIR-based chemotaxonomic inferences is upheld by modern-fossil comparisons of resins from additional conifer families and genera (Cupressaceae: Metasequoia; Pinaceae: Pinus and Pseudolarix). Our conclusions challenge hypotheses advocating members of either of the families Araucariaceae or Pinaceae as the primary amber-producing trees and correlate favourably with the progressive demise of subtropical forest biomes from northern Europe as palaeotemperatures cooled following the Eocene climate optimum.

  17. Paleoenvironmental implications from biomarker and stable isotope investigations on the Pliocene Velenje lignite seam (Slovenia)

    Energy Technology Data Exchange (ETDEWEB)

    Bechtel, A.; Sachsenhofer, R.F.; Markic, M.; Gratzer, R.; Lucke, A.; Puttmann, W. [Montan University of Leoben, Leoben (Austria)

    2003-07-01

    A Pliocene lignite seam up to 160 m thick occurs in the Velenje basin (Slovenia). The seam originated in a topogenous mire and evolved within a non-marine, transgressive setting. Differences in soluble organic matter yield and hydrocarbon content of borehole samples from the lignite are related to differences in the composition of free lipids of microbial origin and/or hydrocarbons derived from the biogeochemical degradation of plant tissue. Variations of the redox conditions within the mire are reflected by pristane/phytane ratios. The abundance of terpenoid biomarkers indicates the predominance of gymnosperms over angiosperms, which is consistent with palynomorphic spectra dominated by pollen of the Sequoia-Taxodium-Metasequoia plant community rather than by angiosperms. Evidence is also provided that the content of land plant derived biomarkers and the preservation of plant tissue is controlled by the input of resin-rich, decay-resistant conifers.

  18. Divergence of the phytochrome gene family predates angiosperm evolution and suggests that Selaginella and Equisetum arose prior to Psilotum.

    Science.gov (United States)

    Kolukisaoglu, H U; Marx, S; Wiegmann, C; Hanelt, S; Schneider-Poetsch, H A

    1995-09-01

    Thirty-two partial phytochrome sequences from algae, mosses, ferns, gymnosperms, and angiosperms (11 of them newly released ones from our laboratory) were analyzed by distance and character-state approaches (PHYLIP, TREECON, PAUP). In addition, 12 full-length sequences were analyzed. Despite low bootstrap values at individual internal nodes, the inferred trees (neighbor-joining, Fitch, maximum parsimony) generally showed similar branching orders consistent with other molecular data. Lower plants formed two distinct groups. One basal group consisted of Selaginella, Equisetum, and mosses; the other consisted of a monophyletic cluster of frond-bearing pteridophytes. Psilotum was a member of the latter group and hence perhaps was not, as sometimes suggested, a close relative of the first vascular plants. The results further suggest that phytochrome gene duplication giving rise to a- and b- and later to c-types may have taken place within seedfern genomes. Distance matrices dated the separation of mono- and dicotyledons back to about 260 million years before the present (Myr B.P.) and the separation of Metasequoia and Picea to a fossil record-compatible value of 230 Myr B.P. The Ephedra sequence clustered with the c- or a-type and Metasequoia and Picea sequences clustered with the b-type lineage. The "paleoherb" Nymphaea branched off from the c-type lineage prior to the divergence of mono- and dicotyledons on the a- and b-type branches. Sequences of Piper (another "paleoherb") created problems in that they branched off from different phytochrome lineages at nodes contradicting distance from the inferred trees' origin.

  19. [Influence of compendium of Materia Medica on the materia medica in the late period of the Chosun Dynasty].

    Science.gov (United States)

    Oh, Chae-Kun

    2012-08-31

    In this paper, I investigated the influence of Compendium of Materia Medica (CM) on Records for Rural Life of Chosun Gentlemen (RRC), and refuted Miki Sakae's opinion, CM did not have much impact on the Materia Medica in the late period of the Chosun Dynasty. When Li Shizhen published CM, it resulted in a shift of mainstream of Materia Medica in Eastern Asia from Classified Emergency Materia Medica to CM and a new categorizing system of Materia Medica by CM led to the division of Materia Medica into medicine and natural history. It is obvious that doctors of the Chosun Dynasty also adopted the latest achievements of Materia Medica by CM, but so far there have been few studies to clarify this. Seo yugu was a scholar of the Realist School of Confucianism during the late period of the Chosun Dynasty, and RRC is his representative work. RRC is a massive encyclopedia of natural history that covers vast areas of science from agriculture, floriculture, writing and drawing, architecture, diet, and medicine, among others which absorbed the achievements of CM, the best Materia Medica book at that time. Miki Sakae also highly regarded the encyclopedic knowledge of RRC, but devalued the results of Materia Medica. He only described a part of RRC's Materia Medica, nurturing volume, on the view of life nurturing and mentioned that it had been strongly influenced by China. According to this study, a large portion of RRC, especially regarding Materia Medica, depends on CM. Seo yugu had accepted the categorizing system and new medicinal information of CM, at the same time he modified the categorizing system of CM practically by the subject of each volume of RRC. We can find many quotations of CM except the nurturing volume, but other books, Treasured Mirror of Eastern Medicine, Materia Medica for Relief of Famines are also quoted. Furthermore, Seo yugu emphasized the differences of natural environments between Chosun and China, and specified the editing criteria, "to be useful in

  20. COPD is frequent in conditions of comorbidity in patients treated with various diseases in a university hospital

    Directory of Open Access Journals (Sweden)

    Akira Yamasaki

    2010-09-01

    Full Text Available Akira Yamasaki, Kiyoshi Hashimoto, Yasuyuki Hasegawa, Ryota Okazaki, Miki Yamamura, Tomoya Harada, Shizuka Ito, Soichiro Ishikawa, Hiroki Takami, Masanari Watanabe, Tadashi Igishi, Yuji Kawasaki, Eiji ShimizuDivision of Medical Oncology and Molecular Respirology, Department of Multidisciplinary Internal Medicine, Faculty of Medicine, Tottori University, JapanBackground: Chronic obstructive pulmonary disease (COPD is one of the leading causes of death and loss of disability-adjusted life-years. However, many COPD patients are not diagnosed because of underrecognition or underdiagnosis of this disease among many patients and physicians. One possible reason is underrecognition of spirometry. In this study, we examined the prevalence of airflow limitation and underlying disease in patients with airflow limitation.Methodology: From April 2006 to March 2008, patients who had spirometry performed were examined. The original disease of patients, pulmonary function tests, smoking status, and respiratory symptoms were surveyed from their medical records.Results: Of all patients who had spirometry performed, 15.8% showed airflow limitation (FEV1/FVC < 0.7. A variety of diseases were observed in patients with airflow limitation. Among all diseases, cardiovascular disease was the highest and gastrointestinal malignant disease had the second highest prevalence in patients with airflow limitation.Conclusion: COPD might be frequent in conditions of comorbidity in patients treated for various diseases. Attention should be paid to the possibility of co-existence of COPD and the influence of COPD on these patients.Keywords: airflow limitation, chronic obstructive pulmonary disease, comorbidity, spirometry, prevalence

  1. EFFECTS OF OUTSCHOOL BODY ACTIVITIES ON QUALITATIVE CHANGES OF MOTORICAL STATUS PUPILS OF PRIMARY SCHOOL STRATURE

    Directory of Open Access Journals (Sweden)

    Izudin Tanović

    2011-09-01

    Full Text Available Population of pupil high classes primary school present one of cariks in chain of complex education and systematic social influence in body and health education, which are used a new generations (Mikić,1991. Including that we have a very sensibility population in way of strature and development in phase of adolescental period, it is necessary that throw the classes body education and extra outschool activities, give enough quantity of motorical activities, which will completly satisfied necessy of children this strature and also completly give them normal biopsychosocial growth. Explorations of effects extra outschool activities in frame of school sport sections pupils of primary school tell us that with a correct planning and programming work, which understand correctly choice adequate methods and operators of work could been very significant transformations of anthropological status of pupils (Malacko 2002. The basic target of this explorations was that confirm influence of outschool body activities on level qualitative changes of structure motorical space of pupils primary school strature, under influence applying programme of outschool activities. With help of factory analise, but also of method of congruation, it was explored structure of motorical space in the start but also at the end of this applying experimental programme of outschool body activities , and we concluded that changes which was appear in structure of explored motorical space, tell us on positive influence outschool body activities in sense transformation and progressing of motorical status of explorated sample.

  2. On factorization of generalized Macdonald polynomials

    Energy Technology Data Exchange (ETDEWEB)

    Kononov, Ya. [Landau Institute for Theoretical Physics, Chernogolovka (Russian Federation); HSE, Math Department, Moscow (Russian Federation); Morozov, A. [ITEP, Moscow (Russian Federation); Institute for Information Transmission Problems, Moscow (Russian Federation); National Research Nuclear University MEPhI, Moscow (Russian Federation)

    2016-08-15

    A remarkable feature of Schur functions - the common eigenfunctions of cut-and-join operators from W{sub ∞} - is that they factorize at the peculiar two-parametric topological locus in the space of time variables, which is known as the hook formula for quantum dimensions of representations of U{sub q}(SL{sub N}) and which plays a big role in various applications. This factorization survives at the level of Macdonald polynomials. We look for its further generalization to generalized Macdonald polynomials (GMPs), associated in the same way with the toroidal Ding-Iohara-Miki algebras, which play the central role in modern studies in Seiberg-Witten-Nekrasov theory. In the simplest case of the first-coproduct eigenfunctions, where GMP depend on just two sets of time variables, we discover a weak factorization - on a one- (rather than four-) parametric slice of the topological locus, which is already a very non-trivial property, calling for proof and better understanding. (orig.)

  3. On factorization of generalized Macdonald polynomials

    Science.gov (United States)

    Kononov, Ya.; Morozov, A.

    2016-08-01

    A remarkable feature of Schur functions—the common eigenfunctions of cut-and-join operators from W_∞ —is that they factorize at the peculiar two-parametric topological locus in the space of time variables, which is known as the hook formula for quantum dimensions of representations of U_q(SL_N) and which plays a big role in various applications. This factorization survives at the level of Macdonald polynomials. We look for its further generalization to generalized Macdonald polynomials (GMPs), associated in the same way with the toroidal Ding-Iohara-Miki algebras, which play the central role in modern studies in Seiberg-Witten-Nekrasov theory. In the simplest case of the first-coproduct eigenfunctions, where GMP depend on just two sets of time variables, we discover a weak factorization—on a one- (rather than four-) parametric slice of the topological locus, which is already a very non-trivial property, calling for proof and better understanding.

  4. Proactive vs. reactive learning on buildings response and earthquake risks, in schools of Romania

    Directory of Open Access Journals (Sweden)

    Daniela DOBRE

    2015-07-01

    Full Text Available During the last 20 years, many specific activities of earthquake education and preparedness were initiated and supported in Romania by drafting materials for citizens, students, professors etc. (Georgescu et al., 2004, 2006. The education, training and information on earthquake disaster potential are important factors to mitigate the earthquake effects. Such activities, however, need time to be developed and may take different forms of presentation in order to capture the attention, to increase interest, to develop skills and attitudes in order to induce a proper behavior towards safety preparedness. It shall also be based on the accumulation of concerns and knowledge, which are, in principle, a consequence of the motivation, but which depend on the methods applied and actions taken for efficient earthquake preparedness, assessed and updated following actual earthquakes (Masuda, Midorikawa, Miki and Ohmachi, 1988. We are now at a crossroad and the proactive attitude and behavior (anticipative and participative needs to be extended in learning, within institutional framework, but correlated with the usual targets of schools and teenagers proactive issue (ROEDUSEIS-NET; Page and Page, 2003, by encouraging students in activities closer to earthquake engineering.

  5. Real-Time Classification of Seagrass Meadows on Flat Bottom with Bathymetric Data Measured by a Narrow Multibeam Sonar System

    Directory of Open Access Journals (Sweden)

    Masahiro Hamana

    2016-01-01

    Full Text Available Seagrass meadows, one of the most important habitats for many marine species, provide essential ecological services. Thus, society must conserve seagrass beds as part of their sustainable development efforts. Conserving these ecosystems requires information on seagrass distribution and relative abundance, and an efficient, accurate monitoring system. Although narrow multibeam sonar systems (NMBSs are highly effective in resolving seagrass beds, post-processing methods are required to extract key data. The purpose of this study was to develop a simple method capable of detecting seagrass meadows and estimating their relative abundance in real time using an NMBS. Because most seagrass meadows grow on sandy seafloors, we proposed a way of discriminating seagrass meadows from the sand bed. We classify meadows into three categories of relative seagrass abundance using the 95% confidence level of beam depths and the depth range of the beam depth. These are respectively two times the standard deviation of beam depths, and the difference between the shallowest and the deepest depths in a 0.5 × 0.5 m grid cell sampled with several narrow beams. We examined Zostera caulescens Miki, but this simple NMBS method of seagrass classification can potentially be used to map seagrass meadows with longer shoots of other species, such as Posidonia, as both have gas filled cavities.

  6. How Vulnerable is Perennial Sea Ice? Insights from Earth's Late Cenozoic Natural Experiments (Invited)

    Science.gov (United States)

    Brigham-Grette, J.; Polyak, L. V.; Caissie, B.; Sharko, C. J.; Petsch, S.

    2010-12-01

    Sea ice is an important component of the climate system. Yet, reconstructions of Arctic sea ice conditions reflecting glacial and interglacial change over the past 3 million years are almost nonexistent. Our work to evaluate the sea ice and sea surface temperature record of the Bering Strait region builds on a review of the sea ice history of the pan-Arctic. The best estimates of sea ice make use of indirect proxies based on reconstructions of treeline, sea surface temperatures, depositional systems, and the ecological preferences of extant marine microfossil species. The development of new proxies of past sea ice extent including microfossil assemblages (diatoms, ostracodes) and biomarker proxies (IP25) show promise for quantifying seasonal concentrations of sea ice cover on centennial to millennial timescales. Using both marine and terrestrial information, periods of restricted sea ice and ice-free Arctic conditions can be inferred for parts of the late Cenozoic. The Arctic Ocean borderlands contain clear stratigraphic evidence for forested conditions at intervals over the past 50 million years, recording the migration of treeline from High Arctic coastal locations within the Canadian Archipelago. Metasequoia forests of the peak Eocene gave way to a variety of biomass-rich circumarctic redwood forests by 46 Ma. Between 23 and 16 Ma, cool-temperate metasequoia forests dominated NE Alaska and the Yukon while mixed conifer-hardwood forests (similar to those of modern southern maritime Canada and New England) dominated the central Canadian Archipelago. By 16 Ma, these forests gave way to larch and spruce. From 5 to 3 Ma the braid plains of the Beaufort Fm were dominated by over 100 vascular plants including pine and birch, while other locations remained dominated by spruce and larch. Boreal conditions across northern Greenland and arctic Alaska are consistent with the presence of bivalve Arctica islandica in marine sediments capping the Beaufort Formation on Meighen

  7. Oxygen and Hydrogen Stable Isotope Composition of Eocene ( ~45 million year old) Fossil Tree Cellulose

    Science.gov (United States)

    Jahren, H.

    2001-05-01

    I report on \\delta18O and \\deltaD values gained from unusually old tree fossils, collected on Axel Heiberg Island of the Canadian High Arctic. A variety of workers have measured the δ ^{18}O value of cellulose and the δ D value of cellulose nitrate isolated from modern trees and compared it to various environmental parameters (esp. Epstein et al., 1977: 14 tree species sampled at 16 sites ranging from 18 \\deg to 62 \\deg North latitude; \\delta18O of cellulose ranged from +20 to +33 \\permil; \\deltaD of cellulose nitrate ranged from -181 to +18). To date the paleoenvironmental interpretations resulting from these studies have been restricted to application in recent and Quaternary earth history due to the lack of sufficiently preserved cellulose and tree ring structure in older tree fossils. An exception to this generalization are the middle Eocene (\\sim45 my old) fossil forests of Axel Heiberg Island, which contain abundant stumps, branches, twigs, cones and leaves of Metasequoia trees in exquisite preservational condition. These deciduous trees grew at a paleolatitude of 80 ° North, and endured prolonged periods of continuous daylight in the summer and continuous darkness in the winter, making the ecosystem completely unlike any forest community existing today. Fossil wood samples from the site have been slightly compressed, but otherwise exhibit minimal alteration: %C and % cellulose (by mass) are similar to modern Metasequoia wood. δ ^{18}O analyses on cellulose isolated from 14 fossil individuals has yielded the following results: range = +17 to +20 ‰ ; mean = +19 ‰ ; variability within an individual = 0.5 to 1.0 ‰ . In presentation, I will complement these results with δ D determinations on cellulose nitrate isolated from the same individuals, as well as from small plants presently growing in the arctic. I will also discuss the surprising result that Axel Heiberg fossil trees appear to have stable isotope composition as low or lower than trees

  8. [Editing style of Imwon-Gyeongjeji, Inje-ji and inclusion of the medicinal knowledge of the late period of Joseon - Comparing mainly with Dongui-Bogam -].

    Science.gov (United States)

    Jeon, Jongwook; Jo, Changrock

    2012-12-01

    Imwon-Gyeongjeji which was created by Seo Yu-gu in the first half of the 19th century is a encyclopedia of practical use in rural life. It consists of 113 volumes, 16 fields, and 2.52 million total characters. Of these, the field of medicine comes 11th of the contents covering 28 volumes and 1.1 million characters. Its name is Inje-ji. This paper examines the academic background of Seo Yu-gu and his life work briefly, and investigates the characteristics of medical knowledge of late Joseon period contained in the Imwon-Gyeongjeji, Inje-ji Here, we made key comparisons especially with Dongui-Bogam, Joseon's leading medical book. Of the pioneers of medical history studies of Joseon, a Japanese researcher Miki Sakae has made a negative evaluation to Inje-ji. But after concrete investigation we have come to conclude as follows. First, familial ancestors of Seo Yu-gu were engaged in the introduction of foreign-language books, so Seo Yu-gu as an officer of proof-reading and editing of the various books, also had a lot of knowledge on the medical books ever in history. On this background and experience, for over 36 years from 1,806 retirement from official position to his death, he had compiled and edited Imwon-Gyeongjeji. Second, unlike Dongui-Bogam which included improving health skill, Inje-ji focused on curing medicine readily accessible from the major population of that time. Its main features are as follows: i) prescriptions directly linked to the diseases and symptoms, ii) greatly increased medicinal knowledge especially on infectious diseases and trauma, iii) detailed index easy to look up for prescription and iv) his 'own opinions'[an-seol] which can indicate relevant contents within the book and organically combines the whole knowledge in it. Third, "Inje-ji" utilizing medical books in China and Korea even those of Japan, collected more massively almost all the medical knowledge, new illness, herbs of local area, private prescription. Meanwhile Inje-ji modified

  9. Intestinal absorption, organ distribution, and urinary excretion of the rare sugar D-psicose

    Directory of Open Access Journals (Sweden)

    Tsukamoto I

    2014-10-01

    Full Text Available Ikuko Tsukamoto,1,* Akram Hossain,2,3,* Fuminori Yamaguchi,2 Yuko Hirata,2 Youyi Dong,2 Kazuyo Kamitori,2 Li Sui,2 Machiko Nonaka,2 Masaki Ueno,4 Kazuyuki Nishimoto,5 Hirofumi Suda,5 Kenji Morimoto,6 Tsuyoshi Shimonishi,7,† Madoka Saito,8 Tao Song,9 Ryoji Konishi,1 Masaaki Tokuda2 1Department of Pharmaco-Bio-Informatics, Faculty of Medicine, Kagawa University, Miki, Kagawa, Japan; 2Department of Cell Physiology, Faculty of Medicine, Kagawa University, Kagawa, Japan; 3Matsutani Chemical Industry Co, Ltd, Itami, Japan; 4Department of Inflammation Pathology, Faculty of Medicine, Kagawa University, Kagawa, Japan; 5Division of Radioisotope Research, Life Science Research Center, Kagawa University, Kagawa, Japan; 6Rare Sugar Research Center, Kagawa University, Kagawa, Japan; 7IZUMORING LLC, Miki, Kita, Kagawa, Japan; 8Department of Pharmacy, Okayama University Hospital, Okayama, Japan; 9The First Affiliated Hospital, China Medical University, Shenyang, People’s Republic of China *These authors contributed equally to this work†Tsuyoshi Shimonishi has passed away Background: The purpose of this study was to evaluate intestinal absorption, organ distribution, and urinary elimination of the rare sugar D-psicose, a 3-carbon stereoisomer of D-fructose that is currently being investigated and which has been found to be strongly effective against hyperglycemia and hyperlipidemia. Methods: This study was performed using radioactive D-psicose, which was synthesized enzymatically from radioactive D-allose. Concentrations in whole blood, urine, and organs were measured at different time points until 2 hours after both oral and intravenous administrations and 7 days after a single oral administration (100 mg/kg body weight to Wistar rats. Autoradiography was also performed by injecting 100 mg/kg body weight of 14C-labeled D-psicose or glucose intravenously to C3H mice. Results: Following oral administration, D-psicose easily moved to blood. The maximum blood

  10. Use of Preservative Agents and Antibiotics for Increased Poliovirus Survival on Positively Charged Filters.

    Science.gov (United States)

    Fagnant, Christine Susan; Kossik, Alexandra Lynn; Zhou, Nicolette Angela; Sánchez-Gonzalez, Liliana; Falman, Jill Christin; Keim, Erika Karen; Linden, Yarrow; Scheibe, Alana; Barnes, Kilala Sayisha; Beck, Nicola Koren; Boyle, David S; Meschke, John Scott

    2017-12-01

    Environmental surveillance of poliovirus (PV) and other non-enveloped viruses can help identify silent circulation and is necessary to certify eradication. The bag-mediated filtration system is an efficient method to filter large volumes of environmental waters at field sites for monitoring the presence of viruses. As filters may require long transit times to off-site laboratories for processing, viral inactivation or overgrowth of bacteria and fungi can interfere with virus detection and quantification (Miki and Jacquet in Aquatic Microb Ecol 51(2):195-208, 2008). To evaluate virus survival over time on ViroCap ™ filters, the filters were seeded with PV type 1 (PV1) and/or MS2 and then dosed with preservatives or antibiotics prior to storage and elution. These filters were stored at various temperatures and time periods, and then eluted for PV1 and MS2 recovery quantification. Filters dosed with the preservative combination of 2% sodium benzoate and 0.2% calcium propionate had increased virus survival over time when stored at 25 °C, compared to samples stored at 25 °C with no preservatives. While elution within 24 h of filtration is recommended, if storage or shipping is required then this preservative mixture can help preserve sample integrity. Addition of an antibiotic cocktail containing cephapirin, gentamicin, and Proclin ™ 300 increased recovery after storage at 4 and 25 °C, when compared to storage with no antibiotics. The antibiotic cocktail can aid sample preservation if access to appropriate antibiotics storage is available and sample cold chain is unreliable. This study demonstrated that the use of preservatives or antibiotics is a simple, cost-effective method to improve virus detection from ViroCap cartridge filters over time.

  11. A case involving an Ahmed™ glaucoma valve transferred from the vitreous into the anterior chamber of the eye with a silicone oil tamponade for the treatment of neovascular glaucoma

    Directory of Open Access Journals (Sweden)

    Miki M

    2013-02-01

    Full Text Available Michiko Miki, Mari Ueki, Tetsuya Sugiyama, Shota Kojima, Tsunehiko IkedaDepartment of Ophthalmology, Osaka Medical College, Takatsuki, JapanPurpose: To report the short-term efficacy and safety of the transfer of an Ahmed™ glaucoma valve (AGV™ tube from the vitreous into the anterior chamber, in a patient with neovascular glaucoma who had undergone pars plana AGV™ implantation and ultimately needed a silicone oil tamponade.Case: A 41-year-old male with proliferative diabetic retinopathy in both eyes was referred to us for treatment in December 2009. Although the patient previously underwent several surgeries, he ultimately lost vision in his right eye. His left eye suffered from neovascular glaucoma after undergoing a pars plana vitrectomy for tractional retinal detachment. After several vitreous and glaucoma surgeries, the patient underwent implantation of a pars plana AGV™. Postoperatively, although his intraocular pressure was stabilized at approximately 10 mmHg, he had repeated vitreous hemorrhage and hyphema without improvement. He ultimately underwent PPV with a silicone oil tamponade and at the same time, the AGV™ tube was pulled out from the vitreous and inserted into the anterior chamber in order to avoid complications caused by the silicone oil.Results: At 19 months postoperative, the patient’s intraocular pressure had stabilized at 10 mmHg with no recurrence of vitreous hemorrhage and hyphema. Eventually, he lost vision in his left eye because of cerebral hemorrhage.Conclusion: The findings show that insertion of a pars plana AGV™ tube into the anterior chamber in a patient undergoing a silicone oil tamponade is both effective and safe in the short-term.Keyword: tube implantation, glaucoma surgery, tube transfer, pars plana, proliferative diabetic retinopathy, intraocular pressure

  12. Joint unloading implant modifies subchondral bone trabecular structure in medial knee osteoarthritis: 2-year outcomes of a pilot study using fractal signature analysis

    Directory of Open Access Journals (Sweden)

    Miller LE

    2015-01-01

    Full Text Available Larry E Miller,1,2 Miki Sode,3 Thomas Fuerst,3 Jon E Block2 1Miller Scientific Consulting, Inc., Asheville, NC, USA; 2The Jon Block Group, San Francisco, CA, USA; 3Bioclinica, Newark, CA, USA Background: Knee osteoarthritis (OA is largely attributable to chronic excessive and aberrant joint loading. The purpose of this pilot study was to quantify radiographic changes in subchondral bone after treatment with a minimally invasive joint unloading implant (KineSpring® Knee Implant System.Methods: Nine patients with unilateral medial knee OA resistant to nonsurgical therapy were treated with the KineSpring System and followed for 2 years. Main outcomes included Western Ontario and McMaster Universities Osteoarthritis Index (WOMAC pain, function, and stiffness subscores and independent core laboratory determinations of joint space width and fractal signature of the tibial cortex.Results: WOMAC scores, on average, improved by 92% for pain, 91% for function, and 79% for stiffness over the 2-year follow-up period. Joint space width in the medial compartment of the treated knee significantly increased from 0.9 mm at baseline to 3.1 mm at 2 years; joint space width in the medial compartment of the untreated knee was unchanged. Fractal signatures of the vertically oriented trabeculae in the medial compartment decreased by 2.8% in the treated knee and increased by 2.1% in the untreated knee over 2 years. No statistically significant fractal signature changes were observed in the horizontally oriented trabeculae in the medial compartment or in the horizontal or vertical trabeculae of the lateral compartment in the treated knee.Conclusion: Preliminary evidence suggests that the KineSpring System may modify knee OA disease progression by increasing joint space width and improving subchondral bone trabecular integrity, thereby reducing pain and improving joint function. Keywords: disease modification, KineSpring, joint space, pain, trabecular

  13. Experimental and theoretical studies of d-dot

    International Nuclear Information System (INIS)

    Ishida, Takekazu; Fujii, Masaki; Abe, Taiji; Yamamoto, Masuo; Miki, Shigehito; Kawamata, Shuichi; Satoh, Kazuo; Yotsuya, Tsutomu; Kato, Masaru; Machida, Masahiko; Koyama, Tomio; Terashima, Takahito; Tsukui, Shigeki; Adachi, Motoaki

    2006-01-01

    We propose the idea of d-dot, where a d-wave superconducting dot is embedded in s-wave matrix. Spontaneous half vortices should appear in the four corners of the d-dot [M. Kato, M. Ako, M. Machida, T. Koyama, T. Ishida, Physica C 412-414 (2004) 352; M. Ako, M. Kato, M. Machida, T. Koyama, T. Ishida, Physica C 412-414 (2004) 544; M. Fujii, T. Abe, H. Yoshikawa, S. Miki, S. Kawamata, K. Satoh, T. Yotsuya, M. Kato, M. Machida, T. Koyama, T. Terashima, S. Tsukui, M. Adachi, T. Ishida, Physica C 426-431 (2005) 104]. Symmetric geometry and the fourfold symmetry of the d-dot would be suitable as a building block for constructing the novel physical systems. The phase dynamics of a closed 0-π junction, which can be realized in a small d x 2 -y 2 -dot, is mapped on a quantum two-level system when the system size is small enough. Using two-component Ginzburg-Landau equation, we study the physical properties of d-dots systematically. We prepare epitaxial YBa 2 Cu 3 O 7 (YBCO) films of thickness 100nm on SrTiO 3 substrates using a laser ablation apparatus. The d-dot is fabricated by a photolithography, electron beam lithography EB and an electron cyclotron resonance (ECR) etching, a focused ion beam microscope, and a lift-off technique. Local vortex profile is investigated using a SQUID microscope when d-dot is cooled in zero field

  14. Estimation for origin of coals on biomaker analysis; Jinko sekitan oyobi tennen sekitan no biomaker bunseki ni yoru sekitan kigen busshitsu no suitei

    Energy Technology Data Exchange (ETDEWEB)

    Suzuki, Y. [Geological Survey of Japan, Tsukuba (Japan); Sugimoto, Y. [National Institute of Materials and Chemical Research, Tsukuba (Japan); Okada, K. [Coal Mining Research Center, Tokyo (Japan)

    1996-10-28

    In order to study coal production processes, an estimation study was carried out on coal originating materials by using biomaker analysis. Test samples are original coals collected directly from a mine in Hokkaido (not having been subjected cleaning). Mixing and solvent extraction were performed after pulverization, and then tests were given on saturated hydrocarbon components divided by using a silicagel column chromatograph for the present study. It can be known from n-alkane distribution in the coal that low molecular alkane increases with increasing degree of coalification. Artificial coal made by wet-heating Metasequoia leaves contains only little n-alkane. Diterpenoid compound exists in the Taiheiyo and Akabira coals. Tetra-cyclic diterpernoid is contained abundantly in subtropical coniferous trees, serving as a parameter for warm environment. The compound is contained also in the Fushun coal, but not in Indonesian coals. Hopanoid constitution shows very high similarity, but H/C atomic ratio may vary largely even if the coalification is at the same degree. This is likely to be caused from difference in originating materials. Hopanoids are bacteria attributed substances, whose activities are not affected by the originating materials. 2 figs., 1 tab.

  15. Stable carbon isotope ratios and intrinsic water-use efficiency of Miocene fossil leaves compared to modern congeners

    Energy Technology Data Exchange (ETDEWEB)

    Marshall, J.D.; Zhang, J.; Rember, W.C.; Jennings, D.; Larson, P. (Univ. of Idaho, Moscow, ID (United States))

    1994-06-01

    Miocene fossil leaves of forest trees were extracted from the Clarkia, Idaho fossil beds and their stable carbon isotope ratios were analyzed. Fossils had higher lignin concentrations and lower cellulose concentrations that modern leaves due to diagenesis and the HF used to extract the fossils. Therefore, [delta][sup 13]C of extracted fossil lignin was compared to that of modern lignin. Fossil lignin [delta][sup 13]C was significantly different from that of congeneric modern leaves (paired t-test, P<0.0001), but was 1.9% less negative. Gymnosperms (Metasequoia, Taxodium) were less negative than angiosperms (e.g., Magnolia, Quercus, Acer, Persea), but no difference between evergreen and deciduous species was detected. Using published estimates of the concentration and [delta][sup 13]C of atmospheric CO[sub 2] during the Miocene was estimated the CO[sub 2] partial pressure gradient across the stomata (intrinsic water-use efficiency). Intrinsic water-use efficiency was at least 70% higher during this past [open quotes]greenhouse[close quotes] period than at present.

  16. Phylogenetic relationships in Taxodiaceae and Cupressaceae sensu stricto based on matK gene, chlL gene, trnL-trnF IGS region, and trnL intron sequences.

    Science.gov (United States)

    Kusumi, J; Tsumura, Y; Yoshimaru, H; Tachida, H

    2000-10-01

    Nucleotide sequences from four chloroplast genes, the matK, chlL, intergenic spacer (IGS) region between trnL and trnF, and an intron of trnL, were determined from all species of Taxodiaceae and five species of Cupressaceae sensu stricto (s.s.). Phylogenetic trees were constructed using the maximum parsimony and the neighbor-joining methods with Cunninghamia as an outgroup. These analyses provided greater resolution of relationships among genera and higher bootstrap supports for clades compared to previous analyses. Results indicate that Taiwania diverged first, and then Athrotaxis diverged from the remaining genera. Metasequoia, Sequoia, and Sequoiadendron form a clade. Taxodium and Glyptostrobus form a clade, which is the sister to Cryptomeria. Cupressaceae s.s. are derived from within Taxodiaceae, being the most closely related to the Cryptomeria/Taxodium/Glyptostrobus clade. These relationships are consistent with previous morphological groupings and the analyses of molecular data. In addition, we found acceleration of evolutionary rates in Cupressaceae s.s. Possible causes for the acceleration are discussed.

  17. Beaufort Formation, eastern Axel Heiberg Island, Canadian Arctic Archipelago

    Energy Technology Data Exchange (ETDEWEB)

    Bustin, R.M.

    1982-07-01

    On eastern Axel Heiberg Island erosional outliers of the Miocene-early Pliocene Beaufort Formation overlie with angular unconformity, or are faulted against, Mesozoic and early Tertiary strata East of Princess Margaret Arch the Beaufort Formation is divisible into three lithofacies: a conglomerate lithofacies interpreted as alluvial-plain deposits, a sandstone conglomerate lithofacies interpreted as distal alluvial-fan deposits and a sandstone-mudstone-siltstone lithofacies interpreted as alluvial-plain deposits. The floodplain was vegetated by a coniferous forest which was characterized by Picea banksii, Larix, Metasequoia and Alnus. Paleocurrent analysis, facies relationships and petrology of the conglomerates and sandstones indicate the provenance of the Beaufort Formation wa Mesozoic strata to the west. Deposition of the Beaufort Formation on eastern Axel Heiberg Island clearly postdates folding of mid-Eocene and older strata and thus provides a minimum age for orogenesis in this part of the Arctic. The occurrence of faulted massiv conglomerates of the Beaufort Formation provides evidence for Miocene-early Pliocene or earlier uplift of ancestral Princess Margaret Arch and a still-later phase of extension.

  18. Physicochemical and biochemical characterization of non-biodegradable cellulose in Miocene gymnosperm wood from the Entre-Sambre-et-Meuse, Southern Belgium

    Energy Technology Data Exchange (ETDEWEB)

    Lechien, Valerie; Rodriguez, Christian; Ongena, Marc; Hiligsmann, Serge; Thonart, Philippe [Liege Univ., Walloon Center of Industrial Biology, Gembloux (Belgium); Rulmont, Andre [Liege Univ., Chemistry Dept., Liege (Belgium)

    2006-11-15

    Specimens of Miocene fossil wood from the Entre-Sambre-et-Meuse karsts (southern Belgium) were examined using physicochemical and biochemical techniques in order to understand the reasons for the exceptional preservation of these fossilized remains after 15 million years. Structural and chemical changes were assessed by comparing the structural features of the fossil samples with those of their modern counterpart, Metasequoia. Solid state {sup 13} C nuclear magnetic resonance (NMR) and microscopic analysis showed good preservation of the cellulose structure in the fossil wood from the Florennes peat deposit. Despite the substantial cellulose fraction available in the fossil tissue, an enzymatic degradation test and a biochemical methane potential assay showed that the fossil cellulose could not be degraded by cellulases and anaerobic microorganisms usually involved in the biodegradation of organic matter. Moreover, the cellulose structure (crystallinity and surface area) seemed to have no effect on cellulose biodegradability in these Miocene fossil wood samples. On the basis of our observations, we suggest that the presence of a modified lignin structure could greatly influence cellulose preservation/biodegradability. (Author)

  19. Co-hydrothermal treatment of fallen leaves with iron sludge to prepare magnetic iron product and solid fuel.

    Science.gov (United States)

    Gu, Lin; Li, Binglian; Wen, Haifeng; Zhang, Xin; Wang, Liang; Ye, Jianfeng

    2018-06-01

    The hydrothermal carbonization (HTC) was performed on Metasequoia Leaves (ML) in the presence of iron sludge, both of which were generated as solid residuals. The relations between sludge, char's properties and operating conditions were systemically investigated. Iron sludge primarily catalyzed the efficient formation of char with higher heating value (HHV) becoming 1.15-1.65 times of ML (18.21 MJ/kg) and was meanwhile reduced to magnetite. The hydrated Fe ions in octahedron crystals acted as nucleophiles facilitating the dehydration and decarboxylation reactions. The increased HHV is found strong temperature dependent while prolonging the residence time is more preferable for low organic acids generation. Thermogravimetric analysis confirmed the iron sludge enhanced conversion of volatile to fixed carbon. The as-prepared solid char showed better stability after catalytic HTC treatment, having ignition temperature increased from 253 to 426 °C as compared to the char prepared without iron sludge addition. Copyright © 2018 Elsevier Ltd. All rights reserved.

  20. Multi-proxy Paleoclimate and CO2 Reconstruction from the Latest Middle Eocene Sedimentary Fill of a Subarctic Kimberlitic Maar Crater

    Science.gov (United States)

    Reyes, A. V.; Wolfe, A. P.; Royer, D. L.; Greenwood, D. R.; Tierney, J. E.; Doria, G.; Gagen, M. H.; Siver, P.; Westgate, J.

    2016-12-01

    Eocene paleoclimate reconstructions are rarely accompanied by parallel estimates of CO2, complicating assessment of the equilibrium climate responses to CO2. We reconstruct temperature, precipitation, and CO2 from latest middle Eocene ( 38 Myrs ago) peats in subarctic Canada, preserved in sediments that record infilling of a kimberlite pipe maar crater. Mutual climatic range analyses of pollen, together with oxygen isotope analyses of a-cellulose from unpermineralized wood and inferenecs from branched glycerol diakyl glycerol tetraethers (GDGTs), reveal a high-latitude humid-temperate forest ecosystem with mean annual temperatures (MATs) >17 °C warmer than present, mean coldest month temperatures above 0 °C, and mean annual precipitation 4x present. Metasequoia stomatal indices and gas-exchange modeling produce median CO2 concentrations of 634 and 432 ppm, respectively, with a consensus median estimate of 494 ppm. Reconstructed MATs are >6 °C warmer than those produced by Eocene climate models forced at 560 ppm CO2, underscoring the capacity for exceptional polar amplification of warming and hydrological intensification under relatively modest CO2 concentrations, once both fast and slow feedbacks become expressed.

  1. Activity, polypeptide and gene identification of thylakoid Ndh complex in trees: potential physiological relevance of fluorescence assays.

    Science.gov (United States)

    Serrot, Patricia H; Sabater, Bartolomé; Martín, Mercedes

    2012-09-01

    Three evergreen (Laurus nobilis, Viburnum tinus and Thuja plicata) and two autumnal abscission deciduous trees (Cydonia oblonga and Prunus domestica) have been investigated for the presence (zymogram and immunodetection) and functionality (post-illumination chlorophyll fluorescence) of the thylakoid Ndh complex. The presence of encoding ndh genes has also been investigated in T. plicata. Western assays allowed tentative identification of zymogram NADH dehydrogenase bands corresponding to the Ndh complex after native electrophoresis of solubilized fractions from L. nobilis, V. tinus, C. oblonga and P. domestica leaves, but not in those of T. plicata. However, Ndh subunits were detected after SDS-PAGE of thylakoid solubilized proteins of T. plicata. The leaves of the five plants showed the post-illumination chlorophyll fluorescence increase dependent on the presence of active Ndh complex. The fluorescence increase was higher in autumn in deciduous, but not in evergreen trees, which suggests that the thylakoid Ndh complex could be involved in autumnal leaf senescence. Two ndhB genes were sequenced from T. plicata that differ at the 350 bp 3' end sequence. Comparison with the mRNA revealed that ndhB genes have a 707-bp type II intron between exons 1 (723 bp) and 2 (729 bp) and that the UCA 259th codon is edited to UUA in mRNA. Phylogenetically, the ndhB genes of T. plicata group close to those of Metasequoia, Cryptomeria, Taxodium, Juniperus and Widdringtonia in the cupresaceae branch and are 5' end shortened by 18 codons with respect to that of angiosperms. Copyright © Physiologia Plantarum 2012.

  2. Petrographic Changes in Compaction Thermal Treatment of Recent Plant Materials, Peat and Coals; Shokubutsu, deitan oyobi sekitan no atsumitsu kanetsu shoributsu no kenbikyo kansatsu

    Energy Technology Data Exchange (ETDEWEB)

    Sugimoto, Yoshikazu. [National Institute of Materials and Chemical Research, Ibaraki (Japan); Okada, Kiyofumi. [Coal Energy Centre, Saitama (Japan); Suzuki, Yuichiro. [Geological Survey of Japan (Japan)

    1999-03-20

    Recent plant materials, peat and coals were compressed and thermally treated at various temperatures (200-400degreeC ) for 25 hours. The compaction pyrolysis products were observed with a microscope in both reflected and fluorescent lights, and their vitrinite reflectance (R{sub o}) were also measured. The R{sub o} values of the original samples varied from 0.1 of peat to 0.7 of Miike bituminous coal. After the thermal treatment at 300, 350 and 400degreeC, the R{sub o} values increased to 0.7-1.0, 1.2-1.4 and 1.7-2.1, respectively, in spite of the kind of the original material. The compaction pyrolysis products abtained from plant materials at 200degreeC showed sprcific textures which are often observed in natural low rank coals. Those textures became homogeneous with the increasing temperatures of the thermal treatment. Petrographic characteristice of the xylems of Morwell coal and red pine changed similarly during the thermal treatment. Because peat and humus soil sontained a large amount of mineral matter, they provided the pyrolysis products with different textures from other materials. The fluorercent material of leaf (metasequoia) after the thermal treatment at 200degreeC was considered as cutinite, and it stated to melt around 250degreeC and disappeared around 300degreeC , whereas thet of Miike bituminous coal did not melt and disappear even around 300degreeC. There still remain quite a few coal macerals of which origin and formation are unclear, and the artificial maturation followed by the microsopic investigation is one of effective approaches to elucidate them. (author)

  3. Micron-scale intra-ring analyses of δ13C in early Eocene Arctic wood from Ellesmere Island

    Science.gov (United States)

    Schubert, B.; Jahren, H.; Eberle, J.; Sternberg, L.

    2009-12-01

    Early Eocene (ca. 53 Ma) fossil assemblages on Ellesmere Island (75 oN paleolatitude), provide rich information about the plant and animal life of the lush polar ecosystems of the time. Fossil wood recovered from Ellesmere Island is abundant and not permineralized; however, morphological features such as growth rings and resin canals have been obliterated by compression. We report on exceptionally high-resolution intra-ring analyses of δ13C within fossil wood, sampled at ~30 micron intervals across several centimeters of wood sample. Clear patterns in systematic seasonal increases and decreases in wood δ13C allowed us to identify at least 5 annual cycles in the wood. The patterns of increase and decrease in δ13C were consistent with patterns observed for evergreen wood, and distinct from the deciduous patterns we have observed for Metasequoia fossil wood from the middle Eocene (ca. 45 Ma) Arctic site on Axel Heiberg Island. We believe that the high point in the δ13C value of wood seen in each cycle corresponds to the highest environmental temperatures during the annual cycle, as has been seen for modern evergreens (e.g., Barbour et al., 2002). Modern studies have also noted that high temperature periods are correlated with the highest vapor-pressure and soil-water deficits of the annual cycle; these environmental factors would cause the plant to change its discrimination during photosynthesis. We will discuss the relatively low amplitude of δ13C fluctuations (0.5-1.0 ‰) clearly defined by Ellesmere fossil wood, in comparison to observations on modern common evergreens (2.0-4.0 ‰), and speculate that this difference implies greatly dampened seasonal temperature fluctuations in Eocene polar environments, relative to today. Barbour M.M., Walcroft A.S., Farquhar G.D., 2002, Seasonal variation in δ13C and δ18O of cellulose from growth rings of Pinus radiata. Plant, Cell and Environment: v. 25, p. 1483-1499.

  4. Does the natriuretic peptide system exist throughout the animal and plant kingdom?

    Science.gov (United States)

    Takei, Y

    2001-06-01

    Natriuretic peptides (NPs) and their receptors have been identified in vertebrate species ranging from elasmobranchs to mammals. Atrial, brain and ventricular NP (ANP, BNP and VNP) are endocrine hormones secreted from the heart, while C-type NP (CNP) is principally a paracrine factor in the brain and periphery. In elasmobranchs, only CNP is present in the heart and brain and it functions as a circulating hormone as well as a paracrine factor. Four types of NP receptors are cloned in vertebrates. NPR-A and NPR-B are guanylyl cyclase-coupled receptors, whereas NPR-C and NPR-D have only a short cytoplasmic domain. NPs are hormones important for volume regulation in mammals, while they act more specifically for Na(+) regulation in fishes. The presence of NP and its receptor has also been suggested in the most primitive vertebrate group, cyclostomes, and its molecular identification is in progress. The presence of ANP or its mRNA has been reported in the hearts and ganglia of various invertebrate species such as mollusks and arthropods using either antisera raised against mammalian ANP or rat ANP cDNA as probes. Immunoreactive ANP has also been detected in the unicellular Paramecium and in various species of plants including Metasequoia. Furthermore, the N-terminal prosegments of ANP, whose sequences are scarcely conserved even in vertebrates, have also been detected by the radioimmunoassay for human ANP prosegments in all invertebrate and plant species examined including Paramecium. Although these data are highly attractive, the current evidence is too circumstantial to be convincing that the immunoreactivity truly originates from ANP and its prosegments in such diverse organisms. The caution that has to be exercised in identification of vertebrate hormones from phylogenetically distant organisms is discussed.

  5. High Arctic Forests During the Middle Eocene Supported by ~400 ppm Atmospheric CO2

    Science.gov (United States)

    Maxbauer, D. P.; Royer, D. L.; LePage, B. A.

    2013-12-01

    Fossils from Paleogene High Arctic deposits provide some of the clearest evidence for greenhouse climates and offer the potential to improve our understanding of Earth system dynamics in a largely ice-free world. One of the most well-known and exquisitely-preserved middle Eocene (47.9-37.8 Myrs ago) polar forest sites, Napartulik, crops out on eastern Axel Heiberg Island (80 °N), Nunavut, Canada. An abundance of data from Napartulik suggest mean annual temperatures of up to 30 °C warmer than today and atmospheric water loads 2× above current levels. Despite this wealth of paleontological and paleoclimatological data, there are currently no direct constraints on atmospheric CO2 levels for Napartulik or any other polar forest site. Here we apply a new plant gas-exchange model to Metasequoia (dawn redwood) leaves to reconstruct atmospheric CO2 from six fossil forests at Napartulik. Individual reconstructions vary between 405-489 ppm with a site mean of 437 ppm (337-564 ppm at 95% confidence). These estimates represent the first direct constraints on CO2 for polar fossil forests and suggest that the temperate conditions present at Napartulik during the middle Eocene were maintained under CO2 concentrations ~1.6× above pre-industrial levels. Our results strongly support the case that long-term climate sensitivity to CO2 in the past was sometimes high, even during largely ice-free periods, highlighting the need to better understand the climate forcing and feedback mechanisms responsible for this amplification.

  6. Miocene fossil plants from Bukpyeong Formation of Bukpyeong Basin in Donghae City, Gangwon-do Province, Korea and their palaeoenvironmental implications

    Science.gov (United States)

    Jeong, Eun Kyoung; Kim, Hyun Joo; Uemura, Kazuhiko; Kim, Kyungsik

    2016-04-01

    The Tertiary sedimentary basins are distributed along the eastern coast of Korean Peninsula. The northernmost Bukpyeong Basin is located in Donghae City, Gangwon-do Province, Korea. The Bukpyeong Basin consists of Bukpyeong Formation and Dogyeongri Conglomerate in ascending order. The geologic age of Bukpyeong Formation has been suggested as from Early Miocene to Pliocene, In particular, Lee & Jacobs (2010) suggested the age of the Bukpyeong Formation as late Early Miocene to early Middle Miocene based on the fossils of rodent teeth. Sedimentary environment has been thought as mainly fresh water lake and/or swamp partly influenced by marine water. Lately, new outcrops of Bukpyeong Formation were exposed during the road construction and abundant fossil plants were yielded from the newly exposed outcrops. As a result of palaeobotanical studies 47 genera of 23 families have been found. This fossil plant assemblage is composed of gymnosperms and dicotyledons. Gymnosperms were Pinaceae (e.g., Pinus, Tsuga), Sciadopityaceae (e.g., Sciadopitys) and Cupressaceae with well-preserved Metasequoia cones. Dicotyledons were deciduous trees such as Betulaceae (e.g., Alnus, Carpinus) and Sapindaceae (e.g., Acer, Aesculus, Sapindus), and evergreen trees such as evergreen Fagaceae (e.g., Castanopsis, Cyclobalanopsis, Pasania) and Lauraceae (e.g., Cinnamomum, Machilus). In addition, fresh water plants such as Hemitrapa (Lytraceae) and Ceratophyllum (Ceratophyllaceae) were also found. The fossil plant assemblage of the Bukpyeong Formation supported the freshwater environment implied by previous studies. It can be suggested that the palaeoflora of Bukpyeong Formation was oak-laurel forest with broad-leaved evergreen and deciduous trees accompanying commonly by conifers of Pinaceae and Cupressaceae under warm-temperate climate.

  7. An investigation of coseismic OSL / TL time zeroing of quartz gouge based on low- to high-velocity friction experiments

    Science.gov (United States)

    Akasegawa, K.; Oohashi, K.; Hasebe, N.; Miura, K.

    2016-12-01

    Shimamoto, T., 2004. Bull. Nara Univ. Educ., Vol. 53, No. 2, 17-29. Ikeya, M., Miki, T. and Tanaka, K. 1982. Seience, 215, 1392-1393. Kim, J. H., Choi, J. H., Chauhan, N., Lee, S., Hirose, T., and Ree, J. H, 2014. AGU, Fall Meeting 2014.

  8. Consumption of nattokinase is associated with reduced blood pressure and von Willebrand factor, a cardiovascular risk marker: results from a randomized, double-blind, placebo-controlled, multicenter North American clinical trial

    Directory of Open Access Journals (Sweden)

    Jensen GS

    2016-10-01

    Full Text Available Gitte S Jensen,1 Miki Lenninger,1 Michael P Ero,2 Kathleen F Benson,1 1NIS Labs, Klamath Falls, OR, 2Machaon Diagnostics, Inc., Oakland, CA, USA Objective: The objective of this study is to evaluate the effects of consumption of nattokinase on hypertension in a North American hypertensive population with associated genetic, dietary, and lifestyle factors. This is in extension of, and contrast to, previous studies on Asian populations.Materials and methods: A randomized, double-blind, placebo-controlled, parallel-arm clinical study was performed to evaluate nattokinase (NSK-SD, a fermented soy extract nattō from which vitamin K2 has been removed. Based on the results from previous studies on Asian populations, 79 subjects were enrolled upon screening for elevated blood pressure (BP; systolic BP ≥130 or diastolic BP ≥90 mmHg who consumed placebo or 100 mg nattokinase/d for the 8-week study duration. Blood collections were performed at baseline and 8 weeks for testing plasma renin activity, von Willebrand factor (vWF, and platelet factor-4. Seventy-four people completed the study with good compliance.Results: Consumption of nattokinase was associated with a reduction in both systolic and diastolic BP. The reduction in systolic BP was seen for both sexes but was more robust in males consuming nattokinase. The average reduction in diastolic BP in the nattokinase group from 87 mmHg to 84 mmHg was statistically significant when compared to that in the group consuming placebo, where the average diastolic BP remained constant at 87 mmHg (P<0.05, and reached a high level of significance for males consuming nattokinase, where the average diastolic BP dropped from 86 mmHg to 81 mmHg (P<0.006. A decrease in vWF was seen in the female population consuming nattokinase (P<0.1. In the subpopulation with low plasma renin activity levels at baseline (<0.29 ng/mL/h, an increase was seen for 66% of the people after 8-week consumption of nattokinase (P

  9. Pars plana vitrectomy combined with internal limiting membrane peeling for recurrent macular edema due to branch retinal vein occlusion after antivascular endothelial growth factor treatments

    Directory of Open Access Journals (Sweden)

    Shirakata Y

    2016-02-01

    Full Text Available Yukari Shirakata,1 Kouki Fukuda,1 Tomoyoshi Fujita,1 Yuki Nakano,1 Hiroyuki Nomoto,2 Hidetaka Yamaji,3 Fumio Shiraga,4 Akitaka Tsujikawa1 1Department of Ophthalmology, Faculty of Medicine, Kagawa University, Miki-cho, 2Nomoto Eye Clinic, Himeji, 3Department of Ophthalmology, Shirai Eye Hospital, Mitoyo, 4Department of Ophthalmology, Okayama University, Okayama, Japan Purpose: To evaluate the anatomic and functional outcomes of pars plana vitrectomy combined with internal limiting membrane peeling for recurrent macular edema (ME due to branch retinal vein occlusion (BRVO after intravitreal injections of antivascular endothelial growth factor (anti-VEGF agents. Methods: Twenty-four eyes of 24 patients with treatment-naive ME from BRVO were treated with intravitreal injections of anti-VEGF agents. Recurred ME was treated with pars plana vitrectomy combined with internal limiting membrane peeling. Results: After the surgery, ME was significantly reduced at 1 month (P=0.031 and the reduction increased with time (P=0.007 at the final visit. With the reduction in ME, treated eyes showed a slow improvement in visual acuity (VA. At the final visit, improvement in VA was statistically significant compared with baseline (P=0.048. The initial presence of cystoid spaces, serous retinal detachment, or subretinal hemorrhage under the fovea, as well as retinal perfusion status, showed no association with VA improvement. However, the presence of epiretinal membrane showed a significant association with the visual recovery. Although eyes without epiretinal membrane showed visual improvement (-0.10±0.32 in logarithm of the minimum angle of resolution [logMAR], eyes with epiretinal membrane showed greater visual improvement (-0.38±0.12 in logMAR, P=0.012. Conclusion: For recurrent ME due to BRVO after anti-VEGF treatment, particularly when accompanied by epiretinal membrane, pars plana vitrectomy combined with internal limiting membrane peeling might be a

  10. Binocular stereo-navigation for three-dimensional thoracoscopic lung resection.

    Science.gov (United States)

    Kanzaki, Masato; Isaka, Tamami; Kikkawa, Takuma; Sakamoto, Kei; Yoshiya, Takehito; Mitsuboshi, Shota; Oyama, Kunihiro; Murasugi, Masahide; Onuki, Takamasa

    2015-05-08

    This study investigated the efficacy of binocular stereo-navigation during three-dimensional (3-D) thoracoscopic sublobar resection (TSLR). From July 2001, the authors' department began to use a virtual 3-D pulmonary model on a personal computer (PC) for preoperative simulation before thoracoscopic lung resection and for intraoperative navigation during operation. From 120 of 1-mm thin-sliced high-resolution computed tomography (HRCT)-scan images of tumor and hilum, homemade software CTTRY allowed sugeons to mark pulmonary arteries, veins, bronchi, and tumor on the HRCT images manually. The location and thickness of pulmonary vessels and bronchi were rendered as diverse size cylinders. With the resulting numerical data, a 3-D image was reconstructed by Metasequoia shareware. Subsequently, the data of reconstructed 3-D images were converted to Autodesk data, which appeared on a stereoscopic-vision display. Surgeons wearing 3-D polarized glasses performed 3-D TSLR. The patients consisted of 5 men and 5 women, ranging in age from 65 to 84 years. The clinical diagnoses were a primary lung cancer in 6 cases and a solitary metastatic lung tumor in 4 cases. Eight single segmentectomies, one bi-segmentectomy, and one bi-subsegmentectomy were performed. Hilar lymphadenectomy with mediastinal lymph node sampling has been performed in 6 primary lung cancers, but four patients with metastatic lung tumors were performed without lymphadenectomy. The operation time and estimated blood loss ranged from 125 to 333 min and from 5 to 187 g, respectively. There were no intraoperative complications and no conversion to open thoracotomy and lobectomy. Postoperative courses of eight patients were uneventful, and another two patients had a prolonged lung air leak. The drainage duration and hospital stay ranged from 2 to 13 days and from 8 to 19 days, respectively. The tumor histology of primary lung cancer showed 5 adenocarcinoma and 1 squamous cell carcinoma. All primary lung

  11. Possible impact of the CYP2D6*10 polymorphism on the nonlinear pharmacokinetic parameter estimates of paroxetine in Japanese patients with major depressive disorders

    Directory of Open Access Journals (Sweden)

    Saruwatari J

    2014-04-01

    Full Text Available Junji Saruwatari,1 Hiroo Nakashima,1 Shoko Tsuchimine,2 Miki Nishimura,1 Naoki Ogusu,1 Norio Yasui-Furukori21Division of Pharmacology and Therapeutics, Graduate School of Pharmaceutical Sciences, Kumamoto University, Kumamoto, Japan; 2Department of Neuropsychiatry, Graduate School of Medicine, Hirosaki University, Hirosaki, JapanAbstract: It has been suggested that the reduced function allele with reduced cytochrome P450 (CYP 2D6 activity, CYP2D6*10, is associated with the interindividual differences in the plasma paroxetine concentrations, but there is no data presently available regarding the influence of the CYP2D6*10 polymorphism on the pharmacokinetic parameters, eg, Michaelis–Menten constant (Km and maximum velocity (Vmax, in Asian populations. The present study investigated the effects of the CYP2D6 polymorphisms, including CYP2D6*10, on the pharmacokinetic parameters of paroxetine in Japanese patients with major depressive disorders. This retrospective study included 15 Japanese patients with major depressive disorders (four males and eleven females who were treated with paroxetine. The CYP2D6*2, CYP2D6*4, CYP2D6*5, CYP2D6*10, CYP2D6*18, CYP2D6*39, and CYP2D6*41 polymorphisms were evaluated. A total of 56 blood samples were collected from the patients. The Km and Vmax values of paroxetine were estimated for each patient. The allele frequencies of CYP2D6*2, CYP2D6*4, CYP2D6*5, CYP2D6*10, CYP2D6*18, CYP2D6*39, and CYP2D6*41 were 6.7%, 0%, 10.0%, 56.7%, 0%, 26.7%, and 0%, respectively. The mean values of Km and Vmax were 50.5±68.4 ng/mL and 50.6±18.8 mg/day, respectively. Both the Km and Vmax values were significantly smaller in CYP2D6*10 allele carriers than in the noncarriers (24.2±18.3 ng/mL versus 122.5±106.3 ng/mL, P=0.008; 44.2±16.1 mg/day versus 68.3±15.0 mg/day, P=0.022, respectively. This is the first study to demonstrate that the CYP2D6*10 polymorphism could affect the nonlinear pharmacokinetic parameter estimates of

  12. Supermodernity, distraction, schizophrenia: walking in Tokyo & Hong Kong.

    Directory of Open Access Journals (Sweden)

    Ian Ho-Yin Fong

    2014-12-01

    Full Text Available The architecture in a supermodern city has no sense of the place where it is located. This paper discusses how schizophrenia and distraction, through walking, respond to supermodernity by referring to how three dislocated subjects, Fumiya Takemura, Aiichiro Fukuhara and Fai in Tokyo and Hong Kong, are respectively depicted in the novel, Adrift in Tokyo written by Fujita Yoshinaga in 1999, with a film adaptation by Satoshi Miki (2007, and the film To Live and Die in Mongkok directed by Wong Jing in 2009. It suggests that Hong Kong is more supermodern than Tokyo. After his release from prison, Fai in To Live and Die in Mongkok finds that Mongkok is a completely different place from the one in which he used to live. The living conditions are no better than those in the prison. He hallucinates about the past. Adrift in Tokyo can be read as a story about walking. Fukuhara, a debt collector, killed his wife; before surrendering to the police, he orders his debtor, Takemura, to walk with him in Tokyo in order to re-experience the walks he enjoyed with his wife. If Takemura agrees, the debt can be paid off. This paper discusses how the repressed heterogeneous time and place can be approached by walking in a way that the rhythm of life can be (re-experienced; in other words, when the body moves forward physically, the past appears as specter haunting the walker. This paper discusses how Adrift in Tokyo and To Live and Die in Mongkok read cities in distractive and schizophrenic ways. In the film version of Adrift in Tokyo, Takemura’s failed relationship with his father may unconsciously drive him to walk with Fukuhara. The novel may imply that the lost relationship with his mother drives him to walk. The film and the novel both address a kind of locality which should be inseparable from the birth parents. To Live and Die in Mongkok suggests that supermodernity kills mother and father. The Father-son relationship disappears at the very beginning of the

  13. Geta aðferðir mannauðsstjórnunar aukið gæði ráðninga hjá hinu opinbera?

    Directory of Open Access Journals (Sweden)

    Gylfi Dalmann Aðalsteinsson

    2006-06-01

    Full Text Available Á undanförnum misserum hafa ráðningar hjá hinu opinbera verið mikið í umræðunni. Í kjölfar embættisveitinga hafa gjarnan komið fram miklar umræður um stöðuveitingarnar og sitt sýnist hverjum. Þó nokkur umræða hefur verið um vinnulag eða vinnubrögð í ráðningarferlinu. Í þessari grein verður fjallað um ráðningarferlið út frá mannauðsstjórnun (human resource management. Gerð verður grein fyrir því hvernig mannauðsstjórnun sem fræðigrein fjallar um ráðningarferlið með það eitt að leiðarljósi að finna aðferð sem spáir vel fyrir um framtíðar frammistöðu starfsmanna þannig að sá hæfasti verður ráðinn hverju sinni. Með ráðningarferlinu er átt við það tímabil frá því að auglýsing um starf birtist og þangað til búið að ganga frá ráðningu í starfið. Í umræðunni um ráðningar hjá hinu opinbera er því stundum haldið fram að ráðning hafi verið fagleg. Faglega ráðningu má skilja sem þá ráðningu sem unnin hefur verið á faglegum forsendum, eftir fyrirframgefnum aðferðum sem hefur það markmið að nota bestu hlutlægu aðferðir hverju sinni sem völ er á við ráðningar til að ráða þann hæfasta óháð kyni, kynþætti eða stjórnmálaskoðunum. Fagleg ráðning er þá ráðning sem unninn er af sérþekkingu. Gera verður þá kröfu til stjórnvalda að fulls jafnræðis sé gætt við ráðningar, allir umsækjendur sitji við sama borð í ráðningarferlinu og allir fái sömu möguleika til að tryggja sér starfið slíkt er í anda mannauðsstjórnunar.

  14. What were the voters thinking? The presidential election in Iceland 2012 Hvað voru kjósendur að hugsa? Forsetakosningar á Íslandi 2012

    Directory of Open Access Journals (Sweden)

    Gunnar Helgi Kristinsson

    2012-12-01

    Full Text Available Social scientists have not done much research on presidential elections in Iceland and therefore little is known about the factors which affect their results. The presidential election on June 30th 2012 was unusual partly because the incumbent president faced more serious opponents and received a lower share of the votes than ever before and partly because the campaign was characterized by more debate about the nature of the office itself than ever before. This article examines the factors that affected the outcome of the election. The findings indicate that voters in general were more preoccupied with personal factors,such as perceived competence, image and honesty, than with the issues or the political opinions of the candidates, although it appears that voters of the two leading candidates had very different perceptions of the role of the president. It seems likely that voters’ attitudes towards the government were the strongest factor affecting the election results. Candidates with a small following were adversely affected by tactical voting but it is unlikely to have had an impact on the outcome of the election.Forsetakosningar á Íslandi hafa ekki mikið verið rannsakaðar af félagsvísindafólki og lítið er þess vegna vitað um hvaða þættir hafa áhrif á úrslit þeirra. Forsetakosningarnar 30. júní 2012 voru óvenjulegar annars vegar vegna þess að sitjandi forseti hlaut alvarlegri mótframboð og lægra hlutfall atkvæða en áður eru dæmi um í forsetakosningum á Íslandi og hins vegar vegna þess að meiri deilur urðu um eðli embættisins sjálfs. Í þessari grein er fjallað um það hvaða þættir höfðu áhrif á úrslitin, á grundvelli könnunar sem gerð var á netinu og annarra gagna. Niðurstöðurnar benda til þess að kjósendur hafi almennt lagt meira upp úr persónulegum þáttum eins og hæfni, ímynd og heiðarleika en málefnum eða stjórnmálaskoðunum frambjóðenda þegar þeir útsk

  15. Cues for Cure; From within

    Directory of Open Access Journals (Sweden)

    Editorial

    2016-05-01

    transplantation of exogenous stem cells, adult cells or precursors, though forms the main stream approach in regenerative medicine, in vivo stimulation of tissue resident stem cells has been postulated as a promising regenerative approach [5], probably owing to its safety compared to transplantation of exogenous cells, especially pluripotent stem cells. Further, even if exogenous cells are administered in cell-based therapies, it is the tissue resident cells with regenerative capability which actually contribute to the regeneration. Hence, unless the local niche/environment and other factors contributing to the maintenance of tissue resident stem cells or progenitor cells are studied and steps to recapitulate their contribution in moulding the function of exogenous stem cells to contribute to regeneration are performed in vitro, translational approaches in regeneration may not realize their expected outcome. The studies by Takeuchi et al and Jones and Connor in the current issue fall in line with this ideology and more such studies need to be encouraged for developing better therapies for the future. References: Barker N, Bartfeld S, Clevers H. Tissue-resident adult stem cell populations of rapidly self-renewing organs. Cell Stem Cell. 2010; 7(6:656-70. Miki K, Uenaka H, Saito A, Miyagawa S, Sakaguchi T, Higuchi T, Shimizu T, Okano T, Yamanaka S, Sawa Y. Bioengineered myocardium derived from induced pluripotent stem cells improves cardiac function and attenuates cardiac remodeling following chronic myocardial infarction in rats. Stem Cells Transl Med. 2012; 1(5:430-7. Takeuchi T, Tonooka A, Okuno Y, Hattori-Kato M, Mikami K. Oct4B, CD90, and CD73 are upregulated in bladder tissue following electro-resection of the bladder. J Stem Cells Regen Med 2016; 12(1 :10-15. Jones KS, Connor BJ. The Effect of Pro-Neurogenic Gene Expression on Adult Subventricular Zone Precursor Cell Recruitment and Fate Determination After Excitotoxic Brain Injury. J Stem Cells Regen Med 2016; 12(1 :25

  16. Icelandic organizational culture; Clear strategic direction and intent but lack of coordination and integration Íslensk vinnustaðamenning. Skýr og markviss stefna en skortur á samhæfingu og samþættingu

    Directory of Open Access Journals (Sweden)

    Gylfi Dalmann Aðalsteinsson

    2010-12-01

    Full Text Available The idea of development gained hegemonic status in the middle of the 20th century as a way of understanding the relationship between different parts of the world. Even though debated how development would best be achieved, the idea as such was generally not critically assessed. Development institutions were seen as objective institutions with the technological knowledge necessary to move one society to the next level of development. The collection of data of these institutions in the so-called underdeveloped parts of the world involved the most intimate aspects of societies,and gave the idea of development content and meaning. The article looks at the origin of Icelandic development aid and aims at contextualizing it within international ideas of aid. The discussion starts with overview of historical appearance of international development globally and its hegemonic position. It focuses then on how the idea of development takes shape in an Icelandic context at a particular period and how it was shaped by international discourses, as is for example reflected in increased pressure on the Icelandic government to initiate an aid institution. The establishment of Iceland’s first governmental institutions focusing on aid in 1971 reflects still little interest by the Icelandic government at that time in international development. The article also shows how these international discourses become entangled with Icelandic nationalism,and thus the emphasis that the Icelandic nation-state would be engaged in international development.Hugtakið vinnustaðamenning hefur verið mikið til umræðu síðustu áratugi innan stjórnunar- og skipulagsfræða. Hugtakið er flókið og erfitt er að henda reiður á því. Í þessari grein er gerð ítarleg grein fyrir hugtakinu og greint frá mörgum ólíkum skilgreiningum þess. Fjallað er um íslenskar rannsóknir á vinnustaðamenningu og helstu einkenni íslensks stjórnunarstíls. Sérstökum sjónum er

  17. EDITORIAL: Invited papers from ISAMMA 2010 (Sendai, Japan, 12-16 July 2010) Invited papers from ISAMMA 2010 (Sendai, Japan, 12-16 July 2010)

    Science.gov (United States)

    Takahashi, M.; Saito, H.

    2011-02-01

    Yanagihara, Yuta Toyoda and Eiji Kita Monte Carlo simulations of the magnetocaloric effect in magnetic Ni-Mn-X (X = Ga, In) Heusler alloys V D Buchelnikov, V V Sokolovskiy, S V Taskaev, V V Khovaylo, A A Aliev, L N Khanov, A B Batdalov, P Entel, H Miki and T Takagi Changes in electronic states and magnetic free energy in La1-zCez(FexSi1-x)13 magnetic refrigerants A Fujita, S Fujieda and K Fukamichi Garnet composite films with Au particles fabricated by repetitive formation for enhancement of Faraday effect H Uchida, Y Mizutani, Y Nakai, A A Fedyanin and M Inoue Control of magnetic domain wall displacement using spin current in small in-plane magnetic field in Permalloy nanowires Yoshihiko Togawa, Takashi Kimura, Ken Harada, Akira Tonomura and Yoshichika Otani Magnetic-field tunable transmittance in a ferrofluid-filled silicon nitride photonic crystal slab H M Lee, L Horng and J C Wu Evaluation of a miniature magnetostrictive actuator using Galfenol under tensile stress Toshiyuki Ueno, Hidemitsu Miura and Sotoshi Yamada Sub-nm resolution depth profiling of the magnetic structure of thin films by the depth-resolved x-ray magnetic circular dichroism technique K Amemiya and M Sakamaki

  18. COASTALT Project's contribution to the development and dissemination of coastal altimetry

    Science.gov (United States)

    Cipollini, P.; Benveniste, J.

    2012-04-01

    , Machiel Bos, Valborg Byfield, Marco Caparrini, Peter Challenor, Paolo Cipollini, Henrique Coelho, Salvatore Dinardo, M. Joana Fernandes, Scott Gleason, Jesus Gómez-Enri, Christine Gommenginger, Clara Lázaro, Bruno M. Lucas, Cristina Martin-Puig, Laura Moreno, Alexandra Nunes, Nelson Pires, Graham Quartly, Andrea Scozzari, Helen Snaith, Mikis Tsimplis, Stefano Vignudelli, Luke J. West, Judith Wolf, Phil Woodworth

  19. PREFACE: 11th IAEA Technical Meeting on H-mode Physics and Transport Barriers

    Science.gov (United States)

    Takizuka, Tomonori

    2008-07-01

    (University of Tsukuba, Japan) K Itoh (National Institute for Fusion Science, Japan) S-I Itoh (Kyushu University, Japan) F Jenko (Max-Plank-Institut für Plasmaphysik, Germany) D Kalupin (Institut für Plasmaphysik, Forschungszentrum Jülich GmbH, Germany) Y Kamada (Japan Atomic Energy Agency, Japan) N Kasuya (National Institute for Fusion Science, Japan) I Katanuma (University of Tsukuba, Japan) M Kimura (Kyushu University, Japan) A Kirk (EURATOM/UKAEA Fusion Association, UK) S Kitajima (Tohoku University, Japan) S Kobayashi (Kyoto University, Japan) T Kobuchi (Tohoku University, Japan) J Kohagura (University of Tsukuba, Japan) P T Lang (Max-Plank-Institut für Plasmaphysik, Germany) S V Lebedev (Ioffe Institute, Russia) A W Leonard (General Atomics, USA) J Q Li (Kyoto University, Japan) A Malaquias (International Atomic Energy Agency) Y R Martin (Centre de Recherches en Physique des Plasmas, EPFL, Switzerland) C J McDevitt (University of California, San Diego, USA) D C McDonald (EURATOM/UKAEA Fusion Association, UK) H Meyer (EURATOM/UKAEA Fusion Association, UK) C A Michael (National Institute for Fusion Science, Japan) K Miki (Kyushu University, Japan) R Minami (University of Tsukuba, Japan) T Minami (National Institute for Fusion Science, Japan) Y Miyata (University of Tsukuba, Japan) N Miyato (Japan Atomic Energy Agency, Japan) Y Motegi (University of Tsukuba, Japan) V Mukhovatov (ITER Organization) S Murakami (Kyoto University, Japan) Y Nagashima (Kyushu University, Japan) Y Nakashima (University of Tsukuba, Japan) T Numakura (University of Tsukuba, Japan) S Ohshima (National Institute for Fusion Science, Japan) T Oishi (National Institute for Fusion Science, Japan) T Onjun (Sirindhorn International Institute of Technology, Thailand) T H Osborne (GENERAL Atomics, USA) N Oyama (Japan Atomic Energy Agency, Japan) T Ozeki (Japan Atomic Energy Agency, Japan) V Parail (EURATOM/UKAEA Fusion Association, UK) A Polevoi (ITER Organization, France) J E Rice (MIT Plasma Science

  20. Unified requirements to papers presented to “Endocrine surgery” journal

    Directory of Open Access Journals (Sweden)

    - -

    2011-03-01

    есто издания. Примеры оформления (обратите внимание на знаки препинания Книги: Фадеев В.В. Заглавие (обязательно полное. М.: Видар, 2005. Руководство по хирургии. В 3-х томах. Т. 1. Н.А. Иванов (ред.. М.: Медицина; 1998. 15–37. Laws E.R. Jr., Sheehan J.P. (eds. Pituitary Surgery – A Modern Approach. Front Horm Res. Basel: Karger,2006. Журналы: Nishioka H., Haraoka J., Miki T. Spontaneous remission of functioning pituitary adenomas without hypopituitarism following infarctive apoplexy: two case reports. Endocr. J. 2005; 52 (1:117–123. Ларин Д.Р., Сомин Е.Н., Назыров Д.У. Название статьи. Название журнала (сокращенное без кавычек. 2000; 16 (2: 6–10. Nishioka H., Haraoka J., Miki T. et al. Spontaneous remission of functioning pituitary adenomas withouthypopituitarism following infarctive apoplexy: two case reports. Lancet 2005; 52 (1:117–123. Если более четырех авторов, то указываются три и др. (et al. Диссертации: Петров В.А. Название диссертации: Дис. ... д-ра мед. наук. М., 2002. Никитин Д.Л. Название диссертации: Автореф. дис. ... канд. мед. наук. М., 2005.14. Редакция оставляет за собой право редактирования статей, а также изменения стиля оформления, не оказывающее влияние на содержание. Кроме того, редакция может потребовать от автора предоставления исходных данных, с использованием которых были получены описываемые в статье результаты, для

  1. Unified requirements to papers presented to “Endocrine surgery” journal

    Directory of Open Access Journals (Sweden)

    - -

    2011-03-01

    римеры оформления (обратите внимание на знаки препинания Книги: Фадеев В.В. Заглавие (обязательно полное. М.: Видар, 2005. Руководство по хирургии. В 3-х томах. Т. 1. Н.А. Иванов (ред.. М.: Медицина; 1998. 15–37. Laws E.R. Jr., Sheehan J.P. (eds. Pituitary Surgery – A Modern Approach. Front Horm Res. Basel: Karger,2006. Журналы: Nishioka H., Haraoka J., Miki T. Spontaneous remission of functioning pituitary adenomas without hypopituitarism following infarctive apoplexy: two case reports. Endocr. J. 2005; 52 (1:117–123. Ларин Д.Р., Сомин Е.Н., Назыров Д.У. Название статьи. Название журнала (сокращенное без кавычек. 2000; 16 (2: 6–10. Nishioka H., Haraoka J., Miki T. et al. Spontaneous remission of functioning pituitary adenomas withouthypopituitarism following infarctive apoplexy: two case reports. Lancet 2005; 52 (1:117–123. Если более четырех авторов, то указываются три и др. (et al. Диссертации: Петров В.А. Название диссертации: Дис. ... д-ра мед. наук. М., 2002. Никитин Д.Л. Название диссертации: Автореф. дис. ... канд. мед. наук. М., 2005.14. Редакция оставляет за собой право редактирования статей, а также изменения стиля оформления, не оказывающее влияние на содержание. Кроме того, редакция может потребовать от автора предоставления исходных данных, с использованием которых были получены описываемые в статье результаты, для оценки редактором