Crossbreeding to increase beef production: additive and non ...

African Journals Online (AJOL)

The indicus x sanga and indicus x taurus direct heterosis effects on all weight traits were greater than either the taurus x sanga or taurus x taurus effects, whereas the indicus x sanga maternal heterosis effect was consistently less than the estimated taurus x sanga maternal heterosis effect. Keywords: Direct effects, heterosis, ...

Urinary excretion of purine derivatives as an index of microbial protein supply in cross-bred (Bos indicus x Bos taurus) cattle in tropical environment

International Nuclear Information System (INIS)

Ojeda, A.; Parra, O.

1999-01-01

Four experiments were carried out to establish a response model between urinary excretion of purine derivatives (PD) and microbial production in Bos indicus x Bos taurus cross-bred cattle: LZ, MZ and HZ (3/8, 1/2 and 5/8 Bos indicus, respectively). The fasting PD excretion was considered as endogenous excretion and amounted to 268 (± 85.1), 294 (± 128.1) and 269 (± 68.4) μmol/kg W 0.75 for LZ, MZ and HZ, respectively. Urinary recovery of absorbed purine bases (PB) was calculated as the urinary recovery of a single dose of intrajugular infused uric acid (1,3- 15 N). In HZ crossbred cattle 83% (± 20.3) of infused uric acid was recovered in the urinary PD. The relationship between duodenal purine absorption (X, mmol/d) and urinary PD excretion (Y, mmol/d) was defined in HZ crossbred cattle as Y = 0.83 X + 0.269W 0.75 (± 85.1), assuming that the endogenous contribution was constant and independent of the exogenous PB supply. The activity of xanthine oxidase (EC 1.2.3.2.) was determined in HZ and MZ and was found to be higher in the liver (0.62 and 0.66 units/g, respectively) than in intestinal mucosa (0.09 and 0.03 units/g, respectively), whereas xanthine oxidase activity was practically absent in plasma of both cross breeds. The ratio PB:total N was determined in microbial extracts taken from rumen fluid of cows fed Bermuda grass (Cynodon dactylon) as the sole diet or supplemented (ratio of 80:20, grass: supplement) with gluten feed, soybean hulls or Gliricidia species and were found to range from 1.52-1.62 μmol PB/mg N. (author)

Fixed-time artificial insemination with estradiol and progesterone for Bos indicus cows II: strategies and factors affecting fertility.

Science.gov (United States)

Sá Filho, O G; Meneghetti, M; Peres, R F G; Lamb, G C; Vasconcelos, J L M

2009-07-15

In Experiments 1, 2, and 3, we evaluated the effects of temporary weaning (TW), equine chorionic gonadotropin (eCG), and follicle-stimulating hormone (FSH) treatments on results of a fixed-time artificial insemination (TAI) protocol in postpartum Bos indicus cows. In Experiment 1, treatment with 400 IU eCG or with TW for 48 h consistently improved pregnancy rates (PRs) at TAI, but, in Experiment 2, FSH treatment was less effective than eCG or TW. In Experiment 3, the inclusion of eCG treatment in cows subjected to TW did not improve PRs. We concluded that TW or 400 IU eCG should be included in the TAI protocol in postpartum Bos indicus cows to enhance fertility. In Experiment 4, we used records from heifers and cows treated with the proposed protocol during the 2006-2007 (n=27,195) and 2007-2008 (n=36,838) breeding seasons from multiple locations in Brazil to evaluate factors potentially affecting PRs. Overall PR at TAI was 49.6% (31,786 of 64,033). Pregnancy rate differed (Pcow group within farm, by breed (Bos indicus, 48.3% [26,123 of 54,145]; Bos taurus, 61.7% [3652 of 5922]; and crossbred Bos indicus x Bos taurus, 50.7% [2011 of 3966]), category (nulliparous, 39.6% [2095 of 5290]; suckled primiparous, 45.2% [3924 of 8677]; suckled multiparous, 51.8% [24,245 of 46,767]; and nonsuckled multiparous, 46.1% [1522 of 3299]), body condition score at TAI ( or =3.5, 52.7% [9419 of 17,881]). Days postpartum at beginning of protocol did not affect PR (30 to 60 d, 47.6% [4228 of 8881]; 61 to 90 d, 51.7% [16,325 to 31,572]; and 91 to 150 d, 50.8% [7616 to 14,991]; P>0.1). Pregnancy rate was also consistently affected (P<0.01) by sire (results ranging from 7.2% to 77.3%) and artificial insemination technician (results ranging from 15.1% to 81.8%).

Gloria Anzaldúa, Mestiza Consciousness, and “Feminism of Difference”

Directory of Open Access Journals (Sweden)

Claudia de Lima Costa

2005-01-01

Full Text Available This article situates Gloria Anzaldúa’s influential “La Conciencia de la mestiza / Towards a New Consciousness” within the history of feminism, focusing on her epistemological perspective of intersectional difference to articulate a politics of coalition against the exclusion of alterity from privileged sites of modernity construction, in both space and time. Drawing on various academic sources of Anzaldúa criticism, we highlight some important ways her theory of mestiza identity actually anticipates not only critiques of the concepts of the subject, difference and modernity but also distinctions between capitalist and critical versions of cultural hybridity, all of which require sensitivity to discourses of dehistoricization, cooptation and assimilation.

Differential abundances of four forms of Binder of SPerm 1 in the seminal plasma of Bos taurus indicus bulls with different patterns of semen freezability.

Science.gov (United States)

Magalhães, Marcos Jorge; Martins, Leonardo Franco; Senra, Renato Lima; Santos, Thaís Ferreira Dos; Okano, Denise Silva; Pereira, Paulo Roberto Gomes; Faria-Campos, Alessandra; Campos, Sérgio Vale Aguiar; Guimarães, José Domingos; Baracat-Pereira, Maria Cristina

2016-08-01

The Binder of SPerm 1 (BSP1) protein is involved in the fertilization and semen cryopreservation processes and is described to be both beneficial and detrimental to sperm. Previously, the relationship of BSP1 with freezability events has not been completely understood. The objective of this work was to determine the differential abundance of the forms of the BSP1 protein in cryopreserved seminal plasma of Bos taurus indicus bulls with different patterns of semen freezability using proteomics. A wide cohort of adult bulls with high genetic value from an artificial insemination center was used as donors of high quality, fresh semen. Nine bulls presenting different patterns of semen freezability were selected. Two-dimensional gel electrophoresis showed differential abundance in a group of seven protein spots in the frozen/thawed seminal plasma from the bulls, ranging from 15 to 17 kDa, with pI values from 4.6 to 5.8. Four of these spots were confirmed to be BSP1 using mass spectrometry, proteomics, biochemical, and computational analysis (Tukey's test at P semen freezability and its absence in bulls presenting high semen freezability. This is the first report showing that more than two forms of BSP1 are found in the seminal plasma of Nelore adult bulls and not all animals have a similar abundance of each BSP1 form. Different BSP1 forms may be involved in different events of fertilization and the cryopreservation process. Copyright © 2016 Elsevier Inc. All rights reserved.

"Curriculum of the Mestiza/o Body": Living and Learning through a Corporal Landscape of Resistance and (Re)Generation

Science.gov (United States)

Sosa-Provencio, Mia Angélica

2018-01-01

Through a Chicana Feminist and Curricular Reconceptualist lens, this article theorizes a Curriculum of the Mestiza/o Body as return to historicized, corporal knowing which takes shape, form, flesh and language in the Mestiza/o Body in order to nourish and arm especially Mexican/Mexican-American (Mexicana/o) young people toward equitable, hopeful…

The role of genotype on classification grades of beef carcasses produced under mexican tropical conditions

Directory of Open Access Journals (Sweden)

José Manuel Zorrilla-Ríos

2015-01-01

Full Text Available El presente estudio identificó la distribución de 22,850 canales de bovino de diferentes genotipos. Éstos, en función del juzgamiento visual del tamaño de la giba (grande, representativa de un genotipo Bos indicus; mediana, genotipo producto de la cruza entre B. taurus y B. indicus y pequeña, considerada como genotipo B. taurus en los grados de clasificación obtenidos bajo la norma mexicana NMX-FF-078-SCFI-2002, en el rastro Tipo Inspección Federal No. 51 de La Unión, Tabasco (México. Se determinó el grado de asociación y la proporción de canales, juzgados por el tamaño de su giba; y el criterio de clasificación de la canal, por el procedimiento analítico de Chi-Cuadrada. Cincuenta y cuatro por ciento de las canales correspondieron al tipo de giba grande (genotipo B. indicus, 35% al de pequeña (genotipo B. taurus y el 10.70% al de mediana (genotipo producto de la cruza entre B. taurus y B. indicus. En los genotipos B. taurus y cruza se concentró un mayor número de canales con clasificación de selecta (P<0.0001; 17.90 y 18.50%, respectivamente y estándar (55.20 y 60.10%, respectivamente que el genotipo B. indicus (10.10% para canales selectas y 39.30% de estándar. El genotipo B. indicus concentró un mayor número de canales de grado comercial (36.20% y fuera de clasificación (14.40% (P<0.0001. Los tres genotipos de bovinos considerados (B. indicus, B. taurus y Cruzas dieron lugar a canales clasificadas como selectas, sugiriendo que el genotipo no sea un factor de sesgo en la norma de clasificación de canales de bovino mexicano NMX-FF-078-SCFI-2002.

Artesanas y artesanías: indígenas y mestizas de Chiapas construyendo espacios de cambio

OpenAIRE

María Teresa Ramos Maza

2004-01-01

El propósito de este artículo es mostrar que las mujeres indígenas artesanas y comerciantes mestizas de los Altos de Chiapas, han creado una nueva artesanía textil que se ha originado a partir de la conjunción de creatividades, intereses y habilidades de las artesanas tseltales y las comerciantes mestizas. Una de sus consecuencias es que se ha creado un espacio a través del cual han obtenido una mayor capacidad de tomar decisiones al interior de la familia, de manejar y controlar recursos, y ...

Cattle phenotypes can disguise their maternal ancestry.

Science.gov (United States)

Srirattana, Kanokwan; McCosker, Kieren; Schatz, Tim; St John, Justin C

2017-06-26

Cattle are bred for, amongst other factors, specific traits, including parasite resistance and adaptation to climate. However, the influence and inheritance of mitochondrial DNA (mtDNA) are not usually considered in breeding programmes. In this study, we analysed the mtDNA profiles of cattle from Victoria (VIC), southern Australia, which is a temperate climate, and the Northern Territory (NT), the northern part of Australia, which has a tropical climate, to determine if the mtDNA profiles of these cattle are indicative of breed and phenotype, and whether these profiles are appropriate for their environments. A phylogenetic tree of the full mtDNA sequences of different breeds of cattle, which were obtained from the NCBI database, showed that the mtDNA profiles of cattle do not always reflect their phenotype as some cattle with Bos taurus phenotypes had Bos indicus mtDNA, whilst some cattle with Bos indicus phenotypes had Bos taurus mtDNA. Using D-loop sequencing, we were able to contrast the phenotypes and mtDNA profiles from different species of cattle from the 2 distinct cattle breeding regions of Australia. We found that 67 of the 121 cattle with Bos indicus phenotypes from NT (55.4%) had Bos taurus mtDNA. In VIC, 92 of the 225 cattle with Bos taurus phenotypes (40.9%) possessed Bos indicus mtDNA. When focusing on oocytes from cattle with the Bos taurus phenotype in VIC, their respective oocytes with Bos indicus mtDNA had significantly lower levels of mtDNA copy number compared with oocytes possessing Bos taurus mtDNA (P cattle with a Bos taurus phenotype. The phenotype of cattle is not always related to their mtDNA profiles. MtDNA profiles should be considered for breeding programmes as they also influence phenotypic traits and reproductive capacity in terms of oocyte quality.

Bordelands/La frontera: the new mestiza: rompiendo las fronteras del género autobiográfico

OpenAIRE

Henríquez Betancor, María

2010-01-01

[ES]Borderlands/La Frontera: The New Mestiza (1987) es la obra más conocida y emblemática de Gloria E. Anzaldúa, la conocida escritora chicana contemporánea. En este artículo analizaremos cómo Borderlands desafía los límites de género autobiográfico tanto desde la perspectiva formal como desde el contenido de la obra. [EN]Borderlands/La Frontera: The New Mestiza (1987) is contemporary Chicana writer Gloria E. Anzaldúa’s best-known and most emblematic work. In this article we will analyze h...

Artesanas y artesanías: indígenas y mestizas de Chiapas construyendo espacios de cambio

Directory of Open Access Journals (Sweden)

María Teresa Ramos Maza

2004-02-01

Full Text Available El propósito de este artículo es mostrar que las mujeres indígenas artesanas y comerciantes mestizas de los Altos de Chiapas, han creado una nueva artesanía textil que se ha originado a partir de la conjunción de creatividades, intereses y habilidades de las artesanas tseltales y las comerciantes mestizas. Una de sus consecuencias es que se ha creado un espacio a través del cual han obtenido una mayor capacidad de tomar decisiones al interior de la familia, de manejar y controlar recursos, y de participar en la actividad política de sus localidades.

Detection and quantification of Duffy antigen on bovine red blood cell membranes using a polyclonal antibody

Directory of Open Access Journals (Sweden)

Ana Teresa B.F. Antonangelo

2012-09-01

Full Text Available Babesiosis is one of the most important diseases affecting livestock agriculture worldwide. Animals from the subspecies Bos taurus indicus are more resistant to babesiosis than those from Bos taurus taurus. The genera Babesia and Plasmodium are Apicomplexa hemoparasites and share features such as invasion of red blood cells (RBC. The glycoprotein Duffy is the only human erythrocyte receptor for Pasmodium vivax and a mutation which abolishes expression of this glycoprotein on erythrocyte surfaces is responsible for making the majority of people originating from the indigenous populations of West Africa resistant to P. vivax. The current work detected and quantified the Duffy antigen on Bos taurus indicus and Bos taurus taurus erythrocyte surfaces using a polyclonal antibody in order to investigate if differences in susceptibility to Babesia are due to different levels of Duffy antigen expression on the RBCs of these animals, as is known to be the case in human beings for interactions of Plasmodium vivax-Duffy antigen. ELISA tests showed that the antibody that was raised against Duffy antigens detected the presence of Duffy antigen in both subspecies and that the amount of this antigen on those erythrocyte membranes was similar. These results indicate that the greater resistance of B. taurus indicus to babesiosis cannot be explained by the absence or lower expression of Duffy antigen on RBC surfaces.

Recombinant lactoferrin (Lf) of Vechur cow, the critical breed of Bos indicus and the Lf gene variants.

Science.gov (United States)

Anisha, Shashidharan; Bhasker, Salini; Mohankumar, Chinnamma

2012-03-01

Vechur cow, categorized as a critically maintained breed by the FAO, is a unique breed of Bos indicus due to its extremely small size, less fodder intake, adaptability, easy domestication and traditional medicinal property of the milk. Lactoferrin (Lf) is an iron-binding glycoprotein that is found predominantly in the milk of mammals. The full coding region of Lf gene of Vechur cow was cloned, sequenced and expressed in a prokaryotic system. Antibacterial activity of the recombinant Lf showed suppression of bacterial growth. To the best of our knowledge this is the first time that the full coding region of Lf gene of B. indicus Vechur breed is sequenced, successfully expressed in a prokaryotic system and characterized. Comparative analysis of Lf gene sequence of five Vechur cows with B. taurus revealed 15 SNPs in the exon region associated with 11 amino acid substitutions. The amino acid arginine was noticed as a pronounced substitution and the tertiary structure analysis of the BLfV protein confirmed the positions of arginine in the β sheet region, random coil and helix region 1. Based on the recent reports on the nutritional therapies of arginine supplementation for wound healing and for cardiovascular diseases, the higher level of arginine in the lactoferrin protein of Vechur cow milk provides enormous scope for further therapeutic studies. Copyright © 2011 Elsevier B.V. All rights reserved.

Feed intake and weight changes in Bos indicus-Bos taurus crossbred steers following Bovine Viral Diarrhea Virus Type 1b challenge under production conditions

Science.gov (United States)

Bovine viral diarrhea virus (BVDV) has major impacts on beef cattle production worldwide, but the understanding of host animal genetic influence on illness is limited. This study evaluated rectal temperature, weight change and feed intake in Bos indicus crossbred steers (n = 366) that were challenge...

THE TAURUS SPITZER SURVEY: NEW CANDIDATE TAURUS MEMBERS SELECTED USING SENSITIVE MID-INFRARED PHOTOMETRY

International Nuclear Information System (INIS)

Rebull, L. M.; Padgett, D. L.; McCabe, C.-E.; Noriega-Crespo, A.; Carey, S. J.; Brooke, T.; Hillenbrand, L. A.; Stapelfeldt, K. R.; Angione, J. R.; Huard, T.; Terebey, S.; Audard, M.; Baldovin-Saavedra, C.; Monin, J.-L.; Menard, F.; Bouvier, J.; Fukagawa, M.; Guedel, M.; Knapp, G. R.; Allen, L. E.

2010-01-01

We report on the properties of pre-main-sequence objects in the Taurus molecular clouds as observed in seven mid- and far-infrared bands with the Spitzer Space Telescope. There are 215 previously identified members of the Taurus star-forming region in our ∼44 deg 2 map; these members exhibit a range of Spitzer colors that we take to define young stars still surrounded by circumstellar dust (noting that ∼20% of the bona fide Taurus members exhibit no detectable dust excesses). We looked for new objects in the survey field with similar Spitzer properties, aided by extensive optical, X-ray, and ultraviolet imaging, and found 148 new candidate members of Taurus. We have obtained follow-up spectroscopy for about half the candidate sample, thus far confirming 34 new members, three probable new members, and 10 possible new members, an increase of 15%-20% in Taurus members. Of the objects for which we have spectroscopy, seven are now confirmed extragalactic objects, and one is a background Be star. The remaining 93 candidate objects await additional analysis and/or data to be confirmed or rejected as Taurus members. Most of the new members are Class II M stars and are located along the same cloud filaments as the previously identified Taurus members. Among non-members with Spitzer colors similar to young, dusty stars are evolved Be stars, planetary nebulae, carbon stars, galaxies, and active galactic nuclei.

Risk factors related to resistance to Rhipicephalus (Boophilus microplus and weight gain of heifers

Directory of Open Access Journals (Sweden)

Jenevaldo Barbosa da Silva

2015-08-01

Full Text Available The aim of the present study was to evaluate the influence of age and genetics in dairy heifers on resistance to the cattle tick Rhipicephalus (Boophilus microplus and correlate these parameters with weight gain. Twenty-two heifers were evaluated from birth up to two years of age. Resistance to the cattle tick was evaluated by counting the number of engorged female ticks and subjective qualification of the larvae and nymph infestation. The animals were weighted in the first 24 hours after birth and at six, 12, 18 and 24 months of age. The average tick count and weight gain were compared by Tukey’s test at 5% significance. Subsequently, linear regression was performed to verify the strength of the association between the risk factors age and genetics and infestation by R. (B. microplus. Age and genetics were both significant risk factors for R. (B. microplus infestation in heifers. Between the third and sixth months of age, the animals showed a window of susceptibility to R. (B. microplus. Regardless of age, Bos taurus heifers had higher infestations than Bos indicus, crossbred F1 (½ B. taurus x ½ B. indicus and crossbred Gir-Holstein (Girolando (? B. taurus x ? B. indicus heifers. B. taurus heifers were heavier than B. indicus heifers at birth and had significantly greater weight gain (p < 0.01.

crossbreeding wit}i africander dam as basis . 3. post-weaning ...

African Journals Online (AJOL)

'n stelsel van rntensiewe vetmesting, het laasgenoemde drie 8os taurus vaarras nageslaggroepe opvallend beter presteer as eersgenoemde twee Bos indicus vaarras nageslaggroepe. Onder ekstensiewe veldtoestande het alle krusgeteelde groepe egter die Afrikanerkontroles geklop. Die nageslag van beide Bos indicus ...

Biomass Briquette Investigation from Pterocarpus Indicus Leaves Waste as an Alternative Renewable Energy

Science.gov (United States)

Anggono, Willyanto; Sutrisno; Suprianto, Fandi D.; Evander, Jovian

2017-10-01

Indonesia is a tropical country located in Southeast Asia. Indonesia has a lot of variety of plant species which are very useful for life. Pterocarpus indicus are commonly used as greening and easily found everywhere in Surabaya city because of its characteristics that they have dense leaves and rapid growth. Pterocarpus indicus leaves waste would be a problem for residents of Surabaya and disturbing the cleanliness of the Surabaya city. Therefore, the Pterocarpus indicus leaves waste would be used as biomass briquettes. This research investigated the calorific value of biomass briquettes from the Pterocarpus indicus leaves waste, the effect of tapioca as an adhesive material to the calorific value of biomass briquettes from the Pterocarpus indicus leaves waste, the optimum composition for Pterocarpus indicus leaves waste biomass briquette as an alternative renewable fuel and the property of the optimum resulted biomass briquette using ultimate analysis and proximate analysis based on the ASTM standard. The calorific value biomass briquettes from the Pterocarpus indicus leaves waste were performed using an oxygen bomb calorimeter at various composition of Pterocarpus indicus from 50% to 90% rising by 10% for each experiment. The experimental results showed that the 90% raw materials (Pterocarpus indicus leaves waste)-10% adhesive materials (tapioca) mixtures is the optimum composition for biomass briquette Pterocarpus indicus leaves waste. The lower the percentage of the mass of tapioca in the biomass briquettes, the higher calorific value generated.

Independent mitochondrial origin and historical genetic differentiation in North Eastern Asian cattle.

Science.gov (United States)

Mannen, H; Kohno, M; Nagata, Y; Tsuji, S; Bradley, D G; Yeo, J S; Nyamsamba, D; Zagdsuren, Y; Yokohama, M; Nomura, K; Amano, T

2004-08-01

In order to clarify the origin and genetic diversity of cattle in North Eastern Asia, this study examined mitochondrial displacement loop sequence variation and frequencies of Bos taurus and Bos indicus Y chromosome haplotypes in Japanese, Mongolian, and Korean native cattle. In mitochondrial analyses, 20% of Mongolian cattle carried B. indicus mitochondrial haplotypes, but Japanese and Korean cattle carried only B. taurus haplotypes. In contrast, all samples revealed B. taurus Y chromosome haplotypes. This may be due to the import of zebu and other cattle during the Mongol Empire era with subsequent crossing with native taurine cattle. B. taurus mtDNA sequences fall into several geographically distributed haplogroups and one of these, termed here T4, is described in each of the test samples, but has not been observed in Near Eastern, European or African cattle. This may have been locally domesticated from an East Eurasian strain of Bos primigenius.

Carbapenem-resistance and pathogenicity of bovine Acinetobacter indicus-like isolates.

Directory of Open Access Journals (Sweden)

Peter Klotz

Full Text Available The objective of this study was to characterize blaOXA-23 harbouring Acinetobacter indicus-like strains from cattle including genomic and phylogenetic analyses, antimicrobial susceptibility testing and evaluation of pathogenicity in vitro and in vivo. Nasal and rectal swabs (n = 45 from cattle in Germany were screened for carbapenem-non-susceptible Acinetobacter spp. Thereby, two carbapenem resistant Acinetobacter spp. from the nasal cavities of two calves could be isolated. MALDI-TOF mass spectrometry and 16S rDNA sequencing identified these isolates as A. indicus-like. A phylogenetic tree based on partial rpoB sequences indicated closest relation of the two bovine isolates to the A. indicus type strain A648T and human clinical A. indicus isolates, while whole genome comparison revealed considerable intraspecies diversity. High mimimum inhibitory concentrations were observed for carbapenems and other antibiotics including fluoroquinolones and gentamicin. Whole genome sequencing and PCR mapping revealed that both isolates harboured blaOXA-23 localized on the chromosome and surrounded by interrupted Tn2008 transposon structures. Since the pathogenic potential of A. indicus is unknown, pathogenicity was assessed employing the Galleria (G. mellonella infection model and an in vitro cytotoxicity assay using A549 human lung epithelial cells. Pathogenicity in vivo (G. mellonella killing assay and in vitro (cytotoxicity assay of the two A. indicus-like isolates was lower compared to A. baumannii ATCC 17978 and similar to A. lwoffii ATCC 15309. The reduced pathogenicity of A. indicus compared to A. baumannii correlated with the absence of important virulence genes encoding like phospholipase C1+C2, acinetobactin outer membrane protein BauA, RND-type efflux system proteins AdeRS and AdeAB or the trimeric autotransporter adhesin Ata. The emergence of carbapenem-resistant A. indicus-like strains from cattle carrying blaOXA-23 on transposable elements and

Morphological dimorphism in the Y chromosome of "pé-duro" cattle in the Brazilian State of Piauí

Directory of Open Access Journals (Sweden)

Carmen M.C. Britto

1999-09-01

Full Text Available "Pé-duro" (hard foot is a rare breed of beef cattle of European (Bos taurus taurus origin, originated in northern and northeastern Brazil. Y chromosome morphology, outer genital elements and other phenotypic characteristics were examined in 75 "pé-duro" bulls from the Empresa Brasileira de Pesquisa Agropecuária (Embrapa herd in the Brazilian State of Piauí. The purpose was to investigate possible racial contamination with Zebu animals (Bos taurus indicus in a cattle that has been considered closest to its European origin (B. t. taurus. The presence of both submetacentric and acrocentric Y chromosomes, typical of B. t. taurus and B. t. indicus, respectively, and the larger preputial sheath in bulls with an acrocentric Y chromosome indicated racial contamination of the "pé-duro" herd with Zebu cattle. Phenotypic parameters involving horn, dewlap, ear, chamfer, and coat color characteristics, indicative of apparent racial contamination, were not associated with acrocentric Y chromosome.Um plantel de touros "pé-duro", consistindo de 75 animais do núcleo da Embrapa envolvido com a preservação desse gado no Estado do Piauí, foi examinado quanto à morfologia do seu cromossomo Y, bem como em relação a elementos da genitália externa e outras características fenotípicas dos machos. O objetivo era investigar a contaminação racial por animais zebuínos (Bos taurus indicus num gado bovino que tem sido considerado mais próximo de sua origem européia (Bos taurus taurus. Tanto a forma submetacêntrica quanto a forma acrocêntrica do cromossomo Y, típicas das sub-espécies B. t. taurus e B. t. indicus, respectivamente, bem como maior bainha prepucial nos espécimes portadores do cromossomo Y acrocêntrico, indicativa de contaminação racial por gado zebuíno, foram detectadas no rebanho "pé-duro" mantido no núcleo da Embrapa. Outras características fenotípicas analisadas que podem informar sobre a contaminação racial aparente n

Toleransi Tanaman Peneduh Polyalthia longifolia dan Pterocarpus indicus terhadap Ganoderma sp.

Directory of Open Access Journals (Sweden)

Siti Muslimah Widyastuti

2014-08-01

Full Text Available Susceptibility of Urban Trees Polyalthia longifolia and Pterocarpus indicus to Infection of  the red root rot fungus Ganoderma sp. Urban trees on the Gadjah Mada University (UGM area play an important role in increasing environmental qualities as well as in supporting the teaching and learning processes. However, red root rot disease caused by Basidiomycete Ganoderma sp. has severely infected some existing urban trees. This experiment was aimed to determine the susceptibility of Polyalthia longifolia (glodokan and Pterocarpus indicus (angsana to the infection of Ganoderma sp. Identification of infected trees was performed in UGM area. Further steps were carried out to achieve those objectives : (1 isolation of Ganoderma spp. and testing of Koch’s postulate and (2 examination of the susceptibility of  P. longifolia and P. indicus to infection of Ganoderma sp. The susceptibility test of P. longifolia and P. indicus to Ganoderma sp. indicated that P. longifolia was more resistant to fungal pathogen infection than that of P. indicus. Based on this experiment, it can be concluded that P. longifolia is a species that is more suitable than P. indicus.  P. longifolia should be planted on the areas that have been infested with inocula of Ganoderma sp..

"The Boys Won't Let Us Play:" Fifth-Grade Mestizas Challenge Physical Activity Discourse at School

Science.gov (United States)

Oliver, Kimberly L.; Hamzeh, Manal

2010-01-01

Drawing on feminist, critical, and poststructural theories, the purpose of this research was: (a) to understand fifth-grade mestizas self-identified barriers to physical activity, and (b) to work with them to develop strategies for challenging these barriers. Data were collected over the 2005-06 school year. Our interpretations are divided into…

Ethanol Production from Lignocellulose by the Dimorphic Fungus Mucor Indicus

Energy Technology Data Exchange (ETDEWEB)

Lennartsson, P.R.; Taherzadeh, M.J. (School of Engineering, Univ. of Boraas, SE-50190, Boraas (Sweden)). e-mail: Patrik.Lennartsson@hb.se; Karimi, K. (Dept. of Chemical Engineering, Isfahan Univ. of Technology, 84156-83111, Isfahan (IR)); Edebo, L. (Dept. of Clinical Bacteriology, Univ. of Goeteborg, SE-41346, Goeteborg (Sweden))

2008-10-15

Ethanol production from dilute-acid lignocellulosic hydrolyzate by the dimorphic fungus Mucor indicus was investigated. A mixture of different forest wood chips dominated by spruce was hydrolyzed with 0.5 g/L sulfuric acid at 15 bar for 10 min, yielding different sugars including galactose, glucose, mannose, and xylose, but also different fermentation inhibitors such as acetic acid, furfural, hydroxymethyl furfural (HMF), and phenolic compounds. We induced different morphological growth of M. indicus from purely filamentous, mostly filamentous, mostly yeast-like to purely yeast-like. The different forms were then used to ferment the hydrolyzate. They tolerated the presence of the inhibitors under anaerobic batch cultivation well and the ethanol yield was 430-440 g/kg consumed sugars. The ethanol productivity depended on the morphology. Judging from these results, we conclude that M. indicus, is useful for ethanol production from toxic substrates independent of its morphology. Keywords: bio-ethanol, lignocellulosic materials, dilute acid hydrolysis, Mucor indicus, dimorphic fungi

Mestiza Consciousness in Relation to Sustained Political Solidarity: A Chicana Feminist Interpretation of the Farmworker Movement

Science.gov (United States)

Barvosa, Edwina

2011-01-01

Two of the most significant themes in Chicana feminist thought are the character of mestiza consciousness and the view that political solidarity--that is, the uniting of diverse people in common cause--should build upon diversity among peoples rather than on a single shared identity. Numerous Chicana and Latina feminists have connected these two…

Utilización de la leucaena leucocephala como suplemento en cabras en crecimiento

OpenAIRE

Clavero, Tyrone; Razz, Rosa

2009-01-01

Con el objeto de evaluar el crecimiento de cabras mestizas (Nubian x Criollo) suplementadas con Leucaena leucocephala, se realizó un ensayo en el Occidente de Venezuela en una zona caracterizada como Bosque muy Seco Tropical. Se evaluaron tres raciones: T1 (pastoreo en gramínea-Cenchrus cillaris), T2 (pastoreo en gramínea + 2 h/día en Leucaena), T3 (pastoreo en gramínea + alimento concentrado comercial, 300 g/animal/día). El diseño experimental fue de bloques completamente al azar. El peso de...

Hormonal protocols for in vitro production of Zebu and taurine embryos

Directory of Open Access Journals (Sweden)

Carlos Antônio de Carvalho Fernandes

2014-10-01

Full Text Available The objective of this work was to evaluate the effects of hormonal synchronization protocols, associated or not with follicular development stimulation, on the recovery of oocytes and on in vitro production of Bos indicus and B. taurus embryos, in different seasons. Ultrasound-guided follicular aspirations (n=237 were performed without pre-treatment (G1, control group and after follicular wave synchronization (G2, or after follicular wave synchronization and follicle growth induction (G3. Bos indicus produced more oocytes and embryos than B. taurus (18.7±0.9 vs. 11.9±0.6 oocytes and 4.8±0.3 vs. 2.1±0.2 embryos. On average, oocyte and embryo yields were higher in G3 than in G2, and both were greater than in G1, which lead to a higher conversion of oocytes to embryos in these treatments. The hot or the cold season did not affect the B. indicus outcomes, whereas, in B. taurus, both oocyte recovery and embryo production were higher in the cold season. Follicular wave synchronization improves ovum pick-up and in vitro production of embryos in both cattle subspecies evaluated.

First record of Galeodes indicus Pocock, 1900 (Arachnida: Solifugae: Galeodidae from Rajasthan, India

Directory of Open Access Journals (Sweden)

Ruquaeya Bano

2016-03-01

Full Text Available During a regular survey to collect soil arthropods in Lasiurus sindicus Henrard grassland by pitfall methods at Chandan Village near Jaisalmer City, Rajasthan, we found a dead specimen of Galeodes indicus in a sample.  Galeodes indicus (Pocock, 1900 has been reported from Madhya Pradesh, Maharashtra, Andhra Pradesh and Telangana but so far was unknown to Rajasthan, India.  In this communication, we report Galeodes indicus from Jaisalmer District, Rajasthan, India. 

Correlación entre la fertilidad y el pH uterino de vacas Holstein suplementadas con levadura de cerveza

Directory of Open Access Journals (Sweden)

Lina María Barrera-Sánchez

2011-11-01

Full Text Available En  la  región del Sugamuxi  se ha establecido  la levadura de cerveza (Saccharomyces cerevisiae como  suplemento  en  ganaderías  lecheras  por producir  aumento  de  la  producción  láctea.  El propósito de este estudio fue evaluar los cambios de pH uterino en fase estral y fase luteal de vacas Holstein suplementadas correlacionándolos con la  fertilidad. Así  se  evaluaron dos grupos: uno suplementado  (n=50  y  otro no suplementado (n=50. Se extrajeron muestras de moco uterino y se midió el pH con un pH-metro para  las dos fases del ciclo estral. Los análisis estadísticos se realizaron mediante la prueba t- student para las variables de pH  y  correlación de Pearson, para relacionar  el  pH  y  fertilidad  de  las  vacas suplementadas. Se determinó que el hecho de no encontrar diferencias significativas (plevadura de cerveza no  interfiere con el pH uterino en esta fase y, por lo tanto, tampoco interfiere en el  transporte  espermático,  la  capacidad  de desarrollo  y  fertilización  del  oocito. Además, según  los  resultados de este  trabajo,  se  logró  inferir que a pesar de la variación encontrada en el pH luteal de  las vacas suplementadas y el de vacas no suplementadas, no se altera el porcentaje de preñez  entre  los grupos; pero el hecho de que vacas  no  suplementadas  con pH  luteal <  6.0 consiguieran la gestación, hace pensar que  los pH ácidos en esta  fase pueden ser compatibles con la supervivencia del embrión.

DIVERSIDAD GENÉTICA ENTRE SUBPOBLACIONES RACIALES BOVINAS DE COSTA RICA

Directory of Open Access Journals (Sweden)

Marco Martínez

2015-01-01

Full Text Available El objetivo del estudio fue cuantificar la diversidad genética entre 16 subpoblaciones raciales bovinas de Costa Rica, con base en 1412 muestras de ADN bovino de todo el país, evaluadas mediante 18 marcadores microsatélites. El número promedio de alelos (Na por locus dentro de raza fue de 10,3, que varían entre 8 (Holstein×Jersey y 13 (Criolla para doble propósito. El número promedio de alelos efectivo (Ne fue de 5,04, con cambios entre 4,18 (Jersey y 5,64 (Bos taurus×Bos indicus. La heterocigosidad observada promedio fue de 0,77, variando entre 0,73 (Jersey y 0,81 (Bos taurus×Bos indicus. La heterocigosidad esperada (He promedio fue de 0,78, que oscilan entre 0,74 (Jersey y Holstein×Jersey y 0,81 (Bos taurus×Bos indicus, Criolla para doble propósito y Cruces para doble propósito. El contenido de información polimórfica (PIC fue de 0,76, con variaciones entre 0,71 (Jersey y Holstein×Jersey y 0,79 (Criollas para doble propósito y Cruces para doble propósito. El FIS promedio fue de 0,02, con oscilaciones entre -0,03 (Holstein×Jersey a 0,04 (Brahman, Criolla para carne y Cruces para leche. La desviación del equilibrio Hardy Weinberg no fue significativa (p>0,05 en la mayoría de los loci para las subpoblaciones raciales. El subgrupo con mayor número de loci en desequilibrio fue Jersey (8 loci, mientras que los subgrupos Bos taurus×Bos indicus, Criolla para leche y Holstein×Jersey presentaron solo 1 locus en desequilibrio. Los índices de fijación FIS (0,02, FIT (0,05 y FST (0,03 indicaron cierta tendencia hacia la homocigosidad. Los dendrogramas mostraron 3 agrupaciones raciales claramente diferenciadas que coinciden con las razas de origen Bos taurus, Bos indicus y sus respectivos cruces. Los resultados del análisis indicaron que el número de microsatélites empleados sí permitió establecer una discriminación clara a nivel de las frecuencias alélicas y en la distribución del tamaño de los alelos entre las

Efeito da idade de desmame e suplementação no desenvolvimento de novilhas de corte Effect of weaning age and supplementation on beef heifers growth

Directory of Open Access Journals (Sweden)

Luciane Salgueiro Pio de Almeida

2004-12-01

Full Text Available O experimento foi conduzido com o objetivo de avaliar o desempenho de 47 novilhas de corte cruzas Bos taurus x Bos indicus até os dois anos de idade, desmamadas precocemente (DP, com idade média de 91 dias e peso mínimo de 70 kg de peso vivo, ou desmamadas à idade convencional (DC, com média de 170 dias de idade e 130,3 kg, suplementadas (Su ou não (NSu com suplemento comercial com 14% de proteína bruta e 75% de NDT, durante 91 dias no primeiro inverno pós-desmame. Os animais do DP e o grupo não-suplementado apresentaram menores pesos vivos até um ano de idade. A idade do desmame não influenciou a taxa de prenhez das novilhas (77,3 e 72%, para o DP e DC, respectivamente. A suplementação no primeiro inverno não influenciou o desempenho das novilhas aos dois anos de idade. O desmame precoce não afetou o desenvolvimento e a fertilidade das novilhas aos dois anos de idade, quando comparado ao desmame à idade convencional.The experiment was conducted to evaluate the performance of 47 Bos taurus x Bos indicus beef heifers until two years of age. Heifers were early weaned (EW with average age of 91 days and minimum of 70 kg of liveweight or weaned at conventional age with average of 170 days and average liveweight of 130.3 kg (CW, supplemented (Su or not (NSu with concentrate containing 14% crude protein and 75% total digestible nutrients (TDN during 91 days in the first winter. The early weaning and the no supplemented group were lightier until one year of age. Weaning age did not affect pregnancy rate (77.3% and 72% to EW and CW, respectively. The supplementation during the first winter did not affect the heifers performance until two years of age. Early weaning did not affected the growth and the fertility of heifers until two years of age when compaired with the weaning at the conventional age.

Photometric peculiarities of the RY Taurus

International Nuclear Information System (INIS)

Zajtseva, G.V.

1982-01-01

The results are presented of photoelectric UBV-observations of RY Taurus carried out in 1965-80 at the Crimean Station of the State Sternberg Astronomical Institute. Two components of brightness variations are observed: fast (days) and slow (years). During fast variations the colour indices U-B and B-V change independently of brightness, however, in particular time inter-- vals the rather strong correlation with the star brightness is observed, positive or negative. During the slow variations only the reverse dependence is observed; the brightness increase is followed by the increase of colour indices (reddening of the star). The comparison of the RY TAURUS intrinsic polarization variations has shown that the dependence of polarization degree on brightness is nonmonotonic. At minimum and maximum brightness the RY TAURUS intrinsic polarization is maximum and reaches 5-6 %. At the general amplitude of RY TAURUS brightness variations in V rays from 10.sup(m)1 to 11.sup(m)7 the V=11.sup(m)0 value is singled out. First a certain ''avoidance'' of this brightness value by the star is observed. Second, the fracture in the course of polarization dependence on brightness occurs as well in the V=11sup(m) region

Meiotic Chromosome Analysis of the Giant Water Bug, Lethocerus indicus

Science.gov (United States)

Wisoram, Wijit; Saengthong, Pradit; Ngernsiri, Lertluk

2013-01-01

The giant water bug, Lethocerus indicus (Lepeletier and Serville) (Heteroptera: Belostomatidae), a native species of Southeast Asia, is one of the largest insects belonging to suborder Heteroptera. In this study, the meiotic chromosome of L. indicus was studied in insect samples collected from Thailand, Myanmar, Loas, and Cambodia. Testicular cells stained with lacto-acetic orcein, Giemsa, DAPI, and silver nitrate were analyzed. The results revealed that the chromosome complement of L. indicus was 2n = 22A + neo-XY + 2m, which differed from that of previous reports. Each individual male contained testicular cells with three univalent patterns. The frequency of cells containing neo-XY chromosome univalent (∼5%) was a bit higher than that of cells with autosomal univalents (∼3%). Some cells (∼0.5%) had both sex chromosome univalents and a pair of autosomal univalents. None of the m-chromosome univalents were observed during prophase I. In addition, this report presents clear evidence about the existence of m-chromosomes in Belostomatidae. PMID:23895100

THE DISK POPULATION OF THE TAURUS STAR-FORMING REGION

International Nuclear Information System (INIS)

Luhman, K. L.; Allen, P. R.; Espaillat, C.; Hartmann, L.; Calvet, N.

2010-01-01

We have analyzed nearly all images of the Taurus star-forming region at 3.6, 4.5, 5.8, 8.0, and 24 μm that were obtained during the cryogenic mission of the Spitzer Space Telescope (46 deg 2 ) and have measured photometry for all known members of the region that are within these data, corresponding to 348 sources, or 99% of the known stellar population. By combining these measurements with previous observations with the Spitzer Infrared Spectrograph and other facilities, we have classified the members of Taurus according to whether they show evidence of circumstellar disks and envelopes (classes I, II, and III). Through these classifications, we find that the disk fraction in Taurus, N(II)/N(II+III), is ∼75% for solar-mass stars and declines to ∼45% for low-mass stars and brown dwarfs (0.01-0.3 M sun ). This dependence on stellar mass is similar to that measured for Chamaeleon I, although the disk fraction in Taurus is slightly higher overall, probably because of its younger age (1 Myr versus 2-3 Myr). In comparison, the disk fraction for solar-mass stars is much lower (∼20%) in IC 348 and σ Ori, which are denser than Taurus and Chamaeleon I and are roughly coeval with the latter. These data indicate that disk lifetimes for solar-mass stars are longer in star-forming regions that have lower stellar densities. Through an analysis of multiple epochs of Spitzer photometry that are available for ∼200 Taurus members, we find that stars with disks exhibit significantly greater mid-infrared (mid-IR) variability than diskless stars, which agrees with the results of similar variability measurements for a smaller sample of stars in Chamaeleon I. The variability fraction for stars with disks is higher in Taurus than in Chamaeleon I, indicating that the IR variability of disks decreases with age. Finally, we have used our data in Taurus to refine the observational criteria for primordial, evolved, and transitional disks. The ratio of the number of evolved and

TAURUS - a wide field imaging Fabry-Perot spectrometer

International Nuclear Information System (INIS)

Atherton, P.D.; Taylor, K.

1983-01-01

TAURUS, an imaging Fabry-Perot system developed by the Royal Greenwich Observatory and Imperial College London, is described. The imaging process is explained and the technique is compared with grating spectrographs. It is argued that TAURUS is superior for obtaining field information from extended emission line sources. (Auth.)

Estudo genômico do nível de infecção por Babesia bovis em bovinos da raça angus

OpenAIRE

Santana, Clarissa Helena [UNESP

2016-01-01

A bovinocultura é um setor com importante destaque no agronegócio brasileiro. O carrapato Ripicephalus (Boophilus) microplus é responsável por perdas econômicas significativas aos pecuaristas e é vetor de hemoparasitoses como Anaplasma spp e Babesia spp. Sabe-se que os bovinos Bos taurus taurus são mais susceptíveis à infestação por carrapatos do que Bos taurus indicus. Acredita-se que o mesmo ocorra para a infecção por Babesia bovis. Neste trabalho, foram avaliados, em duas colheitas, 355 bo...

Diversity and ecology of Varanus indicus in Pepaya Island at Teluk Cenderawasih National Park, West Irian Jaya

Directory of Open Access Journals (Sweden)

DENY ANJELIUS IYAI

2006-04-01

Full Text Available Monitor lizard (Varanidae has dispersed widely in Indonesia, even in Papua. Papua contents of six species. It’s distribution, abundance, both in land and island have been known yet, even carrying capacity of feeding relative limited. However, species extinction rates in nature were increasing both in it. This research was done in Papaya Island in Teluk Cenderawasih National Park, Nabire, Papua since 24th -25th October 2005. Descriptive method was done to answer this study. This research resulted that in Papaya island contents only one species that is Varanus indicus. The V. indicus chosen same habitat in southern part of Papaya island. This species dispersed on 0-4 m above sea level, humidity about 78.6%, and temperature about 23.90C. Vegetation was dominated by coconut (Cocos nucifera, bitangur (Calophyllum inophyllum and tikar (Pandanus sp., papaya (Carica papaya, and ketapang (Terminalia catappa. V. indicus chosen Megapodius reinwadt nest as nesting area. Population of V. indicus was estimated as much 36.3 ≈ 36 pieces by King Method. The nest of V. indicus placed in Cassuarina sp. tree where cutting down. The diet of V. indicus was found such as megapods, sea birds, lizard (sauria, butterflies and bats (Macrochyroptera. People were caused threatened both direct and indirect toward the V. indicus existence.

SPECTROSCOPY OF PUTATIVE BROWN DWARFS IN TAURUS

International Nuclear Information System (INIS)

Luhman, K. L.; Mamajek, E. E.

2010-01-01

Quanz and coworkers have reported the discovery of the coolest known member of the Taurus star-forming complex (L2 ± 0.5), and Barrado and coworkers have identified a possible protostellar binary brown dwarf in the same region. We have performed infrared spectroscopy on the former and the brighter component of the latter to verify their substellar nature. The resulting spectra do not exhibit the strong steam absorption bands that are expected for cool objects, demonstrating that they are not young brown dwarfs. The optical magnitudes and colors for these sources are also indicative of background stars rather than members of Taurus. Although the fainter component of the candidate protostellar binary lacks spectroscopy, we conclude that it is a galaxy rather than a substellar member of Taurus based on its colors and the constraints on its proper motion.

TAURUS, Post-processor of 3-D Finite Elements Plots

International Nuclear Information System (INIS)

Brown, B.E.; Hallquist, J.O.; Kennedy, T.

2002-01-01

Description of program or function: TAURUS reads the binary plot files generated by the LLNL three-dimensional finite element analysis codes, NIKE3D (NESC 9725), DYNA3D (NESC 9909), TACO3D (NESC 9838), TOPAZ3D (NESC9599) and GEMINI and plots contours, time histories, and deformed shapes. Contours of a large number of quantities may be plotted on meshes consisting of plate, shell, and solid type elements. TAURUS can compute a variety of strain measures, reaction forces along constrained boundaries, and momentum. TAURUS has three phases: initialization, geometry display with contouring, and time history processing

Crossbreeding to increase beef production: additive and non ...

African Journals Online (AJOL)

GScholtz

2013-06-06

Jun 6, 2013 ... indicus x taurus direct heterosis effects on all weight traits were greater than .... An important advantage of partitioning breed effects as described above is .... value-unit of products under varying management and marketing ...

Efeitos da injeção de cloreto de cálcio pós-morte e tempo de maturação no amaciamento e nas perdas por cozimento do músculo Longissimus dorsi de animais Bos indicus e Bos taurus selecionados para ganho de peso Effects of postmortem calcium chloride injection and aging time on tenderness and cooking losses of Longissimus dorsi muscle from Bos indicus and Bos taurus animals selected for weight gain

Directory of Open Access Journals (Sweden)

Aparecida Carla de Moura

1999-01-01

Full Text Available O objetivo deste estudo foi avaliar o efeito da injeção pós-morte de cloreto de cálcio (CaCl2 e o tempo de maturação no amaciamento e nas perdas por cozimento do músculo longissimus dorsi de animais Bos indicus e Bos taurus selecionados para ganho de peso. Foram usados 64 machos inteiros (16 Caracu, 16 Guzerá, 16 Nelore Controle e 16 Nelore Seleção. Vinte quatro horas após o abate, foi retirada uma amostra do músculo Longissiumus dorsi (contra-filé entre a 6ª e 9ª vértebras lombares e dividida em nove subamostras. Em cada grupo de três subamostras escolhidas ao acaso, foi injetada, na quantia correspondente a 10% do seu peso, uma das seguintes soluções: a água (controle, b 200 mM de CaCl2 e c 300 mM de CaCl2. Cada subamostra foi, então, embalada a vácuo, congelada (- 2ºC e maturada por 1,7 ou 14 dias até a realização de testes de força de cisalhamento e perdas por cozimento (evaporação, gotejamento e perdas totais. Foi usado delineamento experimental completamente casualizado com parcelas subdivididas, em que a parcela correspondia à raça e a sub-parcela, à combinação entre três níveis de CaCl2 e três tempos de maturação. A raça influenciou a força de cisalhamento, mas não influiu nas perdas por cozimento A maturação por um período de sete dias reduziu os valores de força de cisalhamento e as perdas por evaporação, gotejamento e totais. Maiores concentrações de CaCl2 resultaram em menor força de cisalhamento e maiores perdas por evaporação, embora não tenham influenciado as perdas por gotejamento e totais. A concentração de 200 mM CaCl2 apresentou a melhor redução para a força de cisalhamento. A injeção pós-morte de uma solução de CaCl2 aumentou o processo de amaciamento, sem influir nas perdas por cozimento.ABSTRACT - The objective of this study was to evaluate the effect of postmortem calcium chloride (CaCl2 injection and aging time on tenderness and cooking losses of Longissimus

Biochemical polymorphism in Egyptian Baladi cattle and their relationship with other breeds.

Science.gov (United States)

Graml, R; Ohmayer, G; Pirchner, F; Erhard, L; Buchberger, J; Mostageer, A

1986-01-01

Gene frequencies were estimated in a sample of Baladi cattle for milk proteins, blood proteins and blood groups. Gene frequency estimates of Bos taurus, Bos indicus and Sanga breeds were assembled from the literature. The gene frequencies were utilized for estimating the genetic distance between the breeds and breed groups. The Egyptian Baladi cattle appeared to be closer to Bos taurus breeds than to the Sanga. They are far removed from Zebus.

Effect of Cooking on Quality Commonly Consumed Marine Fish Platycephalidae (Platycephalus indicus in Iran

Directory of Open Access Journals (Sweden)

Ali Aberoumand

2015-11-01

Full Text Available Fish Platycephalus indicus usually are consumed by southern people in Iran. The present study assessed the effect of processing on proximate compositions in the fillets of P.indicus. The fish samples were prepared by boiling, baking and frying, while proximate analysis was done by standard methods. Boiling processing method significantly reduced ash content in the fillet whereas fat content was significantly increased in frying. Baking method recorded highest ash content of 10.64%. The highest protein concentration was obtained for boiled fillet (82.73%. Lipid content was recorded highest in fried fillet (17.27%. P. indicus was, rich in fat, protein, and ash, thus its consumption should be encouraged.

Quantitative trait locus affecting birth weight on bovine chromosome 5 in a F2 Gyr x Holstein population

Directory of Open Access Journals (Sweden)

Gustavo Gasparin

2005-12-01

Full Text Available Segregation between a genetic marker and a locus influencing a quantitative trait in a well delineated population is the basis for success in mapping quantitative trait loci (QTL. To detect bovine chromosome 5 (BTA5 birth weight QTL we genotyped 294 F2 Gyr (Bos indicus x Holstein (Bos taurus crossbreed cattle for five microsatellite markers. A linkage map was constructed for the markers and an interval analysis for the presence of QTL was performed. The linkage map indicated differences in the order of two markers relative to the reference map (http://www.marc.usda.gov. Interval analysis detected a QTL controlling birth weight (p < 0.01 at 69 centimorgans (cM from the most centromeric marker with an effect of 0.32 phenotypic standard-error. These results support other studies with crossbred Bos taurus x Bos indicus populations.

Phylogenetic analysis reveals two genotypes of the emerging fungus Mucor indicus, an opportunistic human pathogen in immunocompromised patients.

Science.gov (United States)

Taj-Aldeen, Saad J; Almaslamani, Muna; Theelen, Bart; Boekhout, Teun

2017-07-12

Mucormycosis is a rare fungal infection caused by Mucor indicus. Phylogenetic analysis of many M. indicus isolates, mainly sampled from different clinical and environmental specimens collected worldwide, revealed two genotypes, I and II, based on ITS and D1/D2 LSU rDNA sequences. A retrospective review of the literature revealed 13 cases. Eight (76.9%) patients had disseminated infections, and the overall mortality rate was 30.7%. A pulmonary infection caused by M. indicus genotype I in a liver transplant recipient was disseminated to include the skin and was successfully treated with liposomal amphotericin B and aggressive surgery. M. indicus can infect a wide variety of patients with no real preference for the site of infection. We concluded that M. indicus has emerged as a significant cause of invasive mycosis in severely immunocompromised patients worldwide. Early diagnosis and initiation of appropriate therapy could enhance survival in these immunocompromised patient populations.

Bacterial flora of pond reared Penaeus indicus (Milne Edwards)

Digital Repository Service at National Institute of Oceanography (India)

Singh, I.S.B.; Lakshmanaperumalsamy, P.; Chandramohan, D.

The population size, generic diversity and potential to produce hydrolytic enzymes of heterotrophic bacteria associated with pond reared Penaeus indicus was worked out following standard bacteriological procedures. Chitinoclastic vibrios were found...

Solid CO in the Taurus dark clouds

International Nuclear Information System (INIS)

Whittet, D.C.B.; McFadzean, A.D.

1985-01-01

The infrared vibrational feature of solid state CO at 4.67 μm wavelength is detected towards five sources in or behind the dark cloud complex in Taurus. A comparison with millimetre-wave data suggests that a significant fraction (up to 40 per cent) of the CO may be depleted on to grains. The adjacent CN feature at 4.62 μm observed in W33A by previous authors is absent from the present spectra, suggesting that the grain mantles in Taurus are unannealed. (author)

Mucor indicus: biology and industrial application perspectives: a review.

Science.gov (United States)

Karimi, Keikhosro; Zamani, Akram

2013-01-01

Mucor indicus, one of the most important strains of zygomycetes fungi, has been the subject of several studies since a couple of hundred years ago. This fungus, regarded as a non-pathogenic dimorphic microorganism, is used for production of several beers and foods. Morphology of the fungus can be manipulated and well controlled by changing a number of parameters. Furthermore, M. indicus can grow on a variety of substrates including lignocellulosic hydrolysates which are mixtures of hexoses, pentoses, and different severe fermentation inhibitors. Indeed, high yield ethanol production is among the most important features of this strain. Presence of considerable amounts of chitosan in the cell wall is another important aspect of the fungus. Besides production of ethanol and chitosan, the biomass of this fungus has shown a great potential to be used as a rich nutritional source, e.g. fish feed. The fungus is also among the oleaginous fungi and produces high amounts of polyunsaturated fatty acids particularly γ-linolenic acid. Furthermore, the biomass autolysate has a high potential for yeast extract replacement in fermentation by the fungus. Additionally, the strain has shown promising results in heavy metal removal from wastewaters. This review discusses different aspects of biology and industrial application perspectives of M. indicus. Furthermore, open areas for the future basic and applied levels of research are also presented. Copyright © 2013 Elsevier Inc. All rights reserved.

Uso de extratos vegetais, vitaminas e sua associação sobre o desempenho, temperamento e qualidade de carne de bovinos nelore confinados com dieta de alto grão

OpenAIRE

Silva, Maurícia Brandão da [UNESP

2015-01-01

Fifty-six Nellore (Bos taurus indicus) young bulls of 360 (±19,8) kg initial weight and 20 month of age were used to evaluate the effect of plant extract, vitamins A, D3 supplementation and their associations on the temperament, feedlot performance (finishing phase) and meat quality of Bos indicus cattle. Animals were located in individual pens during 105 days (21 and 84 days, for adaptation and trial period, respectively). Animals were individually weighed, and blocked by initial body weight...

DESEMPEÑO PRODUCTIVO, COMPOSICIÓN Y BIODISPONIBILIDAD RELATIVA DE SELENIO EN TILAPIA NILÓTICA -Oreochromis niloticus- SUPLEMENTADA CON SELENIO ORGÁNICO E INORGÁNICO

OpenAIRE

J. E. Vinchira; G. A. Wills; A. P. Muñoz

2014-01-01

Se evaluó el desempeño productivo, la composición corporal y la biodisponibilidad relativa de selenio en tilapia nilótica ( Oreochromis niloticus ) suplementada con selenio dietario. Una dieta basal fue suplementada con selenio en forma de selenito de sodio o seleno-levadura en niveles crecientes de suplementación (0.00, 0.10, 0.20, 0.40, 0.80 y 1.60 mg/kg de dieta). Un total de 336 individuos de tilapia nilótica, con un peso inicial de 13.41±0.12 g, fueron distribuidos de forma aleatori...

Imunoidentification of Albumin and Osteopontin in Seminal Plasma of Taurine and Zebuine Bulls/ Imunoidentificação de Albumina e Osteopontina no Plasma Seminal de Reprodutores Taurinos e Zebuínos

Directory of Open Access Journals (Sweden)

Rodrigo Costa Mattos

2002-05-01

Full Text Available Two dimensional polyacrylamide gel electrophoresis was performed in seminal plasma of seven Bos taurus taurus and seven Bos taurus indicus bulls with high semen freezability, from an artificialinsemination center. In a 8% polyacrylamide gels, three bands of 195, 66 and 55 kDa, present in 100% of the samples in both sub-species, were analyzed by their optical densities. In Bos taurus samples, the opticals densities of 55 kDa band, imunoidentified as osteopontin were superior (pAs proteínas do plasma seminal de 14 reprodutores (7 Bos taurus taurus e 7 Bos taurus indicus, foram analisadas por eletroforese bidimensional, em géis de poliacrilamida a 8%, corados por Comassie Blue. Três bandas protéicas, presentes em 100% das amostras de plasma seminal, foram quantificadas de acordo com a densidade óptica exibida: 195 kDa, pI 6,5-7,5 ; 66 kDa, pI 5,4 e 55 kDa, pI 4,5. As amostras de plasma seminal provenientes de taurinos apresentaram densidades ópticas significativamente superiores (p < 0,05 às dos zebuínos na banda de 55 kDa, que foi imunoidentificada como osteopontina. As demais proteínas analisadas não apresentaram variações significativas entre as subespécies. A banda protéica de 66 kDa, foi imunoidentificada como albumina. Nas amostras provenientes de taurinos, as densidades ópticas das três bandas protéicas quantificadas não evidenciaram variação significativa entre os reprodutores. Entretanto, nos zebuínos, as densidades ópticas da albumina apresentaram diferenças significativas entre os touros (p < 0,05.

Correlation analysis of the Taurus molecular cloud complex

International Nuclear Information System (INIS)

Kleiner, S.C.

1985-01-01

Autocorrelation and power spectrum methods were applied to the analysis of the density and velocity structure of the Taurus Complex and Heiles Cloud 2 as traced out by 13 CO J = 1 → 0 molecular line observations obtained with the 14m antenna of the Five College Radio Astronomy Observatory. Statistically significant correlations in the spacing of density fluctuations within the Taurus Complex and Heiles 2 were uncovered. The length scales of the observed correlations correspond in magnitude to the Jeans wavelengths characterizing gravitational instabilities with (i) interstellar atomic hydrogen gas for the case of the Taurus complex, and (ii) molecular hydrogen for Heiles 2. The observed correlations may be the signatures of past and current gravitational instabilities frozen into the structure of the molecular gas. The appendices provide a comprehensive description of the analytical and numerical methods developed for the correlation analysis of molecular clouds

Revisiting AFLP fingerprinting for an unbiased assessment of genetic structure and differentiation of taurine and zebu cattle

NARCIS (Netherlands)

Utsunomiya, Yuri T.; Bomba, Lorenzo; Lucente, Giordana; Colli, Licia; Negrini, Riccardo; Lenstra, Johannes A.; Erhardt, Georg; Garcia, José F.; Ajmone-Marsan, Paolo; Moazami-Goudarzi, K.; Williams, J.; Wiener, P.; Olsaker, I.; Kantanen, J.; Dunner, S.; Cañón, J.; Rodellar, C.; Martín-Burriel, I.; Valentini, A.; Zanotti, M.; Holm, L. E.; Eythorsdottir, E.; Mommens, G.; Polygen, Van Haeringen; Nijman, I. J.; Dolf, G.; Bradley, D. G.

2014-01-01

Background: Descendants from the extinct aurochs (Bos primigenius), taurine (Bos taurus) and zebu cattle (Bos indicus) were domesticated 10,000 years ago in Southwestern and Southern Asia, respectively, and colonized the world undergoing complex events of admixture and selection. Molecular data, in

Marginal costs of abating greenhouse gases in the global ruminant livestock sector

NARCIS (Netherlands)

Henderson, B.; Falcucci, A.; Early, L.; Gerber, P.J.

2017-01-01

Livestock [inclusive of ruminant species, namely cattle (Bos Taurus and Bos indicus), sheep (Ovis aries), goats (Capra hircus), and buffaloes (Bubalus bubalis), and non-ruminant species, namely pigs (Sus scrofa domesticus) and chickens (Gallus domesticus)] are both affected by climate change and

Breeding programs for the main economically important traits of zebu dairy cattle

OpenAIRE

Ariosto Ardila Silva

2010-01-01

In tropical regions, Gyr and Guzerat breeds (Bos indicus) are most explored for dairy industry and are much more adapted to climate. Gyr and Guzerat are Zebu breeds very common in Brazil and they are being used to generate Bos taurus x Bos indicus crosses in order to combine good production, heat and parasite tolerance on the tropics. Breeding programs for the main economically important traits of Zebu dairy cattle have been recently introduced in Brazil and is based on the use of genetically...

Polarimetric study of the interstellar medium in Taurus Dark Clouds

International Nuclear Information System (INIS)

Hsu, J.

1985-01-01

An optical linear polarimetric survey was completed for more than 300 stars in an area of 6.5 0 x 10 0 toward the Taurus Dark Clouds Complex. It was found that the orientation of the magnetic field is roughly perpendicular to the elongation direction of the dust lanes, indicating cloud contraction along the magnetic field lines. The distance to the front edge of the dark clouds in Taurus is determined to be 126 pc. There is only insignificant amount of obscuring material between the cloud complex and the Sun. Besides the polarization data, the reddenings of about 250 stars were also obtained from the UBV photometry. The mean polarization to reddening ratio in the Taurus region is 4.6, which is similar to that of the general interstellar matter. The wavelengths of maximum polarization were determined for 30 stars in Taurus. They show an average value of lambda/sub max/ = 0.57 μm, which is only slightly higher than the mean value of the general interstellar medium, lambda/sub max/ = 0.55 μm. A few stars that show higher values of lambda/sub max/ are found near the small isolated regions of very high extinction. One such highly obscured small region where very complex long chain molecules have been discovered in the ratio spectra, is the Taurus Molecular Cloud 1

Study on the flare stars in the Taurus region

International Nuclear Information System (INIS)

Khodzhaev, A.S.

1986-01-01

The results of the search of flare stars and their photometric, Hsub(α)-spectroscopic and statistical study in the Taurus are presented. By means of photographic observations carried out during 1980-1984, 92 new flare stars were discovered, 13 of which are known Orion Population variables, and 16 repeated flare-ups among 13 known flare stars. Spatial distribution of these stars was considered and the problem of their membership was discussed. Comparative analysis of the data of flare stars in the Taurus with that of other systems has been carried out. The Herzsprung-Russel and two-colour (U-B, B-V) diagrams for the Taurus flare stars are similar to the diagrams of stellar clusters and associations (Pleiades, Orion etc.). The estimated total number of flare stars in this region is larger than 500

A WISE survey of circumstellar disks in Taurus

International Nuclear Information System (INIS)

Esplin, T. L.; Luhman, K. L.; Mamajek, E. E.

2014-01-01

We have compiled photometry at 3.4, 4.6, 12, and 22 μm from the all-sky survey performed by the Wide-field Infrared Survey Explorer (WISE) for all known members of the Taurus complex of dark clouds. Using these data and photometry from the Spitzer Space Telescope, we have identified members with infrared excess emission from circumstellar disks and have estimated the evolutionary stages of the detected disks, which include 31 new full disks and 16 new candidate transitional, evolved, evolved transitional, and debris disks. We have also used the WISE All-Sky Source Catalog to search for new disk-bearing members of Taurus based on their red infrared colors. Through optical and near-infrared spectroscopy, we have confirmed 26 new members with spectral types of M1-M7. The census of disk-bearing stars in Taurus should now be largely complete for spectral types earlier than ∼M8 (M ≳ 0.03 M ☉ ).

A WISE survey of circumstellar disks in Taurus

Energy Technology Data Exchange (ETDEWEB)

Esplin, T. L.; Luhman, K. L. [Department of Astronomy and Astrophysics, The Pennsylvania State University, University Park, PA 16802 (United States); Mamajek, E. E., E-mail: taran.esplin@psu.edu [Department of Physics and Astronomy, The University of Rochester, Rochester, NY 14627 (United States)

2014-04-01

We have compiled photometry at 3.4, 4.6, 12, and 22 μm from the all-sky survey performed by the Wide-field Infrared Survey Explorer (WISE) for all known members of the Taurus complex of dark clouds. Using these data and photometry from the Spitzer Space Telescope, we have identified members with infrared excess emission from circumstellar disks and have estimated the evolutionary stages of the detected disks, which include 31 new full disks and 16 new candidate transitional, evolved, evolved transitional, and debris disks. We have also used the WISE All-Sky Source Catalog to search for new disk-bearing members of Taurus based on their red infrared colors. Through optical and near-infrared spectroscopy, we have confirmed 26 new members with spectral types of M1-M7. The census of disk-bearing stars in Taurus should now be largely complete for spectral types earlier than ∼M8 (M ≳ 0.03 M {sub ☉}).

Interstellar ice grains in the Taurus molecular clouds

International Nuclear Information System (INIS)

Whittet, D.C.B.; Bode, M.F.; Baines, D.W.T.; Evans, A.

1983-01-01

Observations made in November 1981 using the United Kingdom Infrared Telescope (UKIRT) at Mauna Kea of the 3 μm ice absorption feature in the spectra of several obscured stars in the Taurus interstellar clouds are reported. The feature correlated in strength with extinction at visual wavelengths (Asub(v)), and is present in stars with Asub(v) as low as 4-6 mag. Ice may be widespread in the Taurus clouds, vindicating ideas on grain composition and growth first reported nearly 50 yr ago. (author)

T Tauri stars in Taurus - the IRAS view

International Nuclear Information System (INIS)

Harris, Stella; Clegg, Peter; Hughes, Joanne

1988-01-01

Statistical studies of star-formation have traditionally been beset with selection effects. We have developed a technique, using the completeness of the IRAS catalogue, which circumvents these effects. We have taken the properties of known T Tau stars within Taurus as a template to establish a purely IRAS-based definition of such sources. We then use this definition to extract, from the IRAS catalogue, all sources within a specific region of Taurus having those same IRAS properties. This wider class of source is examined and discussed. (author)

Breeds of cattle

NARCIS (Netherlands)

Buchanan, David S.; Lenstra, Johannes A.

2015-01-01

This chapter gives an overview on the different breeds of cattle (Bos taurus and B. indicus). Cattle breeds are presented and categorized according to utility and mode of origin. Classification and phylogeny of breeds are also discussed. Furthermore, a description of cattle breeds is provided.

Characterization of pterin deaminase from Mucor indicus MTCC 3513

Science.gov (United States)

Thandeeswaran, M.; Karthika, P.; Mahendran, R.; Palaniswamy, M.; Angayarkanni, J.

2018-03-01

Pterin deaminase is an amidohydrolase enzyme which hydrolyses pteridines to produce lumazine derivatives and ammonia. Even though the enzyme was shown as early as 1959 for its anticancer efficacy there was a long gap in the communique after that which was in 2013. In our study we have chosen Mucor indicus MTCC 3513 which was a promising strain for production of different industrial products.The pterin deaminase enzyme was harvested and extracellular from M. indicus. The extracellular sample was partially purified by using ethanol precipitation and ion exchange column (Hi-Trap QFF) in Fast Protein Liquid Chromatography. The molecular weight of the purified pterin deaminase enzyme was apparently determined by SDS-PAGE. The purified enzyme was further biochemically characterized. Molecular docking studies with the predicted sequence showed higher binding affinity towards folic acid interaction. The structure of this protein may open the windows for new drug targets for cancer therapy.

Analgesic Activity of Sphaeranthus indicus Linn

OpenAIRE

P. Malairajan; G. Venu Babu; A. Saral; S. Mahesh; Gitanjali

2012-01-01

The ethanol extracts of the whole plant Sphaeranthus indicus Linn. (ALSI) (Compositae) was tested for analgesic activity by tail immersion method in rat models. The test extracts were tested at 250 mg and 500 mg/kg body weight. The analgesic activity was assessed by keeping pentazocine 10 mg/kg as standard drug. The parameters studied were tail withdrawal reflex and percentage protection. In tail immersion method ALSI pretreatment caused significant increase in analgesic activity and percenta...

EGRET observations of diffuse gamma-ray emission in taurus and perseus

International Nuclear Information System (INIS)

Digel, Seth W.; Grenier, Isabelle A.

2001-01-01

We present an analysis of the interstellar gamma-ray emission observed toward the extensive molecular cloud complexes in Taurus and Perseus by the Energetic Gamma-Ray Experiment Telescope (EGRET). The region's large size (more than 300 square degrees) and location below the plane in the anticenter are advantageous for straightforward interpretation of the interstellar emission. The complex of clouds in Taurus has a distance of ∼140 pc and is near the center of the Gould Belt. The complex in Perseus, adjacent to Taurus on the sky, is near the rim of the Belt at a distance of ∼300 pc. The findings for the cosmic-ray density and the molecular mass-calibrating ratio N(H 2 )/W CO in Taurus and Perseus are compared with results for other nearby cloud complexes resolved by EGRET. The local clouds that now have been studied in gamma rays can be used to trace the distribution of high-energy cosmic rays within 1 kpc of the sun

Effect of Concentrate Supplementation on Reproductive ...

African Journals Online (AJOL)

A study was conducted in Rungwe district in Tanzania, to assess the effect of concentrate supplementation on reproductive performance of smallholder dairy cattle. Cattle used were crossbreds, mainly between Friesian (Bos taurus) and indigenous Tanzania Short Horn Zebu (Bos indicus). All animals were managed under ...

The power and pain of market-based carbon policies

NARCIS (Netherlands)

Henderson, B.; Golub, A.; Pambudi, D.; Hertel, T.; Godde, C.; Herrero, M.; Cacho, O.; Gerber, P.

2018-01-01

The objectives of this research are to assess the greenhouse gas mitigation potential of carbon policies applied to the ruminant livestock sector [inclusive of the major ruminant species—cattle (Bos Taurus and Bos indicus), sheep (Ovis aries), and goats (Capra hircus)]—with particular emphasis on

Genomic divergence of indicine and taurine cattle identified through high-density SNP genotyping

Science.gov (United States)

At an arguable date of around 330,000 years ago there were already at least two different types of cattle that became ancestors of nearly all modern cattle, the Bos primigenius taurus more adapted to temperate climates and the tropically adapted Bos primigenius indicus. Human selection exponentially...

Candidate SNPs for carcass and meat traits in Nelore animals and in their crosses with Bos taurus

Directory of Open Access Journals (Sweden)

Rogério Abdallah Curi

2012-02-01

Full Text Available The objective of this work was to evaluate the effects of single-nucleotide polymorphisms (SNPs in the genes IGF1 (AF_017143.1:g.198C>T, MSTN (AF_320998.1:g.433C>A, MYOD1 (NC_007313:g.1274A>G and MYF5 (NC_007303:g.1911A>G on carcass and meat traits in Nelore (Bos indicus and Nelore x B. taurus. A total of 300 animals were genotyped and phenotyped for rib eye area (REA, backfat thickness (BT, intramuscular fat (IF, shear force (SF and myofibrillar fragmentation index (MFI. The effects of allele substitution for each SNP were estimated by regression of the evaluated phenotypes on the number of copies of a particular allele using the general linear model. The polymorphism at IGF1 was non-informative in Nelore animals. In crossbred animals, the IGF1 C allele was associated with greater REA. However, this relation was not significant after Bonferroni correction for multiple testing. The A allele of the MSTN polymorphism was absent in Nelore cattle and was only found in two crossbred animals. The polymorphisms of MYOD1 and MYF5 were little informative in Nelore animals with G allele frequency of 0.097 and A allele frequency of 0.031, respectively. These markers show no association with the analyzed traits in the total sample of evaluated animals.

B- AND A-TYPE STARS IN THE TAURUS-AURIGA STAR-FORMING REGION

International Nuclear Information System (INIS)

Mooley, Kunal; Hillenbrand, Lynne; Rebull, Luisa; Padgett, Deborah; Knapp, Gillian

2013-01-01

We describe the results of a search for early-type stars associated with the Taurus-Auriga molecular cloud complex, a diffuse nearby star-forming region noted as lacking young stars of intermediate and high mass. We investigate several sets of possible O, B, and early A spectral class members. The first is a group of stars for which mid-infrared images show bright nebulae, all of which can be associated with stars of spectral-type B. The second group consists of early-type stars compiled from (1) literature listings in SIMBAD, (2) B stars with infrared excesses selected from the Spitzer Space Telescope survey of the Taurus cloud, (3) magnitude- and color-selected point sources from the Two Micron All Sky Survey, and (4) spectroscopically identified early-type stars from the Sloan Digital Sky Survey coverage of the Taurus region. We evaluated stars for membership in the Taurus-Auriga star formation region based on criteria involving: spectroscopic and parallactic distances, proper motions and radial velocities, and infrared excesses or line emission indicative of stellar youth. For selected objects, we also model the scattered and emitted radiation from reflection nebulosity and compare the results with the observed spectral energy distributions to further test the plausibility of physical association of the B stars with the Taurus cloud. This investigation newly identifies as probable Taurus members three B-type stars: HR 1445 (HD 28929), τ Tau (HD 29763), 72 Tau (HD 28149), and two A-type stars: HD 31305 and HD 26212, thus doubling the number of stars A5 or earlier associated with the Taurus clouds. Several additional early-type sources including HD 29659 and HD 283815 meet some, but not all, of the membership criteria and therefore are plausible, though not secure, members.

Phylogenetic analysis reveals two genotypes of the emerging fungus Mucor indicus, an opportunistic human pathogen in immunocompromised patients

NARCIS (Netherlands)

Taj-Aldeen, Saad J.; Almaslamani, Muna; Theelen, B.J.F.; Boekhout, Teun

2017-01-01

Mucormycosis is a rare fungal infection caused by Mucor indicus. Phylogenetic analysis of many M. indicus isolates, mainly sampled from different clinical and environmental specimens collected worldwide, revealed two genotypes, I and II, based on ITS and D1/D2 LSU rDNA sequences. A retrospective

INFLUENCIA DE LOS ÓRGANOS REPRODUCTORES SOBRE LA FERTILIDAD EN VAQUILLONAS MESTIZAS INSEMINADAS A TIEMPO FIJO

Directory of Open Access Journals (Sweden)

Gustavo Adolfo Hidalgo Bravo

2012-12-01

Full Text Available El propósito de esta investigación fue evaluar el peso corporal y las influencias de las diferentes caracterizaciones del tracto reproductivo de vaquillonas y su relación con la tasa de preñez en programas de inseminación artificial en tiempo fijo (IATF. Las vaquillonas (n=38 utilizadas fueron cruza mestizas, condición corporal de 3 a 4 (Escala 1 al 5 de 20 a 30 meses de edad, las que tenían un peso corporal de 320 a 400 kg. El día pre sincronización todas las vaquillonas fueron examinadas por ecógrafo transrectal Aquila Vet 7.5 MHz, donde se determinó el diámetro uterino (cm, área ovárica (cm², área de estructuras ováricas (cm². Día cero se colocó dispositivo intravaginal 0.5 mg progesterona, conjunto con una inyección intramuscular de 1 mg de Benzoato Estradiol; día 8 retiro del dispositivo más administración intramuscular de 500 µg de D (+ Cloprostenol; día 9 aplicación intramuscular de 0.75 mg de benzoato estradiol. Inseminando 54-57 h de retirado el dispositivo intravaginal. Se diagnosticó gestación 60 días post IATF. No se registraron diferencias significativas (P>0.05, entre peso corporal, útero, ovario izquierdo, y estructuras ováricas, solo encontrándose diferencias significativas en el ovario derecho. Se concluye que el área del ovario derecho influye positivamente sobre la tasa de preñez, en cuanto al mejor umbral en pronóstico de la preñez para seleccionar una vaquillona mestiza en función del ovario derecho el estándar 4.80 cm², es el apropiado.

For a Critique of Transatlantic Mestiza Territoriality: Challenging the Angolan-Cuban Revolutionary Community

Directory of Open Access Journals (Sweden)

Magdalena López

2017-11-01

Full Text Available This essay presents the transatlantic confluence of two hegemonic cultural traditions; the ideology of mestizaje and lusotropicalismo in the discourses of the Angolan and Cuban socialist regimes. The shared political utopia during the Angolan Civil War envisioned a South-South community, racially homogeneous. In the last part of the essay I review the works Dulces guerreros cubanos (1999 by Norberto Fuentes, Desconfiemos de los amaneceres apacibles (2011 by Emilio Comas Paret, Geração da Utopía (1992 by Pepetela, and Estação das Chuvas (1996 by José Eduardo Agualusa, in order to demonstrate socio-racial conflicts embedded in the leftist armed struggle. These narratives challenge the homogeneity of official discourses about identity that sustained the transatlantic mestiza territoriality. In doing so, they note a historical continuity of inequality and authoritarianism between colonial and postcolonial, between pre-national and revolutionary nation.

9 CFR 94.0 - Definitions.

Science.gov (United States)

2010-01-01

... than poultry or game birds). Bovine. Bos taurus, Bos indicus, and Bison bison. Bovine spongiform... loaded with meat product, or the areas at various points along the belt in an oven chamber, slowest to.... Game birds. Migratory birds, including certain ducks, geese, pigeons, and doves (“migratory” refers to...

A study of flare stars in the taurus region

International Nuclear Information System (INIS)

Khodzhaev, A.S.

1986-01-01

The results are given of a search for flare stars in the region of the dark clouds in Taurus together with the results of photometric, H /sub alpha/ -spectroscopic, and statistical investigations of them. Photographic observations during 1980-1984 revealed 92 new flare stars, 13 of which were found to be known Orion variables with 16 repeated flares of 13 previously known flare stars. Their apparent distribution is considered. The question of whether the flare stars belong to a dark cloud is discussed. A comparative analysis of the flare stars in the Taurus region and other aggregates is made. The Hertzsprung-Russell (V, B - V) and two-color (U - B, B - V) diagrams for the flare stars are similar to the corresponding diagrams constructed for star clusters and associations (Pleiades, Orion, etc.). The total number of flare stars in the region of the dark clouds in Taurus is estimated at ≥ 500

Urinary catecholamine concentrations in three beef breeds at ...

African Journals Online (AJOL)

Handling and transport of live animals is a stressful experience for animals. The temperaments of cattle affect their behaviour and differ between breeds, i.e. studies have shown that Bos indicus types are more temperamental than Sanga and Bos taurus types. Catecholamines (CAT's) are considered as indicators of stress, ...

The first complete mitochondrial genome of a Belostomatidae species, Lethocerus indicus, the giant water bug: An important edible insect.

Science.gov (United States)

Devi, Kshetrimayum Miranda; Shantibala, Tourangbam; Debaraj, Hajarimayum

2016-10-10

Lethocerus indicus of the family Belostomatidae is one of the most preferred and delicious edible insects in different parts of South-East Asia including North-East, India. The mitogenome of L. indicus represents the first complete mitogenome sequence of a Belostomatidae species in Heteroptera order. The mitogenome of L. indicus is 16,251bp and contains 37 genes including 13 protein coding genes (PCGs), 22 tRNA genes, two rRNA genes, and a large non-coding region. The genome has a typical gene order which is identical to other Heteroptera species. All tRNAs exhibit the classic cloverleaf secondary structure except tRNASer (AGN). All the PCGs employ a complete translation termination codon either TAA or TAG except COII. The nucleotide composition showed heavy biased toward AT accounting to 70.9% of total mitogenome. The overall A+T content of L. indicus mitogenome was comparatively lower than some other Heteropteran bugs mitogenomes. The control region is divided into seven different parts which includes the putative stem loop, repeats, tandem repeats, GC and AT rich regions. The phylogenetic relationship based on maximum-likelihood method using all protein coding genes was congruent with the traditional morphological classification that Belostomatidae is closely related to Nepidae. The complete mitogenome sequence of L. indicus provides fundamental data useful in conservation genetics and aquaculture diversification. Copyright © 2016. Published by Elsevier B.V.

A near-infrared survey for pre-main sequence stars in Taurus

Science.gov (United States)

Gomez, Mercedes; Kenyon, Scott J.; Hartmann, Lee

1994-01-01

We present a near-infrared survey of approximately 2 sq deg covering parts of L1537, L1538, and Heiles cloud 2 in the Taurus-Auriga molecular cloud. Although this study is more sensitive than previous attempts to identify pre-main sequence stars in Taurus-Auriga, our survey regions contain only one new optically visible, young star. We did find several candidate embedded protostars; additional 10 micrometer photometry is necessary to verify the pre-main sequence nature of these sources. Our results--combined with those of previous surveys--show that the L1537/L1538 clouds contain no pre-main sequence stars. These two clouds are less dense than the active star formation sites in Taurus-Auriga, which suggests a cloud must achieve a threshold density to form stars.

Llllan, w. WAIBOCPH, Keith, T. BALLINGALI, Niall, n. MACHUGA ...

African Journals Online (AJOL)

African cattle are a hi ghly divergent population possibly due tointrogression by Asian Bos indicus Oiumped) cattle and more recently European B. taurus ... highly divergent Asian, African and European allelic families. This describes signiñcant allelic ..... J. Tïssue Culture Methods Il: 101. 13. Bembridge, G.P. Parsons, K,R., ...

Anti-oxidant and anti-hyperlipidemic activity of Hemidesmus indicus in rats fed with high-fat diet

Directory of Open Access Journals (Sweden)

Suganya Venkateshan

2016-08-01

Full Text Available Objective: Dietary changes playmajor risk roles in oxidative stress andcardiovascular disease and modulate normal metabolic function. The present study was designed to investigate the ameliorative potential of different extracts of Hemidesmus indicus to experimental high-fat diet in wistar rats, and their possible mechanism of action.  Materials and Methods: Male wistar rats were divided into 6 groups (n=6/group andfed with a standard diet (control, high-fat diet (HFD, high-fat diet supplemented with different extracts and positive control for 9 weeks. High-fat diet induced changes in average body weight andoxidative stress and elevated levels of plasma lipid profilein rats. Results: Oral administration of methanolic extract of H. indicus(200 mg/kg offered a significant dose-dependent protection against HFD-induced oxidative stress, as reflected in the levels of catalase (pConclusion: The present study revealed that the methanolic extract of H.indicus protects against oxidative stress, hyperlipidemia and liver damage.

Época de nascimento, genótipo e sexo de terneiros cruzas taurinos e zebuínos sobre o peso ao nascer, à desmama e eficiência individual de primíparas Hereford

OpenAIRE

Mendonça,Gilson de; Pimentel,Marcelo Alves; Cardellino,Ricardo Alberto; Osório,José Carlos da Silveira

2003-01-01

O objetivo deste trabalho foi avaliar o efeito da época de nascimento, genótipo e sexo do terneiro sobre a eficiência individual das vacas à desmama (relação percentual entre o peso do terneiro à desmama e o peso da vaca), peso ao nascer e peso à desmama dos terneiros. Foram utilizadas 48 vacas da raça Hereford (Bos taurus), com idade de três anos, manejadas sobre campo natural, 16 inseminadas com um touro da raça Red Angus (Bos taurus) e 32 com Nelore (Bos indicus). Os fatores estudados fora...

Observación de la conducta homosexual en un rebaño de vacas mestizas de doble propósito

OpenAIRE

Lozada Melero, Rafael Enrique

2011-01-01

La identificación de la conducta homosexual de las hembras bovinos de la ganadería mestiza de doble propósito en la República Bolivariana de Venezuela, particularmente en el estado Trujillo; ha sido poco estudiada a pesar de ser una importante herramienta en la unidad de producción bajo programas de inseminación artificial. Para determinar la frecuencia de los principales síntomas y signo del celo, así como su relación con el diagnostico de la gestación por vía transrectal, en una finca (...

Some aspects of the epidemiology of Babesia bovis in Santana do Livramento, Southern Brazil

International Nuclear Information System (INIS)

Martins, J.R.; Correa, B.L.; Cereser, V.H.; Arteche, C.C.P.; Guglielmone, A.A.

1998-01-01

Some aspects of the epidemiology of Babesia bovis were studied in Santana do Livramento, Rio Grande do Sul, Brazil by analysing cattle raising practices applied to 101 herds and by diagnosing B. bovis antibodies in cattle of about 11 months old using an enzyme linked immunosorbent assay. Herds with prevalence of antibodies ranging between 15% to 80% were considered at risk of babesiosis outbreaks of economic importance (enzootic instability). 53% of herds were found in enzootic instability to B. bovis. The proportion of Bos taurus and B. indicus x B. taurus herds in instability were similar (P=0.771, qui square) and the number of acaricides treatments applied yearly had no influence in the instability to B. bovis (P=0.866, chi square). Herds maintained along with sheep in a ratio < 1.5 (P=0.012, chi square); this probability was further increased in herds maintained on properties greater than 500 ha (P=0.057, chi square). High B. bovis antibody prevalence was found in B. taurus x B. indicus herds subjected to an average of 5.8 tick treatments yearly with long residual period acaricides, indicating misuse of the chemicals or tick resistance to them. The epidemiological situation to B. bovis seems to justify vaccination to avoid economic losses in herds in enzootic instability and those in enzootic stability due to low antibody prevalence. (author)

Optimization of xylanase production by Mucor indicus, Mucor hiemalis, and Rhizopus oryzae through solid state fermentation

Directory of Open Access Journals (Sweden)

Sanaz Behnam

2016-03-01

Full Text Available Introduction: Xylan is the main hemicellulosic polymer in a number of lignocelluloses which can be hydrolyzed by xylanolytic enzymes. One of the main ways for enzymes production is solid state fermentation (SSF. The ability of three fungal strains (Mucor indicus, Mucor hiemalis, and Rhizopus oryzae for xylanase production on wheat bran by SSF was investigated. Materials and methods: The effects of cultivation temperature, medium moisture content, and cultivation time on the enzyme production were investigated. Experiments were designed with an orthogonal central composite design on three variables using response surface methodology (RSM. Analysis of variance was applied and the enzyme production was expressed with a mathematical equation as a function of the three factors. The optimum operating conditions for the enzyme production was obtained. Results: For xylanase production by M. indicus, M. hiemalis and R. oryzae the optimum temperatures were 40.0, 43.4 and 43.4ºC respectively. These values were 49.8, 54.2 and 71.8% for moisture percent and 51.3, 53.2 and 53.5 h for cultivation time. The highest enzyme activities per g of dry substrate (gds were 43.1, 43.8 and 25.9 U/gds for M. indicus, M. hiemalis and R. oryzae respectively. Discussion and conclusion: All the fungi were able to produce xylanase. Maximum xylanase production was predicted by M. indicus and M. hiemalis at similar optimum conditions, while R. oryzae produced relatively lower xylanase activity even at the best condition. 

CO survey of the dark nebulae in Perseus, Taurus, and Auriga

International Nuclear Information System (INIS)

Ungerechts, H.; Thaddeus, P.

1987-01-01

A new SIS receiver with extremely low noise temperature, used on the Columbia 1.2-m telescope has permitted mapping CO rapidly with full sampling. Results are presented of a survey for which the angular resolution of the telescope was reduced to 0.5 deg, allowing the observations for the complete region of 750 square degrees to be finished within four months, while retaining sufficient resolution to see significant substructure. Most positions with emission are in the Taurus-Auriga dark nebulae, a cloud associated with IC 348 and NGC 1333, and a cloud associated with the California nebula (NGC 1499) and NGC 1579, which overlaps the northern Taurus-Auriga nebulae but is separated from them in velocity. Also seen were several small clouds at Galactic latitude -25 deg to -35 deg southwest of the Taurus clouds, and the L1558 and L1551 clouds in the south. 89 references

The effect of dietary rations on the gut morphology of Zebu Cattle ...

African Journals Online (AJOL)

Studies in the Bos taurus cattle have shown the gut morphology to be affected by diet, but there is a paucity of such information in the Bos indicus cattle. A study was conducted to evaluate the morphology of digestive tract of the Tanzanian Short Horn Zebu (TSHZ) cattle under different dietary treatments. A total of 54 TSHZ ...

Factors influencing recalving rate in lactating beef cows in the sweet ...

African Journals Online (AJOL)

goups the majority was also late calving. Recalving rate was high in all other breeding groups and was not influenced by date of calving. In general, Bos taurus type cows calve significantly earlier in the calving season than Bos indicus types (Bonsma &. Skinner, 1969; Holroyd et al., 1979; Gotti el a/., 1985). This is to some ...

NEW YOUNG STAR CANDIDATES IN THE TAURUS-AURIGA REGION AS SELECTED FROM THE WIDE-FIELD INFRARED SURVEY EXPLORER

International Nuclear Information System (INIS)

Rebull, L. M.; Padgett, D. L.; Noriega-Crespo, A.

2011-01-01

The Taurus Molecular Cloud subtends a large solid angle on the sky, in excess of 250 deg 2 . The search for legitimate Taurus members to date has been limited by sky coverage as well as the challenge of distinguishing members from field interlopers. The Wide-field Infrared Survey Explorer has recently observed the entire sky, and we take advantage of the opportunity to search for young stellar object (YSO) candidate Taurus members from a ∼260 deg 2 region designed to encompass previously identified Taurus members. We use near- and mid-infrared colors to select objects with apparent infrared excesses and incorporate other catalogs of ancillary data to present a list of rediscovered Taurus YSOs with infrared excesses (taken to be due to circumstellar disks), a list of rejected YSO candidates (largely galaxies), and a list of 94 surviving candidate new YSO-like Taurus members. There is likely to be contamination lingering in this candidate list, and follow-up spectra are warranted.

Feeding efficiency of Penaeus indicus and Metapenaeus dobsoni in different experimental substrata

Digital Repository Service at National Institute of Oceanography (India)

Devi, C.B.L.; Balasubramanian, T.; Iyer, H.K.; Kutty, M.K.

Preying efficiency in the substrata of different concentrations of mud sand, silt and clay and also in mud from natural habitat was examined with respect to Penaeus indicus and Metapenaeus dobsoni in order to understand the factors in their natural...

Genome sequence of the thermophilic sulfate-reducing ocean bacterium Thermodesulfatator indicus type strain (CIR29812T)

Energy Technology Data Exchange (ETDEWEB)

Anderson, Iain [U.S. Department of Energy, Joint Genome Institute; Saunders, Elizabeth H [Los Alamos National Laboratory (LANL); Lapidus, Alla L. [U.S. Department of Energy, Joint Genome Institute; Nolan, Matt [U.S. Department of Energy, Joint Genome Institute; Lucas, Susan [U.S. Department of Energy, Joint Genome Institute; Tice, Hope [U.S. Department of Energy, Joint Genome Institute; Glavina Del Rio, Tijana [U.S. Department of Energy, Joint Genome Institute; Cheng, Jan-Fang [U.S. Department of Energy, Joint Genome Institute; Han, Cliff [Los Alamos National Laboratory (LANL); Tapia, Roxanne [Los Alamos National Laboratory (LANL); Goodwin, Lynne A. [Los Alamos National Laboratory (LANL); Pitluck, Sam [U.S. Department of Energy, Joint Genome Institute; Liolios, Konstantinos [U.S. Department of Energy, Joint Genome Institute; Mavromatis, K [U.S. Department of Energy, Joint Genome Institute; Pagani, Ioanna [U.S. Department of Energy, Joint Genome Institute; Ivanova, N [U.S. Department of Energy, Joint Genome Institute; Mikhailova, Natalia [U.S. Department of Energy, Joint Genome Institute; Pati, Amrita [U.S. Department of Energy, Joint Genome Institute; Chen, Amy [U.S. Department of Energy, Joint Genome Institute; Palaniappan, Krishna [U.S. Department of Energy, Joint Genome Institute; Land, Miriam L [ORNL; Hauser, Loren John [ORNL; Jeffries, Cynthia [Oak Ridge National Laboratory (ORNL); Chang, Yun-Juan [ORNL; Brambilla, Evelyne-Marie [DSMZ - German Collection of Microorganisms and Cell Cultures GmbH, Braunschweig, Germany; Rohde, Manfred [HZI - Helmholtz Centre for Infection Research, Braunschweig, Germany; Spring, Stefan [DSMZ - German Collection of Microorganisms and Cell Cultures GmbH, Braunschweig, Germany; Goker, Markus [DSMZ - German Collection of Microorganisms and Cell Cultures GmbH, Braunschweig, Germany; Detter, J. Chris [U.S. Department of Energy, Joint Genome Institute; Woyke, Tanja [U.S. Department of Energy, Joint Genome Institute; Bristow, James [U.S. Department of Energy, Joint Genome Institute; Eisen, Jonathan [U.S. Department of Energy, Joint Genome Institute; Markowitz, Victor [U.S. Department of Energy, Joint Genome Institute; Hugenholtz, Philip [U.S. Department of Energy, Joint Genome Institute; Kyrpides, Nikos C [U.S. Department of Energy, Joint Genome Institute; Klenk, Hans-Peter [DSMZ - German Collection of Microorganisms and Cell Cultures GmbH, Braunschweig, Germany

2012-01-01

Thermodesulfatator indicus Moussard et al. 2004 is a member of the genomically so far poorly characterized family Thermodesulfobacteriaceae in the phylum Thermodesulfobacteria. Members of this phylum are of interest because they represent a distinct, deep-branching, Gram-negative lineage. T. indicus is an anaerobic, thermophilic, chemolithoautotrophic sulfate reducer isolated from a deep-sea hydrothermal vent. Here we describe the features of this organism, together with the complete genome sequence, and annotation. The 2,322,224 bp long chromosome with its 2,233 protein-coding and 58 RNA genes is a part of the Genomic Encyclopedia of Bacteria and Archaea project.

Growth and maturation of Penaeus indicus under blue and green light

African Journals Online (AJOL)

growth of the penaeid prawn Penaeus indicus was tested by comparing dim green ... light quantity and quality. tank size and/or handling stress. It was decided to ... Three circular, temperature-controlled 8000 e (2,8 m diameter) glass ... of eggs and nauplii in the water. Occasional ..... Penaeus vannamei Boone. J. expo mar.

CO survey of the dark nebulae in Taurus and Perseus

International Nuclear Information System (INIS)

Baran, G.P.

1986-01-01

The thesis reports a large-scale survey of carbon monoxide ( 12 CO) emission (at λ = 2.6 mm) from dark nebulae in Taurus and Perseus. CO spectra at 4395 points were obtained within an area of about 800 square degrees generally west of the galactic anti-center. The spatial resolution of the instrument was eight arcminutes and velocity resolution was 2.6 km s -1 /. CO emission is strongest wherever extinction by dust is greatest, spilling over the apparent outer boundaries of the dust clouds observed optically. Combining CO velocity for the nebulae with optically determined distances shows that the clouds in the survey area form several layers. The molecular cloud mass closest to the sun is the Taurus and Auriga complex about 150 +/- 50 pc). Nearer to the Per )B2 OB association (at 350 +/- 100 pc) than the Taurus clouds are the Per OB2 molecular cloud (350 +/- 100 pc) and the California Nebula = NGC15979 molecular clouds (at 400 +/- 150 pc). Cloud masses were determined from integrated CO emission intensity alone by assuming that γ-ray emission intensities can be used to relate H 2 column densities to CO emission intensities

Biochemical changes of Litopenaeus vannamei and Fenneropenaeus indicus in the different stages of WSSV infection

Directory of Open Access Journals (Sweden)

Ramachandran Shalini

2013-01-01

Full Text Available Objective: To find out the difference in the proximate composition and fatty acid profile of both the species of shrimp Litopenaeus vannamei (L. vannamei and Fenneropenaeus indicus (F. indicus infected with different stages of white spot syndrome virus (WSSV. Methods: Standard methods were followed by estimating the proximate composition and fatty acid analysis. Each fish specimens were beheaded, eviscerated and filleted manually. The tissue samples were oven dried at 67 °C for 24 h. Then the samples were grounded finely with pestle and mortar. The saponified samples were cooled at room temperature for 25 min. They were acidified and methylated by adding 2 mL 54% 6 mol/L HCL in 46% aqueous methanol and incubated at 80 °C for 10 min in water bath. Following the base wash step, the fatty acid methyl esters were cleaned in anhydrous sodium sulphate and then transferred into gas chromatograph sample vial for analysis. Fatty acid methyl esters were separated by gas chromatograph. Results: The proximate composition was higher in the both control tissue than the three (low, moderate, severe infected ones. For L. vannamei and F. indicus, the carbohydrates are 5.07% and 6.18%, and the proteins are 25.01% and 22.17%, respectively. Lipid level recorded was little higher in the shrimps maintained and showed severe sign of WSSV infection than the control and the fatty acid profile result revealed that saturated fatty acids and monounsaturated fatty acid was in higher [48.72% (Severe & 16.87% (low] L. vannamei. In the polyunsaturated fatty acid, F. indicus was 40.47% (low. Conclusions: Our study showed that the healthy shrimps are nutritionally rich than the WSSV affected shrimps.

Biochemical changes of Litopenaeus vannamei and Fenneropenaeus indicus in the different stages of WSSV infection

Directory of Open Access Journals (Sweden)

Ramachandran Shalini

2013-08-01

Full Text Available Objective: To find out the difference in the proximate composition and fatty acid profile of both the species of shrimp Litopenaeus vannamei (L. vannamei and Fenneropenaeus indicus (F. indicus infected with different stages of white spot syndrome virus (WSSV. Methods: Standard methods were followed by estimating the proximate composition and fatty acid analysis. Each fish specimens were beheaded, eviscerated and filleted manually. The tissue samples were oven dried at 67 °C for 24 h. Then the samples were grounded finely with pestle and mortar. The saponified samples were cooled at room temperature for 25 min. They were acidified and methylated by adding 2 mL 54% 6 mol/L HCL in 46% aqueous methanol and incubated at 80 °C for 10 min in water bath. Following the base wash step, the fatty acid methyl esters were cleaned in anhydrous sodium sulphate and then transferred into gas chromatograph sample vial for analysis. Fatty acid methyl esters were separated by gas chromatograph. Results: The proximate composition was higher in the both control tissue than the three (low, moderate, severe infected ones. For L. vannamei and F. indicus, the carbohydrates are 5.07% and 6.18%, and the proteins are 25.01% and 22.17%, respectively. Lipid level recorded was little higher in the shrimps maintained and showed severe sign of WSSV infection than the control and the fatty acid profile result revealed that saturated fatty acids and monounsaturated fatty acid was in higher [48.72% (Severe & 16.87% (low] L. vannamei. In the polyunsaturated fatty acid, F. indicus was 40.47% (low. Conclusions: Our study showed that the healthy shrimps are nutritionally rich than the WSSV affected shrimps.

Resorptive tooth root lesions in the Malayan tapir (Tapirus indicus).

Science.gov (United States)

Da Silva, Mari-Ann O; Kortegaard, Hanne E; Choong, Siew Shean; Arnbjerg, Jens; Bertelsen, Mads F

2011-03-01

Facial abscessation and osteomyelitis due to dental disease is commonly seen in the Malayan tapir (Tapirus indicus), but little is known about the prevalence or etiology of these lesions. To determine the prevalence of dental ailments, 56 skulls and mandibles of deceased Malayan tapirs were visually and radiographically evaluated. Dental lesions were scored according to severity, and individuals were classified according to their age (juvenile/ young adult/adult) and origin (captive/free ranging). All of the lesions identified were of a resorptive nature. seemingly originating at the cementoenamel junction and burrowing towards the center of the tooth. Overall, 27% of the investigated skulls presented radiolucent dental lesions. The prevalence among captive animals was 52% (13/25), while only 6% (2/31) of the free-ranging tapirs had dental lesions. The second, third, and fourth premolars and first molar were the teeth most commonly affected, and the mandibular teeth were more often involved than the maxillary dentition. This study demonstrates a high prevalence of resorptive dental lesions in captive Malayan tapirs and provides a strong indication that age and captivity are significant risk factors in the development of these lesions. Dental disease, Malayan tapir, radiology, resorptive lesions, Tapirus indicus.

New insights on multiplicity and clustering in Taurus.

Science.gov (United States)

Joncour, Isabelle; Duchene, Gaspard; Moraux, Estelle; Mundy, Lee

2018-01-01

Multiplicity and clustering of young stars are critical clues to constraint star formation process. The Taurus molecular complex is the archetype of a quiescent star forming region that may retain primeval signature of star formation.Using statistical and clustering tools such as nearest neighbor statistics, correlation functions and the density-Based Spatial Clustering of Applications with Noise (DBSCAN) algorithm, this work reveals new spatial substructures in Taurus.We have identified unexpected ultra wide pairs (UWPs) candidates of high order multiplicity in Taurus in the 5-60 kAU separation range (Joncour et al 2017), beyond the separation assessed for wide pairs (Kraus & Hillenbrand 2009).Our work reveals 20 local stellar substructures, the Nested Elementary Structures (NESTs). These NESTs contain nearly half the stars of Taurus and 75% of the Class 0/I objects probing that they are the preferred sites of star formation (Joncour et al, sub.). The NESTs size ranges from few kAU up to 80 kAU making a length scale bridge between wide pairs and loose group (few hundreds kAU, Kirk & Myers, 2011). The NESTs mass ranges from 0.5-10 solar mass. The balance between Class I, II and III in NESTs suggests that they may be ordered as an evolutionary temporal scheme, some of them got infertile, while other shelter stars in infancy.The UWPs and the NESTs may be pristine imprints of their spatial configuration at birth. The UWPs population may result from a cascade fragmentation scenario of the natal molecular core. They could be the older counterparts, to the 0.5 Myr prestellar cores/Class 0 multiple objects observed at radio/millimeter wavelengths (Tobin et al 2010, 2016) and the precursors of the large number of UWPs (10–100 kAU) recently identified in older moving groups (Floriano-Alonso et al, 2015 ; Elliot et al 2016). The NESTs may result from the gravitational collapse of a gas clump that fragments to give a tight collection of stars within few millions years

Effects of Plant Growth Hormones on Mucor indicus Growth and Chitosan and Ethanol Production.

Science.gov (United States)

Safaei, Zahra; Karimi, Keikhosro; Golkar, Poorandokht; Zamani, Akram

2015-07-22

The objective of this study was to investigate the effects of indole-3-acetic acid (IAA) and kinetin (KIN) on Mucor indicus growth, cell wall composition, and ethanol production. A semi-synthetic medium, supplemented with 0-5 mg/L hormones, was used for the cultivations (at 32 °C for 48 h). By addition of 1 mg/L of each hormone, the biomass and ethanol yields were increased and decreased, respectively. At higher levels, however, an inverse trend was observed. The glucosamine fraction of the cell wall, as a representative for chitosan, followed similar but sharper changes, compared to the biomass. The highest level was 221% higher than that obtained without hormones. The sum of glucosamine and N-acetyl glucosamine (chitin and chitosan) was noticeably enhanced in the presence of the hormones. Increase of chitosan was accompanied by a decrease in the phosphate content, with the lowest phosphate (0.01 g/g cell wall) being obtained when the chitosan was at the maximum (0.45 g/g cell wall). In conclusion, IAA and KIN significantly enhanced the M. indicus growth and chitosan production, while at the same time decreasing the ethanol yield to some extent. This study shows that plant growth hormones have a high potential for the improvement of fungal chitosan production by M. indicus.

Ethnoveterinary survey of tradomedical importance of Bos taurus L ...

African Journals Online (AJOL)

ethnoveterinary uses of B. taurus by-products by traditional practitioners in Nigeria and South Africa. Conclusion: There ... Moreover, there are over 60 species of bacteria, about 100 species ..... bioremediation of pharmaceutical, pesticides and.

Circumstellar disks around binary stars in Taurus

International Nuclear Information System (INIS)

Akeson, R. L.; Jensen, E. L. N.

2014-01-01

We have conducted a survey of 17 wide (>100 AU) young binary systems in Taurus with the Atacama Large Millimeter Array (ALMA) at two wavelengths. The observations were designed to measure the masses of circumstellar disks in these systems as an aid to understanding the role of multiplicity in star and planet formation. The ALMA observations had sufficient resolution to localize emission within the binary system. Disk emission was detected around all primaries and 10 secondaries, with disk masses as low as 10 –4 M ☉ . We compare the properties of our sample to the population of known disks in Taurus and find that the disks from this binary sample match the scaling between stellar mass and millimeter flux of F mm ∝M ∗ 1.5--2.0 to within the scatter found in previous studies. We also compare the properties of the primaries to those of the secondaries and find that the secondary/primary stellar and disk mass ratios are not correlated; in three systems, the circumsecondary disk is more massive than the circumprimary disk, counter to some theoretical predictions.

Encephalomyocarditis virus in a captive Malayan tapir (Tapirus indicus).

Science.gov (United States)

Vercammen, Francis; Bosseler, Leslie; Tignon, Marylène; Cay, Ann Brigitte

2017-01-01

A 5-month-old female captive Malayan tapir ( Tapirus indicus ) died suddenly without preceding symptoms. Gross necropsy revealed numerous white circular and linear foci in the myocard. Differential diagnosis all turned out negative, except for encephalomyocarditis virus. Histopathology revealed mineralisation of myocardial cells and interstitial infiltration of lymphocytes, plasma cells and less neutrophils. Encephalomyocarditis virus was detected by PCR. Although encephalomyocarditis virus occurs in many mammals, this is the first published description of this virus in a Malayan tapir.

Polymorphism and Mobilization of Rransposons in Bos taurus

DEFF Research Database (Denmark)

Guldbrandtsen, Bernt; Sahana, Goutam; Lund, Mogens Sandø

The bovine genome assembly was explored to detect putative retrotransposon sequences. In total 87,310 such sites were detected. Four breeds of dairy cattle (Bos taurus) were examined with respect to the presence, segregation or complete absence of the putative retrotransposon. A total of 10...

Encephalomyocarditis virus in a captive Malayan tapir (Tapirus indicus

Directory of Open Access Journals (Sweden)

Francis Vercammen

2017-04-01

Full Text Available A 5-month-old female captive Malayan tapir (Tapirus indicus died suddenly without preceding symptoms. Gross necropsy revealed numerous white circular and linear foci in the myocard. Differential diagnosis all turned out negative, except for encephalomyocarditis virus. Histopathology revealed mineralisation of myocardial cells and interstitial infiltration of lymphocytes, plasma cells and less neutrophils. Encephalomyocarditis virus was detected by PCR. Although encephalomyocarditis virus occurs in many mammals, this is the first published description of this virus in a Malayan tapir.

AN INFRARED/X-RAY SURVEY FOR NEW MEMBERS OF THE TAURUS STAR-FORMING REGION

International Nuclear Information System (INIS)

Luhman, K. L.; Allen, P. R.; Mamajek, E. E.; Cruz, K. L.

2009-01-01

We present the results of a search for new members of the Taurus star-forming region using data from the Spitzer Space Telescope and the XMM-Newton Observatory. We have obtained optical and near-infrared spectra of 44 sources that exhibit red Spitzer colors that are indicative of stars with circumstellar disks and 51 candidate young stars that were identified by Scelsi and coworkers using XMM-Newton. We also performed spectroscopy on four possible companions to members of Taurus that were reported by Kraus and Hillenbrand. Through these spectra, we have demonstrated the youth and membership of 41 sources, 10 of which were independently confirmed as young stars by Scelsi and coworkers. Five of the new Taurus members are likely to be brown dwarfs based on their late spectral types (>M6). One of the brown dwarfs has a spectral type of L0, making it the first known L-type member of Taurus and the least massive known member of the region (M ∼ 4-7 M Jup ). Another brown dwarf exhibits a flat infrared spectral energy distribution, which indicates that it could be in the protostellar class I stage (star+disk+envelope). Upon inspection of archival images from various observatories, we find that one of the new young stars has a large edge-on disk (r = 2.''5 = 350 AU). The scattered light from this disk has undergone significant variability on a timescale of days in optical images from the Canada-France-Hawaii Telescope. Using the updated census of Taurus, we have measured the initial mass function for the fields observed by XMM-Newton. The resulting mass function is similar to previous ones that we have reported for Taurus, showing a surplus of stars at spectral types of K7-M1 (0.6-0.8 M sun ) relative to other nearby star-forming regions, such as IC 348, Chamaeleon I, and the Orion Nebula Cluster.

Star Formation in Taurus: Preliminary Results from 2MASS

Science.gov (United States)

Beichman, C. A.; Jarrett, T.

1993-01-01

Data with the 2MASS prototype camera were obtained in a 2.3 sq. deg region in Taurus containing Heiles Cloud 2, a region known from IRAS observations to contain a number of very young solar type stars.

THE SPITZER INFRARED SPECTROGRAPH SURVEY OF T TAURI STARS IN TAURUS

International Nuclear Information System (INIS)

Furlan, E.; Luhman, K. L.; Espaillat, C.

2011-01-01

We present 161 Spitzer Infrared Spectrograph (IRS) spectra of T Tauri stars and young brown dwarfs in the Taurus star-forming region. All of the targets were selected based on their infrared excess and are therefore surrounded by protoplanetary disks; they form the complete sample of all available IRS spectra of T Tauri stars with infrared excesses in Taurus. We also present the IRS spectra of seven Class 0/I objects in Taurus to complete the sample of available IRS spectra of protostars in Taurus. We use spectral indices that are not significantly affected by extinction to distinguish between envelope- and disk-dominated objects. Together with data from the literature, we construct spectral energy distributions for all objects in our sample. With spectral indices derived from the IRS spectra we infer disk properties such as dust settling and the presence of inner disk holes and gaps. We find a transitional disk frequency, which is based on objects with unusually large 13-31 μm spectral indices indicative of a wall surrounding an inner disk hole, of about 3%, and a frequency of about 20% for objects with unusually large 10 μm features, which could indicate disk gaps. The shape and strength of the 10 μm silicate emission feature suggests weaker 10 μm emission and more processed dust for very low mass objects and brown dwarfs (spectral types M6-M9). These objects also display weaker infrared excess emission from their disks, but do not appear to have more settled disks than their higher-mass counterparts. We find no difference for the spectral indices and properties of the dust between single and multiple systems.

A SURVEY FOR NEW MEMBERS OF THE TAURUS STAR-FORMING REGION WITH THE SLOAN DIGITAL SKY SURVEY

International Nuclear Information System (INIS)

Luhman, K. L.; Mamajek, E. E.; Shukla, S. J.; Loutrel, N. P.

2017-01-01

Previous studies have found that ∼1 deg 2 fields surrounding the stellar aggregates in the Taurus star-forming region exhibit a surplus of solar-mass stars relative to denser clusters like IC 348 and the Orion Nebula Cluster. To test whether this difference reflects mass segregation in Taurus or a variation in the initial mass function, we have performed a survey for members of Taurus across a large field (∼40 deg 2 ) that was imaged by the Sloan Digital Sky Survey (SDSS). We obtained optical and near-infrared spectra of candidate members identified with those images and the Two Micron All Sky Survey, as well as miscellaneous candidates that were selected with several other diagnostics of membership. We have classified 22 of the candidates as new members of Taurus, which includes one of the coolest known members (M9.75). Our updated census of members within the SDSS field shows a surplus of solar-mass stars relative to clusters, although it is less pronounced than in the smaller fields toward the stellar aggregates that were surveyed for previously measured mass functions in Taurus. In addition to spectra of our new members, we include in our study near-IR spectra of roughly half of the known members of Taurus, which are used to refine their spectral types and extinctions. We also present an updated set of near-IR standard spectra for classifying young stars and brown dwarfs at M and L types.

A SURVEY FOR NEW MEMBERS OF THE TAURUS STAR-FORMING REGION WITH THE SLOAN DIGITAL SKY SURVEY

Energy Technology Data Exchange (ETDEWEB)

Luhman, K. L. [Department of Astronomy and Astrophysics, The Pennsylvania State University, University Park, PA 16802 (United States); Mamajek, E. E. [Department of Physics and Astronomy, The University of Rochester, Rochester, NY 14627 (United States); Shukla, S. J. [Institute of Astronomy, Madingley Road, Cambridge CB3 0HA (United Kingdom); Loutrel, N. P., E-mail: kluhman@astro.psu.edu [eXtreme Gravity Institute, Department of Physics, Montana State University, Bozeman, MT 59715 (United States)

2017-01-01

Previous studies have found that ∼1 deg{sup 2} fields surrounding the stellar aggregates in the Taurus star-forming region exhibit a surplus of solar-mass stars relative to denser clusters like IC 348 and the Orion Nebula Cluster. To test whether this difference reflects mass segregation in Taurus or a variation in the initial mass function, we have performed a survey for members of Taurus across a large field (∼40 deg{sup 2}) that was imaged by the Sloan Digital Sky Survey (SDSS). We obtained optical and near-infrared spectra of candidate members identified with those images and the Two Micron All Sky Survey, as well as miscellaneous candidates that were selected with several other diagnostics of membership. We have classified 22 of the candidates as new members of Taurus, which includes one of the coolest known members (M9.75). Our updated census of members within the SDSS field shows a surplus of solar-mass stars relative to clusters, although it is less pronounced than in the smaller fields toward the stellar aggregates that were surveyed for previously measured mass functions in Taurus. In addition to spectra of our new members, we include in our study near-IR spectra of roughly half of the known members of Taurus, which are used to refine their spectral types and extinctions. We also present an updated set of near-IR standard spectra for classifying young stars and brown dwarfs at M and L types.

Perfil de ácidos grasos en carne de toretes Europeo x Cebú finalizados en pastoreo y en corral

Directory of Open Access Journals (Sweden)

Maribel Montero-Lagunes

2011-01-01

Full Text Available El objetivo fue determinar el perfil de ácidos grasos en grasa intramuscular de toretes encastados de Europeo (Bos taurus con Cebú (Bos indicus, finalizados en pastoreo y en corral. Cincuenta y dos toretes se analizaron con un ANDEVA en un arreglo factorial 2 x 2. La mitad de los animales fueron finalizados en pastoreo , siendo el pasto estrella de África [Cynodon plectostachyus (K. Schum Pilg.] la base de la alimentación, y la otra mitad en corral alimentados con 65 % de maíz, 10 % de pasta de soya, 20 % de heno, 4 % de sebo, 1 % de urea y minerales. La mitad de cada grupo consistió de toretes con más de ¾ B. taurus, y la otra mitad mayormente ¾ B. indicus . Los toretes se sacrificaron con 500 kg de peso. Se tomaron muestras del músculo Longissimus dorsi de la región de la 12a costilla. Los lípidos se analizaron por cromatografía de gases. El ácido graso más abundante (mg/g de grasa fue el C18,1 (381±16.4 seguido por el C16,0 (250±5.3 y el C18,0 (201±8.6, El contenido de C18:2, 9-cis, 11-trans fue de 6.1±0.67. C14,0 y C16,0 fueron mayores en corral, y C18,0 fue más alto en pastoreo (P<0.01. C14,0, C16,0, C18,2, C18,3 y CLA total fueron mayores (P<0.05 en B. indicus y C18,0 fue más alto (P<0.05 en B. taurus. Se concluye que el perfil de ácidos grasos en toretes cruzados de Europeo por Cebú es diferente si es finalizado en pastoreo o en corral y por el nivel de encaste.

Pesquisa de lasalocida y monensina en leche cruda de vacas lecheras suplementadas con estos ionóforos

OpenAIRE

A Jerez; R Chihuailaf; M Gai; M Noro; F Wittwer

2014-01-01

Los ionóforos lasalocida y monensina han sido usados como aditivos en el alimento para mejorar la ganancia de peso en ganado de carne y la producción de leche en vacas. Los objetivos de este trabajo fueron detectar la presencia de estos compuestos en muestras de leche cruda y la tasa de desaparición ruminal, utilizando HPLC como técnica analítica. Dos rebaños de vacas Friesian fueron utilizados. Las vacas de cada rebaño fueron suplementadas con lasalocida y monensina por 18 y 21 días, respect...

Complete genome sequence of the thermophilic sulfate-reducing ocean bacterium Thermodesulfatator indicus type strain (CIR29812(T)).

Science.gov (United States)

Anderson, Iain; Saunders, Elizabeth; Lapidus, Alla; Nolan, Matt; Lucas, Susan; Tice, Hope; Del Rio, Tijana Glavina; Cheng, Jan-Fang; Han, Cliff; Tapia, Roxanne; Goodwin, Lynne A; Pitluck, Sam; Liolios, Konstantinos; Mavromatis, Konstantinos; Pagani, Ioanna; Ivanova, Natalia; Mikhailova, Natalia; Pati, Amrita; Chen, Amy; Palaniappan, Krishna; Land, Miriam; Hauser, Loren; Jeffries, Cynthia D; Chang, Yun-Juan; Brambilla, Evelyne-Marie; Rohde, Manfred; Spring, Stefan; Göker, Markus; Detter, John C; Woyke, Tanja; Bristow, James; Eisen, Jonathan A; Markowitz, Victor; Hugenholtz, Philip; Kyrpides, Nikos C; Klenk, Hans-Peter

2012-05-25

Thermodesulfatator indicus Moussard et al. 2004 is a member of the Thermodesulfobacteriaceae, a family in the phylum Thermodesulfobacteria that is currently poorly characterized at the genome level. Members of this phylum are of interest because they represent a distinct, deep-branching, Gram-negative lineage. T. indicus is an anaerobic, thermophilic, chemolithoautotrophic sulfate reducer isolated from a deep-sea hydrothermal vent. Here we describe the features of this organism, together with the complete genome sequence, and annotation. The 2,322,224 bp long chromosome with its 2,233 protein-coding and 58 RNA genes is a part of the Genomic Encyclopedia of Bacteria and Archaea project.

Feed Intake and Weight Changes in Bos indicus-Bos taurus Crossbred Steers Following Bovine Viral Diarrhea Virus Type 1b Challenge Under Production Conditions

Directory of Open Access Journals (Sweden)

Chase A. Runyan

2017-12-01

Full Text Available Bovine viral diarrhea virus (BVDV has major impacts on beef cattle production worldwide, but the understanding of host animal genetic influence on illness is limited. This study evaluated rectal temperature, weight change and feed intake in Bos indicus crossbred steers (n = 366 that were challenged with BVDV Type 1b, and where family lines were stratified across three vaccine treatments of modified live (MLV, killed, (KV or no vaccine (NON. Pyrexia classification based on 40.0 °C threshold following challenge and vaccine treatment were investigated for potential interactions with sire for weight change and feed intake following challenge. Pyrexia classification affected daily feed intake (ADFI, p = 0.05, and interacted with day (p < 0.001 for ADFI. Although low incidence of clinical signs was observed, there were marked reductions in average daily gain (ADG and cumulative feed intake during the first 14 day post-challenge; ADG (CV of 104% and feed efficiency were highly variable in the 14-day period immediately post-challenge as compared to the subsequent 14-day periods. A sire × vaccine strategy interaction affected ADFI (p < 0.001, and a sire by time period interaction affected ADG (p = 0.03 and total feed intake (p = 0.03. This study demonstrates that different coping responses may exist across genetic lines to the same pathogen, and that subclinical BVDV infection has a measurable impact on cattle production measures.

Isolation and genetic diversity of endangered grey nurse shark (Carcharias taurus) populations.

Science.gov (United States)

Stow, Adam; Zenger, Kyall; Briscoe, David; Gillings, Michael; Peddemors, Victor; Otway, Nicholas; Harcourt, Robert

2006-06-22

Anthropogenic impacts are believed to be the primary threats to the eastern Australian population of grey nurse sharks (Carcharias taurus), which is listed as critically endangered, and the most threatened population globally. Analyses of 235 polymorphic amplified fragment length polymorphisms (AFLP) loci and 700 base pairs of mitochondrial DNA control region provide the first account of genetic variation and geographical partitioning (east and west coasts of Australia, South Africa) in C. taurus. Assignment tests, analysis of relatedness and Fst values all indicate that the Australian populations are isolated from South Africa, with negligible migration between the east and west Australian coasts. There are significant differences in levels of genetic variation among regions. Australian C. taurus, particularly the eastern population, has significantly less AFLP variation than the other sampling localities. Further, the eastern Australian sharks possess only a single mitochondrial haplotype, also suggesting a small number of founding individuals. Therefore, historical, rather than anthropogenic processes most likely account for their depauperate genetic variation. These findings have implications for the viability of the eastern Australian population of grey nurse sharks.

Circumstellar disks around binary stars in Taurus

Energy Technology Data Exchange (ETDEWEB)

Akeson, R. L. [NASA Exoplanet Science Institute, IPAC/Caltech, Pasadena, CA 91125 (United States); Jensen, E. L. N. [Swarthmore College, Department of Physics and Astronomy, Swarthmore, PA 19081 (United States)

2014-03-20

We have conducted a survey of 17 wide (>100 AU) young binary systems in Taurus with the Atacama Large Millimeter Array (ALMA) at two wavelengths. The observations were designed to measure the masses of circumstellar disks in these systems as an aid to understanding the role of multiplicity in star and planet formation. The ALMA observations had sufficient resolution to localize emission within the binary system. Disk emission was detected around all primaries and 10 secondaries, with disk masses as low as 10{sup –4} M {sub ☉}. We compare the properties of our sample to the population of known disks in Taurus and find that the disks from this binary sample match the scaling between stellar mass and millimeter flux of F{sub mm}∝M{sub ∗}{sup 1.5--2.0} to within the scatter found in previous studies. We also compare the properties of the primaries to those of the secondaries and find that the secondary/primary stellar and disk mass ratios are not correlated; in three systems, the circumsecondary disk is more massive than the circumprimary disk, counter to some theoretical predictions.

Tasas de logro educativo en las poblaciones afrodescendiente, indígena y mestiza: Revisión de algunos factores de exclusión

Directory of Open Access Journals (Sweden)

Marcelo Gaete-Astica

2016-01-01

Full Text Available Este artículo es resultado de la investigación Tasas de logro educativo entre la población afrodescendiente, indígena y mestiza y la revisión de algunos factores de exclusión e inclusión (Gaete, 2014. Mediante la exploración de los datos del X Censo Nacional de Población y el establecimiento de algunas medidas cuantitativas, en este artículo se busca establecer el logro educativo de la población de personas de origen indígena y afrodescendiente, en contraposición con la población mestiza (que denominamos acríticamente blanca y algunos elementos como los de la localización provincial y el de inserción temprana en el mundo del trabajo como factores de exclusión educativa. Siendo este estudio de corte exploratorio, se pretende que dé insumos prácticos y conceptuales para profundizar en la temática de la exclusión social y educativa. El análisis estadístico realizado ha permitido visualizar el hecho de que la identidad étnica y cultural, así como la localización geográfica (a escala provincial no son factores de exclusión educativa y social, sino que las explicaciones hay que buscarlas en la circularidad de la pobreza, que determina logros educativos bajos que influyen, a su vez, el acceso a puestos de trabajo de baja calificación. Este estudio sugiere que la inserción temprana en el mercado de trabajo es un factor clave de exclusión.

Far-infrared investigation of the Taurus star-forming region using the IRAS database

International Nuclear Information System (INIS)

Hughes, J.D.

1986-01-01

The Taurus-Auriga complex was selected as the first molecular cloud to be investigated in this study. The Taurus clouds were defined as lying between 04h and 05h in R.A. and +16 to +31 degrees in Dec., then the IRAS point-source catalogue was searched for sources with good or moderate quality fluxes in all three of the shortest IRAS bands. The sources selected were then classified into subgroups according to their IRAS colors. Taurus is generally believed to be an area of low-mass star formation, having no luminous O-B associations within or near to the cloud complex. Once field stars, galaxies and planetary nebulae had been removed from the sample only the molecular cloud cores, T Tauri stars and a few emission-line A and B stars remained. The great majority of these objects are pre-main sequence in nature and, as stated by Chester (1985), main sequence stars without excess far-infrared emission would only be seen in Taurus if their spectral types were earlier than about A5 and then not 25 microns. By choosing our sample in this way we are naturally selecting the hotter and thus more evolved sources. To counteract this, the molecular cloud core-criterion was applied to soruces with good or moderate quality flux at 25, 60 and 100 microns, increasing the core sample by about one third. The candidate protostar B335 is only detected by IRAS at 60 and 100 microns while Taurus is heavily contaminated by cirrus at 100 microns. This means that detection at 25 microns is also required with those at 60 and 100 microns to avoid confusing a ridge of cirrus with a genuine protostar. The far-infrared luminosity function of these sources is then calculated and converted to the visual band by a standard method to compare with the field star luminosity function of Miller and Scalo

Gloria Anzaldúa, a consciência mestiça e o "feminismo da diferença" Gloria Anzaldúa, mestiza consciousness, and "feminism of difference"

Directory of Open Access Journals (Sweden)

Claudia de Lima Costa

2005-12-01

Full Text Available Este artigo situa a contribuição fundamental de Gloria Anzaldúa sobre a consciência mestiça na história do feminismo, enfocando sua perspectiva epistemológica da diferença interseccional na articulação de uma política de coalizão contra a exclusão da alteridade dos lugares privilegiados da construção da modernidade. Ancorando-se nas reflexões acad��micas sobre os escritos de Anzaldúa, as autoras destacam as maneiras pelas quais a teoria da identidade mestiça de Anzaldúa está antecipando não apenas críticas aos conceitos de sujeito, diferença e modernidade, mas também aquelas que enfatizam as distinções entre versões capitalistas e versões críticas do hibridismo cultural.This article situates Gloria Anzaldúa's influential "La Conciencia de la mestiza / Towards a New Consciousness" within the history of feminism, focusing on her epistemological perspective of intersectional difference to articulate a politics of coalition against the exclusion of alterity from privileged sites of modernity construction, in both space and time. Drawing on various academic sources of Anzaldúa criticism, we highlight some important ways her theory of mestiza identity actually anticipates not only critiques of the concepts of the subject, difference and modernity but also distinctions between capitalist and critical versions of cultural hybridity, all of which require sensitivity to discourses of dehistoricization, cooptation and assimilation.

Flares of Orion population variables in the association Taurus T3

International Nuclear Information System (INIS)

Khodzhaev, A.S.; AN Armyanskoj SSR, Byurakan. Astrofizicheskaya Observatoriya)

1987-01-01

Thirteen new flare stars, proved to be irregular variables of Orion Population, were discovered from a study of the Taurus Dark Cloud region by the homogeneous photographic multipose method on the wide angle Schmidt telescopes of the Byurakan Astorphysical Observatory. Seventeen flares on these stars were detected for about 750 hours of the effective observing time. The analysis of the complicated light curves of these flares shows a great variety and multiplicity of this phenomenon and various dynamics of flare energy release processes. The existence of flare stars with some properties typical for both of the T Tauri and UV Ceti stars simulteneously indicates nonstable stars. The population of flare stars in the Taurus Dark Cloud region is apparently as young as in Orion and Monoceros

Ethnoveterinary survey of tradomedical importance of Bos taurus L ...

African Journals Online (AJOL)

taurus L urine, bile and dung in Nigeria and South Africa. Mariam O ... traditional health care systems are still in use by majority of the people ..... improving memory, enhancing the function of the liver, slowing ... standard guidelines and database be made available to ... WHO, Traditional and Modern Medicine: Harmonishing.

The Taurus Boundary of Stellar/Substellar (TBOSS) Survey. II. Disk Masses from ALMA Continuum Observations

Science.gov (United States)

Ward-Duong, K.; Patience, J.; Bulger, J.; van der Plas, G.; Ménard, F.; Pinte, C.; Jackson, A. P.; Bryden, G.; Turner, N. J.; Harvey, P.; Hales, A.; De Rosa, R. J.

2018-02-01

We report 885 μm ALMA continuum flux densities for 24 Taurus members spanning the stellar/substellar boundary with spectral types from M4 to M7.75. Of the 24 systems, 22 are detected at levels ranging from 1.0 to 55.7 mJy. The two nondetections are transition disks, though other transition disks in the sample are detected. Converting ALMA continuum measurements to masses using standard scaling laws and radiative transfer modeling yields dust mass estimates ranging from ∼0.3 to 20 M ⊕. The dust mass shows a declining trend with central object mass when combined with results from submillimeter surveys of more massive Taurus members. The substellar disks appear as part of a continuous sequence and not a distinct population. Compared to older Upper Sco members with similar masses across the substellar limit, the Taurus disks are brighter and more massive. Both Taurus and Upper Sco populations are consistent with an approximately linear relationship in M dust to M star, although derived power-law slopes depend strongly upon choices of stellar evolutionary model and dust temperature relation. The median disk around early-M stars in Taurus contains a comparable amount of mass in small solids as the average amount of heavy elements in Kepler planetary systems on short-period orbits around M-dwarf stars, with an order of magnitude spread in disk dust mass about the median value. Assuming a gas-to-dust ratio of 100:1, only a small number of low-mass stars and brown dwarfs have a total disk mass amenable to giant planet formation, consistent with the low frequency of giant planets orbiting M dwarfs.

THE MAGNETIC FIELD IN TAURUS PROBED BY INFRARED POLARIZATION

International Nuclear Information System (INIS)

Chapman, Nicholas L.; Goldsmith, Paul F.; Pineda, Jorge L.; Li Di; Clemens, D. P.; Krco, Marko

2011-01-01

We present maps of the plane-of-sky magnetic field within two regions of the Taurus molecular cloud: one in the dense core L1495/B213 filament and the other in a diffuse region to the west. The field is measured from the polarization of background starlight seen through the cloud. In total, we measured 287 high-quality near-infrared polarization vectors in these regions. In L1495/B213, the percent polarization increases with column density up to A V ∼ 9 mag, the limits of our data. The radiative torques model for grain alignment can explain this behavior, but models that invoke turbulence are inconsistent with the data. We also combine our data with published optical and near-infrared polarization measurements in Taurus. Using this large sample, we estimate the strength of the plane-of-sky component of the magnetic field in nine subregions. This estimation is done with two different techniques that use the observed dispersion in polarization angles. Our values range from 5 to 82 μG and tend to be higher in denser regions. In all subregions, the critical index of the mass-to-magnetic flux ratio is sub-unity, implying that Taurus is magnetically supported on large scales (∼2 pc). Within the region observed, the B213 filament takes a sharp turn to the north and the direction of the magnetic field also takes a sharp turn, switching from being perpendicular to the filament to becoming parallel. This behavior can be understood if we are observing the rim of a bubble. We argue that it has resulted from a supernova remnant associated with a recently discovered nearby gamma-ray pulsar.

EFEITO DOS NÍVEIS DE CÁLCIO DA RAÇÃO SUPLEMENTADA COM FITASE SOBRE A ABSORÇÃO DE MINERAIS EM FRANGOS DE CORTE DE 22 A 42 DIAS

Directory of Open Access Journals (Sweden)

Antônio Gilberto Bertechini

2006-10-01

Full Text Available Com o objetivo de avaliar os efeitos dos níveis de cálcio na ração suplementada com fitase para frangos de corte de 22 a 42 dias de idade, sobre a taxa de absorção verdadeira de minerais, foi conduzido um experimento com 600 frangos de 21 dias da linhagem Hubbard-MPK, distribuídos em um delineamento inteiramente casualizado, com arranjo fatorial cinco x dois (níveis de cálcio x sexos, e três repetições de 20 aves por parcela experimental. A ração basal foi balanceada para atender às exigências nutricionais das aves conforme o NRC (1994, exceto para o cálcio, cujos níveis foram 0,40%; 0,59%; 0,78%; 0,97% e 1,16% suplementada com fitase. Aos 35 dias de idade, duas aves de cada tratamento foram transferidas para gaiolas de metabolismo para coleta de excretas. A taxa de absorção verdadeira de fósforo e zinco das fêmeas foi 13,1% e 12,8% inferior à dos machos, respectivamente (P<0,05. A absorção de cálcio apresentou um efeito quadrático, conforme o nível de cálcio, elevado (P<0,05. Não houve diferença (P>0,05 na taxa de absorção verdadeira de fósforo, zinco, manganês e magnésio em função dos níveis de cálcio da ração de 22 a 42 dias de idade. Conclui-se que teores elevados de cálcio da ração suplementada com fitase reduzem somente a taxa de absorção de Ca, sendo que a taxa de absorção do fósforo, zinco, manganês e magnésio não é influenciada pelos níveis de cálcio da ração suplementada com fitase para frangos de corte dos 22 aos 42 dias de idade. PALAVRAS-CHAVE: Fitase, absorção, minerais, frango

Polidactilia en los cuatro miembros, en una potranca mestiza en Chile

Directory of Open Access Journals (Sweden)

Onésimo Sepúlveda S.

2011-05-01

Full Text Available La polidactilia es una anomalía congénita de muy baja incidencia en caballos. A una potranca mestiza de 6 semanas de edad con polidactilia en sus cuatro miembros se le realizó un examen clínico y radiológico. Los exámenes mostraron la presencia de un dígito supernumerario en ambos miembros anteriores, correspondiente a la primera y segunda falange del dígito II, con su respectivo hueso metacarpiano. En ambos miembros posteriores, se observó que un segundo dígito se originaba a nivel de la articulación metatarso-falángica; ambos dígitos eran del mismo tamaño y estaban formados por tres falanges, los que articulaban con el metatarsiano III. En ambos miembros posteriores, las primeras falanges estaban parcialmente fusionadas a nivel proximal. En el miembro posterior izquierdo había osteomielitis y fractura en el dígito lateral. Debido al compromiso del hueso y al dolor, se realizó eutanasia. No se realizó análisis citogenético. De acuerdo con la clasificación existente, la polidactilia encontrada en los miembros anteriores corresponde a la forma atavística y la encontrada en los posteriores a la forma teratogénica. Hasta lo que nosotros sabemos, este es el primer caso de polidactilia en los cuatro miembros registrado en América del Sur y en los últimos 55 años a nivel mundial.

Effect of probiotic supplemented diet on marine shrimp survival after challenge with Vibrio harveyi Efeito do uso de dieta suplementada com o probiótico sobre a sobrevivência de camarões marinhos após o desafio com Vibrio harveyi

Directory of Open Access Journals (Sweden)

F.N. Vieira

2010-06-01

Full Text Available The effect of a Lactobacillus plantarum-supplemented diet on shrimp growth, digestive tract bacterial microbiota, survival, and some hemato-immunological parameters after an experimental challenge with Vibrio harveyi was studied. No difference (P>0.05 was observed in shrimp survival (80±6% and final weight (6.63±0.56g after 60 days feeding trial. Total bacteria count and Vibrio spp. count in the digestive tract were not diferent (P>0.05 until day 40, but they were lower (P0.05 than the control group (39.9±4.4%. Bacterial counts in hemolymph and hepatopancreas was lower (P0.05 in the probiotic-supplemented group after challenge with V. harveyi. Probiotic-supplemented diet modifies shrimp digestive tract bacterial microbiota, increasing resistance to V. harveyi infection.Avaliou-se o efeito de uma dieta suplementada com Lactobacillus plantarum na engorda de Litopenaeus vannamei sobre a microbiota bacteriana do trato digestivo, a sobrevivência e alguns parâmetros hematoimunológicos após desafio com Vibrio harveyi. Não foi observada diferença significativa na sobrevivência (80±6% e no peso final dos camarões (6,63±0,56g durante a engorda (60 dias. A população de bactérias totais e Vibrio spp. no intestino não diferiu até o 40° dia de cultivo, mas foi inferior nos camarões alimentados com dieta suplementada com probiótico no 60° dia de cultivo. A população de bactérias lácticas foi superior no intestino de camarões alimentados com dieta suplementada com probióticos após o 20° dia de cultivo. Dez horas após o desafio, a sobrevivência dos camarões alimentados com dieta suplementada com probiótico foi superior (65,7±2,9% a dos camarões do controle (39,9±4,4%. Camarões alimentados com dieta suplementada com probióticos e desafiados com V. harveyi apresentaram menor contagem de bactérias na hemolinfa e hepatopâncreas. A contagem total de hemócitos e a atividade aglutinante da hemolinfa foram superiores nos camar

SUB-STELLAR COMPANIONS AND STELLAR MULTIPLICITY IN THE TAURUS STAR-FORMING REGION

International Nuclear Information System (INIS)

Daemgen, Sebastian; Bonavita, Mariangela; Jayawardhana, Ray; Lafrenière, David; Janson, Markus

2015-01-01

We present results from a large, high-spatial-resolution near-infrared imaging search for stellar and sub-stellar companions in the Taurus-Auriga star-forming region. The sample covers 64 stars with masses between those of the most massive Taurus members at ∼3 M ☉ and low-mass stars at ∼0.2 M ☉ . We detected 74 companion candidates, 34 of these reported for the first time. Twenty-five companions are likely physically bound, partly confirmed by follow-up observations. Four candidate companions are likely unrelated field stars. Assuming physical association with their host star, estimated companion masses are as low as ∼2 M Jup . The inferred multiplicity frequency within our sensitivity limits between ∼10-1500 AU is 26.3 −4.9 +6.6 %. Applying a completeness correction, 62% ± 14% of all Taurus stars between 0.7 and 1.4 M ☉ appear to be multiple. Higher order multiples were found in 1.8 −1.5 +4.2 % of the cases, in agreement with previous observations of the field. We estimate a sub-stellar companion frequency of ∼3.5%-8.8% within our sensitivity limits from the discovery of two likely bound and three other tentative very low-mass companions. This frequency appears to be in agreement with what is expected from the tail of the stellar companion mass ratio distribution, suggesting that stellar and brown dwarf companions share the same dominant formation mechanism. Further, we find evidence for possible evolution of binary parameters between two identified sub-populations in Taurus with ages of ∼2 Myr and ∼20 Myr, respectively

SUB-STELLAR COMPANIONS AND STELLAR MULTIPLICITY IN THE TAURUS STAR-FORMING REGION

Energy Technology Data Exchange (ETDEWEB)

Daemgen, Sebastian [Department of Astronomy and Astrophysics, University of Toronto, 50 St. George Street, Toronto, ON M5H 3H4 (Canada); Bonavita, Mariangela [The University of Edinburgh, Royal Observatory, Blackford Hill, Edinburgh EH9 3HJ (United Kingdom); Jayawardhana, Ray [Physics and Astronomy, York University, Toronto, Ontario L3T 3R1 (Canada); Lafrenière, David [Department of Physics, University of Montréal, Montréal, QC (Canada); Janson, Markus, E-mail: daemgen@astro.utoronto.ca [Department of Astronomy, Stockholm University, Stockholm (Sweden)

2015-02-01

We present results from a large, high-spatial-resolution near-infrared imaging search for stellar and sub-stellar companions in the Taurus-Auriga star-forming region. The sample covers 64 stars with masses between those of the most massive Taurus members at ∼3 M {sub ☉} and low-mass stars at ∼0.2 M {sub ☉}. We detected 74 companion candidates, 34 of these reported for the first time. Twenty-five companions are likely physically bound, partly confirmed by follow-up observations. Four candidate companions are likely unrelated field stars. Assuming physical association with their host star, estimated companion masses are as low as ∼2 M {sub Jup}. The inferred multiplicity frequency within our sensitivity limits between ∼10-1500 AU is 26.3{sub −4.9}{sup +6.6}%. Applying a completeness correction, 62% ± 14% of all Taurus stars between 0.7 and 1.4 M {sub ☉} appear to be multiple. Higher order multiples were found in 1.8{sub −1.5}{sup +4.2}% of the cases, in agreement with previous observations of the field. We estimate a sub-stellar companion frequency of ∼3.5%-8.8% within our sensitivity limits from the discovery of two likely bound and three other tentative very low-mass companions. This frequency appears to be in agreement with what is expected from the tail of the stellar companion mass ratio distribution, suggesting that stellar and brown dwarf companions share the same dominant formation mechanism. Further, we find evidence for possible evolution of binary parameters between two identified sub-populations in Taurus with ages of ∼2 Myr and ∼20 Myr, respectively.

Recent TAURUS results on Hα velocities in M83

International Nuclear Information System (INIS)

Allen, R.J.; Atherton, P.D.; Oosterloo, T.A.

1983-01-01

Preliminary Hα observations with the TAURUS imaging spectrometer confirm a pattern of systematic radial motions in a section of spiral arm in M83. The velocity gradients are not consistent with those predicted for the neutral gas. Non-circular motions have also been discovered in the central regions of the galaxy. (Auth.)

Mosquitocidal and water purification properties of Cynodon dactylon, Aloe vera, Hemidesmus indicus and Coleus amboinicus leaf extracts against the mosquito vectors.

Science.gov (United States)

Arjunan, Nareshkumar; Murugan, Kadarkarai; Madhiyazhagan, Pari; Kovendan, Kalimuthu; Prasannakumar, Kanagarajan; Thangamani, Sundaram; Barnard, Donald R

2012-04-01

Ethanolic extracts of Cynodon dactylon, Aloe vera, Hemidesmus indicus and Coleus amboinicus were tested for their toxicity effect on the third-instar larvae of Anopheles stephensi, Culex quinquefasciatus and Aedes aegypti. The leaves of C. dactylon, A. vera, H. indicus and C. amboinicus were collected from natural habitats (forests) in Western Ghats, Tamil Nadu, India. A total of 250 g of fresh, mature leaves were rinsed with distilled water and dried in shade. The dried leaves were put in Soxhlet apparatus and extract prepared using 100% ethanol for 72 h at 30-40°C. Dried residues were obtained from 100 g of extract evaporated to dryness in rotary vacuum evaporator. Larvicidal properties of ethanolic leaf extracts showed that the extracts are effective as mosquito control agents. The larval mortality was observed after 24 h exposure. No mortality was observed in the control. The median lethal concentration (LC(50)) values observed for the larvicidal activities are 0.44%, 0.51%, 0.59% and 0.68% for extracts of C. dactylon, A. vera, H. indicus and C. amboinicus, respectively. The observed mortality were statistically significant at P < 0.05 level. C. dactylon showed the highest mortality rate against the three species of mosquito larvae in laboratory and field. The selected plants were shown to exhibit water purification properties. Water quality parameters such as turbidity, pH and water clarity were analyzed in the water samples (pre-treatment and post-treatment of plant extracts) taken from the different breeding sites of mosquitoes. Water colour, turbidity and pH were reduced significantly after treatment with C. dactylon (13 HU, 31.5 mg/l and 6.9), H. indicus (13.8 HU, 33 mg/l and 7.1), A. vera (16 HU, 33.8 mg/l and 7.4) and C. amboinicus (21 HU, 35 mg/l and 7.5) extracts. The study proved that the extracts of C. dactylon, A. vera, H. indicus and C. amboinicus have both mosquitocidal and water sedimentation properties.

Whole-genome sequencing reveals mutational landscape underlying phenotypic differences between two widespread Chinese cattle breeds

OpenAIRE

Xu, Yao; Jiang, Yu; Shi, Tao; Cai, Hanfang; Lan, Xianyong; Zhao, Xin; Plath, Martin; Chen, Hong

2017-01-01

Whole-genome sequencing provides a powerful tool to obtain more genetic variability that could produce a range of benefits for cattle breeding industry. Nanyang (Bos indicus) and Qinchuan (Bos taurus) are two important Chinese indigenous cattle breeds with distinct phenotypes. To identify the genetic characteristics responsible for variation in phenotypes between the two breeds, in the present study, we for the first time sequenced the genomes of four Nanyang and four Qinchuan cattle with 10 ...

Ford Taurus Ethanol-Fueled Sedan

International Nuclear Information System (INIS)

Eudy, Leslie

1999-01-01

The U.S. Department of Energy (DOE) is encouraging the use of alternative fuels and alternative fuel vehicles (AFVs). To support this activity, DOE has directed the National Renewable Energy Laboratory (NREL) to conduct projects to evaluate the performance and acceptability of light-duty AFVs. In this study, we tested a pair of 1998 Ford Tauruses: one E85 (85% gasoline/15% ethanol) model (which was tested on both E85 and gasoline) and a gasoline model as closely matched as possible. Each vehicle was run through a series of tests to evaluate acceleration, fuel economy, braking, and cold-start capabilities, as well as more subjective performance indicators such as handling, climate control, and noise

Rotation and kinematics of the premain-sequence stars in Taurus-Auriga with Ca II emission

Science.gov (United States)

Hartmann, Lee W.; Soderblom, David R.; Stauffer, John R.

1987-01-01

Radial velocities and v sin i values for the stars in the Taurus-Auriga region that were found to have strong Ca II H and K emission by Herbig, Vrba, and Rydgren 'HVR', (1986) are reported. Most of the velocities are determined to better than 2 km/s precision. The kinematic properties of the Ca II emission stars with strong Li are found to be indistinguishable from conventional T Tauris in Taurus-Auriga, contrary to HVR. These Li-rich stars also rotate like T Tauris. Most of the stars that lack Li are probable or possible members of the Hyades, in the foreground, and are among the brightest and most active stars in that cluster for their spectral types. It is suggested following Jones and Herbig (1979), that the apparent absence of low-mass stars older than 10 Myr in Taurus-Auriga is real, and is due to the finite lifetime of the cloud.

Rotation and kinematics of the premain-sequence stars in Taurus-Auriga with CA II emission

Science.gov (United States)

Hartmann, Lee W.; Soderblom, David R.; Stauffer, John R.

1987-04-01

The authors report radial velocities and v sin i values for the stars in the Taurus-Auriga region that were found to have strong Ca II H and K emission by Herbig, Vrba, and Rydgren (HVR). Most of the velocities are determined to better than 2 km s-1 precision. The authors find the kinematic properties of the Ca II emission stars with strong Li to be indistinguishable from conventional T Tauris in Taurus-Auriga, contrary to HVR. These Li-rich stars also rotate like T Tauris. Most of the stars that lack Li are probable or possible members of the Hyades, in the foreground, and are among the brightest and most active stars in that cluster for their spectral types. The authors suggest, following Jones and Herbig, that the apparent absence of low-mass stars older than 10 Myr in Taurus-Auriga is real, and is due to the finite lifetime of the cloud.

Infestation by Haematopinus quadripertusus on cattle in São Domingos do Capim, state of Pará, Brazil Infestação por Haematopinus quadripertusus em bovinos de São Domingos do Capim, Estado do Pará, Brasil

Directory of Open Access Journals (Sweden)

Alessandra Scofield

2012-09-01

Full Text Available Severe infestation with lice was observed on crossbred cattle (Bos taurus indicus ×Bos taurus taurus in the municipality of São Domingos do Capim, state of Pará, Brazil. Sixty-five animals were inspected and the lice were manually collected, preserved in 70% alcohol and taken to the Animal Parasitology Laboratory, School of Veterinary Medicine, Federal University of Pará, Brazil, for identification. The adult lice were identified as Haematopinus quadripertusus, and all the cattle examined were infested by at least one development stage of this ectoparasite. The specimens collected were located only on the tail in 80% (52/65 of the cattle, while they were around the eyes as well as on the ears and tail in 20% (13/65. Nits, nymphs and adults of the parasite were respectively collected from 98.46% (64/65, 38.46% (25/65 and 23.08% (15/65 of the animals examined. This is the first report of bovine pediculosis caused by H. quadripertusus in the state of Pará, Brazil. Further studies should be conducted to determine the occurrence pattern of this species in Brazil and its importance to livestock production.Alta infestação por piolhos foi observada em vacas mestiças Bos taurus indicus e Bos taurus taurus do município de São Domingos do Capim, Estado do Pará, Brasil. Sessenta e cinco animais foram inspecionados e os piolhos foram coletados manualmente, armazenados em álcool 70% e transportados ao Laboratório de Parasitologia Animal da Faculdade de Medicina Veterinária da Universidade Federal do Pará para a identificação. Os exemplares adultos foram identificados como Haematopinus quadripertusus e todos os animais examinados apresentaram pelo menos um estágio de desenvolvimento do ectoparasito. Em 80% (52/65 dos animais, os exemplares coletados localizavam-se somente na cauda e em 20% (13/65 na região periocular, orelha e cauda. Lêndeas, ninfas e adultos foram coletados, respectivamente, em 98,46% (64/65, em 38,46% (25/65 e em 23

Infrared spectroscopy of dust in the Taurus dark clouds: solid carbon monoxide

International Nuclear Information System (INIS)

Whittet, D.C.B.; McFadzean, A.D.

1989-01-01

Spectra centred on the spectral feature of solid CO at 4.67 μm wavelength are presented for eight stars in or behind the quiescent dark cloud complex in Taurus. The solid CO profile is dominated by a sharp component centred at 4.673 μm (2140 cm -1 ). As in previous observations of the feature, asymmetry in the profile is consistent with the presence of a weaker, somewhat broader, overlapping component centred at ∼ 4.682 μm (2136 cm -1 ). New and previously published data for Taurus stars are combined to study the correlation of the peak optical depth in the CO feature with visual extinction and with the depth of the water-ice feature at 3.0 μm. (author)

Successful treatment of oral squamous cell carcinoma with intralesional fluorouracil in a Malayan tapir (Tapirus indicus).

Science.gov (United States)

Miller, C L; Templeton, R S; Karpinski, L

2000-06-01

An oral mass was observed in a Malayan tapir (Tapirus indicus). Squamous cell carcinoma was diagnosed by histologic examination of a biopsy specimen. A series of intralesional injections using fluorouracil resulted in complete regression of the neoplasm with no recognized adverse effects.

Using binary statistics in Taurus-Auriga to distinguish between brown dwarf formation processes

Science.gov (United States)

Marks, M.; Martín, E. L.; Béjar, V. J. S.; Lodieu, N.; Kroupa, P.; Manjavacas, E.; Thies, I.; Rebolo López, R.; Velasco, S.

2017-08-01

Context. One of the key questions of the star formation problem is whether brown dwarfs (BDs) form in the manner of stars directly from the gravitational collapse of a molecular cloud core (star-like) or whether BDs and some very low-mass stars (VLMSs) constitute a separate population that forms alongside stars comparable to the population of planets, for example through circumstellar disk (peripheral) fragmentation. Aims: For young stars in Taurus-Auriga the binary fraction has been shown to be large with little dependence on primary mass above ≈ 0.2 M⊙, while for BDs the binary fraction is computations. A small amount of dynamical processing of the stellar component was accounted for as appropriate for the low-density Taurus-Auriga embedded clusters. Results: The binary fraction declines strongly in the transition region between star-like and peripheral formation, exhibiting characteristic features. The location of these features and the steepness of this trend depend on the mass limits for star-like and peripheral formation. Such a trend might be unique to low density regions, such as Taurus, which host binary populations that are largely unprocessed dynamically in which the binary fraction is large for stars down to M-dwarfs and small for BDs. Conclusions: The existence of a strong decline in the binary fraction - primary mass diagram will become verifiable in future surveys on BD and VLMS binarity in the Taurus-Auriga star-forming region. The binary fraction - primary mass diagram is a diagnostic of the (non-)continuity of star formation along the mass scale, the separateness of the stellar and BD populations, and the dominant formation channel for BDs and BD binaries in regions of low stellar density hosting dynamically unprocessed populations.

Correlación entre la fertilidad y el pH uterino de vacas Holstein suplementadas con levadura de cerveza

OpenAIRE

Lina María Barrera-Sánchez; José Luis Porras-Vargas

2011-01-01

En  la  región del Sugamuxi  se ha establecido  la levadura de cerveza (Saccharomyces cerevisiae) como  suplemento  en  ganaderías  lecheras  por producir  aumento  de  la  producción  láctea.  El propósito de este estudio fue evaluar los cambios de pH uterino en fase estral y fase luteal de vacas Holstein suplementadas correlacionándolos con la  fertilidad. Así  se  evaluaron dos grupos: uno suplementado  (n=50)  y  otro no suplementado (n=50). Se extrajeron muestras de moco uterino y se mid...

Ratio of total-to-selective extinction in the Taurus dark cloud complex

International Nuclear Information System (INIS)

Vrba, F.J.; Rydgren, A.E.; Space Telescope Science Institute, Baltimore, MD)

1985-01-01

UBVRI and JHK photometry, as well as spectral classifications are presented for seven reddened early-type field stars that are observed through the Taurus dark cloud complex. The ratio of total-to-selective extinction is derived for each star by the color-difference method. For six stars with absolute magnitudes in violet of more than 1.7 and less than 3.2 mag, a normal ratio R of total-to-selective extinction of about 3.1 is found. The mildly anomalous R value of about 3.5 for the well-studied star HD 29647 was also confirmed. The results provide further evidence that the interstellar extinction law in the Taurus dark cloud complex is basically normal for lines of sight with absolute magnitudes in violet of less than 3 mag. 24 references

Comparative "in vitro" evaluation of the antiresorptive activity residing in four Ayurvedic medicinal plants. Hemidesmus indicus emerges for its potential in the treatment of bone loss diseases.

Science.gov (United States)

Di Pompo, Gemma; Poli, Ferruccio; Mandrone, Manuela; Lorenzi, Beatrice; Roncuzzi, Laura; Baldini, Nicola; Granchi, Donatella

2014-06-11

Four Indian plants, traditionally used in Ayurvedic medicine: Asparagus racemosus Willd., Emblica officinalis Gaertn., Hemidesmus indicus R. Br., and Rubia cordifolia L. were selected on the basis of their ethnobotanical use and of scientific evidence that suggests a potential efficacy in the treatment of bone-loss diseases. The antiresorptive properties of the four plants have been investigated. The aim was to provide adequate evidence for the exploitation of natural compounds as alternative therapeutics for the treatment of diseases caused by increased osteoclast activity. Decoctions were prepared from dried plant material according to the traditional procedure and standardization by HPLC was performed using marker compounds for each species. Total polyphenols, flavonoids and radical scavenging activity of the decoctions were also determined. The bioactivity of the plant decoctions was evaluated in subsequent phases. (1) A cytotoxicity screening was performed on the mouse monocytic RAW 264.7 cell line to define the concentrations that could be utilized in the following step. (2) The antiresorptive properties of plant decoctions were compared with that of a "gold standard" drug (alendronate) by measuring osteoclastogenesis inhibition and osteoclast apoptosis. (3) The toxic effect on bone forming cells was excluded by evaluating the impact on the proliferation of osteogenic precursors (mesenchymal stem cells, MSC). All the decoctions inhibited osteoclastogenesis similarly to alendronate at the highest doses, but Hemidesmus indicus and Rubia cordifolia were also effective at lower concentrations. Apoptosis increased significantly when cells were exposed to the highest concentration of Emblica officinalis, Hemidesmus indicus, and Rubia cordifolia. All concentrations of Emblica officinalis tested inhibited the proliferation of osteogenic precursors, while only the highest doses of Asparagus racemosus and Rubia cordifolia were toxic. On the contrary, Hemidesmus indicus

The infestation by an exotic ambrosia beetle, Euplatypus parallelus (F. (Coleoptera: Curculionidae: Platypodinae of Angsana trees (Pterocarpus indicus Willd. in southern Thailand

Directory of Open Access Journals (Sweden)

Sara Bumrungsri

2008-07-01

Full Text Available An exotic ambrosia beetle, Euplatypus parallelus (F. was collected from infested Pterocarpus indicus Willd. trees in Prince of Songkla University. Larvae and eggs were found in simple galleries with a single branch. Either a single male or a male and a female were found in each gallery. Half of these infested trees were previously attacked by long-horned beetles probably Aristobia horridula (Hope (Coleoptera: Cerambycidae, while some of them appeared to be healthy. Fusarium oxysporum Schlecht.:Fr. was isolated from frass, sapwood samples and insect larvae, and might be a cause of death of P.indicus.

Studies on the growth of penaeid prawns: 2. Growth of @iPenaeus indicus@@ under different levels of feeding

Digital Repository Service at National Institute of Oceanography (India)

Nair, S.R.S.; Iyer, H.K.; Balasubramanian, T.; Kutty, M.K.

@iPenaeus indicus@@ was subjected to four different levels of feeding with live earthworm. The growth increments irrespective of the feeding levels did not show any decreasing trend throughout the experimental period. This is probably because...

Length-weight relation and condition factor of @iPenaeus indicus@@ and @iMetapenaeus dobsoni@@ in the Cochin Backwater

Digital Repository Service at National Institute of Oceanography (India)

Devi, C.B.L.; Nair, K.K.C.; Balasubramanian, T.; Gopalakrishnan, T.C.; Aravindakshan, P.N.; Kutty, M.K.

Length-weight relation and condition factor of @iPenaeus indicus@@ and @iMetapenaeus dobsoni@@ were estimated using samples from Cochin backwater. Statistical tests support the view that the length-weight exponent of these species may be species...

The temporal behaviour of Taurus X-1 (the Crab Nebula)

International Nuclear Information System (INIS)

Davison, P.J.N.

1975-01-01

Copernicus data on Taurus X-1 and the Crab pulsar extending over a 2 1/2-yr period indicate that under normal conditions the source has a flux that is constant to within 2.5 per cent at the 90 per cent confidence level. The pulsed/total flux ratio also shows no significant changes during the same time. (author)

Mosquitocidal and water purification properties of Cynodon dactylon, Aloe vera, Hemidesmus indicus and Coleus amboinicus leaf extracts.

Science.gov (United States)

Ethanolic extracts of Cynodon dactylon, Aloe vera, Hemidesmus indicus and Coleus amboinicus were tested for toxicity to 3rd instar Anopheles stephensi, Culex quinquefasciatus, and Aedes aegypti. Median lethal concentrations (LC50) were, respectively, 0.44%, 0.51%, 0.59% and 0.68%. Cynodon dactylon...

Studies on the growth of penaeid prawns. 3. Growth pattern of @iPenaeus indicus@@ and @iMetapenaeus dobsoni@@

Digital Repository Service at National Institute of Oceanography (India)

Nair, S.R; Nair, K.K.C.; Gopalakrishnan, T.C.; Kutty, M.K.

Experimental studies on the growth of @iPenaeus indicus@@ and @iMetapenaeus dobsoni@@ for three and a half months under different levels of feeding gave a growth pattern different from that of von Bertalanffy. The two distinct growth patterns...

Detection of warm water vapour in Taurus protoplanetary discs by Herschel

NARCIS (Netherlands)

Riviere-Marichalar, P.; Menard, F.; Thi, W. F.; Kamp, I.; Montesinos, B.; Meeus, G.; Woitke, P.; Howard, C.; Sandell, G.; Podio, L.; Dent, W. R. F.; Mendigutia, I.; Pinte, C.; White, G. J.; Barrado, D.

Line spectra of 68 Taurus T Tauri stars were obtained with the Herschel-PACS (Photodetector Array Camera and Spectrometer) instrument as part of the GASPS (GAS evolution in Protoplanetary Systems) survey of protoplanetary discs. A careful examination of the linescans centred on the [OI] 63.18 mu m

THE GOULD'S BELT VERY LARGE ARRAY SURVEY. IV. THE TAURUS-AURIGA COMPLEX

Energy Technology Data Exchange (ETDEWEB)

Dzib, Sergio A. [Max Planck Institut für Radioastronomie, Auf dem Hügel 69, D-53121 Bonn (Germany); Loinard, Laurent; Rodríguez, Luis F.; Ortiz-León, Gisela N.; Pech, Gerardo; Rivera, Juana L. [Centro de Radioastronomía y Astrofísica, Universidad Nacional Autónoma de México Apartado Postal 3-72, 58090 Morelia, Michoacán (Mexico); Mioduszewski, Amy J. [National Radio Astronomy Observatory, Domenici Science Operations Center, 1003 Lopezville Road, Socorro, NM 87801 (United States); Kounkel, Marina A.; Hartmann, Lee [Department of Astronomy, University of Michigan, 500 Church Street, Ann Arbor, MI 48105 (United States); Torres, Rosa M. [Instituto de Astronomía y Meteorología, Universidad de Guadalajara, Avenida Vallarta No. 2602, Col. Arcos Vallarta, CP 44130 Guadalajara, Jalisco, México (Mexico); Boden, Andrew F. [Division of Physics, Math, and Astronomy, California Institute of Technology, 1200 East California Boulevard, Pasadena, CA 91125 (United States); Evans II, Neal J. [Department of Astronomy, The University of Texas at Austin, 1 University Station, C1400, Austin, TX 78712 (United States); Briceño, Cesar [Cerro Tololo Interamerican Observatory, Casilla 603, La Serena (Chile); Tobin, John, E-mail: sdzib@mpifr-bonn.mpg.de [Leiden Observatory, Leiden University, P.O. Box 9513, 2300 RA Leiden (Netherlands)

2015-03-10

We present a multi-epoch radio study of the Taurus-Auriga star-forming complex made with the Karl G. Jansky Very Large Array at frequencies of 4.5 GHz and 7.5 GHz. We detect a total of 610 sources, 59 of which are related to young stellar objects (YSOs) and 18 to field stars. The properties of 56% of the young stars are compatible with non-thermal radio emission. We also show that the radio emission of more evolved YSOs tends to be more non-thermal in origin and, in general, that their radio properties are compatible with those found in other star-forming regions. By comparing our results with previously reported X-ray observations, we notice that YSOs in Taurus-Auriga follow a Güdel-Benz relation with κ = 0.03, as we previously suggested for other regions of star formation. In general, YSOs in Taurus-Auriga and in all the previous studied regions seem to follow this relation with a dispersion of ∼1 dex. Finally, we propose that most of the remaining sources are related with extragalactic objects but provide a list of 46 unidentified radio sources whose radio properties are compatible with a YSO nature.

THE GOULD'S BELT VERY LARGE ARRAY SURVEY. IV. THE TAURUS-AURIGA COMPLEX

International Nuclear Information System (INIS)

Dzib, Sergio A.; Loinard, Laurent; Rodríguez, Luis F.; Ortiz-León, Gisela N.; Pech, Gerardo; Rivera, Juana L.; Mioduszewski, Amy J.; Kounkel, Marina A.; Hartmann, Lee; Torres, Rosa M.; Boden, Andrew F.; Evans II, Neal J.; Briceño, Cesar; Tobin, John

2015-01-01

We present a multi-epoch radio study of the Taurus-Auriga star-forming complex made with the Karl G. Jansky Very Large Array at frequencies of 4.5 GHz and 7.5 GHz. We detect a total of 610 sources, 59 of which are related to young stellar objects (YSOs) and 18 to field stars. The properties of 56% of the young stars are compatible with non-thermal radio emission. We also show that the radio emission of more evolved YSOs tends to be more non-thermal in origin and, in general, that their radio properties are compatible with those found in other star-forming regions. By comparing our results with previously reported X-ray observations, we notice that YSOs in Taurus-Auriga follow a Güdel-Benz relation with κ = 0.03, as we previously suggested for other regions of star formation. In general, YSOs in Taurus-Auriga and in all the previous studied regions seem to follow this relation with a dispersion of ∼1 dex. Finally, we propose that most of the remaining sources are related with extragalactic objects but provide a list of 46 unidentified radio sources whose radio properties are compatible with a YSO nature

Absolute measurements of fluxes from Cassiopeia A, Cygnus A, Taurus A, Virgo A at seven wavelengths in the 1.8-4.2 cm band

International Nuclear Information System (INIS)

Dmitrenko, L.V.; Snegireva, V.V.; Turchin, V.I.; Tsejtlin, N.M.; Voronkov, L.A.; Dmitrenko, D.A.; Kuznetsova, N.A.; Kholodilov, N.N.

1981-01-01

Results of absolute measurements of fluxes from Cassiopeia A, Cygnus A, Taurus A, Virgo A at 1.8-4.17 cm wavelengths are presented. Spectra are built in the wave range of 1.8-100 cm with the use of results obtained earlier. Variability has been detected in radiation of Taurus A as well as ''steps'' in the spectrum of Taurus A with the spectral index α=0 in the region of 2 cm and 3-4 cm [ru

cDNA cloning, characterization and expression analysis of a novel antimicrobial peptide gene penaeidin-3 (Fi-Pen3) from the haemocytes of Indian white shrimp Fenneropenaeus indicus.

Science.gov (United States)

Shanthi, S; Vaseeharan, B

2012-03-20

A new member of antimicrobial peptide genes of the penaeidin family, penaeidin 3, was cloned from the haemocytes of Indian white shrimp Fenneropeneaus indicus (F. indicus), by reverse transcription PCR (RT-PCR) and rapid amplification of cDNA end (RACE-PCR) methods. The complete nucleotide sequence of cDNA clone of Indian white shrimp F. indicus Penaeidin 3 (Fi-Pen3) was 243bp long and has an open reading frame which encodes 80 amino acid peptide. The homology analysis of Fi-Pen3 sequence with other Penaeidins 3 shows higher similarity with Penaeus monodon (92%). The theoretical 3D structure generated through ab initio modelling indicated the presence of two-disulphide bridges in the alpha-helix. The signal peptide sequence of Fi-Pen3 is almost entirely homologous to that of other Penaeidin 3 of crustaceans, while differing relatively in the N-terminal domain of the mature peptide. The mature peptide has a predicted molecular weight of 84.9kDa, and a theoretical pI of 9.38. Phylogenetic analysis of Fi-Pen3 shows high resemblance with other Pen-3 from P. monodon, Litopenaeus stylirostris, Litopenaeus vannamei and Litopenaeus setiferus. Fi-Pen3 found to be expressed in haemocytes, heart, hepatopancreas, muscles, gills, intestine, and eyestalk with higher expression in haemocytes. Microbial challenge resulted in mRNA up-regulation, up to 6h post injection of Vibrio parahemolyticus. The Fi-Pen3 mRNA expression of F. indicus in the premolt stage (D(01) and D(02)) was significantly up-regulated than the postmolt (A and B) and intermolt stages (C). The findings of the present paper underline the involvement of Fi-Pen3 in innate immune system of F. indicus. Copyright © 2011 Elsevier GmbH. All rights reserved.

A breeding site record of Long-billed Vulture Gyps indicus (Aves: Accipitriformes: Accipitridae from Bejjur Reserve Forest, Telangana, India

Directory of Open Access Journals (Sweden)

Swetha Stotrabhashyam

2015-01-01

Full Text Available The Long-billed Vulture Gyps indicus is, Critically Endangered with few known breeding sites in peninsular India.  We present a previously undocumented Long-billed Vulture breeding site in Bejjur Reserve Forest, Adilabad District, northern Telangana.

Breeding programs for the main economically important traits of zebu dairy cattle

Directory of Open Access Journals (Sweden)

Ariosto Ardila Silva

2010-06-01

Full Text Available In tropical regions, Gyr and Guzerat breeds (Bos indicus are most explored for dairy industry and are much more adapted to climate. Gyr and Guzerat are Zebu breeds very common in Brazil and they are being used to generate Bos taurus x Bos indicus crosses in order to combine good production, heat and parasite tolerance on the tropics. Breeding programs for the main economically important traits of Zebu dairy cattle have been recently introduced in Brazil and is based on the use of genetically superior sires in the herds. A major objective of QTL (Quantitative Trait Loci and candidate genes is to find genes and markers that can be implemented in breeding programs across marker assisted selection (MAS. In Zebu dairy cattle MAS could be used to pre-select young candidate bulls to progeny testing, thus increasing selection differentials, shortening generation interval and increasing genetic gain

A CENSUS OF ROTATION AND VARIABILITY IN L1495: A UNIFORM ANALYSIS OF TRANS-ATLANTIC EXOPLANET SURVEY LIGHT CURVES FOR PRE-MAIN-SEQUENCE STARS IN TAURUS

International Nuclear Information System (INIS)

Xiao Hongyu; Covey, Kevin R.; Lloyd, James P.; Rebull, Luisa; Charbonneau, David; Mandushev, Georgi; O'Donovan, Francis; Slesnick, Catherine

2012-01-01

We analyze light curves obtained by the Trans-atlantic Exoplanet Survey (TrES) for a field centered on the L1495 dark cloud in Taurus. The Spitzer Taurus Legacy Survey catalog identifies 179 bona fide Taurus members within the TrES field; 48 of the known Taurus members are detected by TrES, as well as 26 candidate members identified by the Spitzer Legacy team. We quantify the variability of each star in our sample using the ratio of the standard deviation of the original light curve (σ orig. ) to the standard deviation of a light curve that has been smoothed by 9 or 1001 epochs (σ 9 and σ 1001 , respectively). Known Taurus members typically demonstrate (σ orig. /σ 9 ) orig. /σ 1001 ) orig. /σ 9 ) ∼ 3.0 and (σ orig. /σ 1001 ) ∼ 10, as expected for light curves dominated by unstructured white noise. Of the 74 Taurus members/candidates with TrES light curves, we detect significant variability in 49 sources. Adapting a quantitative metric originally developed to assess the reliability of transit detections, we measure the amount of red and white noise in each light curve and identify 18 known or candidate Taurus members with highly significant period measurements. These appear to be the first periods measured for four of these sources (HD 282276, CX Tau, FP Tau, TrES J042423+265008), and in two other cases, the first non-aliased periods (LkCa 21 and DK Tau AB). For the remainder, the TrES measurements typically agree very well (δP < 1%) with previously reported values. Including periods measured at lower confidence for 15 additional sources, we report periods for 11 objects where no previous periods were found, including 8 confirmed Taurus members. We also identify 10 of the 26 candidate Taurus members that demonstrate variability levels consistent with being bona fide T Tauri stars. A Kolomgorov-Smirnov (K-S) test confirms that these new periods confirm the distinction between the rotation period distributions of stars with and without circumstellar

Interstellar extinction in the Taurus dark clouds

International Nuclear Information System (INIS)

Meistas, E.; Straizys, V.

1981-01-01

The results of photoelectric photometry of 89 stars in the Vilnius seven-color system in the area of the Taurus dark clouds with corrdinates (1950) 4sup(h)16sup(m)-4sup(h)33sup(m), +16 0 -+20 0 are presented. Photometric spectral types, absolute magnitude, color excesses, interstellar extinctions and distances of the stars are determined. The distance of the dark nebula is found to be 140 pc and is in a good agreement with the distance determined for the dark nebula Khavtassi 286, 278. The average extinction Asub(v) in the investigated area is of the order of 1.4. (author)

Clotting of cow (Bos taurus) and goat milk ( Capra hircus ) using ...

African Journals Online (AJOL)

The ease to locally produce kid rennet contrary to that of calve has led us to compare the proteolytic and clotting activities of these two rennets depending on their action on goat (Capra hircus) milk and cow (Bos taurus) milk. The proteolysis was measured by determining the increase of non-protein nitrogen according to the ...

Anomalous strength of the 2200 Angstroem feature in Cassiopeia-Taurus association

International Nuclear Information System (INIS)

Morales, C.; Ruiz del Arbol, J.A.; Llorente de Andres, F.

1980-01-01

From a large sample of reddened stars we computed the individual extinction curves which agree with that calculated by Nandy et al. (1976), except for four stars which show that the extinction at the 2200 Angstroem feature is greater than that deduced for the rest of stars. These four stars belong to the Cassiopeia-Taurus association. (orig.)

THE RELATION BETWEEN GAS AND DUST IN THE TAURUS MOLECULAR CLOUD

International Nuclear Information System (INIS)

Pineda, Jorge L.; Goldsmith, Paul F.; Chapman, Nicholas; Li Di; Snell, Ronald L.; Cambresy, Laurent; Brunt, Chris

2010-01-01

We report a study of the relation between dust and gas over a 100 deg 2 area in the Taurus molecular cloud. We compare the H 2 column density derived from dust extinction with the CO column density derived from the 12 CO and 13 CO J = 1 → 0 lines. We derive the visual extinction from reddening determined from 2MASS data. The comparison is done at an angular size of 200'' corresponding to 0.14 pc at a distance of 140 pc. We find that the relation between visual extinction A V and N(CO) is linear between A V ≅ 3 and 10 mag in the region associated with the B213-L1495 filament. In other regions, the linear relation is flattened for A V ∼> 4 mag. We find that the presence of temperature gradients in the molecular gas affects the determination of N(CO) by ∼30%-70% with the largest difference occurring at large column densities. Adding a correction for this effect and accounting for the observed relation between the column density of CO and CO 2 ices and A V , we find a linear relationship between the column of carbon monoxide and dust for observed visual extinctions up to the maximum value in our data ≅23 mag. We have used these data to study a sample of dense cores in Taurus. Fitting an analytical column density profile to these cores we derive an average volume density of about 1.4 x 10 4 cm -3 and a CO depletion age of about 4.2 x 10 5 yr. At visual extinctions smaller than ∼3 mag, we find that the CO fractional abundance is reduced by up to two orders of magnitude. The data show a large scatter suggesting a range of physical conditions of the gas. We estimate the H 2 mass of Taurus to be about 1.5 x 10 4 M sun , independently derived from the A V and N(CO) maps. We derive a CO integrated intensity to H 2 conversion factor of about 2.1 x 10 20 cm -2 (K km s -1 ) -1 , which applies even in the region where the [CO]/[H 2 ] ratio is reduced by up to two orders of magnitude. The distribution of column densities in our Taurus maps resembles a log

Influence of Type of Electric Bright Light on the Attraction of the African Giant Water Bug, Lethocerus indicus (Hemiptera: Belostomatidae

Directory of Open Access Journals (Sweden)

Luke Chinaru Nwosu

2012-01-01

Full Text Available This study investigated the influence of type of electric bright light (produced by fluorescent light tube and incandescent light bulb on the attraction of the African giant water bug, Lethocerus indicus (Hemiptera: Belostomatidae. Four fluorescent light tubes of 15 watts each, producing white-coloured light and four incandescent light bulbs of 60 watts each, producing yellow-coloured light, but both producing the same amount of light, were varied and used for the experiments. Collections of bugs at experimental house were done at night between the hours of 8.30 pm and 12 mid-night on daily basis for a period of four months per experiment in the years 2008 and 2009. Lethocerus indicus whose presence in any environment has certain implications was the predominant belostomatid bug in the area. Use of incandescent light bulbs in 2009 significantly attracted more Lethocerus indicus 103 (74.6% than use of fluorescent light tubes 35 (25.41% in 2008 [4.92=0.0001]. However, bug’s attraction to light source was not found sex dependent [>0.05; (>0.18=0.4286 and >0.28=0.3897]. Therefore, this study recommends the use of fluorescent light by households, campgrounds, and other recreational centres that are potentially exposed to the nuisance of the giant water bugs. Otherwise, incandescent light bulbs should be used when it is desired to attract the presence of these aquatic bugs either for food or scientific studies.

The Pan-STARRS1 Proper-motion Survey for Young Brown Dwarfs in Nearby Star-forming Regions. I. Taurus Discoveries and a Reddening-free Classification Method for Ultracool Dwarfs

Science.gov (United States)

Zhang, Zhoujian; Liu, Michael C.; Best, William M. J.; Magnier, Eugene A.; Aller, Kimberly M.; Chambers, K. C.; Draper, P. W.; Flewelling, H.; Hodapp, K. W.; Kaiser, N.; Kudritzki, R.-P.; Metcalfe, N.; Wainscoat, R. J.; Waters, C.

2018-05-01

We are conducting a proper-motion survey for young brown dwarfs in the Taurus-Auriga molecular cloud based on the Pan-STARRS1 3π Survey. Our search uses multi-band photometry and astrometry to select candidates, and is wider (370 deg2) and deeper (down to ≈3 M Jup) than previous searches. We present here our search methods and spectroscopic follow-up of our high-priority candidates. Since extinction complicates spectral classification, we have developed a new approach using low-resolution (R ≈ 100) near-infrared spectra to quantify reddening-free spectral types, extinctions, and gravity classifications for mid-M to late-L ultracool dwarfs (≲100–3 M Jup in Taurus). We have discovered 25 low-gravity (VL-G) and the first 11 intermediate-gravity (INT-G) substellar (M6–L1) members of Taurus, constituting the largest single increase of Taurus brown dwarfs to date. We have also discovered 1 new Pleiades member and 13 new members of the Perseus OB2 association, including a candidate very wide separation (58 kau) binary. We homogeneously reclassify the spectral types and extinctions of all previously known Taurus brown dwarfs. Altogether our discoveries have thus far increased the substellar census in Taurus by ≈40% and added three more L-type members (≲5–10 M Jup). Most notably, our discoveries reveal an older (>10 Myr) low-mass population in Taurus, in accord with recent studies of the higher-mass stellar members. The mass function appears to differ between the younger and older Taurus populations, possibly due to incompleteness of the older stellar members or different star formation processes.

A deterministic simulation study of embryo marker-assisted selection for age at first calving in Nellore ( Bos indicus) beef cattle

NARCIS (Netherlands)

Rosa, A.J.M.; Bijma, P.; Oliveira, H.N.; Lobo, R.B.; Arendonk, van J.A.M.

2007-01-01

We used deterministic simulation of four alternative multiple ovulation and embryo manipulation (MOET) closed nucleus schemes to investigate the benefits of using marker-assisted selection (MAS) of Nellore (Bos indicus) beef cattle embryos prior to transplantation to reduce the age at first calving

A Survey For Planetary-mass Brown Dwarfs in the Taurus and Perseus Star-forming Regions

Energy Technology Data Exchange (ETDEWEB)

Esplin, T. L.; Luhman, K. L., E-mail: taran.esplin@psu.edu [Department of Astronomy and Astrophysics, The Pennsylvania State University, University Park, PA 16802 (United States)

2017-10-01

We present the initial results from a survey for planetary-mass brown dwarfs in the Taurus star-forming region. We have identified brown dwarf candidates in Taurus using proper motions and photometry from several ground- and space-based facilities. Through spectroscopy of some of the more promising candidates, we have found 18 new members of Taurus. They have spectral types ranging from mid-M to early-L, and they include the four faintest known members in extinction-corrected K{sub s}, which should have masses as low as ∼4–5 M {sub Jup} according to evolutionary models. Two of the coolest new members (M9.25, M9.5) have mid-IR excesses that indicate the presence of disks. Two fainter objects with types of M9–L2 and M9–L3 also have red mid-IR colors relative to photospheres at ≤L0, but since the photospheric colors are poorly defined at >L0, it is unclear whether they have excesses from disks. We also have obtained spectra of candidate members of the IC 348 and NGC 1333 clusters in Perseus that were identified by Luhman et al. Eight candidates are found to be probable members, three of which are among the faintest and least-massive known members of the clusters (∼5 M{sub Jup}).

A Survey For Planetary-mass Brown Dwarfs in the Taurus and Perseus Star-forming Regions

International Nuclear Information System (INIS)

Esplin, T. L.; Luhman, K. L.

2017-01-01

We present the initial results from a survey for planetary-mass brown dwarfs in the Taurus star-forming region. We have identified brown dwarf candidates in Taurus using proper motions and photometry from several ground- and space-based facilities. Through spectroscopy of some of the more promising candidates, we have found 18 new members of Taurus. They have spectral types ranging from mid-M to early-L, and they include the four faintest known members in extinction-corrected K s , which should have masses as low as ∼4–5 M Jup according to evolutionary models. Two of the coolest new members (M9.25, M9.5) have mid-IR excesses that indicate the presence of disks. Two fainter objects with types of M9–L2 and M9–L3 also have red mid-IR colors relative to photospheres at ≤L0, but since the photospheric colors are poorly defined at >L0, it is unclear whether they have excesses from disks. We also have obtained spectra of candidate members of the IC 348 and NGC 1333 clusters in Perseus that were identified by Luhman et al. Eight candidates are found to be probable members, three of which are among the faintest and least-massive known members of the clusters (∼5 M Jup ).

A search for companions to brown dwarfs in the Taurus and Chamaeleon star-forming regions

International Nuclear Information System (INIS)

Todorov, K. O.; Luhman, K. L.; Konopacky, Q. M.; McLeod, K. K.; Apai, D.; Pascucci, I.; Ghez, A. M.; Robberto, M.

2014-01-01

We have used WFPC2 on board the Hubble Space Telescope to obtain images of 47 members of the Taurus and Chamaeleon I star-forming regions that have spectral types of M6-L0 (M ∼ 0.01-0.1 M ☉ ). An additional late-type member of Taurus, FU Tau (M7.25+M9.25), was also observed with adaptive optics at Keck Observatory. In these images, we have identified promising candidate companions to 2MASS J04414489+2301513 (ρ = 0.''105/15 AU), 2MASS J04221332+1934392 (ρ = 0.''05/7 AU), and ISO 217 (ρ = 0.''03/5 AU). We reported the first candidate in a previous study, showing that it has a similar proper motion as the primary in images from WFPC2 and Gemini adaptive optics. We have collected an additional epoch of data with Gemini that further supports that result. By combining our survey with previous high-resolution imaging in Taurus, Chamaeleon I, and Upper Sco (τ ∼ 10 Myr), we measure binary fractions of 14/93 = 0.15 −0.03 +0.05 for M4-M6 (M ∼ 0.1-0.3 M ☉ ) and 4/108 = 0.04 −0.01 +0.03 for >M6 (M ≲ 0.1 M ☉ ) at separations of >10 AU. Given the youth and low density of these regions, the lower binary fraction at later types is probably primordial rather than due to dynamical interactions among association members. The widest low-mass binaries (>100 AU) also appear to be more common in Taurus and Chamaeleon I than in the field, which suggests that the widest low-mass binaries are disrupted by dynamical interactions at >10 Myr, or that field brown dwarfs have been born predominantly in denser clusters where wide systems are disrupted or inhibited from forming.

A search for companions to brown dwarfs in the Taurus and Chamaeleon star-forming regions

Energy Technology Data Exchange (ETDEWEB)

Todorov, K. O.; Luhman, K. L. [Department of Astronomy and Astrophysics, The Pennsylvania State University, University Park, PA 16802 (United States); Konopacky, Q. M. [Lawrence Livermore National Laboratory, 7000 East Avenue, Livermore, CA 94550 (United States); McLeod, K. K. [Whitin Observatory, Wellesley College, Wellesley, MA 02481 (United States); Apai, D.; Pascucci, I. [Department of Astronomy, University of Arizona, 933 N. Cherry Avenue, Tucson, AZ 85721 (United States); Ghez, A. M. [Division of Astronomy and Astrophysics, University of California, Los Angeles, CA 90095 (United States); Robberto, M., E-mail: todorovk@phys.ethz.ch [Space Telescope Science Institute, 3700 San Martin Drive, Baltimore, MD 21218 (United States)

2014-06-10

We have used WFPC2 on board the Hubble Space Telescope to obtain images of 47 members of the Taurus and Chamaeleon I star-forming regions that have spectral types of M6-L0 (M ∼ 0.01-0.1 M {sub ☉}). An additional late-type member of Taurus, FU Tau (M7.25+M9.25), was also observed with adaptive optics at Keck Observatory. In these images, we have identified promising candidate companions to 2MASS J04414489+2301513 (ρ = 0.''105/15 AU), 2MASS J04221332+1934392 (ρ = 0.''05/7 AU), and ISO 217 (ρ = 0.''03/5 AU). We reported the first candidate in a previous study, showing that it has a similar proper motion as the primary in images from WFPC2 and Gemini adaptive optics. We have collected an additional epoch of data with Gemini that further supports that result. By combining our survey with previous high-resolution imaging in Taurus, Chamaeleon I, and Upper Sco (τ ∼ 10 Myr), we measure binary fractions of 14/93 = 0.15{sub −0.03}{sup +0.05} for M4-M6 (M ∼ 0.1-0.3 M {sub ☉}) and 4/108 = 0.04{sub −0.01}{sup +0.03} for >M6 (M ≲ 0.1 M {sub ☉}) at separations of >10 AU. Given the youth and low density of these regions, the lower binary fraction at later types is probably primordial rather than due to dynamical interactions among association members. The widest low-mass binaries (>100 AU) also appear to be more common in Taurus and Chamaeleon I than in the field, which suggests that the widest low-mass binaries are disrupted by dynamical interactions at >10 Myr, or that field brown dwarfs have been born predominantly in denser clusters where wide systems are disrupted or inhibited from forming.

Successful treatment of a necrotizing fasciitis patient caused by Mucor indicus with amphotericin B and skin grafting.

Science.gov (United States)

Luo, Yijin; Zeng, Fanqin; Huang, Xiaowen; Li, Qun; Tan, Guozhen; Xi, Liyan; Lu, Changming; Guo, Qing

2014-04-01

Cutaneous mucormycosis, an uncommon disease caused by Mucorales, predominantly occurs in immunocompromised host. The present case is a primary cutaneous mucormycosis due to Mucor indicus in an immunocompetent individual. It is with the features of necrotizing fasciitis over the right pretibial area. We are presenting this case owing to its rarity and the successful treatment with amphotericin B and skin grafting.

Full-length cloning and phylogenetic analyses of translationally controlled tumour protein and ferritin genes from the Indian white prawn, Fenneropenaeus indicus (H. Milne Edwards)

Digital Repository Service at National Institute of Oceanography (India)

Nayak, S.; Ramaiah, N.; Meena, R.M.; Sreepada, R.A.

-length sequences of these immune-relevant genes, this study highlighted their conserved natures, which perhaps make them important defence-related proteins in the innate immune system of F. indicus....

Molecular analysis of clinical isolates previously diagnosed as Mycobacterium intracellulare reveals incidental findings of "Mycobacterium indicus pranii" genotypes in human lung infection.

Science.gov (United States)

Kim, Su-Young; Park, Hye Yun; Jeong, Byeong-Ho; Jeon, Kyeongman; Huh, Hee Jae; Ki, Chang-Seok; Lee, Nam Yong; Han, Seung-Jung; Shin, Sung Jae; Koh, Won-Jung

2015-09-30

Mycobacterium intracellulare is a major cause of Mycobacterium avium complex lung disease in many countries. Molecular studies have revealed several new Mycobacteria species that are closely related to M. intracellulare. The aim of this study was to re-identify and characterize clinical isolates from patients previously diagnosed with M. intracellulare lung disease at the molecular level. Mycobacterial isolates from 77 patients, initially diagnosed with M. intracellulare lung disease were re-analyzed by multi-locus sequencing and pattern of insertion sequences. Among the 77 isolates, 74 (96 %) isolates were designated as M. intracellulare based on multigene sequence-based analysis. Interestingly, the three remaining strains (4 %) were re-identified as "Mycobacterium indicus pranii" according to distinct molecular phylogenetic positions in rpoB and hsp65 sequence-based typing. In hsp65 sequevar analysis, code 13 was found in the majority of cases and three unreported codes were identified. In 16S-23S rRNA internal transcribed spacer (ITS) sequevar analysis, all isolates of both species were classified within the Min-A ITS sequevar. Interestingly, four of the M. intracellulare isolates harbored IS1311, a M. avium-specific element. Two of three patients infected with "M. indicus pranii" had persistent positive sputum cultures after antibiotic therapy, indicating the clinical relevance of this study. This analysis highlights the importance of precise identification of clinical isolates genetically close to Mycobacterium species, and suggests that greater attention should be paid to nontuberculous mycobacteria lung disease caused by "M. indicus pranii".

Toxoplasma gondii in experimentally infected Bos taurus and Bos indicus semen and tissues Toxoplasma gondii em semen e tecidos de Bos taurus and Bos indicus experimentalmente infectados

Directory of Open Access Journals (Sweden)

Leslie Scarpelli

2009-01-01

Full Text Available Eighteen young steers were inoculated with Toxoplasma gondii and randomly distributed into three groups of six animals each: GI, 2.5x10(5 "P" strain oocysts, GII, 5.0x10(6 "RH" strain tachyzoites, and GIII (Control. Clinical, serological and parasitemia exams were realized. Parasite investigation by bioassay and PCR was realized on semen and fragments of skeletal musculature, lymph nodes, brain, retina, spleen, liver, lung, testicle, epididymis and seminal vesicle. Blood and semen samples were collected on days -2, -1, 1, 3, 5, 7, 14 and weekly thereafter, up to postinfection day (PID 84. The inoculated steers (GI and GII presented hyperthermia from PID 3 to 16. Antibodies against T. gondii were detected through the indirect fluorescence antibody test (IFAT on PID 5 (1:16 in both inoculated groups (oocysts and tachyzoites, reaching peaks of 1:4096 on PID 7. Parasitemia outbursts occurred in all infected bovines, principally from PID 7 to 28, independent of the strain and inoculate used. Bioassays revealed the presence of parasites in semen samples of animals infected with oocysts (GI and tachyzoites (GII on several experimental days between PID 7 and 84. Tissue parasitism by T. gondii was diagnosed by bioassay and the PCR technique in several organ and tissue fragments. These findings suggest the possibility of sexual transmission of T. gondii in the bovine species.Dezoito bovinos foram inoculados com Toxoplasma gondii e distribuídos aleatoriamente em três grupos de seis bovinos cada: GI (2,5x10(5 oocistos da cepa "P", GII (5,0x10(6 taquizoítos da cepa "RH" e GIII (controle. Exames clínicos, sorológicos e parasitêmicos foram realizados. Pesquisas do parasito, por meio da bioprova e pela técnica de Reação em Cadeia pela Polimerase (PCR, foram realizadas no sêmen e em fragmentos de musculatura esquelética, linfonodos, cérebro, retina, baço, fígado, pulmão, testículo, epidídimo e vesícula seminal. Amostras de sangue e sêmen foram colhidas nos dias -2, -1, 1, 3, 5, 7, 14 e, semanalmente, até o 84º dia pós-infecção (DPI. Os bovinos inoculados (GI e GII apresentaram hipertermia do 3º ao 16º DPI. Anticorpos contra T. gondii foram detectados (IFI no 5º DPI (1:16, em ambos grupos inoculados (oocistos e taquizoítos, atingindo picos de 1:4096 no 7º DPI. Surtos parasitêmicos ocorreram em todos os bovinos infectados, principalmente do 7º ao 28º DPI, independente da cepa e inóculo utilizados. O bioensaio revelou a presença do parasito em amostras seminais dos bovinos infectados com oocistos (GI e taquizoítos (GII, em diversas datas experimentais, entre o 7º e 84º DPI. Parasitismo tissular por T. gondii foi diagnosticado por meio da bioprova e pela técnica da PCR, em vários fragmentos de tecidos e/ou órgãos. Os achados sugerem a possibilidade da ocorrência da transmissão sexual do T. gondii na espécie bovina.

COMBINED ANALYSIS OF IMAGES AND SPECTRAL ENERGY DISTRIBUTIONS OF TAURUS PROTOSTARS

International Nuclear Information System (INIS)

Gramajo, Luciana V.; Gomez, Mercedes; Whitney, Barbara A.; Robitaille, Thomas P.

2010-01-01

We present an analysis of spectral energy distributions (SEDs), near- and mid-infrared images, and Spitzer spectra of eight embedded Class I/II objects in the Taurus-Auriga molecular cloud. The initial model for each source was chosen using the grid of young stellar objects (YSOs) and SED fitting tool of Robitaille et al. Then the models were refined using the radiative transfer code of Whitney et al. to fit both the spectra and the infrared images of these objects. In general, our models agree with previous published analyses. However, our combined models should provide more reliable determinations of the physical and geometrical parameters since they are derived from SEDs, including the Spitzer spectra, covering the complete spectral range; and high-resolution near-infrared and Spitzer IRAC images. The combination of SED and image modeling better constrains the different components (central source, disk, envelope) of the YSOs. Our derived luminosities are higher, on average, than previous estimates because we account for the viewing angles (usually nearly edge-on) of most of the sources. Our analysis suggests that the standard rotating collapsing protostar model with disks and bipolar cavities works well for the analyzed sample of objects in the Taurus molecular cloud.

The phylogenomic position of the grey nurse shark Carcharias taurus Rafinesque, 1810 (Lamniformes, Odontaspididae) inferred from the mitochondrial genome.

Science.gov (United States)

Bowden, Deborah L; Vargas-Caro, Carolina; Ovenden, Jennifer R; Bennett, Michael B; Bustamante, Carlos

2016-11-01

The complete mitochondrial genome of the grey nurse shark Carcharias taurus is described from 25 963 828 sequences obtained using Illumina NGS technology. Total length of the mitogenome is 16 715 bp, consisting of 2 rRNAs, 13 protein-coding regions, 22 tRNA and 2 non-coding regions thus updating the previously published mitogenome for this species. The phylogenomic reconstruction inferred from the mitogenome of 15 species of Lamniform and Carcharhiniform sharks supports the inclusion of C. taurus in a clade with the Lamnidae and Cetorhinidae. This complete mitogenome contributes to ongoing investigation into the monophyly of the Family Odontaspididae.

Las salamancas mestizas: de las religiones indígenas a la hechicería colonial. Santiago del Estero, siglo XVIII

Directory of Open Access Journals (Sweden)

Judith Farberman

2005-12-01

Full Text Available La mayoría de los folcloristas ha coincidido en el origen hispano del estereotipo de escuela de magia conocida como salamanca, de amplia difusión en el noroeste argentino. Este trabajo postula la configuración mestiza del mismo y su desarrollo a partir de la hibridación de elementos religiosos y culturales entre los siglos XVI y XVIII. Como fuentes principales me he valido de dos procesos civiles contra hechiceras sustanciados en Santiago del Estero y, secundariamente, de materiales como Cartas Anuas jesuíticas, catecismos y confesionarios de indios.In general folklore studies agreed upon the Spanish origins of the magic school known as Salamanca, widely spread in the northwest of Argentina. Based on the existence of hybrid elements, found in culture and religion, this article poses the existence of a mestizo influence in its development in Santiago del Estero during the XVI and XVII centuries. The main sources analyzed were judicial processes held against witches in the area under study, and secondarily some material such us the Jesuits' Cartas Anuas, and Indian catechisms and confessionaries.

Breeding Biology of Critically Endangered Long-billed Vulture (Gyps indicus at a Unique Site in Telangana State, India

Directory of Open Access Journals (Sweden)

Ravikanth Manchiryala

2016-04-01

Full Text Available Out of nine species of vultures, the population of three Gyps species, White-backed Vulture (Gyps bengalensis, Slender-billed Vulture (Gyps tenuirostris and Long-billed Vulture (Gyps indicus has declined drastically by 99% over the past decade (Prakash, 1999. The Gyps vultures' population declined in India by 97% and by 92% in Pakistan (Virani, 2006, Prakash et al., 2012. Possibly the widespread usage of Diclofenac drug in the animal led to the rapid population decline for these Vultures (Green et al., 2004. The Long-billed Vulture G. indicus is a bald headed vulture with very broad wings and short tail feathers, having no sexual dimorphism. In Malabar hills region of India the breeding season of Long-billed Vultures was noted to be November to May where it breed mainly on cliffs (Edward, 1915. Presently, it is in the most critical category of endangerment, listed in Schedule-I of the Indian Wildlife Protection Act-1972 followed by IUCN, 2015 (http://www.iucnredlist.org/details/22729731/0. The Andhra Pradesh State Biodiversity Board, Hyderabad announced that vultures are already 'Extinct' in the state (Medicheti, 2013.

Estimativa de consumo de matéria seca e de fibra em detergente neutro por vacas leiteiras sob pastejo, suplementadas com diferentes quantidades de alimento concentrado

OpenAIRE

Sousa,B.M.; Saturnino,H.M.; Borges,A.L.C.C.; Lopes,F.C.F.; Silva,R.R.; Campos,M.M.; Pimenta,M.; Campos,W.E.

2008-01-01

Estimou-se o consumo de matéria seca e de fibra em detergente neutro por vacas leiteiras mestiças em pastejo de gramíneas do gênero Brachiaria. Foram utilizadas 24 vacas em lactação, distribuídas em três tratamentos com oito vacas cada, suplementadas com 4, 6 ou 8kg de matéria natural de alimento concentrado/vaca/dia, no momento da ordenha, duas vezes ao dia. O delineamento utilizado foi o de blocos ao acaso, sendo oito blocos com três vacas em cada um, cada vaca sendo alimentada com um dos t...

Absence of heat intolerance (panting) syndrome in foot-and-mouth disease-affected Indian cattle (Bos indicus) is associated with intact thyroid gland function.

Science.gov (United States)

Maddur, M S; Rao, S; Chockalingam, A K; Kishore, S; Gopalakrishna, S; Singh, N; Suryanarayana, V V S; Gajendragad, M R

2011-06-01

Foot-and-mouth disease (FMD) is a highly contagious and economically important viral disease with high morbidity and reduced productivity of affected animals. We studied the heat intolerance (HI) (panting) syndrome and the effect of FMD virus (FMDV) infection on thyroid gland function in Indian cattle (Bos indicus). Experimental infection with FMDV Asia 1 resulted in a mild form of disease with superficial lesions. Heat intolerance syndrome and its signs were not observed among the recovered animals. Subtle changes in the serum level of thyroid hormones, triiodothyronine (T₃) and thyroxine (T₄) were observed. However, there were no distinct histological changes in the thyroid gland, and FMDV antigens were not detected in the thyroid tissues. Our results thus suggest that the absence of panting syndrome in FMD-affected Bos indicus cattle may be associated with intact thyroid gland function.

VLBA DETERMINATION OF THE DISTANCE TO NEARBY STAR-FORMING REGIONS. III. HP TAU/G2 AND THE THREE-DIMENSIONAL STRUCTURE OF TAURUS

International Nuclear Information System (INIS)

Torres, Rosa M.; Loinard, Laurent; Rodriguez, Luis F.; Mioduszewski, Amy J.

2009-01-01

Using multiepoch Very Long Baseline Array (VLBA) observations, we have measured the trigonometric parallax of the weak-line T Tauri star HP Tau/G2 in Taurus. The best fit yields a distance of 161.2 ± 0.9 pc, suggesting that the eastern portion of Taurus (where HP Tau/G2 is located) corresponds to the far side of the complex. Previous VLBA observations have shown that T Tau, to the south of the complex, is at an intermediate distance of about 147 pc, whereas the region around L1495 corresponds to the near side at roughly 130 pc. Our observations of only four sources are still too coarse to enable a reliable determination of the three-dimensional structure of the entire Taurus star-forming complex. They do demonstrate, however, that VLBA observations of multiple sources in a given star-forming region have the potential not only to provide a very accurate estimate of its mean distance, but also to reveal its internal structure. The proper motion measurements obtained simultaneously with the parallax allowed us to study the kinematics of the young stars in Taurus. Combining the four observations available so far, we estimate the peculiar velocity of Taurus to be about 10.6 km s -1 almost completely in a direction parallel to the Galactic plane. Using our improved distance measurement, we have refined the determination of the position on the H-R diagram of HP Tau/G2, and of two other members of the HP Tau group (HP Tau itself and HP Tau/G3). Most pre-main-sequence evolutionary models predict significantly discrepant ages (by 5 Myr) for those three stars-expected to be coeval. Only in the models of Palla and Stahler do they fall on a single isochrone (at 3 Myr).

Dual Origins of Dairy Cattle Farming – Evidence from a Comprehensive Survey of European Y-Chromosomal Variation

DEFF Research Database (Denmark)

Edwards, Ceiridwen J; Genja, Catarina; Kantanen, Juha

2011-01-01

, with limited breed panels, identified two Bos taurus (taurine) haplogroups (Y1 and Y2; both composed of several haplotypes) and one Bos indicus (indicine/zebu) haplogroup (Y3), as well as a strong phylogeographic structuring of paternal lineages. Methodology and Principal Findings: Haplogroup data were......, the Nordic region and Russia, with the highest Ychromosomal diversity seen in the Iberian Peninsula. Conclusions: We propose that the homogeneous Y1 and Y2 regions reflect founder effects associated with the development and expansion of two groups of dairy cattle, the pied or red breeds from the North Sea...

Tractus génital des vaches zébus (Bos indicus) au Niger.

OpenAIRE

Moussa Garba, Mahamadou; Marichatou, H; Issa, M; Abdoul Aziz, ML; Hanzen, Christian

2013-01-01

Les caractéristiques anatomiques et les structures ovariennes et pathologiques du tractus génital de 500 femelles zébus (Bos indicus), appartenant à quatre races bovines (Azawak, Bororo, Djelli, Goudali), ont été étudiées à l’abattoir de Niamey au Niger du 15 août au 15 décembre 2011. Chaque animal a été examiné avant abattage. Ces vaches et génisses, âgées en moyenne de 8 ± 2,5 ans, ont eu une note d’état corporel moyenne de 1,6 ± 0,6 et un poids moyen de carcasse de 113 ± ...

The Brain of the Domestic Bos taurus: Weight, Encephalization and Cerebellar Quotients, and Comparison with Other Domestic and Wild Cetartiodactyla.

Science.gov (United States)

Ballarin, Cristina; Povinelli, Michele; Granato, Alberto; Panin, Mattia; Corain, Livio; Peruffo, Antonella; Cozzi, Bruno

2016-01-01

The domestic bovine Bos taurus is raised worldwide for meat and milk production, or even for field work. However the functional anatomy of its central nervous system has received limited attention and most of the reported data in textbooks and reviews are derived from single specimens or relatively old literature. Here we report information on the brain of Bos taurus obtained by sampling 158 individuals, 150 of which at local abattoirs and 8 in the dissecting room, these latter subsequently formalin-fixed. Using body weight and fresh brain weight we calculated the Encephalization Quotient (EQ), and Cerebellar Quotient (CQ). Formalin-fixed brains sampled in the necropsy room were used to calculate the absolute and relative weight of the major components of the brain. The data that we obtained indicate that the domestic bovine Bos taurus possesses a large, convoluted brain, with a slightly lower weight than expected for an animal of its mass. Comparisons with other terrestrial and marine members of the order Cetartiodactyla suggested close similarity with other species with the same feeding adaptations, and with representative baleen whales. On the other hand differences with fish-hunting toothed whales suggest separate evolutionary pathways in brain evolution. Comparison with the other large domestic herbivore Equus caballus (belonging to the order Perissodactyla) indicates that Bos taurus underwent heavier selection of bodily traits, which is also possibly reflected in a comparatively lower EQ than in the horse. The data analyzed suggest that the brain of domestic bovine is potentially interesting for comparative neuroscience studies and may represents an alternative model to investigate neurodegeneration processes.

The complete mitochondrial genome of the Asian tapirs (Tapirus indicus): the only extant Tapiridae species in the old world.

Science.gov (United States)

Muangkram, Yuttamol; Wajjwalku, Worawidh; Kaolim, Nongnid; Buddhakosai, Waradee; Kamolnorranath, Sumate; Siriaroonrat, Boripat; Tipkantha, Wanlaya; Dongsaard, Khwanruean; Maikaew, Umaporn; Sanannu, Saowaphang

2016-01-01

Asian tapir (Tapirus indicus) is categorized as Endangered on the 2008 IUCN red list. The first full-length mitochondrial DNA (mtDNA) sequence of Asian tapir is 16,717 bp in length. Base composition shows 34.6% A, 27.2% T, 25.8% C and 12.3% G. Highest polymorphic site is on the control region as typical for many species.

Possible maternal offloading of metals in the plasma, uterine and capsule fluid of pregnant ragged-tooth sharks (Carcharias taurus) on the east coast of South Africa.

Science.gov (United States)

Naidoo, Kristina; Chuturgoon, Anil; Cliff, Geremy; Singh, Sanil; Ellis, Megan; Otway, Nicholas; Vosloo, Andre; Gregory, Michael

2017-07-01

We studied the possible metal offloading onto the progeny of three pregnant female ragged-tooth sharks (Carcharias taurus) (C. taurus). The presences of five metals, i.e. aluminium (Al), arsenic (As), cadmium (Cd), lead (Pb) and selenium (Se) were validated by mass spectrometry in the maternal plasma as well as the intracapsular and uterine fluids (UF) in which embryos develop. Metals were ranked in a decreasing concentration as follows: Plasma: As > Al > Se > Pb > Cd; ICF: As > Se > Al > Cd > Pb and UF: As > Se > Al > Cd > Pb. As was present in the highest concentration in all three sharks. Al, Pb and Cd were found to be the highest within the plasma, while concentrations of Se were similar in all three fluids. These results indicate that C. taurus embryos are exposed to metals during early development, but the impact of this exposure remains unknown. To the best of our knowledge, this is the first investigation to confirm the presence of metals in the fluids that surround the developing C. taurus embryos, a species that is already listed as vulnerable.

Resposta superovulatória na primeira onda de crescimento folicular em doadoras Nelore (Bos indicus)

OpenAIRE

Luiz Fernando Tonissi Nasser

2006-01-01

Três experimentos foram realizados para testar a hipótese de que a resposta superestimulatória de doadoras Nelore (Bos indicus) com tratamentos iniciados próximo à ovulação durante a primeira onda de crescimento folicular seria maior ou comparável àquela decorrente de tratamentos convencionais. Os animais foram aleatoriamente alocados em três grupos. As doadoras dos Grupos 1 - Onda 1 s/P4 e 2 - Onda 1 c/P4 foram superestimuladas na primeira onda de crescimento folicular, e as do Grupo 3 - Sin...

Evidence of Bos javanicus x Bos indicus hybridization and major QTLs for birth weight in Indonesian Peranakan Ongole cattle.

Science.gov (United States)

Hartati, Hartati; Utsunomiya, Yuri Tani; Sonstegard, Tad Stewart; Garcia, José Fernando; Jakaria, Jakaria; Muladno, Muladno

2015-07-04

Peranakan Ongole (PO) is a major Indonesian Bos indicus breed that derives from animals imported from India in the late 19(th) century. Early imports were followed by hybridization with the Bos javanicus subspecies of cattle. Here, we used genomic data to partition the ancestry components of PO cattle and map loci implicated in birth weight. We found that B. javanicus contributes about 6-7% to the average breed composition of PO cattle. Only two nearly fixed B. javanicus haplotypes were identified, suggesting that most of the B. javanicus variants are segregating under drift or by the action of balancing selection. The zebu component of the PO genome was estimated to derive from at least two distinct ancestral pools. Additionally, well-known loci underlying body size in other beef cattle breeds, such as the PLAG1 region on chromosome 14, were found to also affect birth weight in PO cattle. This study is the first attempt to characterize PO at the genome level, and contributes evidence of successful, stabilized B. indicus x B. javanicus hybridization. Additionally, previously described loci implicated in body size in worldwide beef cattle breeds also affect birth weight in PO cattle.

Individual taper models for natural cedar and Taurus fir mixed stands of Bucak Region, Turkey

Directory of Open Access Journals (Sweden)

Ramazan Özçelik

2017-11-01

Full Text Available In this study, we assessed the performance of different types of taper equations for predicting tree diameters at specific heights and total stem volumes for mixed stands of Taurus cedar (Cedrus libani A. Rich. and Taurus fir (Abies cilicica Carr.. We used data from mixed stands containing a total of 131 cedar and 124 Taurus fir trees. We evaluated six commonly used and well-known forestry taper functions developed by a variety of researchers (Biging (1984, Zakrzewski (1999, Muhairwe (1999, Fang et al. (2000, Kozak (2004, and Sharma and Zhang (2004. To address problems related to autocorrelation and multicollinearity in the hierarchical data associated with the construction of taper models, we used appropriate statistical procedures for the model fitting. We compared model performances based on the analysis of three goodness-of-fit statistics and found the compatible segmented model of Fang et al. (2000 to be superior in describing the stem profile and stem volume of both tree species in mixed stands. The equation used by Zakrzewski (1999 exhibited the poorest fitting results of the three taper equations. In general, we found segmented taper equations to provide more accurate predictions than variable-form models for both tree species. Results from the non-linear extra sum of squares method indicate that stem tapers differ among tree species in mixed stands. Therefore, a different taper function should be used for each tree species in mixed stands in the Bucak district. Using individual-specific taper equations yields more robust estimations and, therefore, will enhance the prediction accuracy of diameters at different heights and volumes in mixed stands.

TAURUS observations of the emission-line velocity field of Centaurus A (NGC 5128)

International Nuclear Information System (INIS)

Taylor, K.; Atherton, P.D.

1983-01-01

Using TAURUS - an Imaging Fabry Perot system in conjunction with the IPCS on the AAT, the authors have studied the velocity field of the Hα emission line at a spatial resolution of 1.7'' over the dark lane structure of Centaurus A. The derived velocity field is quite symmetrical and strongly suggests that the emission line material is orbiting the elliptical component, as a warped disc. (orig.)

Taurus Hill Observatory Scientific Observations for Pulkova Observatory during the 2016-2017 Season

Science.gov (United States)

Hentunen, V.-P.; Haukka, H.; Heikkinen, E.; Salmi, T.; Juutilainen, J.

2017-09-01

Taurus Hill Observatory (THO), observatory code A95, is an amateur observatory located in Varkaus, Finland. The observatory is maintained by the local astronomical association Warkauden Kassiopeia. THO research team has observed and measured various stellar objects and phenomena. Observatory has mainly focused on exoplanet light curve measurements, observing the gamma rays burst, supernova discoveries and monitoring. We also do long term monitoring projects.

Developmental changes in concentrations of vitellin, vitellogenin, and lipids in hemolymph, hepatopancreas, and ovaries from different ovarian stages of Indian white prawn Fenneropenaeus indicus

DEFF Research Database (Denmark)

Boucard, C.G.V.; Levy, P.; Ceccaldi, H.J.

2002-01-01

The objective of the present study was to characterize the relationship between vitellogenin (Vtg) and vitellin (Vt) concentration profiles during the reproductive cycle of the penaeid prawn Fenneropenaeus indicus. Vt was purified from ovaries of vitellogenic females by gradient ultracentrifugati...

The Brain of the Domestic Bos taurus: Weight, Encephalization and Cerebellar Quotients, and Comparison with Other Domestic and Wild Cetartiodactyla.

Directory of Open Access Journals (Sweden)

Cristina Ballarin

Full Text Available The domestic bovine Bos taurus is raised worldwide for meat and milk production, or even for field work. However the functional anatomy of its central nervous system has received limited attention and most of the reported data in textbooks and reviews are derived from single specimens or relatively old literature. Here we report information on the brain of Bos taurus obtained by sampling 158 individuals, 150 of which at local abattoirs and 8 in the dissecting room, these latter subsequently formalin-fixed. Using body weight and fresh brain weight we calculated the Encephalization Quotient (EQ, and Cerebellar Quotient (CQ. Formalin-fixed brains sampled in the necropsy room were used to calculate the absolute and relative weight of the major components of the brain. The data that we obtained indicate that the domestic bovine Bos taurus possesses a large, convoluted brain, with a slightly lower weight than expected for an animal of its mass. Comparisons with other terrestrial and marine members of the order Cetartiodactyla suggested close similarity with other species with the same feeding adaptations, and with representative baleen whales. On the other hand differences with fish-hunting toothed whales suggest separate evolutionary pathways in brain evolution. Comparison with the other large domestic herbivore Equus caballus (belonging to the order Perissodactyla indicates that Bos taurus underwent heavier selection of bodily traits, which is also possibly reflected in a comparatively lower EQ than in the horse. The data analyzed suggest that the brain of domestic bovine is potentially interesting for comparative neuroscience studies and may represents an alternative model to investigate neurodegeneration processes.

Correlations between the stellar and disc properties of Taurus PMS stars in the GASPS sample

NARCIS (Netherlands)

Alonso-Martínez, Miguel; Riviere-Marichalar, Pablo; Pascual, Natalia; Montesinos, Benjamín; Howard, Christian D.; Sandell, Göran; Meeus, Gwendolyn; Eiroa, Carlos; Dent, Bill

The Herschel Open Time Key Programme GASPS (P.I. B. Dent) has observed a large number of pre-main sequence TTauri stars in Taurus with PACS (photometry and spectroscopy). In addition, we have also carried out new ground-based optical and near-IR observations (photometry and spectroscopy) of most of

Sarcocystis heydorni, n. sp. (Apicomplexa: Protozoa) with cattle (Bos taurus) and human (Homo sapiens) cycle

Science.gov (United States)

Cattle (Bos taurus) are intermediate hosts for four species of Sarcocystis, S. cruzi, S. hirsuta, S. hominis, and S. rommeli. Of these four species, mature sarcocysts of S. cruzi are thin-walled (< 1µm) whereas S. hirsuta, S. hominis, and S. rommeli have thick walls (4 µm or more). Here we describe ...

Dietary Administration of Yeast β 1,3 1,6 Glucan on Immunity and Survival Rate of White Indian Shrimp, Fennerpenaeus indicus Challenged with White Spot Syndrome Disease

Directory of Open Access Journals (Sweden)

Babak Ghaednia

2012-01-01

Full Text Available The potency of dietary β 1,3 1,6 glucan (BG, derived from Saccharomyces cerevisiae, in stimulating the non-specific immunity of white Indian shrimp, Fennerpenaeus indicus (Milne-Edwards, 1837 and improving its resistance to white spot syndrome disease were investigated. F. indicus (11.32±1.20 g were fed for 20 days on a series of treatment diets containing graded levels of BG (blank control, 0 as control, 2, 10, 20 g kg-1 feed and were then challenged by injection of WSSV virus. Total haemocyte count (THC, total plasma protein (TPP, phagocytic activity (PA and Bacterial Clearance activity (BC were measured at days 0, 7, 14, 21 after BG feeding, and shrimp survival rate was also recorded daily after challenge. THC, TPP, PA and BC of the 10 and 20 g kg-1 BG treatments were significantly higher (P<0.05 by day 14 than control and 2 g kg-1 treatment shrimp. Survival rate of shrimp fed with the diet containing 10 and 20 g kg-1 BG after 21 days, were 53.32±5.77 and 48.32±5.77%, respectively. Accordingly, oral administration of BG at an optimal level of 10 g kg-1 diet for 20 days efficaciously stimulate the immune defense and improve the survival rate of WSV-infected F. indicus.

Perdas de colônias de Apis mellifera L. no inverno suplementadas com alimentação artificial com pólen e favos de mel

Directory of Open Access Journals (Sweden)

Adhemar Pegoraro

2012-11-01

Full Text Available O objetivo deste trabalho foi avaliar o efeito do tipo de suplementação, nas áreas de cria, alimento e infestação por Varroa destructor nas colônias perdidas. Foram analisadas18 colônias de Apis mellifera L. alojadas em colméias modelo Langstroth e submetidas a dois tipos de suplementação alimentar: 1- cremosa (açúcar cristal moído, mel e pólen; 2- favos de mel. As áreas de ovo-larva e pupa, néctar, mel e pólen das 18 colônias foram fotografadas e analisadas com o auxílio do software AutoCAD. As colônias perdidas suplementadas com alimento artificial e pólen possuíam áreas de: ovo-larva (87,79 ± 70,38cm2, pupa (228,46 ± 192,94cm2, néctar (1.219 ± 149,58cm2, mel (563,47 ± 807,93cm2, pólen (139,09 ± 80,30cm2 e percentagem de infestação por V. destructor (10,50 ± 4,30%. As colônias perdidas suplementadas com favos de mel possuíam áreas de ovo-larva (7,92 ± 9,35cm2, pupas (60,71 ± 63,94 cm2, néctar (658,22 ± 1.040,94cm2, mel (122,62 ± 49,45cm2, pólen (53,58 ± 72,39cm2 e percentagem de infestação por V. destructor (14,40 ± 1,56%. As causas das perdas em parte podem ser atribuídas à infestação por V. destructor.

Gastrointestinal Strongyle Egg Output and its Relationship with Tick Burden in Gambian N'dama and Gobra Zebu Cattle

Directory of Open Access Journals (Sweden)

Mattioli, RC.

1995-01-01

Full Text Available Fortnightly quantitative analysis of rectal faecal samples for the presence of strongyle eggs were carried out from May 1992 to April 1993 on 11 Gambian N'dama Bos taurus and 11 Gobra zebu Bos indicus cattle. Significantly (P <0.001 lower strongyle egg outputs were found in N'dama in comparison with zebu cattle. No correlation was found between individual cumulative tick burden and strongyle egg output in either breed, although individual variations in parasite burdens were lower in N'dama than in zebu cattle. This study strenghtens the evidence for the presence of a natural resistant trait to strongyle infection in N'dama cattle.

Interstellar extinction in the dark Taurus clouds. Pt. 1

International Nuclear Information System (INIS)

Straizys, V.; Meistas, E.

1980-01-01

The results of photoelectric photometry of 74 stars in the Vilnius seven-color system in the area of Taurus dark clouds with coordinates (1950) 4sup(h)20sup(m)-4sup(h)48sup(m)+24 0 .5-+27 0 are presented. Photometric spectral types, absolute magnitudes, color excesses, interstellar extinctions and distances of the stars are determined. The dark cloud Khavtassi 286, 278 and the surrounding absorbing nebulae are found to extend from 140 to 175 pc from the sun. The average interstellar extinction Asub(V) on both sides of the dark cloud is of the order of 1sup(m).5. We find no evidence of the existence of several absorbing clouds situated at various distances. (author)

MAPPING STUDY OF 71 PLANCK COLD CLUMPS IN THE TAURUS, PERSEUS, AND CALIFORNIA COMPLEXES

International Nuclear Information System (INIS)

Meng, Fanyi; Wu, Yuefang; Liu, Tie

2013-01-01

A mapping study of 71 Planck cold clumps was made with 12 CO(1-0), 13 CO(1-0), and C 18 O(1-0) lines at the 13.7 m telescope of Purple Mountain Observatory. For all the clumps, 12 CO(1-0) and 13 CO(1-0) emissions were detected, while for 55 of them, C 18 O(1-0) emissions were detected. Of the 71 Clumps, 34 are in the Taurus Complex, 24 in the California Complex, and 13 are in the Perseus Complex. In the 76 velocity components, 38 cores are found in 27 clumps; 19 of these cores are in the Taurus Complex, 16 in the California Complex, and 3 in the Perseus Complex. We acquired V lsr , T A and FWHM of lines. Physical parameters including T ex , N H 2 , σ Therm , σ NT , and σ 3D were calculated. Generally, the cores are of T ex = 2-16 K, N H 2 =10 21 --10 22 cm –2 , and σ 3D = 0.2-1.0 km s –1 . In the Taurus Complex, the cores are less dense on average and have smaller σ Therm than the cores in the Perseus and California Complexes. Two of the three cores in the Perseus Complex are revealed to have larger T ex , N H 2 , and σ 3D than the mean values in the other two regions. Most of the cores have σ NT larger than σ Therm , suggesting a dominance of turbulence in our cores. The majority of the cores have M vir /M LTE >> 1, which indicates these cores are not bound and will disperse. By comparing our results with the dust properties revealed by the Planck Early Release Cold Cores Catalog, we investigated the coupling of gas and dust components. We found that most of the cores have dust temperatures higher than their gas temperatures. The stellar objects associated with our sources were checked and 90% of the cores were found to be starless

Neospora caninum abortion in a Malayan tapir (Tapirus indicus).

Science.gov (United States)

Peters, M; Osmann, C; Wohlsein, P; Schares, G

2017-05-30

A captive 17-year old female Malayan tapir (Tapirus indicus) aborted a fetus with a crown rump length of 19cm in early pregnancy. The fetus showed an early state of mummification. Histologically, a multifocal mononuclear encephalitis, myocarditis and periportal hepatitis was present indicating a possible protozoal cause of abortion. Although immunohistologically, Neospora (N.) caninum antigen could not be demonstrated, N. caninum DNA was detected by Polymerase Chain Reaction (PCR) in brain, heart, liver and lung of the fetus. N. caninum DNA was extracted from the aborted fetus and the microsatellite marker MS10 was amplified by PCR and sequenced. The obtained MS10 microsatellite pattern has not been described in Germany yet. Nevertheless, the MS10 pattern was very similar to those reported for N. caninum isolated from dogs and cattle in Germany. Because of the histological pattern and extent of the lesions, neosporosis was suspected as the cause of fetal death and abortion. This case report describes for the first time transplacental transmission of N. caninum and abortion due to neosporosis in a tapir. Copyright © 2017 Elsevier B.V. All rights reserved.

PRODUCCIÓN Y CALIDAD FISICOQUÍMICA DE LECHE DE CABRAS SUPLEMENTADAS CON FORRAJE VERDE HIDROPÓNICO DE MAÍZ

Directory of Open Access Journals (Sweden)

Mario Garc\\u00EDa-Carrillo

2013-01-01

Full Text Available El objetivo del presente trabajo fue evaluar la producción y calidad fisicoquímica de leche de cabras al ser suplementadas con dietas que contenían forraje verde hidropónico de maíz. Este estudio se desarrolló en la Comarca Lagunera de Coahuila, México durante los meses de marzo a agosto de 2011. Para la dieta 1 se empleó una relación 85:15 (base seca de alfalfa henificada y forraje verde hidropónico (AH: FVH. La dieta 2 se formuló con una relación 70:30 de AH y FVH, mientras que la dieta testigo tuvo una relación 87.5:12.5 de alfalfa henificada y vaina de mezquite. Se utilizó un diseño en triple cuadro latino. La producción y calidad de leche fueron mayores al suministrar la dieta compuesta con alfalfa henificada y forraje verde hidropónico de maíz al 30%.

SUSCEPTIBILIDADE DE BOVINOS DAS RAÇAS JERSEY E GIR À ACIDOSE LÁCTICA RUMINAL: II - ACIDOSE METABÓLICAE METABOLIZAÇÃO DO LACTATO-L SUSCEPTIBILITY OF JERSEY AND GIR STEERS TO RUMEN LACTIC ACIDOSIS: II - METABOLIC ACIDOSIS AND L-LACTATE METABOLISM

Directory of Open Access Journals (Sweden)

Celso Akio Maruta

2002-02-01

Full Text Available Quatro garrotes Jersey (J (Bos taurus e quatro Gir (G (Bos indicus foram utilizados para comparar a susceptibilidade de zebuínos e taurinos à acidose láctica ruminal (ALR. Neste trabalho, acompanhou-se o grau da acidose metabólica (AM e a metabolização do lactato-L. A ALR foi induzida com a administração de sacarose intraruminal. Amostras de sangue foram colhidas nos seguintes momentos: zero, 14, 16, 18, 20, 22 e 24 horas. Foram determinadas as concentrações de lactato total, de seus isômeros L e D e o perfil hemogasométrico. Nos momentos mais críticos observados (14ªh a 18ªh, a AM foi severa em ambas as raças, porém, ao término do experimento, esta passou a grau moderado nos garrotes G, mantendo-se severa nos J. Os animais J absorveram, do rúmen, maiores quantidades de lactato-D, o qual apresentou correlação negativa com o pH sangüíneo (r = - 0,78. Por outro lado, o lactato-L foi mais absorvido e utilizado nos bovinos G, contribuindo para a restauração parcial do equilíbrio ácido-básico e gerando alterações nas pCO2 e pO2. Os garrotes zebuínos da raça Gir apresentaram menor susceptibilidade à AM que os taurinos da raça Jersey.In order to compare the susceptibility to acute rumen lactic acidosis (RLA, four Jersey (J (Bos taurus and four Gir (G (Bos indicus steers were used to evaluate the degree of metabolic acidosis (MA and the metabolism of L-lactate during the RLA. The RLA was induced by the administration of sucrose into the rumen. Blood samples were collected at following times: zero, 14th,16th, 18th, 20th, 22nd and 24th h. Total lactic acid and its isomers, and blood gas determination were measured. At the most critical moments (14th to 18th h the MA was severe in both breeds, but the MA became moderate in the G steers and remained severe in the J steers at the end of the trial. Higher amounts of D-lactate was absorbed from the rumen to the blood of the J steers; the higher the D-lactate plasma level, the

Transient periodic x-ray source in Taurus, A0535+26

International Nuclear Information System (INIS)

Bradt, H.; Mayer, W.; Buff, J.; Clark, G.W.; Doxsey, R.; Hearn, D.; Jernigan, G.; Joss, P.C.; Laufer, B.; Lewin, W.; Li, F.; Matilsky, T.; McClintock, J.; Primini, F.; Rappaport, S.; Schnopper, H.

1976-01-01

Light curves of the 104 s periodicity in the transient X-ray source in Taurus (A0535+26) are presented for six energy intervals in the range 1-35 keV for the period 1975 May 30-June 2. The pulse structure ranges from an apparently simple modulation at higher energies to a very complex pattern at lower energies. No Doppler shift is observed in the 104 s pulse period during the three days of observations. This places severe constraints upon possible binary orbital motion. Upper limits on the power at other periodicities are approximately-less-than10 percent for 2 ms-2s and approximately-less-than2 percent for 2 s-2000 s

ULTRAVIOLET-SELECTED FIELD AND PRE-MAIN-SEQUENCE STARS TOWARD TAURUS AND UPPER SCORPIUS

International Nuclear Information System (INIS)

Findeisen, K.; Hillenbrand, L.

2010-01-01

We have carried out a Galaxy Evolution Explorer (GALEX) Cycle 1 guest investigator program covering 56 deg 2 near the Taurus T association and 12 deg 2 along the northern edge of the Upper Scorpius OB association. We combined photometry in the GALEX far-ultraviolet and near-ultraviolet bands with data from the Two Micron All Sky Survey to identify candidate young (∼<100 Myr old) stars as those with an ultraviolet excess relative to older main-sequence stars. Follow-up spectroscopy of a partial sample of these candidates suggests five new members of Taurus, with 8-20 expected from additional observations, and five new members of Upper Scorpius, with three to six expected from additional observations. These candidate new members appear to represent a distributed, non-clustered population in either region, although our sample statistics are as of yet too poor to constrain the nature or extent of this population. Rather, our study demonstrates the ability of GALEX observations to identify young stellar populations distributed over a wide area of the sky. We also highlight the necessity of a better understanding of the Galactic ultraviolet source population to support similar investigations. In particular, we report a large population of stars with an ultraviolet excess but no optical indicators of stellar activity or accretion, and briefly argue against several interpretations of these sources.

Origen geno-geográfico de haplotipos STR del cromosoma Y en una muestra caucásico-mestiza y afrodescendiente de Colombia

Directory of Open Access Journals (Sweden)

Juan J. Yunis

2013-09-01

Full Text Available Introducción. Los haplotipos STR de cromosoma Y han sido ampliamente utilizados en estudios de poblaciones para establecer el origen de diversas poblaciones. Objetivo. Se analizaron haplotipos STR del cromosoma Y (8 loci en 134 afrodescendientes y caucásico-mestizos no relacionados de Colombia, para correlacionar el origen geográfico con los datos históricos, así como las relaciones genéticas y posibles patrones de mezcla. Materiales y métodos. Se analizaron los haplotipos STR del cromosoma Y mediante PCR seguidas de electroforesis en acrilamida, de 134 muestras de afrodescendientes y 137 muestras de caucásicos mestizos. Resultados. No se encontró evidencia de subestructuración de la población afrodescendiente. El 2,59 % de los haplotipos eran compartidos en los dos grupos analizados, con la posible existencia deflujo génico de caucásico-mestizos hacia los afrodescendientes. Conclusión. La población caucásico-mestiza colombiana se agrupa con otras poblaciones de la península Ibérica y Europa, mientras que la población afrodescendiente colombiana se agrupa conotras poblaciones africanas reportadas.   doi: http://dx.doi.org/10.7705/biomedica.v33i3.807

Ethanol production by Mucor indicus and Rhizopus oryzae from rice straw by separate hydrolysis and fermentation

Energy Technology Data Exchange (ETDEWEB)

Abedinifar, Sorahi [Department of Chemical Engineering, Isfahan University of Technology, Isfahan 84156-83111 (Iran); Karimi, Keikhosro [Department of Chemical Engineering, Isfahan University of Technology, Isfahan 84156-83111 (Iran); School of Engineering, University of Boraas, SE-501 90 Boraas (Sweden); Khanahmadi, Morteza [Isfahan Agriculture and Natural Resources Research Centre, Isfahan (Iran); Taherzadeh, Mohammad J. [School of Engineering, University of Boraas, SE-501 90 Boraas (Sweden)

2009-05-15

Rice straw was successfully converted to ethanol by separate enzymatic hydrolysis and fermentation by Mucor indicus, Rhizopus oryzae, and Saccharomyces cerevisiae. The hydrolysis temperature and pH of commercial cellulase and {beta}-glucosidase enzymes were first investigated and their best performance obtained at 45 C and pH 5.0. The pretreatment of the straw with dilute-acid hydrolysis resulted in 0.72 g g{sup -1} sugar yield during 48 h enzymatic hydrolysis, which was higher than steam-pretreated (0.60 g g{sup -1}) and untreated straw (0.46 g g{sup -1}). Furthermore, increasing the concentration of the dilute-acid pretreated straw from 20 to 50 and 100 g L{sup -1} resulted in 13% and 16% lower sugar yield, respectively. Anaerobic cultivation of the hydrolyzates with M. indicus resulted in 0.36-0.43 g g{sup -1} ethanol, 0.11-0.17 g g{sup -1} biomass, and 0.04-0.06 g g{sup -1} glycerol, which is comparable with the corresponding yields by S. cerevisiae (0.37-0.45 g g{sup -1} ethanol, 0.04-0.10 g g{sup -1} biomass and 0.05-0.07 glycerol). These two fungi produced no other major metabolite from the straw and completed the cultivation in less than 25 h. However, R. oryzae produced lactic acid as the major by-product with yield of 0.05-0.09 g g{sup -1}. This fungus had ethanol, biomass and glycerol yields of 0.33-0.41, 0.06-0.12, and 0.03-0.04 g g{sup -1}, respectively. (author)

Effect of heat stress on rumen temperature of three breeds of cattle

Science.gov (United States)

Lees, A. M.; Lees, J. C.; Lisle, A. T.; Sullivan, M. L.; Gaughan, J. B.

2018-02-01

Thirty-six steers (12 of each Angus, Charolais, and Brahman) with an initial BW of 318.5 ± 6.7 kg were used in a 130-day study. Two treatments were imposed: un-shaded and shaded (3 m2/animal; 90% solar block shade cloth). On day 1, steers were administered with rumen temperature boluses. Rumen temperatures ( T RUM) were obtained at 10 min intervals over the duration of the study to determine differences in T RUM between Bos indicus and Bos taurus cattle. Six feedlot pens (162 m2) were used with six steers (2/breed) per pen with three pens/treatment. Ambient dry bulb temperature ( T A; °C), relative humidity (RH; %), wind speed (WS; m/s) and direction, and solar radiation (SR; W/m2) were recorded at 10 min intervals. Rainfall (mm) was collected daily at 0900 h. From these data, black globe temperature (BGT; °C), temperature humidity index (THI), heat load index (HLI), and accumulated heat load (AHL) were calculated. Individual T RUM were converted to an hourly average and then mean hourly T RUM were converted to a mean within hour T RUM across the 130 days. Rumen temperatures were analyzed using an autoregressive repeated measures model. The model analyzed the effect of breed ( P < 0.0002), treatment ( P = 0.3543), time of day (hour, h; P < 0.0001), breed × treatment ( P < 0.3683), breed × h ( P < 0.0001), treatment × h ( P < 0.0001), breed × treatment × h ( P = 0.0029), pen within treatment ( P = 0.0195), and animal × breed × treatment within pen ( P = 0.1041). Furthermore, there were breed × treatment × hour differences in T RUM ( P = 0.0036), indicating that Bos indicus and Bos taurus regulate T RUM differently.

Expression of androgen-producing enzyme genes and testosterone concentration in Angus and Nellore heifers with high and low ovarian follicle count.

Science.gov (United States)

Loureiro, Bárbara; Ereno, Ronaldo L; Favoreto, Mauricio G; Barros, Ciro M

2016-07-15

Follicle population is important when animals are used in assisted reproductive programs. Bos indicus animals have more follicles per follicular wave than Bos taurus animals. On the other hand, B taurus animals present better fertility when compared with B indicus animals. Androgens are positively related with the number of antral follicles; moreover, they increase growth factor expression in granulose cells and oocytes. Experimentation was designed to compare testosterone concentration in plasma, and follicular fluid and androgen enzymes mRNA expression (CYP11A1, CYP17A1, 3BHSD, and 17BHSD) in follicles from Angus and Nellore heifers. Heifers were assigned into two groups according to the number of follicles: low and high follicle count groups. Increased testosterone concentration was measured in both plasma and follicular fluid of Angus heifers. However, there was no difference within groups. Expression of CYP11A1 gene was higher in follicles from Angus heifers; however, there was no difference within groups. Expression of CYP17A1, 3BHSD, and 17BHSD genes was higher in follicles from Nellore heifers, and expression of CYP17A1 and 3BHSD genes was also higher in HFC groups from both breeds. It was found that Nellore heifers have more antral follicles than Angus heifers. Testosterone concentration was higher in Angus heifers; this increase could be associated with the increased mRNA expression of CYP11A1. Increased expression of androgen-producing enzyme genes (CYP17A1, 3BHSD, and 17BHSD) was detected in Nellore heifers. It can be suggested that testosterone is acting through different mechanisms to increase follicle development in Nellore and improve fertility in Angus heifers. Copyright © 2016 Elsevier Inc. All rights reserved.

Observations of the polarized emission of Taurus A, Cas A and Cygnus A at 9-mm wavelength

International Nuclear Information System (INIS)

Flett, A.M.; Henderson, C.

1979-01-01

Measurements of the total intensity and degree of linear polarization of the supernova remnants Taurus A and Cas A and of the radiogalaxy Cygnus A have been made at lambda 9 mm using the 25-m radiotelescope at Chilbolton. A new experimental technique involving Faraday rotation of the incoming polarized radiation was employed. Taurus A shows the expected strong and uniform polarization over the central area investigated, and Cas A the ring-like distribution observed at other wavelengths. The beamwidth of 1.5 arcmin resolves the two major components of Cygnus A and it is found that the polarization in the E component has a position angle of 53 +- 3 0 and P = 7.5 +- 1.2 per cent, and the W component a position angle of 133 +- 3 0 and P = 9.6 +-1.1 per cent. When these results are combined with earlier data at longer wavelengths, the large rotation measure of the E component and the fall of the degree of polarization of the W component at short wavelength are further established. (author)

MOLECULAR OUTFLOWS IN THE SUBSTELLAR DOMAIN: MILLIMETER OBSERVATIONS OF YOUNG VERY LOW MASS OBJECTS IN TAURUS AND ρ OPHIUCHI

International Nuclear Information System (INIS)

Ngoc Phan-Bao; Lee, Chin-Fei; Ho, Paul T. P.; Tang, Ya-Wen

2011-01-01

We report here our search for molecular outflows from young very low mass stars and brown dwarfs in Taurus and ρ Ophiuchi. Using the Submillimeter Array and the Combined Array for Research in Millimeter-wave Astronomy, we have observed four targets at 1.3 mm wavelength (230 GHz) to search for CO J = 2 → 1 outflows. A young very low mass star MHO 5 (in Taurus) with an estimated mass of 90 M J , which is just above the hydrogen-burning limit, shows two gas lobes that are likely outflows. While the CO map of MHO 5 does not show a clear structure of outflow, possibly due to environment gas, its position-velocity diagram indicates two distinct blue- and redshifted components. We therefore conclude that they are components of a bipolar molecular outflow from MHO 5. We estimate an outflow mass of 7.0 x 10 -5 M sun and a mass-loss rate of 9.0 x 10 -10 M sun . These values are over two orders of magnitude smaller than the typical ones for T Tauri stars and somewhat weaker than those we have observed in the young brown dwarf ISO-Oph 102 of 60 M J in ρ Ophiuchi. This makes MHO 5 the first young very low mass star showing a bipolar molecular outflow in Taurus. The detection boosts the scenario that very low mass objects form like low-mass stars but in a version scaled down by a factor of over 100.

Overlapping Open Clusters NGC 1750 and NGC 1758 behind the Taurus Dark Clouds. II. CCD Photometry in the Vilnius System

Directory of Open Access Journals (Sweden)

Straižys V.

2003-09-01

Full Text Available Seven-color photometry in the Vilnius system has been obtained for 420 stars down to V = 16 mag in the area containing the overlapping open clusters NGC 1750 and NGC 1758 in Taurus. Spectral and luminosity classes, color excesses, interstellar extinctions and distances are given for 287 stars. The classification of stars is based on their reddening-free Q-parameters. 18 stars observed photoelectrically were used as standards. The extinction vs. distance diagram exhibits the presence of one dust cloud at a distance of 175 pc which almost coincides with a distance of other dust clouds in the Taurus complex. The clusters NGC 1750 and NGC 1758 are found to be at the same distance of ~760 pc and may penetrate each other. Their interstellar extinction AV is 1.06 mag which corresponds to EB-V = 0.34 mag.

Objective Measures for the Assessment of Post-Operative Pain in Bos indicus Bull Calves Following Castration

Science.gov (United States)

Musk, Gabrielle C.; Hyndman, Timothy H.; Lehmann, Heidi S.; Tuke, S. Jonathon; Collins, Teresa; Johnson, Craig B.

2017-01-01

Simple Summary Surgical castration of cattle is a common husbandry procedure, and although this procedure is known to cause pain in cattle and other species, in some countries it is often performed without anaesthesia or analgesia. Society is increasingly aware of this animal welfare issue and it is creating pressure to drive research into animal welfare science with the aim of identifying practical and economical approaches to pain management in livestock. To effectively manage pain, a pain assessment must be performed. Pain assessment methods are often subjective and therefore influenced by the observer. Ideally, objective assessments that generate consistent and repeatable results between observers should be identified. Bos indicus bull calves were divided into four groups: no castration (NC, n = 6); castration with pre-operative local anaesthetic (CL n = 12); castration with pre-operative anti-inflammatory medication (CM, n = 12); and, castration without pain relief (C, n = 12). A range of objective assessments was performed: bodyweight measurements, activity, and rest levels, and four different compounds in the blood. The results of this study suggest that animals rest for longer periods after the pre-operative administration of anti-inflammatory medication. The other objective assessments measured in this study were not able to consistently differentiate between treatment groups. These findings emphasise the need for alternative quantifiable and objective indicators of pain in Bos indicus bull calves. Abstract The aim of the study was to assess pain in Bos indicus bull calves following surgical castration. Forty-two animals were randomised to four groups: no castration (NC, n = 6); castration with pre-operative lidocaine (CL, n = 12); castration with pre-operative meloxicam (CM, n = 12); and, castration alone (C, n = 12). Bodyweight was measured regularly and pedometers provided data on activity and rest from day −7 (7 days prior to surgery) to 13. Blood

Isolation and partial purification of antimicrobial peptides/proteins from dung beetle, Onthophagus taurus immune hemolymph

International Nuclear Information System (INIS)

Vasanth Patil, H.B.; Sathish Kumar, B.Y.

2012-01-01

Antimicrobial peptides are important in the first line of the host defense system of all insect species. In the present study antimicrobial peptide(s) were isolated from the hemolymph of the dung beetle Onthophagus taurus. Both non induced and immune induced hemolymphs were tested for their antimicrobial activity against different bacterial strains and C. albicans. Induction was done by injecting E. coli into the abdominal cavity of the O. taurus. The non induced hemolymph did not show activity against any of the tested fungal and bacterial strains where as induced hemolymph showed activity against all tested bacterial strains but no activity against C. albicans. The induced hemolymph was subjected to non reducing SDS-PAGE and UV wavelength scan was performed to detect the presence of peptides. The immune induced hemolymph was purified by gel filtration chromatography to separate the proteins responsible for the antibacterial activity. The fractions within the peak were tested against those bacteria which previously showed sensitivity to the crude immune induced hemolymph. All fractions were found to be active against all tested bacteria with difference in zone of inhibition. The peptides are active against prokaryotes and not against eukaryotes. These properties reveal its unique characteristics and therapeutic application. (author)

The trans-Himalayan flights of bar-headed geese (Anser indicus)

Science.gov (United States)

Hawkes, L.A.; Balachandran, S.; Batbayar, N.; Butler, P.J.; Frappell, P.B.; Milsom, W.K.; Tseveenmyadag, N.; Newman, S.H.; Scott, G.R.; Sathiyaselvam, P.; Takekawa, John Y.; Wikelski, M.; Bishop, C.M.

2011-01-01

Birds that fly over mountain barriers must be capable of meeting the increased energetic cost of climbing in low-density air, even though less oxygen may be available to support their metabolism. This challenge is magnified by the reduction in maximum sustained climbing rates in large birds. Bar-headed geese (Anser indicus) make one of the highest and most iconic transmountain migrations in the world. We show that those populations of geese that winter at sea level in India are capable of passing over the Himalayas in 1 d, typically climbing between 4,000 and 6,000min 7-8 h. Surprisingly, these birds do not rely on the assistance of upslope tailwinds that usually occur during the day and can support minimum climb rates of 0.8-2.2 km??h-1, even in the relative stillness of the night. They appear to strategically avoid higher speed winds during the afternoon, thus maximizing safety and control during flight. It would seem, therefore, that bar-headed geese are capable of sustained climbing flight over the passes of the Himalaya under their own aerobic power.

Detection of Theileria annulata carriers in Holstein–Friesian (Bos taurus taurus) and Sistani (Bos taurus indicus) cattle breeds by polymerase chain reaction in Sistan region, Iran

OpenAIRE

Majidiani, Hamidreza; Nabavi, Reza; Ganjali, Maryam; Saadati, Dariush

2015-01-01

Theileria annulata is common in tropical and subtropical regions especially in Iran and causes great economic losses in cattle industry. In Iran the epidemiological aspects of bovine theileriosis in different breeds of cattle is poorly understood. The aim of present study is comparison of the number of T. annulata carriers in the two major cattle breeds (Holstein–Friesian and Sistani) in Sistan of Iran by giemsa and polymerase chain reaction (PCR) methods. During winter 2013, 160 native cattl...

Comportamiento productivo de vacas mestizas Siboney, en condiciones de estabulación en el trópico

Directory of Open Access Journals (Sweden)

Julio J. Reyes

2015-01-01

Full Text Available Con el objetivo de conocer el comportamiento productivo de vacas lecheras en condiciones de estabulación con forrajes tropicales, se estudiaron 20 vacas mestizas Siboney durante tres años, utilizando una superficie de cultivo de los forrajes de 4.25 hectáreas. Para el análisis estadístico se empleó un modelo multiplicativo (producción y calidad de leche, el resto de las medidas se analizó por un análisis de varianza, según diseño completamente aleatorizado. Se mostraron interacciones entre los bimestres de parto y producción, por años (P<0.001, mostraron una mayor producción en los animales que parieron en la época lluviosa (8.63 vs. 8.09 kg vaca-1 día-1. Con respecto a la calidad de la leche, solamente los sólidos totales mostraron, en los dos primeros años, un mayor (P<0.05 porcentaje en la época lluviosa. Los animales del grupo seco revelaron una mejor (P<0.05 condición corporal que los de ordeño en ambas épocas (2.96; 3.35 vs. 2.87; 3.30 ordeño y secos en lluvia y poco lluviosa, respectivamente. El análisis del punto de equilibrio, mostró una ganancia neta sobre las ventas del 23.68, 31.44 y 36.46% para los años del primero al tercero, respectivamente. Los resultados del trabajo demuestran la posibilidad de obtener producción láctea bioeconómicamente factible, en el orden de los 9,183.09 a 12,035.40 kg leche ha-1 año-1, sin afectaciones en la calidad de la misma.

Novel polymorphisms in UTR and coding region of inducible heat shock protein 70.1 gene in tropically adapted Indian zebu cattle (Bos indicus) and riverine buffalo (Bubalus bubalis).

Science.gov (United States)

Sodhi, M; Mukesh, M; Kishore, A; Mishra, B P; Kataria, R S; Joshi, B K

2013-09-25

Due to evolutionary divergence, cattle (taurine, and indicine) and buffalo are speculated to have different responses to heat stress condition. Variation in candidate genes associated with a heat-shock response may provide an insight into the dissimilarity and suggest targets for intervention. The present work was undertaken to characterize one of the inducible heat shock protein genes promoter and coding regions in diverse breeds of Indian zebu cattle and buffaloes. The genomic DNA from a panel of 117 unrelated animals representing 14 diversified native cattle breeds and 6 buffalo breeds were utilized to determine the complete sequence and gene diversity of HSP70.1 gene. The coding region of HSP70.1 gene in Indian zebu cattle, Bos taurus and buffalo was similar in length (1,926 bp) encoding a HSP70 protein of 641 amino acids with a calculated molecular weight (Mw) of 70.26 kDa. However buffalo had a longer 5' and 3' untranslated region (UTR) of 204 and 293 nucleotides respectively, in comparison to Indian zebu cattle and Bos taurus wherein length of 5' and 3'-UTR was 172 and 286 nucleotides, respectively. The increased length of buffalo HSP70.1 gene compared to indicine and taurine gene was due to two insertions each in 5' and 3'-UTR. Comparative sequence analysis of cattle (taurine and indicine) and buffalo HSP70.1 gene revealed a total of 54 gene variations (50 SNPs and 4 INDELs) among the three species in the HSP70.1 gene. The minor allele frequencies of these nucleotide variations varied from 0.03 to 0.5 with an average of 0.26. Among the 14 B. indicus cattle breeds studied, a total of 19 polymorphic sites were identified: 4 in the 5'-UTR and 15 in the coding region (of these 2 were non-synonymous). Analysis among buffalo breeds revealed 15 SNPs throughout the gene: 6 at the 5' flanking region and 9 in the coding region. In bubaline 5'-UTR, 2 additional putative transcription factor binding sites (Elk-1 and C-Re1) were identified, other than three common sites

La dinámica placer/afecto en la constitución de feminidades en mujeres negras y mestizas-blancas de diferentes sectores sociales en el suroccidente colombiano

Directory of Open Access Journals (Sweden)

Fernando Urrea Giraldo

Full Text Available Este articulo analiza la producción de determinadas feminidades en el suroeste colombiano actual, a través de las tensiones entre placer y afecto reveladas por las biografías sexuales de 18 mujeres negras y blancas-mestizas, de diferentes clases sociales, color de piel, orientación sexual, generación, edad, estado civil y prole. A través de la construcción de cuatro tipologías, se aborda el papel creciente del placer en la conformación social de las subjetividades contemporáneas. Parte de los resultados son debatidos a partir de la perspectiva foucaultiana, el feminismo radical, la teoría queer, y el psicoanálisis lacaniano, con aportes de la sociología y el feminismo afroamericano. El presente texto se inscribe en la teoría feminista de la interseccionalidad, y plantea especialmente el papel de la racialización en la vivencia de la sexualidad de las mujeres negras entrevistadas, mediante la articulación de las dimensiones sexual y racial.

DESEMPEÑO PRODUCTIVO, COMPOSICIÓN Y BIODISPONIBILIDAD RELATIVA DE SELENIO EN TILAPIA NILÓTICA -Oreochromis niloticus- SUPLEMENTADA CON SELENIO ORGÁNICO E INORGÁNICO

Directory of Open Access Journals (Sweden)

J. E. Vinchira

2014-01-01

Full Text Available Se evaluó el desempeño productivo, la composición corporal y la biodisponibilidad relativa de selenio en tilapia nilótica ( Oreochromis niloticus suplementada con selenio dietario. Una dieta basal fue suplementada con selenio en forma de selenito de sodio o seleno-levadura en niveles crecientes de suplementación (0.00, 0.10, 0.20, 0.40, 0.80 y 1.60 mg/kg de dieta. Un total de 336 individuos de tilapia nilótica, con un peso inicial de 13.41±0.12 g, fueron distribuidos de forma aleatoria en 48 acuarios de vidrio (80 l, 4 réplicas, 7 peces por acuario. No se detectó selenio en el agua de abastecimiento. Los peces fueron alimentados hasta saciedad aparente 3 veces al día por un período de 9 semanas. El desempeño productivo de la tilapia nilótica no se vio afectado ( P >0.05 por la suplementación con selenio dietario. El selenio corporal se incrementó de forma lineal ( P <0.05 con la suplementación de selenio orgánico e inorgánico. La composición corporal de selenio fue menor ( P <0.05 en los peces suplementados con selenito de sodio (1.67±0.14 mg/kg en comparación con la seleno-levadura (1.95±0.21 mg/kg. A partir de la relación entre pendientes se estimó que la biodisponibilidad relativa de la seleno- levadura para la composición de selenio corporal fue de 155.72±0,10%, con relación al selenito de sodio (fijada en 100%. De acuerdo con los resultados, la concentración basal de selenio dietario (0.21 mg/kg no limitó el desempeño productivo de tilapia nilótica. La suplementación con selenio orgánico (seleno-levadura e inorgánico (selenito de sodio entre 0.10 y 1.60 mg/kg no afectó el desempeño productivo de la tilapia nilótica.

k-Casein, b-lactoglobulin and growth hormone allele frequencies and genetic distances in Nelore, Gyr, Guzerá, Caracu, Charolais, Canchim and Santa Gertrudis cattle

Directory of Open Access Journals (Sweden)

Paola Augusta Kemenes

1999-12-01

Full Text Available The genotypes for k-casein (k-CN, b-lactoglobulin (b-LG and growth hormone (GH were determined by polymerase chain reaction (PCR and restriction enzyme digestion in seven breeds of cattle (Nelore, Gyr, Guzerá, Caracu, Charolais, Canchim and Santa Gertrudis. k-Casein had two alleles with the A allele occurring at a higher frequency in Bos indicus breeds (0.93, 0.92 and 0.91% for Gyr, Guzerá and Nelore, respectively. The b-lactoglobulin locus had two alleles in all of the breeds. European breeds had a higher frequency of the b-LG A allele than Zebu breeds. The GH locus had two alleles (L and V in Bos taurus and was monomorphic (L allele only in all of the Bos indicus breeds evaluated. The highest frequency for the V allele was observed in Charolais cattle. The markers used revealed a considerable similarity among breeds, with two main groups being discernible. One group consisted of Zebu and Santa Gertrudis breeds and the other consisted of European and Canchim breeds.Os genótipos de k-caseína (k-CN, b-lactoglobulina (b-LG e hormônio de crescimento foram determinados por reação em cadeia de polimerase (PCR e digestão com enzima de restrição em sete raças de bovinos (Nelore, Gir, Guzerá, Caracu, Charolesa, Canchim and Santa Gertrudis. A k-caseína apresentou dois alelos e as freqüências mais elevadas para o alelo A foram observadas em Bos indicus (0,93, 0,92 e 0,91% para as raças Gir, Guzerá e Nelore, respectivamente. A b-lactoglobulina apresentou dois alelos em todas as raças estudadas, sendo a freqüência do alelo A mais elevada nas raças européias. O loco de hormônio de crescimento apresentou dois alelos em Bos taurus e foi monomórfico (alelo L em todas as raças zebuínas. A maior freqüência para o alelo V foi observado na raça Charolesa. Os marcadores investigados revelaram alta similaridade entre as raças, com a formação de dois grupos principais: um composto de raças zebuínas e a raça Santa Gertrudis e outro

AVALIAÇÕES DA PARASITEMIA, DO HEMATÓCRITO E DOS NÍVEIS BIOQUÍMICOS SÉRICOS, DE BEZERROS NELORE (Bos indicus), INOCULADOS COM ISOLADOS DE Babesia bigemina (Smith & Kilborne, 1893) DAS REGIÕES SUL, SUDESTE, CENTRO-OESTE, NORDESTE E NORTE DO BRASIL

OpenAIRE

Maria Aparecida Schenki; Cláudio Roberto Madruga; Aguemi Kohayagawa; Carla Lopes Mendonça; Dirson Vieira; Raul Kessler

2006-01-01

Avaliaram-se a parasitemia, o hematócrito e os níveis séricos de bilirrubina total, creatinina, uréia e colesterol de bezerros Nelore (Bos indicus) inoculados com isolados de Babesia bigemina das cinco regiões fisiográficas do Brasil. Constatou-se que os diferentes isolados desenvolveram baixa parasitemia, nos animais experimentalmente inoculados, diminuição do colesterol sérico, e que não houve variações nos níveis de bilirrubina, creatinina e uréia sérica. PALAVRAS-CHAVE: Bos indicus, ...

Consumo de forrajes tropicales por vacas lecheras, mestizas Siboney, manejadas en condiciones de estabulación

Directory of Open Access Journals (Sweden)

Julio J. Reyes

2015-01-01

Full Text Available Con el objetivo de estudiar el comportamiento de tres forrajes tropicales y su consumo por animales lecheros, durante tres años, se utilizó un área total de cultivos de 4.25 hectáreas, distribuidas en 1.50 hectáreas para caña de azúcar (Sacharum officinarun, 2 hectáreas del king grass clon CT-169 (Pennisetum purpureum vc Cuba CT-169 y 0.75 hectáreas de leucaena (Leucaena leucocephala; para estimar el consumo, se utilizaron 20 vacas lecheras mestizas de Siboney, mantenidas en régimen de estabulación, con dieta semi-integral. Se realizó un análisis de varianza, según diseño completamente aleatorizado, en arreglo factorial. Los resultados arrojan que las disponibilidades promedio del forraje caña de azúcar fueron mayores (P<0.05 en la época poco lluviosa: 1,916.64 vs. 1,474.73 kg MS ha-1 mes-1; mientras que los forrajes de CT-169 y leucaena fueron superiores sus disponibilidades (P<0.01 en la época lluviosa: 924.76 y 519.01 vs. 649.10 y 314.20 kg MS ha-1 mes-1, respectivamente. La calidad de los forrajes fue menor (P<0.001 en la época poco lluviosa. Los consumos totales de materia seca que realizaron los animales, fue superior (P<0.001 en la época lluviosa (10.56 vs. 9.33 kg MS animal-1 día-1; mientras que los animales de ordeño realizaron un mayor (P<0.001 consumo que los secos (10.82 vs. 9.06 kg MS animal-1 día-1. Los resultados expresan la posibilidad del sistema en estabulación de mantener una carga promedio de 4.70 a 4.9 UGM ha-1, con vacas lecheras de mediano potencial y obtener un consumo adecuado de estos forrajes.

Stability of Stellar Periods in the Hyades and Taurus

Science.gov (United States)

Rebull, Luisa M.; Stauffer, John R.; K2 Clusters Team

2018-06-01

K2 has opened to us the study of high-precision light curves from which we can derive stellar rotation periods. We have presented period distributions for the Pleiades, Praesepe, Upper Sco and Rho Oph. But, how stable are the periods we are deriving from them? Early ground-based work in Orion (Rebull 2001) suggested that, for the youngest stars, about half the stars had sufficiently different spot distributions in two consecutive years such that periods could not be recovered in the second year. However, now that we have K2, precision and diurnal windowing functions are no longer really much of a concern. For a handful of stars in Hyades and Taurus, the K2 spacecraft monitored them for two non-consecutive 70d windows (campaigns 4, 2015 Feb and 13, 2017 Mar). In this poster, we examine whether or not the light curves are similar in the two epochs, and how accurately the same period can be recovered.

Multi-target activity of Hemidesmus indicus decoction against innovative HIV-1 drug targets and characterization of Lupeol mode of action.

Science.gov (United States)

Esposito, Francesca; Mandrone, Manuela; Del Vecchio, Claudia; Carli, Ilaria; Distinto, Simona; Corona, Angela; Lianza, Mariacaterina; Piano, Dario; Tacchini, Massimo; Maccioni, Elias; Cottiglia, Filippo; Saccon, Elisa; Poli, Ferruccio; Parolin, Cristina; Tramontano, Enzo

2017-08-31

Despite the availability of several anti-retrovirals, there is still an urgent need for developing novel therapeutic strategies and finding new drugs against underexplored HIV-1 targets. Among them, there are the HIV-1 reverse transcriptase (RT)-associated ribonuclease H (RNase H) function and the cellular α-glucosidase, involved in the control mechanisms of N-linked glycoproteins formation in the endoplasmic reticulum. It is known that many natural compounds, such as pentacyclic triterpenes, are a promising class of HIV-1 inhibitors. Hence, here we tested the pentacyclic triterpene Lupeol, showing that it inhibits the HIV-1 RT-associated RNase H function. We then performed combination studies of Lupeol and the active site RNase H inhibitor RDS1759, and blind docking calculations, demonstrating that Lupeol binds to an HIV-1 RT allosteric pocket. On the bases of these results and searching for potential multitarget active drug supplement, we also investigated the anti-HIV-1 activity of Hemidesmus indicus, an Ayurveda medicinal plant containing Lupeol. Results supported the potential of this plant as a valuable multitarget active drug source. In fact, by virtue of its numerous active metabolites, H. indicus was able to inhibit not only the RT-associated RNase H function, but also the HIV-1 RT-associated RNA-dependent DNA polymerase activity and the cellular α-glucosidase. © FEMS 2017. All rights reserved. For permissions, please e-mail: journals.permissions@oup.com.

Progesterone production in superovulated holstein heifers and in crossbred recipient of embryo supplemented with betacarotene and tocopherol Produção de progesterona em novilhas Holandesas superovuladas e receptoras de embrião mestiças suplementadas com betacaroteno e tocoferol

Directory of Open Access Journals (Sweden)

José Nélio de Sousa Sales

2011-08-01

Full Text Available Two experiments were conducted to evaluate the effect of the intramuscular injection of betacarotene associated to tocopherol on the plasma concentration progesterone of superovulated Holstein heifers (experiment 1 and in crossbred (Bos taurus x Bos indicus heifers submitted to fixed-time embryo transfer (FTET, experiment 2. In experiment 1, after estrus synchronization and superovulation animals were inseminated 12 and 24 hours after estrus onset and embryos flushed 7 days later. Heifers were allocated randomly to one of three treatments: Control; T800 (800 mg of betacarotene plus 500 mg of tocopherol and T1200 (1,200 mg of betacarotene plus 750 mg of tocopherol. The treatments were given on the day of ear implant placement and repeated on the first day of superovulation. Blood samples were collected on D0, D5, D9, D12 and D16. In experiment 2, treatments were imposed at intravaginal device insertion (D0. The same experimental design, as in experiment 1, was used. Blood samples were collected on D17 (embryos implanted for progesterone determination by radioimmunoassay. In experiment 1, average plasma progesterone concentrations after corpora lutea formation (D12 plus D16 means were 13.7±1.8 ng/ml, 14.5±2.3 ng/ml and 10.8±2.3 ng/ml for control, T800 and T1200, respectively, and did not differ (P=0.44. In experiment 2, progesterone concentrations on D17 in Control (8.88±0.57 ng/ml, T800 (7.48±0.64 ng/ml and T1200 (5.90±1.33 ng/ml groups were similar (P=0.11. Results indicate that the supplemental betacarotene and tocopherol injections did not influence peripheral progesterone concentrations in superovulated Holstein donors and crossbreed recipients heifers.Dois experimentos foram conduzidos para avaliar o efeito da injeção intramuscular de betacaroteno associada ao tocoferol, na concentração plasmática de progesterona de novilhas Holandesas superovuladas (Experimento 1 e em novilhas cruzadas (Bos taurus x Bos indicus submetidas �

Aspectos clínicos da indução experimental de acidose láctica ruminal em zebuínos e taurinos

Directory of Open Access Journals (Sweden)

Enrico Lippi Ortolani

2010-08-01

Full Text Available To compare the clinical signs and the susceptibility to acute rumen lactic acidosis (ARLA, experimentally induced, five Jersey (J (Bos taurus and five Gir (G (Bos indicus steers were used. The ARLA caused in all animals tachycardia, decreased rumen movement, diarrhoea, and dehydration; Although G steers presented higher tachycardia and tendency to a more severe dehydration, the J steers exhibited a pronounced depression in the general state, requiring an intense treatment to recover. J steers needed more time to recover the normal appetite. Thus, regarding clinical picture, was observed that J steers are more susceptible to ARLA than G. Positive correlation was found between plasma volume deficit and tachycardia (r = 0.67; blood pH did not influence heart rate (r= - 0.25.

Phylogenetic relationships of Malayan gaur with other species of the genus Bos based on cytochrome b gene DNA sequences.

Science.gov (United States)

Rosli, M K A; Zakaria, S S; Syed-Shabthar, S M F; Zainal, Z Z; Shukor, M N; Mahani, M C; Abas-Mazni, O; Md-Zain, B M

2011-03-22

The Malayan gaur (Bos gaurus hubbacki) is one of the three subspecies of gaurs that can be found in Malaysia. We examined the phylogenetic relationships of this subspecies with other species of the genus Bos (B. javanicus, B. indicus, B. taurus, and B. grunniens). The sequence of a key gene, cytochrome b, was compared among 20 Bos species and the bongo antelope, used as an outgroup. Phylogenetic reconstruction was employed using neighbor joining and maximum parsimony in PAUP and Bayesian inference in MrBayes 3.1. All tree topologies indicated that the Malayan gaur is in its own monophyletic clade, distinct from other species of the genus Bos. We also found significant branching differences in the tree topologies between wild and domestic cattle.

Sexual behaviour in cattle

International Nuclear Information System (INIS)

King, G.J.

1990-01-01

Short duration or weak expression of oestrus are frequently cited as major reasons for poor results when artificial insemination of Bos indicus breeds is attempted. The existing literature on sexual behaviour certainly indicates that oestrus sometimes lasts for only a few hours in Bos indicus, but similar patterns are also reported in Bos taurus animals. The period of sexual receptivity in suckled Hereford or Hereford-dairy cross-breds maintained in small, totally confined groups ranged from 1 to 18 h, with a mean of 4.4 h and a median of 3.5 h. In totally confined Holstein cows the onset of the LH surge always followed the beginning of homosexual activity by 1 or 2 h even when the period of receptivity was very short. Thus, the beginning rather than the end of oestrus should be used for estimating ovulation time. The expression of sexual behaviour is modified by many factors, including environmental conditions, the number of peri-oestrous females in the group and the presence of observers. In Hereford beef, Holstein dairy and probably all other cattle breeds, the variability in duration and intensity of oestrous activity is very large, so generalizations on a typical individual behavioural pattern are not possible. (author). 39 refs, 1 fig., 2 tabs

Ice in the Taurus molecular cloud: modelling of the 3-μm profile

International Nuclear Information System (INIS)

Bult, C.E.P.M. van de; Greenberg, J.M.; Whittet, D.C.B.

1985-01-01

Detailed calculations of the absorption by interstellar core-mantle particles with mantles of different compositions are compared with observations of the 3μm ice band in the Taurus molecular cloud. The strength and shape of the 3-μm band is shown to be a remarkably good diagnostic of the physical state and evolution of the dust in molecular clouds. The strength of the band is consistent with large fractional H 2 O mantle concentrations, in the range 60-70 per cent, as predicted by theoretical studies of cloud chemistry and as expected from the high oxygen abundance in pre-molecular clouds. (author)

Evaluación de indicadores productivos en conejas mestizas con una dieta basada en forraje y pienso criollo Evaluation of productive indicators in crossbred does with a diet based on forage and homemade concentrate

Directory of Open Access Journals (Sweden)

O López

2011-03-01

Full Text Available Con el objetivo de evaluar el comportamiento productivo de conejas mestizas se utilizaron un total de 24 reproductoras, entre 10 y 18 meses de edad, con un peso promedio superior a los 3,0 kg durante cuatro meses. Las reproductoras consumieron una dieta constituida por: forraje de morera (Morus alba: 0,30 kg; caña (Saccharum officinarum molida: 0,25 kg, glycine (Neonotonia wightii: 0,40 kg y pienso criollo: 0,06 kg. Las crías se pesaron al nacimiento, a los 20 y a los 45 días de edad. En las reproductoras se controló las crías nacidas vivas y destetadas por parto. Se obtuvo como promedio 6,4 gazapos vivos por parto con 0,054 kg de PV al nacimiento y se destetaron 5,4 crías a los 45 días de edad con un peso de 0,694 kg. Además, se encontró un 84,4% de supervivencia durante la etapa de lactación. La ganancia media diaria durante la lactancia fue de 0,014 kg/animal/día. Los resultados evidenciaron que con la dieta propuesta se obtuvieron indicadores productivos alentadores en reproductoras mestizas.With the objective of evaluating the productive performance of crossbred does, a total of 24 animals were used, between 10 and 18 months old, with average weight higher than 3,0 kg, during four months. The does ate a diet constituted by mulberry (Morus alba forage: 0,30 kg; ground sugarcane (Saccharum officinarum: 0,25 kg; glycine (Neonotonia wightii: 0,40 kg and homemade concentrate: 0,06 kg. The young rabbits were weighed at birth, 20 and 45 days after birth. In the does the offspring born alive and weaned per parturition, were controlled. As average, 6,4 live rabbits were obtained per parturition, with 0,054 kg LW at birth and 5,4 rabbits were weaned being 45 days old and weighing 0,694 kg. In addition, 84,4% survival was found during the lactation stage. The mean daily gain during lactation was 0,014 kg/animal/day. The results proved that with the proposed diet encouraging productive indicators were obtained in crossbred does.

Probing Disk Stratification by Combining X-ray and Disk Inclination Data for Taurus-Auriga

Science.gov (United States)

Arraki, Kenza S.; Daly, B.; Harding, M.; McCleary, J.; Cox, A. W.; Grady, C. A.; Woodgate, B. E.; Hamaguchi, K.; Wisniewski, J. P.; Brakken-Thal, S.; Hilton, G.; Bonfield, D.; Williger, G. M.

2010-01-01

Photoelectric neutral Hydrogen absorption, N(H), is a probe of the gas and dust column towards the star. Kastner et al. (2005) found a correlation between N(H) and proplyd aspect ratio in the Orion nebula cluster. We extend this study to Taurus-Auriga by combining publicly available N(H) data from the XMM-Newton Extended Survey of the Taurus molecular cloud (XEST), with published disk inclination data obtained from HST coronagraphic imagery and mm interferometry. Additional inclinations were derived from jet proper motion and radial velocity data obtained from archival HST imagery and the Apache Point Observatory 3.5m telescope's Goddard Fabry-Perot and DIS long-slit spectrograph. Both N(H) and extinction have linear relations with system inclination, where the extinction has a smaller slope than the N(H) trend. Correlations with system inclination demonstrate that the bulk of both N(H) and extinction arise in the disk rather than in remnant envelopes, nearby molecular cloud material, or foreground material. The deficit in extinction compared with predictions for ISM-like gas to dust ratios is consistent with grain growth and settling toward the disk midplane and stratification in disks occurring by 2 Myr. However, the disks remain gas-rich, indicating that giant planet formation is still feasible. We gratefully acknowledge the support of the NASA Motivating Undergraduates in Science and Technology (MUST) Project and of NASA's APRA program under WBS#399131.02.06.02.32. A grant of Director's Discretionary Time funded observing time at the Apache Point Observatory.

Índices produtivos de fêmeas suínas alimentadas com dietas de gestação e lactação suplementadas com óleos essenciais de orégano e alecrim: avaliação de leitegadas

Directory of Open Access Journals (Sweden)

Carlos Augusto Rigon Rossi

2013-11-01

Full Text Available Este estudo avaliou os índices produtivos de matrizes suínas alimentadas com dietas contendo uma mescla líquida de óleos essenciais. Foram utilizadas 250 matrizes de ordens de parto (OP entre um a oito, com duas dietas experimentais na gestação e duas na lactação (dietas controle e com 200ppm de óleos essenciais. O delineamento experimental foi o de blocos ao acaso, em um arranjo fatorial 2x2 (tratamentos na gestação e na lactação com as matrizes e leitegadas como unidade experimental. O peso vivo médio da leitegada ao desmame e o número de desmamados foram 8,0% e 3,8% superiores (P<0,05, respectivamente, para os leitões filhos de matrizes suplementadas com óleos essenciais. A temperatura corporal das fêmeas do controle e OP cinco, avaliadas no período pré-parto e durante o parto, foi 4,4% e 3,5% superiores (P<0,05 aos óleos essenciais, respectivamente. A adição de óleos essenciais na dieta de matrizes no final de gestação e no início da lactação aumentou o número de leitões desmamados e o peso de leitegada. As fêmeas suplementadas com óleos essenciais não apresentaram temperatura e sinais clínicos condizentes com disgalactia.

Conservation of the Critically Endangered Eastern Australian Population of the Grey Nurse Shark ( Carcharias taurus) Through Cross-Jurisdictional Management of a Network of Marine-Protected Areas

Science.gov (United States)

Lynch, Tim P.; Harcourt, Robert; Edgar, Graham; Barrett, Neville

2013-12-01

Between 2001 and 2009, 26 marine-protected areas (MPA) were established on the east Australian seaboard, at least in part, to manage human interactions with a critically endangered population of grey nurse shark, Carcharias taurus. This network is spread across six MPA systems and includes all 19 sites outlined in the National Recovery Plan for C. taurus, though five sites remain open to some forms of fishing. The reserve network has complex cross-jurisdictional management, as the sharks occur in waters controlled by the Australian states of New South Wales (NSW) and Queensland, as well as by the Commonwealth (Federal) government. Jurisdiction is further complicated by fisheries and conservation departments both engaging in management activities within each state. This has resulted in protected area types that include IUCN category II equivalent zones in NSW, Queensland, and Commonwealth marine parks that either overlay or complement another large scaled network of protected sites called critical habitats. Across the network, seven and eight rule permutations for diving and fishing, respectively, are applied to this population of sharks. Besides sites identified by the recovery plan, additional sites have been protected as part of the general development of MPA networks. A case study at one of these sites, which historically was known to be occupied by C. taurus but had been abandoned, appears to shows re-establishment of an aggregation of juvenile and sub-adult sharks. Concurrent with the re-establishment of the aggregation, a local dive operator increased seasonal dive visitation rates at the site fourfold. As a precautionary measure, protection of abandoned sites, which includes nursery and gestating female habitats are options that may assist recovery of the east coast population of C. taurus.

Polyphasic taxonomic analysis establishes Mycobacterium indicus pranii as a distinct species.

Directory of Open Access Journals (Sweden)

Vikram Saini

Full Text Available BACKGROUND: Mycobacterium indicus pranii (MIP, popularly known as Mw, is a cultivable, non-pathogenic organism, which, based on its growth and metabolic properties, is classified in Runyon Group IV along with M. fortuitum, M. smegmatis and M. vaccae. The novelty of this bacterium was accredited to its immunological ability to undergo antigen driven blast transformation of leukocytes and delayed hypersensitivity skin test in leprosy patients, a disease endemic in the Indian sub-continent. Consequently, MIP has been extensively evaluated for its biochemical and immunological properties leading to its usage as an immunomodulator in leprosy and tuberculosis patients. However, owing to advances in sequencing and culture techniques, the citing of new strains with almost 100% similarity in the sequences of marker genes like 16S rRNA, has compromised the identity of MIP as a novel species. Hence, to define its precise taxonomic position, we have carried out polyphasic taxonomic studies on MIP that integrate its phenotypic, chemotaxonomic and molecular phylogenetic attributes. METHODOLOGY/PRINCIPAL FINDINGS: The comparative analysis of 16S rRNA sequence of MIP by using BLAST algorithm at NCBI (nr database revealed a similarity of > or =99% with M. intracellulare, M. arosiense, M. chimaera, M. seoulense, M. avium subsp. hominissuis, M. avium subsp. paratuberculosis and M. bohemicum. Further analysis with other widely used markers like rpoB and hsp65 could resolve the phylogenetic relationship between MIP and other closely related mycobacteria apart from M. intracellulare and M. chimaera, which shares > or =99% similarity with corresponding MIP orthologues. Molecular phylogenetic analysis, based on the concatenation of candidate orthologues of 16S rRNA, hsp65 and rpoB, also substantiated its distinctiveness from all the related organisms used in the analysis excluding M. intracellulare and M. chimaera with which it exhibited a close proximity. This

CLOSE COMPANIONS TO YOUNG STARS. I. A LARGE SPECTROSCOPIC SURVEY IN CHAMAELEON I AND TAURUS-AURIGA

International Nuclear Information System (INIS)

Nguyen, Duy Cuong; Brandeker, Alexis; Van Kerkwijk, Marten H.; Jayawardhana, Ray

2012-01-01

We present the results of a multiplicity survey of 212 T Tauri stars in the Chamaeleon I and Taurus-Auriga star-forming regions, based on high-resolution spectra from the Magellan Clay 6.5 m telescope. From these data, we achieved a typical radial velocity (RV) precision of ∼80 m s –1 with slower rotators yielding better precision, in general. For 174 of these stars, we obtained multi-epoch data with sufficient time baselines to identify binaries based on RV variations. We identified eight close binaries and four close triples, of which three and two, respectively, are new discoveries. The spectroscopic multiplicity fractions we find for Chamaeleon I (7%) and Taurus-Auriga (6%) are similar to each other, and to the results of field star surveys in the same mass and period regime. However, unlike the results from imaging surveys, the frequency of systems with close companions in our sample is not seen to depend on primary mass. Additionally, we do not find a strong correlation between accretion and close multiplicity. This implies that close companions are not likely the main source of the accretion shut down observed in weak-lined T Tauri stars. Our results also suggest that sufficient RV precision can be achieved for at least a subset of slowly rotating young stars to search for hot Jupiter planets.

Classifying the embedded young stellar population in Perseus and Taurus and the LOMASS database

DEFF Research Database (Denmark)

Carney, M. T.; Ylldlz, U. A.; Mottram, J. C.

2016-01-01

. An additional 16% are confused sources with an uncertain evolutionary stage. Outflows are found to make a negligible contribution to the integrated HCO+ intensity for the majority of sources in this study. Conclusions. Separating classifications by cloud reveals that a high percentage of the Class 0+I sources...... in the Perseus star forming region are truly embedded Stage I sources (71%), while the Taurus cloud hosts a majority of evolved PMS stars with disks (68%). The concentration factor method is useful to correct misidentified embedded YSOs, yielding higher accuracy for YSO population statistics and Stage timescales...

On the secular decrease of radio emission flux densities of the supernova remnants of Cassiopeia A and Taurus A at frequency 927 MHz

International Nuclear Information System (INIS)

Vinyajkin, E.N.; Razin, V.A.

1979-01-01

Relative measurements of the radio emission flux densities of the supernova remnants of Cassiopeia A and Taurus A were made at the frequency 927 MHz to investigate the secular decrease of their intensity. Experiments were fulfilled in October-December 1977 at the 10-meter radio telescope of the radioastronomical station Staraya Pustyn' (NIRFI). The radio galaxied of Cygnus A, Virgo A and Orion Nebula were taken as the comparison sources. The comparison of the data obtained with the results of absolute measurements carried out in October 1962 permits to state that during 15 years the radio emission flux density of Cassiopeia A decreased by (14.2+-0.6)% (the average annual decrease amounts to (0.95+-O.04)%) and the radio emission flux density of Taurus A decreased by (2.7+-0.1)% (the annual decrease is (0.18+-0.01)%)

Interstellar C2 molecules in a Taurus dark cloud

International Nuclear Information System (INIS)

Hobbs, L.M.; Black, J.H.; van Dishoeck, E.F.

1983-01-01

Five relatively strong interstellar absorption lines of the 2--0) Phillips band of C 2 near lambda8760 are detected in the spectrum of HD 29647, a late B star which lies behind a substantial part of the Taurus molecular cloud complex about 20triangle-solid from TMC-1. In combination with newly determined oscillator strengths, the observations yield a column density N(C 2 )roughly-equal9 x 10 13 cm -2 , which is comparable to those of widely distributed molecules like CH and H 2 O. Theoreticl models of the observed C 2 rotational level populations indicate a kinetic temperature T = 14 +8 /sub -/ 5 K and a mean density n 3 cm -3 . A narrow, anomalous strong, stellar Mn II line yields for HD 29647 a project rotational velocity v sin i -1 and is explained by previous identifications HD 29647 as a Hg-Mn peculiar star. Similar spectra of ν Cyg and omicron And give an upper limit W/sub lambda/ 2 lines in the 2--0) band, toward both stars

Genome sequencing of the extinct Eurasian wild aurochs, Bos primigenius, illuminates the phylogeography and evolution of cattle.

Science.gov (United States)

Park, Stephen D E; Magee, David A; McGettigan, Paul A; Teasdale, Matthew D; Edwards, Ceiridwen J; Lohan, Amanda J; Murphy, Alison; Braud, Martin; Donoghue, Mark T; Liu, Yuan; Chamberlain, Andrew T; Rue-Albrecht, Kévin; Schroeder, Steven; Spillane, Charles; Tai, Shuaishuai; Bradley, Daniel G; Sonstegard, Tad S; Loftus, Brendan J; MacHugh, David E

2015-10-26

Domestication of the now-extinct wild aurochs, Bos primigenius, gave rise to the two major domestic extant cattle taxa, B. taurus and B. indicus. While previous genetic studies have shed some light on the evolutionary relationships between European aurochs and modern cattle, important questions remain unanswered, including the phylogenetic status of aurochs, whether gene flow from aurochs into early domestic populations occurred, and which genomic regions were subject to selection processes during and after domestication. Here, we address these questions using whole-genome sequencing data generated from an approximately 6,750-year-old British aurochs bone and genome sequence data from 81 additional cattle plus genome-wide single nucleotide polymorphism data from a diverse panel of 1,225 modern animals. Phylogenomic analyses place the aurochs as a distinct outgroup to the domestic B. taurus lineage, supporting the predominant Near Eastern origin of European cattle. Conversely, traditional British and Irish breeds share more genetic variants with this aurochs specimen than other European populations, supporting localized gene flow from aurochs into the ancestors of modern British and Irish cattle, perhaps through purposeful restocking by early herders in Britain. Finally, the functions of genes showing evidence for positive selection in B. taurus are enriched for neurobiology, growth, metabolism and immunobiology, suggesting that these biological processes have been important in the domestication of cattle. This work provides important new information regarding the origins and functional evolution of modern cattle, revealing that the interface between early European domestic populations and wild aurochs was significantly more complex than previously thought.

Esophageal dissection and hematoma associated with obstruction in an Indian elephant (Elephas maximus indicus).

Science.gov (United States)

Phair, Kristen A; Sutherland-Smith, Meg; Pye, Geoffrey W; Pessier, Allan P; Clippinger, Tracy L

2014-06-01

A 42-year-old female Indian elephant (Elephas maximus indicus) developed a sudden onset of excessive salivation and dysphagia. Esophageal obstruction was suspected; possibly related to palm frond ingestion. Esophageal endoscopy revealed a mat of plant material in the distal esophagus. An initial attempt at relieving the obstruction was unsuccessful, but subsequent use of custom-made instruments along with insufflation and hydropulsion enabled partial removal of the material. Postimmobilization care included aggressive intravenous and rectal fluids, anti-inflammatory and antibiotic administration, and fasting. Despite treatment, the dysphagia persisted and the elephant was euthanized due to lack of improvement and grave prognosis. Postmortem examination revealed remaining plant material in the esophagus, complicated by an esophageal dissection, mural hematoma, and secondary bacterial infection. Iatrogenic trauma may have contributed to the extent of esophageal injury. Although treatment was ultimately unsuccessful, the supportive care employed could potentially aid recovery in cases of less severe esophageal trauma.

Observations of HC5N and NH3 in Taurus

International Nuclear Information System (INIS)

Myers, P.C.; Ho, P.T.P.; Benson, P.J.

1979-01-01

Observations of HC 5 N lines toward TMC-2 indicate that it is a small (Lapprox.0.1 pc), dense (napprox.4 x 10 4 cm -3 ), low-mass (Mapprox.1 M/sub sun/) fragment in the Taurus complex, with velocity dispersion at the emission peak only about twice thermal (Δvapprox.0.2 km s -1 ). The HC 5 N emission region in TMC-2 has roughly half the projected area of that in TMC-1, and is more round than filamentary. The HC 5 N and NH 3 emission regions in TMC-2 are coincident, with N (HC 5 N)/N (NH 3 ) approx.0.1. The line width is much smaller than the free-fall width; the deduced values of L, n, and T satisfy the virial-theorem requirement for stable equilibrium. The temporary equilibrium of such fragments may serve to lengthen the time scales for formation of low-mass stars and long-chain molecules

AVALIAÇÕES DA PARASITEMIA, DO HEMATÓCRITO E DOS NÍVEIS BIOQUÍMICOS SÉRICOS, DE BEZERROS NELORE (Bos indicus, INOCULADOS COM ISOLADOS DE Babesia bigemina (Smith & Kilborne, 1893 DAS REGIÕES SUL, SUDESTE, CENTRO-OESTE, NORDESTE E NORTE DO BRASIL

Directory of Open Access Journals (Sweden)

Maria Aparecida Schenki

2006-10-01

Full Text Available Avaliaram-se a parasitemia, o hematócrito e os níveis séricos de bilirrubina total, creatinina, uréia e colesterol de bezerros Nelore (Bos indicus inoculados com isolados de Babesia bigemina das cinco regiões fisiográficas do Brasil. Constatou-se que os diferentes isolados desenvolveram baixa parasitemia, nos animais experimentalmente inoculados, diminuição do colesterol sérico, e que não houve variações nos níveis de bilirrubina, creatinina e uréia sérica. PALAVRAS-CHAVE: Bos indicus, Babesia bigemina, parasitemia, bioquímica sérica.

DISK EVOLUTION IN THE THREE NEARBY STAR-FORMING REGIONS OF TAURUS, CHAMAELEON, AND OPHIUCHUS

International Nuclear Information System (INIS)

Furlan, E.; Watson, Dan M.; McClure, M. K.

2009-01-01

We analyze samples of Spitzer Infrared Spectrograph spectra of T Tauri stars in the Ophiuchus, Taurus, and Chamaeleon I star-forming regions, whose median ages lie in the <1-2 Myr range. The median mid-infrared spectra of objects in these three regions are similar in shape, suggesting, on average, similar disk structures. When normalized to the same stellar luminosity, the medians follow each other closely, implying comparable mid-infrared excess emission from the circumstellar disks. We use the spectral index between 13 and 31 μm and the equivalent width of the 10 μm silicate emission feature to identify objects whose disk configuration departs from that of a continuous, optically thick accretion disk. Transitional disks, whose steep 13-31 μm spectral slope and near-IR flux deficit reveal inner disk clearing, occur with about the same frequency of a few percent in all three regions. Objects with unusually large 10 μm equivalent widths are more common (20%-30%); they could reveal the presence of disk gaps filled with optically thin dust. Based on their medians and fraction of evolved disks, T Tauri stars in Taurus and Chamaeleon I are very alike. Disk evolution sets in early, since already the youngest region, the Ophiuchus core (L1688), has more settled disks with larger grains. Our results indicate that protoplanetary disks show clear signs of dust evolution at an age of a few Myr, even as early as ∼1 Myr, but age is not the only factor determining the degree of evolution during the first few million years of a disk's lifetime.

Effects of Bos taurus autosome 9-located quantitative trait loci haplotypes on the disease phenotypes of dairy cows with experimentally induced Escherichia coli mastitis

DEFF Research Database (Denmark)

Khatun, Momena; Sørensen, Peter; Jørgensen, Hanne Birgitte Hede

2013-01-01

Several quantitative trait loci (QTL) affecting mastitis incidence and mastitis-related traits such as somatic cell score exist in dairy cows. Previously, QTL haplotypes associated with susceptibility to Escherichia coli mastitis in Nordic Holstein-Friesian (HF) cows were identified on Bos taurus...... autosome 9. In the present study, we induced experimental E. coli mastitis in Danish HF cows to investigate the effect of 2 E. coli mastitis-associated QTL haplotypes on the cows' disease phenotypes and recovery in early lactation. Thirty-two cows were divided in 2 groups bearing haplotypes with either low...... the HH group did. However, we also found interactions between the effects of haplotype and biopsy for body temperature, heart rate, and PMNL. In conclusion, when challenged with E. coli mastitis, HF cows with the specific Bos taurus autosome 9-located QTL haplotypes were associated with differences...

The marine leech Stibarobdella loricata (Harding, 1924 (Hirudinea, Piscicolidae, parasitic on the angel shark Squatina spp. and sandtiger shark Carcharias taurus Rafinesque, 1810 (Chondrichthyes: Squatinidae, Carchariidae in Southern Brazilian waters

Directory of Open Access Journals (Sweden)

Soto J. M. R.

2003-01-01

Full Text Available The presence of the marine leech, Stibarobdella loricata (Harding, 1924 (Hirudinea, Piscicolidae, is reported on the southern coast of Brazil, based on seven lots with 47 specimens, between 71 and 182 mm in total length, collected on the dorsal region of angel sharks, Squatina argentina (Marini, 1930; S. guggenheim Marini, 1936; S. punctata Marini, 1936 (Chondrichthyes, Squatinidae; and on the head of a sandtiger shark, Carcharias taurus Rafinesque, 1810 (Chondrichthyes, Carchariidae. This is the first record of S. loricata in the western Atlantic and of its parasitic association with S. argentina, S. guggenheim, S. punctata, and C. taurus.

MAPPING THE SHORES OF THE BROWN DWARF DESERT. II. MULTIPLE STAR FORMATION IN TAURUS-AURIGA

International Nuclear Information System (INIS)

Kraus, Adam L.; Ireland, Michael J.; Martinache, Frantz; Hillenbrand, Lynne A.

2011-01-01

We have conducted a high-resolution imaging study of the Taurus-Auriga star-forming region in order to characterize the primordial outcome of multiple star formation and the extent of the brown dwarf desert. Our survey identified 16 new binary companions to primary stars with masses of 0.25-2.5 M sun , raising the total number of binary pairs (including components of high-order multiples) with separations of 3-5000 AU to 90. We find that ∼2/3-3/4 of all Taurus members are multiple systems of two or more stars, while the other ∼1/4-1/3 appear to have formed as single stars; the distribution of high-order multiplicity suggests that fragmentation into a wide binary has no impact on the subsequent probability that either component will fragment again. The separation distribution for solar-type stars (0.7-2.5 M sun ) is nearly log-flat over separations of 3-5000 AU, but lower-mass stars (0.25-0.7 M sun ) show a paucity of binary companions with separations of ∼>200 AU. Across this full mass range, companion masses are well described with a linear-flat function; all system mass ratios (q = M B /M A ) are equally probable, apparently including substellar companions. Our results are broadly consistent with the two expected modes of binary formation (free-fall fragmentation on large scales and disk fragmentation on small scales), but the distributions provide some clues as to the epochs at which the companions are likely to form.

Genital tract of zebu (Bos indicus cows in Niger

Directory of Open Access Journals (Sweden)

M. Moussa Garba

2014-01-01

Full Text Available The anatomical characteristics, and the ovarian and pathological structures of the genital tract of 500 zebu (Bos indicus females belonging to four breeds (Azawak, Bororo, Djelli, Goudali were studied at Niamey’s slaughterhouse in Niger from August 15 to December 15, 2011. Each animal was examined before slaughter. The cows and heifers were on average 8 ± 2.5 years old. Their mean body condition score was 1.6 ± 0.6 and mean carcass weight 113 ± 21 kg. The anatomical characteristics of the genital tract did not show differences between breeds (p > 0.05. The following characteristics were observed: cervix diameter 3.4 ± 1.1 cm, cervix length 8.1 ± 2.5 cm, horn length 21.6 ± 5.2 cm, horn diameter 1.6 ± 0.5 cm, length and width of the right ovary 19.8 ± 4.4 and 11.2 ± 3.8 mm, of the left ovary 18.8 ± 4.5 and 10.2 ± 3.3 mm, and weight of the right and left ovaries 2.9 ± 1.8 and 2.5 ± 1.6 g, respectively. A corpus luteum was identified in only 14% cases and no visible follicles were found on the surface of the ovaries in 32% cases. These characteristics were significantly (p < 0.05 influenced by the age of the animal. Among the examined females, 7.4% were confirmed pregnant. Various genital tract diseases (cysts, uterine infection, free martinism, pyometra... were observed in 10.4% of the genital tracts.

Evidence for detection of 1--10 MeV emission from the Taurus region in 1971 August

International Nuclear Information System (INIS)

Gruber, D.E.; Ling, J.C.

1977-01-01

The Taurus region was scanned in mid-1971 during three balloon flights with an actively shielded NaI detector sensitive between 0.2 and 10 MeV. Below 1 MeV, these observations yielded measurements and upper limits consistent with extensions of the X-ray power laws of 0.0035 (E/1 MeV) -2 /sup ./ 2 photons (cm 2 s MeV) -1 and 0.0008(E/1 MeV) -2 /sup ./ 1 photons (cm 2 s MeV) -1 for the Crab Nebula and NP 0532, respectively. Above 1 MeV an apparent unpulsed flux, enhanced well above the extrapolated Crab Nebula power law, was observed during the 1971 August 8 flight; it was the most sensitive of the three. For the NP 0532 above 1 MeV on the same date, the measured upper limit of a factor of 8 above the extrapolated power law excludes only the possibility of a large flare-up. The possibility that the observation reported here for 1971 August 8 was a purely instrumental effect, or was produced by environmental radiations, is thoroughly examined, with negative results. If of cosmic origin, the emission must have been short-term (approx.days, months), because other observations in 1973 and 1974 have shown null results. The possibility of variable MeV range emission is discussed in the context of other reported variable emissions in recent years from the Crab and the Taurus region

Observations of the interstellar ice grain feature in the Taurus molecular clouds

International Nuclear Information System (INIS)

Whittet, D.C.B.; Longmore, A.J.; Baines, D.W.T.; Evans, A.

1984-01-01

Although water ice was originally proposed as a major constituent of the interstellar grain population, the advent of infrared astronomy has shown that the expected absorption due to O-H stretching vibrations at 3 μm is illusive. Observations have in fact revealed that the carrier of this feature is apparently restricted to regions deep within dense molecular clouds. However, the exact carrier of this feature is still controversial, and many questions remain as to the conditions required for its appearance. The Taurus molecular clouds were selected for observations, in the form of a preliminary survey in the 2-4 μm window. It is concluded that the carrier of the 3μm absorption feature appears to reside in the general cloud medium and is probably amorphous water ice. (author)

Characterization of a Dairy Gyr herd with respect to its mitochondrial DNA (mt DNA origin

Directory of Open Access Journals (Sweden)

Anibal Eugênio Vercesi Filho

2010-01-01

Full Text Available The Zebu breeds were introduced in Brazil mainly in the last century by imports from the Indian subcontinent. When the Zebu cattle arrived, the national herd suffered a significative change by backcrossing the national cows of taurine origin with Zebu sires. These processes created a polymorphism in the mitochondrial DNA (mtDNA in the Zebu animals with are in a major part derived from backcrossing and sharing mtDNA of taurine origin. To verify the maternal origin of cows belonging to the Dairy Gyr herd of APTA, Mococa 60 females were analyzed and 33 presented mtDNA from Bos taurus origin and 27 presented mtDNA from Bos indicus origin. None of these animals presented patterns of both mtDNA origins, indicating absence of heteroplasmy for these mitochondrial genotypes.

Temperature effect on behaviour, oxygen consumption, ammonia excretion and tolerance limit of the post larvae of shrimp Penaeus indicus.

Science.gov (United States)

Krishnamoorthy, R; Mohamed, E H Syed; Rao, T Subba; Venugopalanj, V P; Hameed, P Shahul

2008-01-01

The present study has been carried out to know the effect of temperature on behaviour, equilibrium loss and tolerance limit of the post larvae of shrimp Penaeus indicus. The experimental temperatures were selected based on the thermal tolerance limit. The experiments were conducted at a specific temperature for duration of 48 hr. The thermal tolerance experiments were conducted in two ways: in direct exposure and in gradually increasing temperature. The upper and lower lethal temperatures for the post larvae of shrimp P. indicus were 43.5 degrees C and 8 degrees C respectively. During tolerance experiment, no mortality was observed at 33 degrees C and 35 degrees C. But at 38 degrees C with gradual increase in temperature, 30% loss of equilibrium and mortality were recorded in 24.31 hrs and 25.07 hrs, and the remaining 70% were alive. On the contrary, when the post larvae of shrimps were directly exposed to 38 degrees C, almost 80% loss of equilibrium and mortality were recorded in 30.22 hrs and 30.40 hrs, remaining 20% were alive. At 40 degrees C with gradual increase in temperature, 100% loss of equilibrium and mortality were recorded in 25.32 hrs and 25.56 hrs. On the other hand, when the post larvae of shrimps were directly exposed to 40 degrees C, 100% loss of equilibrium was observed in 0.37 hrs and mortality in 1.40 hrs. These behavioral responses include an elevated temperature of 12 degrees C, surfacing, dashing against glass wall, jumping out of the water, etc. In general, the rate of oxygen consumption and ammonia excretion was found to enhance with increasing temperature. In the present study, it was found that gradual increase in temperature favours the shellfish population to escape from the thermal exposure as compared to direct exposure.

Identity of Sarcocystis species of the water buffalo (Bubalus bubalis) and cattle (Bos taurus) and the suppression of Sarcocystis sinensis as a nomen nudum

Science.gov (United States)

There are uncertainties concerning the identity and host species specificity of Sarcocystis species of the water buffalo (Bubalus bubalis) and cattle (Bos taurus). Currently, in cattle three species are recognized with known endogenous stages, viz.: S. cruzi (with canine definitive host), S. hirsuta...

Gross anatomy and ultrasonographic images of the reproductive system of the Malayan tapir (Tapirus indicus).

Science.gov (United States)

Lilia, K; Rosnina, Y; Abd Wahid, H; Zahari, Z Z; Abraham, M

2010-12-01

The Malayan tapir (Tapirus indicus) is the largest among the four tapir species and is listed as an endangered species. Ultrasound examination and description of the external anatomy of the female reproductive system of three adult females were performed, whereas the internal anatomy was investigated in necropsied samples of four adult females and one subadult female. Descriptions of the male external genitalia were conducted on one adult male. Gross examination revealed the presence of a bicornuate uterus. The uterine cervix is firm and muscular with projections towards its lumen, which is also evident on ultrasonography. The elongated and relatively small ovaries, which have a smooth surface, could not be imaged on ultrasonography, due to their anatomical position. The testes are located inside a slightly pendulous scrotum that is sparsely covered with soft, short hairs. The penis has one dorsal and two lateral penile projections just proximal to the glans penis. © 2010 Blackwell Verlag GmbH.

DYNA3D, INGRID, and TAURUS: an integrated, interactive software system for crashworthiness engineering

International Nuclear Information System (INIS)

Benson, D.J.; Hallquist, J.O.; Stillman, D.W.

1985-04-01

Crashworthiness engineering has always been a high priority at Lawrence Livermore National Laboratory because of its role in the safe transport of radioactive material for the nuclear power industry and military. As a result, the authors have developed an integrated, interactive set of finite element programs for crashworthiness analysis. The heart of the system is DYNA3D, an explicit, fully vectorized, large deformation structural dynamics code. DYNA3D has the following four capabilities that are critical for the efficient and accurate analysis of crashes: (1) fully nonlinear solid, shell, and beam elements for representing a structure, (2) a broad range of constitutive models for representing the materials, (3) sophisticated contact algorithms for the impact interactions, and (4) a rigid body capability to represent the bodies away from the impact zones at a greatly reduced cost without sacrificing any accuracy in the momentum calculations. To generate the large and complex data files for DYNA3D, INGRID, a general purpose mesh generator, is used. It runs on everything from IBM PCs to CRAYS, and can generate 1000 nodes/minute on a PC. With its efficient hidden line algorithms and many options for specifying geometry, INGRID also doubles as a geometric modeller. TAURUS, an interactive post processor, is used to display DYNA3D output. In addition to the standard monochrome hidden line display, time history plotting, and contouring, TAURUS generates interactive color displays on 8 color video screens by plotting color bands superimposed on the mesh which indicate the value of the state variables. For higher quality color output, graphic output files may be sent to the DICOMED film recorders. We have found that color is every bit as important as hidden line removal in aiding the analyst in understanding his results. In this paper the basic methodologies of the programs are presented along with several crashworthiness calculations

Water vapor weathering of Taurus-Littrow orange soil - A pore-structure analysis

Science.gov (United States)

Cadenhead, D. A.; Mikhail, R. S.

1975-01-01

A pore-volume analysis was performed on water vapor adsorption data previously obtained on a fresh sample of Taurus-Littrow orange soil, and the analysis was repeated on the same sample after its exposure to moist air for a period of approximately six months. The results indicate that exposure of an outgassed sample to high relative pressures of water vapor can result in the formation of substantial micropore structure, the precise amount being dependent on the sample pretreatment, particularly the outgassing temperature. Micropore formation is explained in terms of water penetration into surface defects. In contrast, long-term exposure to moist air at low relative pressures appears to reverse the process with the elimination of micropores and enlargement of mesopores possibly through surface diffusion of metastable adsorbent material. The results are considered with reference to the storage of lunar samples.

FAR-INFRARED OBSERVATIONS OF THE VERY LOW LUMINOSITY EMBEDDED SOURCE L1521F-IRS IN THE TAURUS STAR-FORMING REGION

International Nuclear Information System (INIS)

Terebey, Susan; Fich, Michel; Noriega-Crespo, Alberto; Padgett, Deborah L.; Brooke, Tim; Carey, Sean; McCabe, Caer-Eve; Rebull, Luisa; Fukagawa, Misato; Audard, Marc; Evans, Neal J.; Guedel, Manuel; Hines, Dean; Huard, Tracy; Knapp, Gillian R.; Menard, Francois; Monin, Jean-Louis

2009-01-01

We investigate the environment of the very low luminosity object L1521F-IRS using data from the Taurus Spitzer Legacy Survey. The MIPS 160 μm image shows both extended emission from the Taurus cloud and emission from multiple cold cores over a 1 0 x 2 0 region. Analysis shows that the cloud dust temperature is 14.2 ± 0.4 K and the extinction ratio is A 160 /A K = 0.010 ± 0.001 up to A V ∼ 4 mag. We find κ 160 = 0.23 ± 0.046 cm 2 g -1 for the specific opacity of the gas-dust mixture. Therefore, for dust in the Taurus cloud we find that the 160 μm opacity is significantly higher than that measured for the diffuse interstellar medium, but not too different from dense cores, even at modest extinction values. Furthermore, the 160 μm image shows features that do not appear in the IRAS 100 μm image. We identify six regions as cold cores, i.e., colder than 14.2 K, all of which have counterparts in extinction maps or C 18 O maps. Three of the six cores contain embedded young stellar objects, which demonstrates the cores are sites of current star formation. We compare the effects of L1521F-IRS on its natal core and find there is no evidence for dust heating at 160 or 100 μm by the embedded source. From the infrared luminosity L TIR = 0.024 L sun we find L bol-int =0.034-0.046 L odot , thus confirming the source's low luminosity. Comparison of L1521F-IRS with theoretical simulations for the very early phases of star formation appears to rule out the first core collapse phase. The evolutionary state appears similar to or younger than the class 0 phase, and the estimated mass is likely to be substellar.

NEAR-INFRARED POLARIMETRY OF A NORMAL SPIRAL GALAXY VIEWED THROUGH THE TAURUS MOLECULAR CLOUD COMPLEX

International Nuclear Information System (INIS)

Clemens, Dan P.; Cashman, L. R.; Pavel, M. D.

2013-01-01

Few normal galaxies have been probed using near-infrared polarimetry, even though it reveals magnetic fields in the cool interstellar medium better than either optical or radio polarimetry. Deep H-band (1.6 μm) linear imaging polarimetry toward Taurus serendipitously included the galaxy 2MASX J04412715+2433110 with adequate sensitivity and resolution to map polarization across nearly its full extent. The observations revealed the galaxy to be a steeply inclined (∼75°) disk type with a diameter, encompassing 90% of the Petrosian flux, of 4.2 kpc at a distance of 53 Mpc. Because the sight line passes through the Taurus Molecular Cloud complex, the foreground polarization needed to be measured and removed. The foreground extinction A V of 2.00 ± 0.10 mag and reddening E(H – K) of 0.125 ± 0.009 mag were also assessed and removed, based on analysis of Two Micron All Sky Survey, UKIRT Infrared Deep Sky Survey, Spitzer, and Wide-field Infrared Survey Explorer photometry using the Near-Infrared Color Excess, NICE-Revisited, and Rayleigh-Jeans Color Excess methods. Corrected for the polarized foreground, the galaxy polarization values range from 0% to 3%. The polarizations are dominated by a disk-parallel magnetic field geometry, especially to the northeast, while either a vertical field or single scattering of bulge light produces disk-normal polarizations to the southwest. The multi-kiloparsec coherence of the magnetic field revealed by the infrared polarimetry is in close agreement with short-wavelength radio synchrotron observations of edge-on galaxies, indicating that both cool and warm interstellar media of disk galaxies may be threaded by common magnetic fields.

Pleiotropic Genes Affecting Carcass Traits in Bos indicus (Nellore Cattle Are Modulators of Growth.

Directory of Open Access Journals (Sweden)

Anirene G T Pereira

Full Text Available Two complementary methods, namely Multi-Trait Meta-Analysis and Versatile Gene-Based Test for Genome-wide Association Studies (VEGAS, were used to identify putative pleiotropic genes affecting carcass traits in Bos indicus (Nellore cattle. The genotypic data comprised over 777,000 single-nucleotide polymorphism markers scored in 995 bulls, and the phenotypic data included deregressed breeding values (dEBV for weight measurements at birth, weaning and yearling, as well visual scores taken at weaning and yearling for carcass finishing precocity, conformation and muscling. Both analyses pointed to the pleomorphic adenoma gene 1 (PLAG1 as a major pleiotropic gene. VEGAS analysis revealed 224 additional candidates. From these, 57 participated, together with PLAG1, in a network involved in the modulation of the function and expression of IGF1 (insulin like growth factor 1, IGF2 (insulin like growth factor 2, GH1 (growth hormone 1, IGF1R (insulin like growth factor 1 receptor and GHR (growth hormone receptor, suggesting that those pleiotropic genes operate as satellite regulators of the growth pathway.

Genetic polymorphisms related to meat traits in purebred and crossbred Nelore cattle Polimorfismos genéticos relacionados às características da carne em bovinos Nelore puros e cruzados

Directory of Open Access Journals (Sweden)

Rogério Abdallah Curi

2009-12-01

Full Text Available The objective of this work was to estimate the allelic and genotypic frequencies of CAST/XmnI, a calpastatin gene polymorphism, and CAPN530, a calpain 1 large subunit gene polymorphism, in different beef genetic groups (Nelore and Nelore x Bos taurus, and to investigate associations between these polymorphisms and carcass and meat traits. Three hundred animals - comprising 114 Nelore, 67 Angus x Nelore, 44 Rubia Gallega x Nelore, 41 Canchim, 19 Brangus three-way cross and 15 Braunvieh three-way cross- were genotyped by PCR-RFLP and phenotyped for rib-eye area (REA, back-fat thickness (BT, intramuscular fat (IF, shear force (SF and myofibrillar fragmentation index (MFI. The occurrence of the two alleles of the CAST/XmnI and CAPN530 single nucleotide polymorphisms (SNPs in a B. indicus breed, which permitted association studies in purebred and crossbred Nelore cattle, was first shown in the present work. No relationship was found between the CAST or CAPN1 SNPs and growth-related traits (REA or fat deposition (BT and IF, since calpastatin and µ-calpain are not physiologically involved with these traits. Moreover, the association results between genotypes and aged meat tenderness (assessed by SF and MFI showed that these markers are useless in assisted selection for purebred Nelore and their crosses with B. taurus.O presente trabalho objetivou estimar, em bovinos de corte de diferentes grupos genéticos (Nelore e Nelore x Bos taurus, as frequências alélicas e genotípicas dos polimorfismos CAST/XmnI, do gene da calpastatina, e CAPN530, do gene da calpaína, bem como avaliar a ocorrência de associações entre esses polimorfismos e características da carcaça e da carne produzida. Trezentos animais - 114 Nelore, 67 Angus x Nelore, 44 Rubia Galega x Nelore, 41 Canchim, 19 tricross Brangus e 15 tricross Braunvieh - foram genotipados por PCR-RFLP e fenotipados para área de olho de lombo (AOL, cobertura de gordura subcutânea (CGS, gordura

Controle do carrapato Boophilus microplus (Acari: Ixodidae em sistemas de produção de leite da microrregião fisiográfica fluminense do grande Rio - Rio de Janeiro Control of the cattle tick Boophilus microplus (Acari: Ixodidae in dairy farm systems of the physiographic microrregion of grande Rio, Rio de Janeiro, Brazil

Directory of Open Access Journals (Sweden)

Juracy de Castro Borba Santos Júnior

2000-04-01

Full Text Available O objetivo do trabalho foi analisar os métodos de controle do carrapato Boophilus microplus realizados em três fazendas representativas dos sistemas de produção de leite da Microrregião Fisiográfica Fluminense do Grande Rio, Rio de Janeiro, levando-se em consideração o manejo das fazendas, o grau de sangue Bos taurus e Bos indicus dos rebanhos, os fatores climáticos e a prevalência estacional do carrapato. Para efeito de avaliação, foi utilizada a contagem periódica de fêmeas ingurgitadas medindo entre 4,5 e 8mm, no antímero direito de 20% das vacas em lactação de cada fazenda, durante um ano. A diferença no manejo das pastagens, a composição genética dos rebanhos e as condições climáticas influenciaram a prevalência estacional de B. microplus. A maior lotação animal por hectare, o elevado "stand" vegetativo das pastagens e o maior grau de sangue B. taurus contribuíram para as maiores infestações de carrapatos nas fazendas. O controle de B. microplus realizado pelos proprietários teve importância secundária em relação as outras atitudes de manejo dos rebanhos. Ficou evidenciado o uso excessivo e ineficiente de produtos químicos para o controle de B. microplus nas fazendas. Para implantação de medidas de controle estratégico do B. Microplus, fazem-se necessários esforços para a transferência e adoção dos resultados de pesquisas disponíveis aos produtores rurais.The objective of the study was to analyse the control methods of the cattle tick, Boophilus microplus. The experiment was carried out on three farms of the dairy production systems of the Fluminense Physiographic Microregion of Grande Rio, Rio de Janeiro State, Brazil. Farm management, the Bos indicus and Bos taurus composition of herds, climatic factors and seasonal variation in tick infestation level of cattle was taken into account. Counts of engorged female ticks, measuring between 4.5 and 8.0mm, in 20% of the lactating cows of each farm

Genome-Enabled Prediction of Breeding Values for Feedlot Average Daily Weight Gain in Nelore Cattle

Directory of Open Access Journals (Sweden)

Adriana L. Somavilla

2017-06-01

Full Text Available Nelore is the most economically important cattle breed in Brazil, and the use of genetically improved animals has contributed to increased beef production efficiency. The Brazilian beef feedlot industry has grown considerably in the last decade, so the selection of animals with higher growth rates on feedlot has become quite important. Genomic selection (GS could be used to reduce generation intervals and improve the rate of genetic gains. The aim of this study was to evaluate the prediction of genomic-estimated breeding values (GEBV for average daily weight gain (ADG in 718 feedlot-finished Nelore steers. Analyses of three Bayesian model specifications [Bayesian GBLUP (BGBLUP, BayesA, and BayesCπ] were performed with four genotype panels [Illumina BovineHD BeadChip, TagSNPs, and GeneSeek High- and Low-density indicus (HDi and LDi, respectively]. Estimates of Pearson correlations, regression coefficients, and mean squared errors were used to assess accuracy and bias of predictions. Overall, the BayesCπ model resulted in less biased predictions. Accuracies ranged from 0.18 to 0.27, which are reasonable values given the heritability estimates (from 0.40 to 0.44 and sample size (568 animals in the training population. Furthermore, results from Bos taurus indicus panels were as informative as those from Illumina BovineHD, indicating that they could be used to implement GS at lower costs.

Pro-Amateur Observatories as a Significant Resource for Professional Astronomers - Taurus Hill Observatory

Science.gov (United States)

Haukka, H.; Hentunen, V.-P.; Nissinen, M.; Salmi, T.; Aartolahti, H.; Juutilainen, J.; Vilokki, H.

2013-09-01

Taurus Hill Observatory (THO), observatory code A95, is an amateur observatory located in Varkaus, Finland. The observatory is maintained by the local astronomical association of Warkauden Kassiopeia [8]. THO research team has observed and measured various stellar objects and phenomena. Observatory has mainly focuse d on asteroid [1] and exoplanet light curve measurements, observing the gamma rays burst, supernova discoveries and monitoring [2]. We also do long term monitoring projects [3]. THO research team has presented its research work on previous EPSC meetings ([4], [5],[6], [7]) and got very supportive reactions from the European planetary science community. The results and publications that pro-amateur based observatories, like THO, have contributed, clearly demonstrates that pro-amateurs area significant resource for the professional astronomers now and even more in the future.

Radiation preservation of sea-foods : development of dehydro-irradiation processes for shrimp (Penaeus indicus) and Bombay duck (Harpodon nehereus)

International Nuclear Information System (INIS)

Lewis, N.F.

1978-01-01

Bombay duck which comprises more than 10% of India's annual fish catch is not amenable to freezing and canning mainly due to the high content of free water and extreme lability of its proteins. The commercially available sun-dried product is suspect to rapid spoilage by mould leading to impairment of organoleptic qualities. The dehydro-irradiation process using heat and gamma radiation has been developed to stabilise sea foods and is studied with Bombay duck (Harpodon nehereus) and shrimp (Penaeus indicus). The process has been found to preserve Bombay duck laminates for a period of four months at ambient temperature and the products are more superior in organoleptic qualities to those prepared by the conventional sun-drying method. (M.G.B.)

Association of udder traits with single nucleotide polymorphisms in crossbred Bos indicus-Bos taurus cows.

Science.gov (United States)

Tolleson, M W; Gill, C A; Herring, A D; Riggs, P K; Sawyer, J E; Sanders, J O; Riley, D G

2017-06-01

The size, support, and health of udders limit the productive life of beef cows, especially those with background, because, in general, such cows have a reputation for problems with udders. Genomic association studies of bovine udder traits have been conducted in dairy cattle and recently in Continental European beef breeds but not in cows with background. The objective of this study was to determine associations of SNP and udder support scores, teat length, and teat diameter in half (Nellore), half (Angus) cows. Udders of cows ( = 295) born from 2003 to 2007 were evaluated for udder support and teat length and diameter ( = 1,746 records) from 2005 through 2014. These included a subjective score representing udder support (values of 1 indicated poorly supported, pendulous udders and values of 9 indicated very well-supported udders) and lengths and diameters of individual teats in the 4 udder quarters as well as the average. Cows were in full-sibling or half-sibling families. Residuals for each trait were produced from repeated records models with cow age category nested within birth year of cows. Those residuals were averaged to become the dependent variables for genomewide association analyses. Regression analyses of those dependent variables included genotypic values as explanatory variables for 34,980 SNP from a commercially available array and included the genomic relationship matrix. Fifteen SNP loci on BTA 5 were associated (false discovery rate controlled at 0.05) with udder support score. One of those was also detected as associated with average teat diameter. Three of those 15 SNP were located within genes, including one each in (), (), and (). These are notable for their functional role in some aspect of mammary gland formation or health. Other candidate genes for these traits in the vicinity of the SNP loci include () and (). Because these were detected in Nellore-Angus crossbred cows, which typically have very well-formed udders with excellent support across their productive lives, similar efforts in other breeds should be completed, because that may facilitate further refinement of genomic regions responsible for variation in udder traits important in multiple breeds.

Spectropolarimetry of the 3μm ice band in Elias 16 (Taurus Dark Cloud)

International Nuclear Information System (INIS)

Hough, J.H.; Sato, Shuji; Tamura, Motohide

1988-01-01

Polarization data between 1.2 and 3.8 μm, including spectro-polarimetry in the 3-μm ice feature, are presented for the highly reddened field star Elias 16 in the Taurus Dark Cloud. The polarization is observed to increase with optical depth in the ice feature in a manner similar to that found for the BN object, that is, consistent with dichroic absorption by aligned grains. The polarization feature can be well modelled assuming grains composed of ammonia-water ices, with the ratio of H 2 O:NH 3 greater than 3:1. The continuum polarization can be well fitted over most of the observed wavelength range assuming a mix of silicate and graphite grains with size ∼ 0.13μm. (author)

Influence of the age on hematological parameters of Sindi cattle (Bos indicus in Paraíba backwoods

Directory of Open Access Journals (Sweden)

Luciano José Bezerra Delfino

2014-09-01

Full Text Available ABSTRACT. Delfino L.J.B., de Souza B.B., Silva W.W., Ferreira A.F. & Soares C.E.A. Influence of the age on hematological parameters of Sindi cattle (Bos indicus in Paraíba backwoods. [Influência da idade nos parâmetros hematológicos do gado Sindi (Bos indicus no sertão paraibano.] Revista Brasileira de Medicina Veterinária, 36(3:266-270, 2014. Departamento de Medicina Veterinária, Universidade Federal de Campina Grande, Campus de Patos, Av. Universitária, s/n, Santa Cecília, Patos, PB 58708-110, Brasil. Email: zulu_vet@hotmail.com The aim this work was to establish reference values of the hemogram of Sindi cattle raised in Paraiba backwood and evaluate the influence of same age, on blood samples we collected from 60 clinically healthy animals, being 30 females and 30 males, with the following age groups: Group I: 6 - 24 months, Group II: 24 - 48 months and Group III: up to 48 months. The experiment was conducted at the Center for Research and Development for the Semiarid Tropics (NUPEÁRIDO and the Veterinary Clinical Pathology Laboratory of the Health Center and Rural Technology (CSTR, Universidade Federal de Campina Grande (UFCG, Campus de Patos-PB. Blood samples were placed in tubes containing EDTA (tetracético-ethylenediamine-di-sodium as an anticoagulant were performed the following tests: counting the number of red blood cells, packed cell volume (PCV, Hemoglobin (Hb content, calculations of absolute Erythrocyte count (RBC, Mean corpuscular volume (MCV and Mean corpuscular hemoglobin concentration (CHGH. Held global count and differential leukocyte such as segmented neutrophils, eosinophils, lymphocytes and monocytes. Reference values for erythrocyte count (RBC, hematocrit (PCV, hemoglobin (Hb, MCV and CHGH were, respectively, (6375 to 13,400 X106 / MM3 , (32 – 50 %, (9 - 15 G/DL (37 – 60 µ3, (23 to 33 µµG. And for the WBC were obtained the following results: WBC (5270 to 17,170 UL, segmented neutrophils (from 1360 to 5780

The nature of the high-velocity gas in NGC 1275: first results with TAURUS-2 on the William Herschel telescope

International Nuclear Information System (INIS)

Unger, S.W.; Taylor, K.; Pedlar, A.; Ghataure, H.S.; Penston, M.V.; Robinson, A.

1990-01-01

Observations with a new imaging Fabry-Perot interferometer, TAURUS-2, show that there is a close spatial association between the two systems of emission-line gas in the active galaxy NGC 1275 (Perseus A, 3C84). It therefore seems likely that, as first suggested by previous authors, we are witnessing two galaxies in the process of colliding. We show that this hypothesis is consistent with all available observations of this object. (author)

A GALEX-BASED SEARCH FOR THE SPARSE YOUNG STELLAR POPULATION IN THE TAURUS-AURIGAE STAR FORMING REGION

International Nuclear Information System (INIS)

Gómez de Castro, Ana I.; Lopez-Santiago, Javier; López-Martínez, Fatima; Sánchez, Néstor; Sestito, Paola; Gestoso, Javier Yañez; De Castro, Elisa; Cornide, Manuel

2015-01-01

In this work, we identify 63 bona fide new candidates to T Tauri stars (TTSs) in the Taurus-Auriga region, using its ultraviolet excess as our baseline. The initial data set was defined from the GALEX all sky survey (AIS). The GALEX satellite obtained images in the near-ultraviolet (NUV) and far-ultraviolet (FUV) bands where TTSs show a prominent excess compared with main-sequence or giants stars. GALEX AIS surveyed the Taurus-Auriga molecular complex, as well as a fraction of the California Nebula and the Perseus complex; bright sources and dark clouds were avoided. The properties of TTSs in the ultraviolet (GALEX), optical (UCAC4), and infrared (2MASS) have been defined using the TTSs observed with the International Ultraviolet Explorer reference sample. The candidates were identified by means of a mixed ultraviolet-optical-infrared excess set of colors; we found that the FUV-NUV versus J–K color-color diagram is ideally suited for this purpose. From an initial sample of 163,313 bona fide NUV sources, a final list of 63 new candidates to TTSs in the region was produced. The search procedure has been validated by its ability to detect all known TTSs in the area surveyed: 31 TTSs. Also, we show that the weak-lined TTSs are located in a well-defined stripe in the FUV-NUV versus J–K diagram. Moreover, in this work, we provide a list of TTSs photometric standards for future GALEX-based studies of the young stellar population in star forming regions

A GALEX-BASED SEARCH FOR THE SPARSE YOUNG STELLAR POPULATION IN THE TAURUS-AURIGAE STAR FORMING REGION

Energy Technology Data Exchange (ETDEWEB)

Gómez de Castro, Ana I.; Lopez-Santiago, Javier; López-Martínez, Fatima; Sánchez, Néstor; Sestito, Paola; Gestoso, Javier Yañez [AEGORA Research Group, Universidad Complutense de Madrid, Plaza de Ciencias 3, E-28040 Madrid (Spain); De Castro, Elisa; Cornide, Manuel [Fac. de CC. Físicas, Universidad Complutense de Madrid, Plaza de Ciencias 1, E-28040 Madrid (Spain)

2015-02-01

In this work, we identify 63 bona fide new candidates to T Tauri stars (TTSs) in the Taurus-Auriga region, using its ultraviolet excess as our baseline. The initial data set was defined from the GALEX all sky survey (AIS). The GALEX satellite obtained images in the near-ultraviolet (NUV) and far-ultraviolet (FUV) bands where TTSs show a prominent excess compared with main-sequence or giants stars. GALEX AIS surveyed the Taurus-Auriga molecular complex, as well as a fraction of the California Nebula and the Perseus complex; bright sources and dark clouds were avoided. The properties of TTSs in the ultraviolet (GALEX), optical (UCAC4), and infrared (2MASS) have been defined using the TTSs observed with the International Ultraviolet Explorer reference sample. The candidates were identified by means of a mixed ultraviolet-optical-infrared excess set of colors; we found that the FUV-NUV versus J–K color-color diagram is ideally suited for this purpose. From an initial sample of 163,313 bona fide NUV sources, a final list of 63 new candidates to TTSs in the region was produced. The search procedure has been validated by its ability to detect all known TTSs in the area surveyed: 31 TTSs. Also, we show that the weak-lined TTSs are located in a well-defined stripe in the FUV-NUV versus J–K diagram. Moreover, in this work, we provide a list of TTSs photometric standards for future GALEX-based studies of the young stellar population in star forming regions.

Radial Velocity Survey of T Tauri Stars in Taurus-Auriga

Science.gov (United States)

Crockett, Christopher; Mahmud, N.; Huerta, M.; Prato, L.; Johns-Krull, C.; Hartigan, P.; Jaffe, D.

2009-01-01

Is the frequency of giant planet companions to young stars similar to that seen around old stars? Is the "brown dwarf desert" a product of how low-mass companion objects form, or of how they evolve? Some models indicate that both giant planets and brown dwarfs should be common at young ages within 3 AU of a primary star, but migration induced by massive disks drive brown dwarfs into the parent stars, leaving behind proportionally more giant planets. Our radial velocity survey of young stars will provide a census of the young giant planet and brown dwarf population in Taurus-Auriga. In this poster we present our progress in quantifying how spurious radial velocity signatures are caused by stellar activity and in developing models to help distinguish between companion induced and spot induced radial velocity variations. Early results stress the importance of complementary observations in both visible light and NIR. We present our technique to determine radial velocities by fitting telluric features and model stellar features to our observed spectra. Finally, we discuss ongoing observations at McDonald Observatory, KPNO, and the IRTF, and several new exoplanet host candidates.

Effect of Punica granatum fruit peel on glucose-6-phosphate dehydrogenase and malate dehydrogenase in amphistome Gastrothylax indicus.

Science.gov (United States)

Aggarwal, Rama; Bagai, Upma

2017-03-01

Increasing anthelmintic resistance and the impact of conventional anthelmintics on the environment, it is important to look for alternative strategies against helminth parasite in sheep. Important lipogenic enzymes like glucose-6-phosphate dehydrogenase (G-6-PDH) and malate dehydrogenase (MDH) show subcellular distribution pattern. Activity of G-6-PDH was largely restricted to cytosolic fraction while MDH was found in both cytosolic and mitochondrial fraction in Gastrothylax indicus. Following in vitro treatment with ethanolic and aqueous extracts of Punica granatum fruit peel and commercial anthelmintic, albendazole G-6-PDH activity was decreased by 19-32 %, whereas MDH was suppressed by 24-41 %, compared to the respective control. Albendazole was quite effective when compared with negative control and both the extracts. The results indicate that phytochemicals of plant may act as potential vermifuge or vermicide.

Post-Eocene tectonics of the Central Taurus Mountains

Directory of Open Access Journals (Sweden)

Ergün AKAY

1988-06-01

Full Text Available In post-Eocene time, the Central Taurus mountains have been subjected to four episodes of compression in probably Upper Eocene — Lower Oligocene, Langhian, Upper Tortonian, and Upper Pliocene to recent times. In the Upper Eocene — Lower Oligocene compressional period, Ecemiş, and Beyşehir conjugate faults which have both vertical and lateral components have been formed after an N - S compression. In the Langhian compression period, the Lycian nappes were emplaced from the NW to SE and this tectonic movement has also effected the Antalya and the Adana Miocene basins. In the Upper Tortonian compression period, firstly a WSW-ENE compression has resulted in the formation of Aksu thrust, Kırkkavak oblique reverse fault, Köprüçay syncline, Beşkonak anticline, Radyoring anticline, Taşağıl syncline and Kargı reverse faults. In this period a later phase of N — S compression has formed Çakallar folds, Gökçeler normal fault, the smooth anticline in Mut Karaman and the syncline in Ulukışla. In the latest compressional period from Upper Pliocene to recent, first on E — W compression which can be recognized by some mesoscopic faults has been developed and later a N — S compression resulted in the formation of the active faults on Ecemiş and Gökçeler faults, and the Antalya bay graben.

PEMANFAATAN KULIT KAYU ANGSANA (Pterocarpus indicus SEBAGAI SUMBER ZAT WARNA ALAM PADA PEWARNAAN KAIN BATIK SUTERA

Directory of Open Access Journals (Sweden)

Dwi Wiji Lestari

2017-06-01

Full Text Available Telah dilakukan penelitian pemanfaatan kulit kayu angsana (Pterocarpus indicus sebagai sumber zat warna alam untuk pewarnaan kain batik sutera. Ekstraksi ZWA dilakukan dengan pelarut air dengan variasi suhu ekstraksi 75 °C dan 100 °C. Pewarnaan zat warna alam kemudian diaplikasikan pada kain batik sutera pada kondisi pencelupan asam (pH 4 dan basa (pH 10. Mordan awal yang digunakan adalah tawas dan jirak. Diakhir pewarnaan alam dilakukan fiksasi dengan menggunakan tawas dan tunjung. Berdasar hasil penelitian, kulit kayu angsana terbukti dapat digunakan sebagai sumber zat warna alam untuk batik sutera. Ketuaan warna paling tinggi diperoleh pada pewarnaan batik sutera dengan menggunakan mordan jirek pada suhu ekstraksi 100 °C dalam kondisi pencelupan basa dengan fiksator tunjung. Arah warna yang dihasilkan adalah coklat tua pada suasana pencelupan asam dengan fiksasi tunjung, coklat kemerahan pada suasana  pencelupan asam fiksasi tawas, coklat kemerahan pada suasana  pencelupan basa fiksasi tawas dan coklat tanah pada suasana  pencelupan basa dengan fiksasi tunjung. Hasil uji ketahanan luntur warna terhadap pencucian dari sampel pewarnaan menunjukkan kualitas baik yaitu pada skala 4-5 (Baik. Study on utilizationof angsana (Pterocarpus indicus as natural dye for silk batik has been conducted. The study was aimed to determine the quality of the natural dyeing of the bark of angsana by use jirak (Symplocos fasciculata Zoll. and alum as the natural mordant. Extraction of natural dye was carried out using water by varying the extraction temperature of 75 and 100 °C. The coloration was applied to silk batik at both acid (pH 4 and basic (pH 6 impregnations. The mordant employed  were alum and jirak. The last stage was fixation using alum and ferrosulfate. Based on the results, angsana was proved to be used as a source of natural dyes for silk batik. The highest color intensity was obtained by using angsana bark extract and jirak as mordant at

Adaptive traits of indigenous cattle breeds: The Mediterranean Baladi as a case study.

Science.gov (United States)

Shabtay, Ariel

2015-11-01

Generally taken, breeds of Bos taurus ancestry are considered more productive, in comparison with Bos indicus derived breeds that present enhanced hardiness and disease resistance, low nutritional requirements and higher capability of feed utilization. While breeds of B. taurus have been mostly selected for intensive production systems, indigenous cattle, developed mostly from indicine and African taurines, flourish in extensive habitats. Worldwide demographic and economic processes face animal production with new challenges - the increasing demand for animal food products. Intensification of animal husbandry is thus a desired goal in stricken parts of the world. An introduction of productive traits to indigenous breeds might serve to generate improved biological and economic efficiencies. For this to succeed, the genetic merit of traits like efficiency of feed utilization and product quality should be revealed, encouraging the conservation initiatives of indigenous cattle populations, many of which are already extinct and endangered. Moreover, to overcome potential genetic homogeneity, controlled breeding practices should be undertaken. The Baladi cattle are a native local breed found throughout the Mediterranean basin. Purebred Baladi animals are rapidly vanishing, as more European breeds are being introduced or used for backcrosses leading to improved production. The superiority of Baladi over large-framed cattle, in feedlot and on Mediterranean pasture, with respect to adaptability and efficiency, is highlighted in the current review. Copyright © 2015 Elsevier Ltd. All rights reserved.

Far-infrared to Millimeter Data of Protoplanetary Disks: Dust Growth in the Taurus, Ophiuchus, and Chamaeleon I Star-forming Regions

Energy Technology Data Exchange (ETDEWEB)

Ribas, Álvaro; Espaillat, Catherine C.; Macías, Enrique [Department of Astronomy, Boston University, Boston, MA 02215 (United States); Bouy, Hervé [Laboratoire d’Astrophysique de Bordeaux, Univ. Bordeaux, CNRS, F-33615 Pessac (France); Andrews, Sean; Wilner, David [Harvard-Smithsonian Center for Astrophysics, Cambridge, MA 91023 (United States); Calvet, Nuria [Astronomy Department, University of Michigan, Ann Arbor, MI 48109 (United States); Naylor, David A.; Van der Wiel, Matthijs H. D. [Institute for Space Imaging Science, Department of Physics and Astronomy, University of Lethbridge (Canada); Riviere-Marichalar, Pablo, E-mail: aribas@bu.edu [Instituto de Ciencia de Materiales de Madrid (CSIC). Calle Sor Juana Inés de la Cruz 3, E-28049 Cantoblanco, Madrid (Spain)

2017-11-01

Far-infrared and (sub)millimeter fluxes can be used to study dust in protoplanetary disks, the building blocks of planets. Here, we combine observations from the Herschel Space Observatory with ancillary data of 284 protoplanetary disks in the Taurus, Chamaeleon I, and Ophiuchus star-forming regions, covering from the optical to mm/cm wavelengths. We analyze their spectral indices as a function of wavelength and determine their (sub)millimeter slopes when possible. Most disks display observational evidence of grain growth, in agreement with previous studies. No correlation is found between other tracers of disk evolution and the millimeter spectral indices. A simple disk model is used to fit these sources, and we derive posterior distributions for the optical depth at 1.3 mm and 10 au, the disk temperature at this same radius, and the dust opacity spectral index β . We find the fluxes at 70 μ m to correlate strongly with disk temperatures at 10 au, as derived from these simple models. We find tentative evidence for spectral indices in Chamaeleon I being steeper than those of disks in Taurus/Ophiuchus, although more millimeter observations are needed to confirm this trend and identify its possible origin. Additionally, we determine the median spectral energy distribution of each region and find them to be similar across the entire wavelength range studied, possibly due to the large scatter in disk properties and morphologies.

Systemic and local anti-Mullerian hormone reflects differences in the reproduction potential of Zebu and European type cattle.

Science.gov (United States)

Stojsin-Carter, Anja; Mahboubi, Kiana; Costa, Nathalia N; Gillis, Daniel J; Carter, Timothy F; Neal, Michael S; Miranda, Moyses S; Ohashi, Otavio M; Favetta, Laura A; King, W Allan

2016-04-01

This study was conducted to evaluate plasma anti-Mullerian hormone (Pl AMH), follicular fluid AMH (FF AMH) and granulosa cell AMH transcript (GC AMH) levels and their relationships with reproductive parameters in two cattle subspecies, Bos taurus indicus (Zebu), and Bos taurus taurus (European type cattle). Two-dimensional ultrasound examination and serum collection were performed on Zebu, European type and crossbreed cows to determine antral follicle count (AFC), ovary diameter (OD) and Pl AMH concentration. Slaughterhouse ovaries for Zebu and European type cattle were collected to determine FF AMH concentrations, GC AMH RNA levels, AFC, oocyte number, cleavage and blastocyst rate. Additionally GC AMH receptor 2 (AMHR2) RNA level was measured for European type cattle. Relationship between AMH and reproductive parameters was found to be significantly greater in Zebu compared to European cattle. Average Pl AMH mean ± SE for Zebu and European cattle was 0.77 ± 0.09 and 0.33 ± 0.24 ng/ml respectively (p = 0.01), whereas average antral FF AMH mean ± SE for Zebu and European cattle was 4934.3 ± 568.5 and 2977.9 ± 214.1 ng/ml respectively (p cattle. Levels of GC AMHR2 RNA in European cattle were correlated to oocyte number (p = 0.01). Crossbred animals were found more similar to their maternal Zebu counterparts with respect to their Pl AMH to AFC and OD relationships. These results demonstrate that AMH reflects differences between reproduction potential of the two cattle subspecies therefore can potentially be used as a reproductive marker. Furthermore these results reinforce the importance of separately considering the genetic backgrounds of animals when collecting or interpreting bovine AMH data for reproductive performance. Copyright © 2016 Elsevier B.V. All rights reserved.

Exome-wide DNA capture and next generation sequencing in domestic and wild species

Directory of Open Access Journals (Sweden)

Ng Sarah B

2011-07-01

Full Text Available Abstract Background Gene-targeted and genome-wide markers are crucial to advance evolutionary biology, agriculture, and biodiversity conservation by improving our understanding of genetic processes underlying adaptation and speciation. Unfortunately, for eukaryotic species with large genomes it remains costly to obtain genome sequences and to develop genome resources such as genome-wide SNPs. A method is needed to allow gene-targeted, next-generation sequencing that is flexible enough to include any gene or number of genes, unlike transcriptome sequencing. Such a method would allow sequencing of many individuals, avoiding ascertainment bias in subsequent population genetic analyses. We demonstrate the usefulness of a recent technology, exon capture, for genome-wide, gene-targeted marker discovery in species with no genome resources. We use coding gene sequences from the domestic cow genome sequence (Bos taurus to capture (enrich for, and subsequently sequence, thousands of exons of B. taurus, B. indicus, and Bison bison (wild bison. Our capture array has probes for 16,131 exons in 2,570 genes, including 203 candidate genes with known function and of interest for their association with disease and other fitness traits. Results We successfully sequenced and mapped exon sequences from across the 29 autosomes and X chromosome in the B. taurus genome sequence. Exon capture and high-throughput sequencing identified thousands of putative SNPs spread evenly across all reference chromosomes, in all three individuals, including hundreds of SNPs in our targeted candidate genes. Conclusions This study shows exon capture can be customized for SNP discovery in many individuals and for non-model species without genomic resources. Our captured exome subset was small enough for affordable next-generation sequencing, and successfully captured exons from a divergent wild species using the domestic cow genome as reference.

Exome-wide DNA capture and next generation sequencing in domestic and wild species.

Science.gov (United States)

Cosart, Ted; Beja-Pereira, Albano; Chen, Shanyuan; Ng, Sarah B; Shendure, Jay; Luikart, Gordon

2011-07-05

Gene-targeted and genome-wide markers are crucial to advance evolutionary biology, agriculture, and biodiversity conservation by improving our understanding of genetic processes underlying adaptation and speciation. Unfortunately, for eukaryotic species with large genomes it remains costly to obtain genome sequences and to develop genome resources such as genome-wide SNPs. A method is needed to allow gene-targeted, next-generation sequencing that is flexible enough to include any gene or number of genes, unlike transcriptome sequencing. Such a method would allow sequencing of many individuals, avoiding ascertainment bias in subsequent population genetic analyses.We demonstrate the usefulness of a recent technology, exon capture, for genome-wide, gene-targeted marker discovery in species with no genome resources. We use coding gene sequences from the domestic cow genome sequence (Bos taurus) to capture (enrich for), and subsequently sequence, thousands of exons of B. taurus, B. indicus, and Bison bison (wild bison). Our capture array has probes for 16,131 exons in 2,570 genes, including 203 candidate genes with known function and of interest for their association with disease and other fitness traits. We successfully sequenced and mapped exon sequences from across the 29 autosomes and X chromosome in the B. taurus genome sequence. Exon capture and high-throughput sequencing identified thousands of putative SNPs spread evenly across all reference chromosomes, in all three individuals, including hundreds of SNPs in our targeted candidate genes. This study shows exon capture can be customized for SNP discovery in many individuals and for non-model species without genomic resources. Our captured exome subset was small enough for affordable next-generation sequencing, and successfully captured exons from a divergent wild species using the domestic cow genome as reference.

Valores bioquímicos sanguíneos en hembras brahman bajo condiciones de pastoreo Clinical biochemistry values in serum from grazing brahman cows

Directory of Open Access Journals (Sweden)

Nestor Alonso Villa

1999-12-01

Full Text Available Con el objeto de establecer un rango de referencia para diferentes metabolitos en hembras bovinas B. indicus, se tomaron 5-10 mL de suero sanguíneo a 21 hembras bovinas Brahman registradas en el departamento de Caldas, Colombia. Se determinó la concentración de los diferentes metabolitos que forman parte de un perfil metabólico estándar, como beta-hidroxibutirato, proteína total, albúmina, globulinas, urea, aspartato aminotransferasa (AST, calcio y magnesio. Los resultados fueron analizados mediante la obtención del rango, promedio y desviación estándar (DE. El intervalo de referencia se estableció en el 95% (x±2DE. El promedio y la DE obtenidos para cada metabolito fueron: beta-hidroxibutirato 0,34±0,15 mmol/L; proteína total 81±9 g/L; albúmina 41±3 g/L; globulinas 40±10 g/L; urea 3,31±1,43 mmol/L; AST 158±34 U/L; Ca 2,50±0,21 mmol/L y Mg 1,40±0,44 mmol/L. Se observó que las alteraciones más frecuentes fueron aumento en la concentración de butiratos y globulinas y aumento en la actividad de AST. Según los resultados obtenidos, se puede señalar que los valores encontrados para la concentración de diferentes metabolitos séricos en hembras Brahman mantenidas en pastoreo, son similares a los valores descritos para bovinos B. taurus.This study was designed in order to get the reference values for the concentration of different metabolites included in a standard metabolic profile for grazing Brahman cattle (B. indicus from Caldas, Colombia. Serum samples (5-10 mL were taken from 21 healthy grazing Brahman cows to analyse beta-hydroxybutyrate, total protein, albumin, globulines, urea, aspartate aminotransferase (AST, calcium and magnesium. The results were analyzed by calculating range, mean and standard deviation (SD. The reference interval was set at 95% (x±2SD. The mean and SD obtained for the concentration of the different metabolites were: beta-hydroxybutyrate 0.34±0.15 mmol/L; total protein 81±9 g/L; albumin 41±3

Efecto de la manipulación del semen criopreservado de bovinos Bos Taurus sobre la integridad espermática

OpenAIRE

Norberto Villa-Duque; Claudia Marcela Amaya-Torres; Darwin García-Rojas; Natalia Nieto-Omeara; Natalia Terán-Acuña

2016-01-01

En el estudio se evaluó el efecto de descongelar y aplicar semen de bovinos Bos Taurus en 33 ganaderías del Magdalena Medio colombiano, y se estudió in vitro el efecto de la injuria encontrada sobre la integridad de las membranas espermáticas. La información en fincas se recopiló mediante formulario específico, mientras que el estudio in vitro se ejecutó en el laboratorio de Biotecnología Reproductiva Animal del Instituto Universitario de la Paz (Barrancabermeja, Santander). El estudio consis...

Brood ball-mediated transmission of microbiome members in the dung beetle, Onthophagus taurus (Coleoptera: Scarabaeidae.

Directory of Open Access Journals (Sweden)

Anne M Estes

Full Text Available Insects feeding on plant sap, blood, and other nutritionally incomplete diets are typically associated with mutualistic bacteria that supplement missing nutrients. Herbivorous mammal dung contains more than 86% cellulose and lacks amino acids essential for insect development and reproduction. Yet one of the most ecologically necessary and evolutionarily successful groups of beetles, the dung beetles (Scarabaeinae feeds primarily, or exclusively, on dung. These associations suggest that dung beetles may benefit from mutualistic bacteria that provide nutrients missing from dung. The nesting behaviors of the female parent and the feeding behaviors of the larvae suggest that a microbiome could be vertically transmitted from the parental female to her offspring through the brood ball. Using sterile rearing and a combination of molecular and culture-based techniques, we examine transmission of the microbiome in the bull-headed dung beetle, Onthophagus taurus. Beetles were reared on autoclaved dung and the microbiome was characterized across development. A ~1425 bp region of the 16S rRNA identified Pseudomonadaceae, Enterobacteriaceae, and Comamonadaceae as the most common bacterial families across all life stages and populations, including cultured isolates from the 3(rd instar digestive system. Finer level phylotyping analyses based on lepA and gyrB amplicons of cultured isolates placed the isolates closest to Enterobacter cloacae, Providencia stuartii, Pusillimonas sp., Pedobacter heparinus, and Lysinibacillus sphaericus. Scanning electron micrographs of brood balls constructed from sterile dung reveals secretions and microbes only in the chamber the female prepares for the egg. The use of autoclaved dung for rearing, the presence of microbes in the brood ball and offspring, and identical 16S rRNA sequences in both parent and offspring suggests that the O. taurus female parent transmits specific microbiome members to her offspring through the brood

Effects of temperament and acclimation to handling on reproductive performance of Bos taurus beef females.

Science.gov (United States)

Cooke, R F; Bohnert, D W; Cappellozza, B I; Mueller, C J; Delcurto, T

2012-10-01

Two experiments evaluated the effects of temperament and acclimation to handling on reproductive performance of Bos taurus beef females. In Exp. 1, 433 multiparous, lactating Angus × Hereford cows were sampled for blood and evaluated for temperament before the breeding season. Cow temperament was assessed by chute score and exit velocity. Chute score was assessed on a 5-point scale according to behavioral responses during chute restraining. Exit score was calculated by dividing exit velocity into quintiles and assigning cows with a score from 1 to 5 (1 = slowest, 5 = fastest cows). Temperament score was calculated by averaging chute and exit scores. Cows were classified for temperament type according to temperament score (≤ 3 = adequate, > 3 = aggressive). Plasma cortisol concentrations were greater (P score (d 10). On d 11, heifers were ranked by these variables and assigned to receive or not (control) an acclimation treatment. Acclimated heifers were processed through a handling facility 3 times weekly for 4 wk (d 11 to 39; Mondays, Wednesdays, and Fridays), whereas control heifers remained undisturbed on pasture. Heifer puberty status, evaluated via plasma progesterone concentrations, was assessed on d 0 and 10, d 40 and 50, 70 and 80, 100 and 110, 130 and 140, 160 and 170, and 190 and 200. Blood samples collected on d 10 and 40 were also analyzed for plasma concentrations of cortisol and haptoglobin. Temperament score was assessed again on d 40 and d 200. Acclimated heifers had reduced (P = 0.01) concentrations of cortisol and haptoglobin on d 40 and reduced (P = 0.02) exit velocity on d 200 compared with control heifers. Puberty was hastened in acclimated heifers compared with control (P = 0.01). Results from this study indicate that B. taurus beef cows with aggressive temperament have impaired reproductive performance compared with cohorts with adequate temperament, whereas acclimation to human handling after weaning hastens reproductive development of

Cambios antropométricos en la nariz mestiza después de rinoplastia abierta Anthropometric changes in the mestizo nose after open rhinoplasty

Directory of Open Access Journals (Sweden)

Julio César Gálvez Chávez

2007-12-01

Full Text Available Se describen los cambios antropométricos nasales en una serie de 29 pacientes mestizos, a los cuales se practicó rinoplastia abierta. La nariz mestiza de la muestra estuvo caracterizada por dorso ancho, altura normal, punta nasal ancha e hipoproyectada, ángulo naso-labial agudo, columela retraída, relación dorso-punta desproporcionada y triángulo base-punta no equilátero. Los resultados estéticos fueron evaluados como regulares en todos los pacientes, según patrones estéticos aceptados como ideales. Con el plan quirúrgico empleado todas las regiones anatómicas experimentaron mejorías; siendo dichos cambios más significativos en parámetros como la proyección y ancho de la punta, así como en el ancho y altura del dorso. Las modificaciones fueron menos marcadas en cuanto a la proyección de la columela, el triángulo base-punta y el ángulo nasolabial.The nasal anthropometric changes in a series of 29 mestizo patients that underwent open rhinoplasty are described. The mestizo nose of the sample was characterized by broad dorsum, normal height, wide and hypoprojected nose tip, acute nasolabial angle, retrusive columella, disproportionate dorsum-tip relation and non-equilateral base-tip triangle. The aesthetic results were evaluated as fair in every patient, according to the aesthetic patterns accepted as ideal. With the surgical plan used, all the anatomical regions improved. The most significant changes were observed in parameters such as the projection and tip width, as well as in the width and height of the dorsum. The modifications were less marked as regards the projection of the columella, the base-tip triangle and the nasolabial angle.

SMA and CARMA observations of young brown dwarfs in ρ Ophiuchi and Taurus

Directory of Open Access Journals (Sweden)

Lee C.-F.

2011-07-01

Full Text Available Molecular outflows provide vital information about the earliest stages in the birth of stars, studying the molecular outflow properties is therefore crucial for understanding how stars form. Brown dwarfs with masses between that of stars and planets are not massive enough to maintain stable hydrogen-burning fusion reactions during most of their lifetime. Their origins are subject to much debate in recent literature because their masses are far below the typical mass where core collapse is expected to occur. Based on Submillimeter Array (SMA and Combined Array for Research in Millimeter-wave Astronomy (CARMA observations, we present the first detections of bipolar molecular outflows from young brown dwarfs in ρ Ophiuchi and Taurus. Our results demonstrate that the bipolar molecular outflow operates down to brown dwarf masses, occurring in brown dwarfs as a scaled-down version of the universal process seen in young low-mass stars. This demonstrates that brown dwarfs and low-mass stars likely share the same formation mechanism.

A radio survey of weak T Tauri stars in Taurus-Auriga

International Nuclear Information System (INIS)

O'neal, D.; Feigelson, E.D.; Mathieu, R.D.; Myers, P.C.

1990-01-01

A multi-epoch 5 GHz survey of candidate or confirmed weak T Tauri stars in the Taurus-Auriga molecular cloud complex was conducted with the Very Large Array. The stars were chosen from those having detectable X-ray or chromospheric emission, and weak-emission-line pre-main-sequence stars found by other means. Snapshots of 99 VLA fields containing 119 candidate stars were obtained with a sensitivity of 0.7 mJy; most fields were observed on two or three dates. Nine radio sources coincident with cataloged stars were found. One may be an RS CVn binary system; the other eight are pre-main-sequence stars. Three of the detected stars - HD 283447, V410 Tau, and FK X-ray 1 - were previously known radio sources. Five new detections are Herbig's Anon 1, Hubble 4, HDE 283572, Elias 12, and HK Tau/c. At least five of the sources are variable, and no linear or circular polarization was found. Several lines of evidence suggest that the radio-detected weak T Tauri stars are quite young, perhaps younger on average than nondetected stars. 54 refs

Assessment of antimicrobial activity of c-type lysozyme from Indian shrimp Fenneropenaeus indicus

Directory of Open Access Journals (Sweden)

Viswanathan Karthik

2014-10-01

Full Text Available Objective: To assess the multitudinal antimicrobial effects of recombinant lysozyme from Fenneropenaeus indicus (rFi-Lyz in comparison with commercially available recombinant hen egg white lysozyme (rHEWL. Methods: Antimicrobial activity of the recombinant rFi-Lyz using several Gram positive, Gram negative bacteria and fungi in comparison with rHEWL has been evaluated. rFi-Lyz was expressed and purified using Ni2+ affinity chromatography. The effect of rFi-Lyz in the growth of yeast Candida krusei, plant molds Rhizoctonia solani and Fusarium solani was assessed by well diffusion assay in petri plates with potato dextrose agar. Results: rFi-Lyz exhibited high inhibitory activity on Gram positive bacteria such as Staphylococcus aureus and Bacillus subtilis. Among various Gram negative bacteria tested Klebsiella pneumoniae exhibited the highest inhibition followed by Pseudomonas aeruginosa and Shigella dysenteriae. rFi-Lyz also exhibited significant inhibition on two marine pathogens Aeromonas veronii and Vibrio alginolyticus. Among the various fungal strains tested, rFi-Lyz inhibited the growth of budding yeast Candida krusei significantly. Further the growth of two other plants fungus Rhizoctonia solani and Fusarium oxysporum were retarded by rFi-Lyz in the plate inhibition assay. Conclusions: rFi-Lyz exhibits a broad spectrum of antimicrobial activity like a natural antibiotic on various pathogenic bacteria and fungal strains.

Infrared spectroscopy of dust in the Taurus dark clouds: ice and silicates

International Nuclear Information System (INIS)

Whittet, D.C.B.; Adamson, A.J.; McFadzean, A.D.; Aitken, D.K.

1988-01-01

Low-resolution spectra are presented of the 3 μm water-ice and 10 μm silicate dust features for stars in the direction of the extensive dark cloud complex in Taurus. A total of 22 stars were observed at 3 μm, and 16 at 10 μm. Our sample includes both dust-embedded objects and background field stars seen through the cloud. New and previously published results are combined to investigate the correlation of the strengths of both features with visual extinction A v , and we demonstrate the existence of a very close linear correlation between the peak optical depth in the 3 μm feature and A v for field stars. Ice is detected in all cases where A v exceeds a threshold value of 3.3 ± 0.1 mag, a result which provides a firm observational basis for models of volatile mantle growth on grains in the dark cloud environment. In contrast, the silicate feature is rather poorly correlated with A v . (author)

Optical polarization maps of star-forming regions in Perseus, Taurus, and Ophiuchus

International Nuclear Information System (INIS)

Goodman, A.A.; Bastien, P.; Menard, F.; Myers, P.C.

1990-01-01

New optical linear polarization maps are presented of the star-forming regions near L1506 in Taurus, L1755 in Ophiuchus, and the complex of dark cloud which extends from L1448 in B5 in Perseus. The former two show a well-defined peak magnetic field direction in the plane of the sky with a finite dispersion about that peak which is smaller than would be expected for a random distribution of field distributions. The dispersion in the position angle of filamentary clouds within these complexes implies that clouds which appear elongated on the plane of the sky are not all associated with a pattern of polarization vectors particularly parallel or perpendicular to their geometry. Instead, clouds tend to be oriented at the angle formed by their axis and the mean direction of the local large-scale field. For the dark cloud complex, a bimodal distribution of the polarization vector angle is taken to result from at least two distributions of gas along the line of sight which appear as a complex in projection. 55 refs

VizieR Online Data Catalog: Spitzer observations of Taurus members (Luhman+, 2010)

Science.gov (United States)

Luhman, K. L.; Allen, P. R.; Espaillat, C.; Hartmann, L.; Calvet, N.

2016-03-01

For our census of the disk population in Taurus, we use images at 3.6, 4.5, 5.8, and 8.0um obtained with Spitzer's Infrared Array Camera (IRAC) and images at 24um obtained with the Multiband Imaging Photometer for Spitzer (MIPS). The cameras produced images with FWHM=1.6"-1.9" from 3.6 to 8.0um and FWHM=5.9" at 24um. The available data were obtained through Guaranteed Time Observations for PID = 6, 36, 37 (G. Fazio), 53 (G. Rieke), 94 (C. Lawrence), 30540 (G. Fazio, J. Houck), and 40302 (J. Houck), Director's Discretionary Time for PID = 462 (L. Rebull), Legacy programs for PID = 139, 173 (N. Evans), and 30816 (D. Padgett), and General Observer programs for PID = 3584 (D. Padgett), 20302 (P. Andre), 20386 (P. Myers), 20762 (J. Swift), 30384 (T. Bourke), 40844 (C. McCabe), and 50584 (D. Padgett). The IRAC and MIPS observations were performed through 180 and 137 Astronomical Observation Requests (AORs), respectively. The characteristics of the resulting images are summarized in Tables 1 and 2. (6 data files).

Climacteric symptoms in Quechua and Mestizo women from the Andean region of Cusco, Peru: effects of altitude and ethnicity.

Science.gov (United States)

Ojeda, Eliana; Blümel, Juan E; Vallejo, María Soledad; Lavín, Pablo

2014-04-01

Latin-American women present a greater severity of climacteric symptoms than women from other parts of the world. Previous studies suggest that this could be due to either its Amerindian crossbreeding or the altitude in which a huge proportion of the Latin-American population lives. To answer this question, climacteric symptoms between Peruvian women ("Hispanic-Mestizas" and "Quechuas") living in similar altitude (around 3000 MASL) were compared. This is a cross sectional descriptive study of healthy women of 40-59 years of age living in Departamento de El Cusco, Peru. Using the MRS questionnaire climacteric symptoms were assessed in 395 "Hispanic-Mestizas" (Quechua-Spaniard breeding) and 376 pure "Quechuas". The "Quechuas" compared with "Hispanic-Mestizas" have comparable similar age, but less: obesity, schooling years, cigarette smoking, use of hormonal therapy, diabetes and hypertension; and a greater: proportion of postmenopausal women and number of children. "Quechuas" showed a greater prevalence in ten of the eleven symptoms evaluated by the MRS scale, except for insomnia. The total MRS score was 14.54±7.51 vs. 9.87±6.26 (pQuechuas" had a deteriorated quality of life due to severe climacteric symptomatology, compared to only 14.2% of "Hispanic-Mestizas" women (pQuechua being (OR: 2.38, 95% CI: 1.27-4.45). Peruvian "Quechuas" women have severer climacteric symptoms than the Peruvian "Hispanic-Mestizas" who live in a comparable altitude. This could suggest that the ethnicity could be one of the factors that could explain the augmented symptoms in Latin-American climacteric woman. Copyright © 2014 Elsevier Ireland Ltd. All rights reserved.

Daboia russellii and Naja kaouthia venom neutralization by lupeol acetate isolated from the root extract of Indian sarsaparilla Hemidesmus indicus R.Br.

Science.gov (United States)

Chatterjee, Ipshita; Chakravarty, A K; Gomes, A

2006-06-15

The present study reports the isolation and purification of lupeol acetate from the methanolic root extract of Indian medicinal plant Hemidesmus indicus (L.) R.Br. (family: Asclepiadaceae) which could neutralize venom induced action of Daboia russellii and Naja kaouthia on experimental animals. Lupeol acetate could significantly neutralize lethality, haemorrhage, defibrinogenation, edema, PLA(2) activity induced by Daboia russellii venom. It also neutralized Naja kaouthia venom induced lethality, cardiotoxicity, neurotoxicity and respiratory changes in experimental animals. Lupeol acetate potentiated the protection by snake venom antiserum action against Daboia russellii venom induced lethality in male albino mice. Venom induced changes in lipid peroxidation and super oxide dismutase activity was antagonized by lupeol acetate. Snake venom neutralization by lupeol acetate and its possible mechanism of action has been discussed.

Vaccine-induced rabies case in a cow (Bos taurus): Molecular characterisation of vaccine strain in brain tissue.

Science.gov (United States)

Vuta, Vlad; Picard-Meyer, Evelyne; Robardet, Emmanuelle; Barboi, Gheorghe; Motiu, Razvan; Barbuceanu, Florica; Vlagioiu, Constantin; Cliquet, Florence

2016-09-22

Rabies is a fatal neuropathogenic zoonosis caused by the rabies virus of the Lyssavirus genus, Rhabdoviridae family. The oral vaccination of foxes - the main reservoir of rabies in Europe - using a live attenuated rabies virus vaccine was successfully conducted in many Western European countries. In July 2015, a rabies vaccine strain was isolated from the brain tissues of a clinically suspect cow (Bos taurus) in Romania. The nucleotide analysis of both N and G gene sequences showed 100% identity between the rabid animal, the GenBank reference SAD B19 strain and five rabies vaccine batches used for the national oral vaccination campaign targeting foxes. Copyright © 2016 Elsevier Ltd. All rights reserved.

Desempenho produtivo e respostas fisiopatológicas de tambaquis alimentados com ração suplementada com β-glucano

Directory of Open Access Journals (Sweden)

Edsandra Campos Chagas

2013-08-01

Full Text Available O objetivo deste trabalho foi avaliar o efeito do imunoestimulante β-glucano na dieta do tambaqui (Colossoma macropomum sobre o desempenho produtivo, as respostas fisiológicas e imunológicas, e a resistência ao desafio com Aeromonas hydrophila. O experimento foi conduzido em delineamento inteiramente casualizado, em arranjo fatorial 5x2, com cinco níveis de β-glucano na dieta (0, 0,1, 0,2, 0,4 e 0,8% e dois tempos de amostragem (antes e após o desafio com A. hydrophila, com três repetições. Os peixes (28,65±0,49 g; 12,14±0,07 cm foram alimentados, por 60 dias, com dieta (28% de proteína bruta suplementada com preparação comercial de β-glucano. Após o período de alimentação, avaliou-se o desempenho produtivo, e os peixes foram desafiados com A. hydrophila. Os parâmetros hematológicos e imunológicos (concentração e atividade de lisozima foram avaliados antes e após o desafio bacteriano. Após o desafio bacteriano, observouse a ocorrência de anemia normocítica-normocrômica. A suplementação com β-glucano não alterou a concentração nem a atividade da lisozima; porém, a menor concentração de β-glucano (0,1% favoreceu maior sobrevivência para a espécie quando desafiada com Aeromonas hydrophila. A suplementação de β-glucano não exerce influência sobre o desempenho produtivo e nem sobre os parâmetros hematológicos do tambaqui.

Effect of follicular diameter, time of first cleavage and H3K4 methylation on embryo production rates of Bos indicus cattle

Directory of Open Access Journals (Sweden)

Paula Alvares Lunardelli

2016-10-01

Full Text Available This study aimed investigate the relationship between epigenetics, follicular diameter and cleavage speed, by evaluating the developmental potential and occurence of H3K4 monomethylation of early-, intermediate- and late-cleaving Bos indicus embryos from in vitro fertilized oocytes originating from follicles up to 2 mm in diameter or between 4 and 8 mm in diameter. Oocytes (n = 699 from small follicles (? 2 mm and 639 oocytes from large follicles (4-8 mm were punched from 1,982 Bos indicus’ slaughterhouse ovaries. After maturation and in vitro fertilization (IVF, the cultured embryos were separated into early (? 28 h post-IVF, intermediate (> 28 h and ? 34 h post-IVF and late (> 34 h and ? 54 h post-IVF cleavage groups. Blastocysts were subjected to an immunofluorescence assessment for H3K4me investigation. The blastocyst rate for large follicles (36.3% was higher than that for small follicles (22.9%, P < 0.05. In addition, blastocyst rates for early and intermediate cleavage groups (45.3% and 33.8%, respectively were higher than that for late cleavage group (13.5%, P < 0.05. The blastocysts from all groups displayed H3K4me staining by immunofluorescence, particularly intense in what seemed to be trophectoderm cells and weak or absent in cells seemingly from the inner cell mass. For the first time for indicus embryos, data from this study demonstrate that higher blastocyst embryo rates are obtained from embryos that cleave within 34 h after fertilization and from those produced from follicles of 4-8 mm in diameter, indicating a greater ability of these embryos to develop to the stage of embryonic preimplantation. This is the first article demonstrating the occurrence of H3K4me in cattle embryos; its presence in all the evaluated blastocysts suggests that this histone modification plays a key role in maintaining embryo viability at preimplantation stage.

DGAT1 and ABCG2 polymorphism in Indian cattle (Bos indicus and buffalo (Bubalus bubalis breeds

Directory of Open Access Journals (Sweden)

Mishra Bina

2006-11-01

Full Text Available Abstract Background Indian cattle (Bos indicus and riverine buffalo (Bubalus bubalis give a poor yield of milk but it has a high fat and protein percentage compared to taurine cattle. The identification of QTLs (Quantitative Trait Loci on BTA14 and BTA6 and its subsequent fine mapping has led to identification of two non conservative mutations affecting milk production and composition. Our objective was to estimate the frequency of K232A (DGAT1 – diacylglycerol – acyltransferase 1 and Y581S (ABCG2 – ATP binding cassette sub family G member 2 polymorphisms in diverse cattle and buffalo breeds of India having large variation in terms of milk production. Results We screened the reported missense mutations in six cattle and five buffalo breeds. The DGAT1K and ABCG2Y alleles were found to be fixed in Indian cattle and buffalo breeds studied. Conclusion This study provides an indirect evidence that all the Indian cattle and buffalo breeds have fixed alleles with respect to DGAT1 and ABCG2 genes reported to be responsible for higher milk fat yield, higher fat and protein percent.

In vivo Efficacy of Vernonia amygdalina (Compositae Against Natural Helminth Infection in Bunaji (Bos indicus Calves

Directory of Open Access Journals (Sweden)

C. B. I. Alawa ab*, A. M. Adamu, J. O. Gefub, O. J. Ajanusic, P. A. Abdud and N. P. Chiezeyb

2010-10-01

Full Text Available Fifteen Bunaji calves (Bos indicus averaging 105±12.5 Kg liveweight and approximately nine months of age with natural helminth infection were distributed into three treatment groups of five animals each. Animals were either treated orally with aqueous extract of Vernonia amygdalina at a dose concentration of 1.1g/Kg body weight, a conventional anthelmintic or left untreated. V. amygdalina treatment produced 59.5% reduction in eggs per gram (EPG of faeces which was significantly different (P<0.001 from the untreated control (-17.24%, whereas levamisol hydrochloride treatment produced 100% reduction in EPG. A total of six genera of helminths were recovered from the gastrointestinal tracts and liver of experimental animals. These were Haemonchus contortus, Trichostrongylus spp, Bunostomum spp, Oesophagostomum spp, Fasciola spp and Dicrocoelium spp. There was significant difference (P<0.001 in worm load between the different treatment groups. Except for Haemonchus spp, animals in the untreated group had significantly (P<0.001 higher worm load for all the genera of helminth recovered than those of the V. amygdalina treated group, indicating that V. amygdalina had no effect on Haemonchus contortus.

Taxonomy Icon Data: Asiatic tapir [Taxonomy Icon

Lifescience Database Archive (English)

Full Text Available Asiatic tapir Tapirus indicus Chordata/Vertebrata/Mammalia/Theria/Eutheria/etc. Tapirus_indicus_L.png Tapi...rus_indicus_NL.png Tapirus_indicus_S.png Tapirus_indicus_NS.png http://biosciencedbc....jp/taxonomy_icon/icon.cgi?i=Tapirus+indicus&t=L http://biosciencedbc.jp/taxonomy_icon/icon.cgi?i=Tapirus+ind...icus&t=NL http://biosciencedbc.jp/taxonomy_icon/icon.cgi?i=Tapirus+indicus&t=S http://biosciencedbc.jp/taxonomy_icon/icon.cgi?i=Tapirus+indicus&t=NS ...

Hemidesmus indicus and Hibiscus rosa-sinensis Affect Ischemia Reperfusion Injury in Isolated Rat Hearts

Directory of Open Access Journals (Sweden)

Vinoth Kumar Megraj Khandelwal

2011-01-01

Full Text Available Hemidesmus indicus (L. R. Br. (HI and Hibiscus rosa-sinensis L. (HRS are widely used traditional medicine. We investigated cardioprotective effects of these plants applied for 15 min at concentrations of 90, 180, and 360 μg/mL in Langendorff-perfused rat hearts prior to 25-min global ischemia/120-min reperfusion (I/R. Functional recovery (left ventricular developed pressure—LVDP, and rate of development of pressure, reperfusion arrhythmias, and infarct size (TTC staining served as the endpoints. A transient increase in LVDP (32%–75% occurred at all concentrations of HI, while coronary flow (CF was significantly increased after HI 180 and 360. Only a moderate increase in LVDP (21% and 55% and a tendency to increase CF was observed at HRS 180 and 360. HI and HRS at 180 and 360 significantly improved postischemic recovery of LVDP. Both the drugs dose-dependently reduced the numbers of ectopic beats and duration of ventricular tachycardia. The size of infarction was significantly decreased by HI 360, while HRS significantly reduced the infarct size at all concentrations in a dose-dependent manner. Thus, it can be concluded that HI might cause vasodilation, positive inotropic effect, and cardioprotection, while HRS might cause these effects at higher concentrations. However, further study is needed to elucidate the exact mechanism of their actions.

Larvicultura de Rhamdia quelen (Pisces, Pimelodidae con proteína vegetal y animal, suplementadas con plancton

Directory of Open Access Journals (Sweden)

Germán Castañeda A.

2011-12-01

Full Text Available Objetivo. Determinar el efecto de dietas con diferentes proporciones de fuentes proteicas animales y vegetales suplementadas con plancton sobre el crecimiento y sobrevivencia en larvas de Rhamdia quelen. Materiales y métodos. Fueron formuladas dos dietas experimentales, dieta-1 con 70% de proteína de origen vegetal (torta de soya y dieta-2 con 70% de proteína proveniente de animales (corazón bovino yharina de pescado; se utilizaron cuatro protocolos de alimentación (cinco réplicas por tratamiento: dieta-1 + plancton filtrado en tamiz de 50-200 micras (T1, dieta-2 + plancton filtrado en tamiz de 50-200 micras (T2, dieta-1 (T3, dieta-2 (T4. Las larvas fueron manejadas a una densidad de 20 animales L-1 suministrando alimentohasta aparente saciedad diariamente a las 07:00, 11:00, 16:00 y 21:00 horas; la suplementación con plancton se realizó a las 11:00 y 21:00 horas. Resultados. Entre T1 y T2 no se observaron diferencias estadísticas (p>0.05 en peso final (21.89 ± 15.17mg vs 20.37 ± 10.37mg, longitud total (13.41±2.34mm vs 13.39±1.99 mm, factor de condición (K (0.80±0.13 vs 0.78±0.13 y sobrevivencia (46.6±2.68% vs36.0±7.41%; las diferencias entre T3 y T4 tampoco fueron significativas (3.35±1.40 mg vs 2.98±1.48 mg; 7.54±0.91mm vs 7.33±0.96mm; 0.75±0.13 vs 0.71±0.12; 33.6±9.07% vs 24.8±6.76%, respectivamente; hubo diferencias significativas (p<0.05 entre los grupos suplementados con plancton y los alimentados solo con ración. Conclusiones. La suplementación con plancton fue más efectiva que elofrecimiento solo de ración. La inclusión del 62.9% de torta de soya en la formulación (T1, aparentemente no afectó el crecimiento ni la sobrevivencia.

Iron deficiency anemia in captive āalayan tapir calves (Tapirus indicus).

Science.gov (United States)

Helmick, Kelly E; Milne, Victoria E

2012-12-01

Iron deficiency anemia (IDA) was diagnosed in two captive female neonatal Malayan tapirs (Tapirus indicus) at separate institutions. Both calves had unremarkable exams and normal blood parameters within the first 3 days of life. Microcytic hypochromic anemia (hematocrit, HCT= 20%; mean corpuscular volume, MCV = 32.8 fl; mean corpuscular hemoglobin, MCH = 10.5 pg) was diagnosed at day 66 of age in calf EPZ-1. Iron dextran (10 mg/kg i.m.) was administered at day 71. A normal HCT (33%) with microcytosis and hypochromasia (MCV = 33.0 fl; MCH = 11.7 pg) was identified at day 80. No further concerns were noted through 610 days of age. Microcytic hypochromic anemia (HCT = 16%; MCV = 38.4 fl; MCH = 13.3 pg; mean corpuscular hemoglobin concentration, MCHC= 34.6 g/dl) with thrombocytosis (platelets= 1018 10(3)/UL) and poikilocytosis was diagnosed at day 38 of age in calf WPZ-1 by samples obtained through operant conditioning. Iron dextran (10 mg/kg i.m.) was administered at day 40 and day 68. Improving hematocrit (32%) and low serum iron (45 micorg/dl) was identified at day 88; total iron binding capacity (TIBC; 438 microg/dl) and percentage saturation (10%) were also measured. No further concerns were noted through day 529 of age. Retrospective evaluation identified presumptive IDA in two male siblings of calf WPZ-1. One calf died at day 40 (iron = 40 microg/dl; TIBC = 482 microg/dl; percentage saturation = 4%) and another at day 72 (HCT = 11%; iron = 26 microg/dl; TIBC = 470 microg/dl; percentage saturation = 6%). Death in both calves was attributed to disseminated intravascular coagulation and bacterial septicemia. IDA can develop in Malayan tapirs between day 38 and day 72 of age and may be a significant precursor to bacterial septicemia and death in neonatal Malayan tapirs.

Estimating the population density of the Asian tapir (Tapirus indicus) in a selectively logged forest in Peninsular Malaysia.

Science.gov (United States)

Rayan, D Mark; Mohamad, Shariff Wan; Dorward, Leejiah; Aziz, Sheema Abdul; Clements, Gopalasamy Reuben; Christopher, Wong Chai Thiam; Traeholt, Carl; Magintan, David

2012-12-01

The endangered Asian tapir (Tapirus indicus) is threatened by large-scale habitat loss, forest fragmentation and increased hunting pressure. Conservation planning for this species, however, is hampered by a severe paucity of information on its ecology and population status. We present the first Asian tapir population density estimate from a camera trapping study targeting tigers in a selectively logged forest within Peninsular Malaysia using a spatially explicit capture-recapture maximum likelihood based framework. With a trap effort of 2496 nights, 17 individuals were identified corresponding to a density (standard error) estimate of 9.49 (2.55) adult tapirs/100 km(2) . Although our results include several caveats, we believe that our density estimate still serves as an important baseline to facilitate the monitoring of tapir population trends in Peninsular Malaysia. Our study also highlights the potential of extracting vital ecological and population information for other cryptic individually identifiable animals from tiger-centric studies, especially with the use of a spatially explicit capture-recapture maximum likelihood based framework. © 2012 Wiley Publishing Asia Pty Ltd, ISZS and IOZ/CAS.

A clone-free, single molecule map of the domestic cow (Bos taurus) genome.

Science.gov (United States)

Zhou, Shiguo; Goldstein, Steve; Place, Michael; Bechner, Michael; Patino, Diego; Potamousis, Konstantinos; Ravindran, Prabu; Pape, Louise; Rincon, Gonzalo; Hernandez-Ortiz, Juan; Medrano, Juan F; Schwartz, David C

2015-08-28

The cattle (Bos taurus) genome was originally selected for sequencing due to its economic importance and unique biology as a model organism for understanding other ruminants, or mammals. Currently, there are two cattle genome sequence assemblies (UMD3.1 and Btau4.6) from groups using dissimilar assembly algorithms, which were complemented by genetic and physical map resources. However, past comparisons between these assemblies revealed substantial differences. Consequently, such discordances have engendered ambiguities when using reference sequence data, impacting genomic studies in cattle and motivating construction of a new optical map resource--BtOM1.0--to guide comparisons and improvements to the current sequence builds. Accordingly, our comprehensive comparisons of BtOM1.0 against the UMD3.1 and Btau4.6 sequence builds tabulate large-to-immediate scale discordances requiring mediation. The optical map, BtOM1.0, spanning the B. taurus genome (Hereford breed, L1 Dominette 01449) was assembled from an optical map dataset consisting of 2,973,315 (439 X; raw dataset size before assembly) single molecule optical maps (Rmaps; 1 Rmap = 1 restriction mapped DNA molecule) generated by the Optical Mapping System. The BamHI map spans 2,575.30 Mb and comprises 78 optical contigs assembled by a combination of iterative (using the reference sequence: UMD3.1) and de novo assembly techniques. BtOM1.0 is a high-resolution physical map featuring an average restriction fragment size of 8.91 Kb. Comparisons of BtOM1.0 vs. UMD3.1, or Btau4.6, revealed that Btau4.6 presented far more discordances (7,463) vs. UMD3.1 (4,754). Overall, we found that Btau4.6 presented almost double the number of discordances than UMD3.1 across most of the 6 categories of sequence vs. map discrepancies, which are: COMPLEX (misassembly), DELs (extraneous sequences), INSs (missing sequences), ITs (Inverted/Translocated sequences), ECs (extra restriction cuts) and MCs (missing restriction cuts

Desempenho e retenção de nitrogênio de frangos de corte dos 22 aos 42 dias alimentados com rações com diferentes níveis de cálcio e suplementadas com Fitase Performance and nitrogen retention in broilers from 22 to 42 days old fed diets with different levels in calcium supplement with Fitase

Directory of Open Access Journals (Sweden)

Antônio Soares Teixeira

2003-02-01

Full Text Available Com o objetivo de avaliar os níveis de cálcio na ração suplementada com enzima fitase para frangos de corte de 22 a 42 dias de idade, foi conduzido um experimento com 600 frangos de 21 dias da linhagem Hubbard-MPK, distribuídos em um delineamento inteiramente casualizado, em arranjo fatorial cinco x dois (níveis de cálcio da dieta x sexos, com três repetições de 20 aves por parcela. A ração basal foi balanceada para atender às exigências nutricionais das aves, conforme o NRC (1994, exceto para o cálcio, cujos níveis foram 0,40; 0,59; 0,78; 0,97 e 1,16%, suplementada com Fitase. Aos 35 dias de idade, duas aves de cada tratamento foram transferidas para gaiolas de metabolismo para coleta total das excretas durante quatro dias. O consumo de ração e o ganho de peso foram de 12,8 e 16% respectivamente, e superiores (P0,05 para o consumo de ração, ganho de peso e conversão alimentar em razão dos níveis crescentes de cálcio nas rações. A digestibilidade da matéria seca foi melhor com o nível de 0,88% de cálcio, e a maior retenção de nitrogênio foi obtida com 0,70% de cálcio na ração suplementadas com fitase. Conclui-se que o aumento dos níveis de cálcio em rações suplementadas com fitase para frangos de corte dos 22 aos 42 dias de idade não afeta o desempenho dos mesmos, e níveis muito baixos de cálcio reduzem a digestibilidade da matéria seca e retenção de nitrogênio das rações.With the objective of evaluating the levels of calcium in the ration supplemented with phytase for broiler chickens from 22 to 42 days old, one experiment was conducted by using a total of 600 chickens of 22 days old Hubardb-MPK strain, distributed in a completely randomized design, in five two factorial arrangement (levels of calcium of the diet x sexes, with three replicates of 20 birds per plot. The basal diets was formulated to meet the nutritional requirements of the broilers according to NRC (1994, except for calcium, whose

Discovery of a bright microlensing event with planetary features towards the Taurus region: a super-Earth planet

Science.gov (United States)

Nucita, A. A.; Licchelli, D.; De Paolis, F.; Ingrosso, G.; Strafella, F.; Katysheva, N.; Shugarov, S.

2018-05-01

The transient event labelled as TCP J05074264+2447555 recently discovered towards the Taurus region was quickly recognized to be an ongoing microlensing event on a source located at distance of only 700-800 pc from Earth. Here, we show that observations with high sampling rate close to the time of maximum magnification revealed features that imply the presence of a binary lens system with very low-mass ratio components. We present a complete description of the binary lens system, which host an Earth-like planet with most likely mass of 9.2 ± 6.6 M⊕. Furthermore, the source estimated location and detailed Monte Carlo simulations allowed us to classify the event as due to the closest lens system, being at a distance of ≃380 pc and mass ≃0.25 M⊙.

Abundancia relativa de Amblyomma spp. (Acari: Ixodidae en bovinos (Bos taurus y B. indicus de Costa Rica

Directory of Open Access Journals (Sweden)

V. Alvarez

2003-06-01

Full Text Available El estudio describe la abundancia de garrapatas del género Amblyomma encontradas sobre bovino a través de muestreos mensuales llevados a cabo en diez fincas pertenecientes a ocho zonas ecológicas (ZE de Costa Rica. Durante la visita se recolectaban garrapatas >4 mm del lado derecho de los bovinos. El estudio recopiló información meteorológica para algunas de las fincas ubicadas en el ensayo, mostrando que la variable que más fluctúa es la de precipitación. La principal especie de Amblyomma encontrada fue A. cajennense. La presencia de ninfas del género Amblyomma se localizan solo en los meses de enero a mayo, coincidente con la época de menor humedad en la zona de estacionalidad de lluvias, por lo que es esperable solo una generación por año. En el trabajo de laboratorio se mantienen ninfas de Amblyomma a las cuales se les mide el tiempo de muda y de sobrevivencia bajo condiciones controladas, sin encontrar mayores diferencias entre sexo. Los períodos de sobrevivencia muestran la imposibilidad de efectuar un manejo de potreros con el fin de controlar a las especies de este género. La presencia de adultos del género Amblyomma es a lo largo del año sin presentar una preferencia particular por alguna época. El estudio dividió las zonas de estudio en régimen lluvioso estacional y régimen sin patrón de estacionalidad. La mayor presencia de adultos de Amblyomma se da precisamente en el de estacionalidad, o de influencia Pacífico. Se reporta la presencia de A. maculatum solo en la ZE correspondiente al Bosque húmedo Tropical transición a premontano. Igualmente, se informa de la presencia de Ixodes boliviensis en la ZE denominada Bosque muy húmedo Montano bajo.The research describe the big amount of ticks of the Amblyomma genus, found on bovines through monthly samplings carried out in ten farms in eight ecological zones (EZ of Costa Rica. Ticks larger than 4 mm were picked up from the right side of the animals during the visit. The study compiled meteorological information for some farms located in the experiment, showing that the most fluctuant variable is rainfall. The most important Amblyomma species found was A. cajennense. Amblyomma nymphs were found only from January to May, which coincides with the lower humidity season in the rain seasonality area; as for it is expected only one generation per year. In the lab work Amblyomma nymphs are kept to measure the moulting season and the surviving time under controlled conditions, but no major differences were found between both sexes. The surviving periods show that it is not possible to do a grazing land handling, in order to control this genus species. Adults of the genus Amblyomma are present through all the year, not showing any specific preference for a season. The research divided the investigation areas in rain seasonality and not-seasonality systems. The highest amount of Amblyomma is found given in the rain seasonality system or of Pacific influence. A. maculatum is present only in the EZ of Tropical Humid Forest transition to pre-montainous. Likewise, Ixodes boliviensis is found in the EZ of low mountainous Very Humid Forest.

Comet assay to determine genetic damage by the use of ivermectin in zebu cows (Bos taurus indicus

Directory of Open Access Journals (Sweden)

Donicer Montes-Vergara

2017-05-01

Full Text Available Objective. The objective of the work was evaluate the damage genetic caused by the use of ivermectin (IVM in cows zebu to concentrations of 1% and 3.15% through the test comet. Material and methods. 15 cows, were taken with age between 3 and 4 years old, average weight of 350 kg, body condition between 3 and 3.5. Three experimental groups with five animals per group, which were exposed to the concentration of IVM to 1% to 3.15% more group control (without application of IVM were used. Animal blood sample was performed by venipuncture jugular or medial flow with vacutainer® needle, extracting 8 ml of blood. The blood samples it was collected at 9, 18 and 27 days post-treatment. Results. The display of the comets is made by using fluorescence microscope, the cells were evaluated by means of visual log and the Comet image software. Evidenced the presence of nuclei with DNA migration in all analyzed plates. The values of classification of comets indicate cells with high levels of damage (grade 3: cells with high damage. The rate of DNA damage of the treatment to 1% to 3.15% was significant, to relate to the control group. Conclusions. The results obtained in this study demonstrate the likely genotoxic potential of the use of IVM in cattle.

Fertility variation in two populations of taurus cedar (cedrus libani rich.)

International Nuclear Information System (INIS)

Ozel, H.B.; Bilir, N.

2016-01-01

Fertility variation, measured as half-sib family coefficient, based on number of one, two and three years cones were investigated in plantation population (PP), and a natural population (NP) of Taurus Cedar (Cedrus libani Rich.) sampled from southern part of Turkey. Fertility variation was higher in PP than NP for one, two and three years. It was the highest in PP for one year cones (2.34), while it was lowest in NP for three years cones (1.73) as shown in Table 2. The effective number of parents were 21.8 (38.4% of census number) for one year cones, 25.7 (47.9% of census number) for two years cones and 29.8 (52.6% of census number) for three cones in PP. On the other hand the effective number of parents were 28.3 (43.4% of census number) for one year cones, 32.8 (51.6% of census number) for two years cones and 36.4 (58.9% of census number) for three years cones in NP. Diameter at breast height and tree crown area had positive and significant (p<0.05) effective on cone production, while effects of tree height and tree age were not significant (NS) on that (Table 3). There were also positive and significant (p<0.05) correlation between years in cone production. (author)

Tissue-specific and minor inter-individual variation in imprinting of IGF2R is a common feature of Bos taurus Concepti and not correlated with fetal weight.

Directory of Open Access Journals (Sweden)

Daniela Bebbere

Full Text Available The insulin-like growth factor 2 receptor (IGF2R is essential for prenatal growth regulation and shows gene dosage effects on fetal weight that can be affected by in-vitro embryo culture. Imprinted maternal expression of murine Igf2r is well documented for all fetal tissues excluding brain, but polymorphic imprinting and biallelic expression were reported for IGF2R in human. These differences have been attributed to evolutionary changes correlated with specific reproductive strategies. However, data from species suitable for testing this hypothesis are lacking. The domestic cow (Bos taurus carries a single conceptus with a similar gestation length as human. We identified 12 heterozygous concepti informative for imprinting studies among 68 Bos taurus fetuses at Day 80 of gestation (28% term and found predominantly maternal IGF2R expression in all fetal tissues but brain, which escapes imprinting. Inter-individual variation in allelic expression bias, i.e. expression of the repressed paternal allele relative to the maternal allele, ranged from 4.6-8.9% in heart, 4.3-10.2% in kidney, 6.1-11.2% in liver, 4.6-15.8% in lung and 3.2-12.2% in skeletal muscle. Allelic bias for mesodermal tissues (heart, skeletal muscle differed significantly (P<0.05 from endodermal tissues (liver, lung. The placenta showed partial imprinting with allelic bias of 22.9-34.7% and differed significantly (P<0.001 from all other tissues. Four informative fetuses were generated by in-vitro fertilization (IVF with embryo culture and two individuals displayed fetal overgrowth. However, there was no evidence for changes in imprinting or DNA methylation after IVF, or correlations between allelic bias and fetal weight. In conclusion, imprinting of Bos taurus IGF2R is similar to mouse except in placenta, which could indicate an effect of reproductive strategy. Common minor inter-individual variation in allelic bias and absence of imprinting abnormalities in IVF fetuses suggest

Physiological Responses and Lactation to Cutaneous Evaporative Heat Loss in , , and Their Crossbreds

Directory of Open Access Journals (Sweden)

Wang Jian

2015-11-01

Full Text Available Cutaneous evaporative heat loss in Bos indicus and Bos taurus has been well documented. Nonetheless, how crossbreds with different fractional genetic proportions respond to such circumstances is of interest. A study to examine the physiological responses to cutaneous evaporative heat loss, also lactation period and milk yield, were conducted in Sahiwal (Bos indicus, n = 10, 444±64.8 kg, 9±2.9 years, Holstein Friesian (Bos taurus, HF100% (n = 10, 488±97.9 kg, 6±2.8 years and the following crossbreds: HF50% (n = 10, 355±40.7 kg, 2±0 years and HF87.5% (n = 10, 489±76.8 kg, 7±1.8 years. They were allocated so as to determine the physiological responses of sweating rate (SR, respiration rate (RR, rectal temperature (RT, and skin temperature (ST with and without hair from 06:00 h am to 15:00 h pm. And milk yield during 180 days were collected at days from 30 to 180. The ambient temperature-humidity-index (THI increased from less than 80 in the early morning to more than 90 in the late afternoon. The interaction of THI and breed were highly affected on SR, RR, RT, and ST (p0.05 but did change over time. The ST with and without hair were similar, and was higher in HF100% (37.4°C; 38.0°C and their crossbred HF50% (35.5°C; 35.5°C and HF87.5% (37.1°C; 37.9°C than Sahiwal (34.8°C; 34.8°C (p<0.01. Moreover, the early lactation were higher at HF100% (25 kg and 87.5% (25 kg than HF50% (23 kg which were higher than Sahiwal (18 kg while the peak period of lactation was higher at HF100% (35 kg than crossbreds both HF87.5% and HF50% (32 kg which was higher than Sahiwal (26 kg (p<0.05. In conclusion, sweating and respiration were the main vehicle for dissipating excess body heat for Sahiwal, HF and crossbreds, respectively. The THI at 76 to 80 were the critical points where the physiological responses to elevated temperature displayed change.

STAR FORMATION IN THE TAURUS FILAMENT L 1495: FROM DENSE CORES TO STARS

International Nuclear Information System (INIS)

Schmalzl, Markus; Kainulainen, Jouni; Henning, Thomas; Launhardt, Ralf; Quanz, Sascha P.; Alves, Joao; Goodman, Alyssa A.; Pineda, Jaime E.; Roman-Zuniga, Carlos G.

2010-01-01

We present a study of dense structures in the L 1495 filament in the Taurus Molecular Cloud and examine its star-forming properties. In particular, we construct a dust extinction map of the filament using deep near-infrared observations, exposing its small-scale structure in unprecedented detail. The filament shows highly fragmented substructures and a high mass-per-length value of M line = 17 M sun pc -1 , reflecting star-forming potential in all parts of it. However, a part of the filament, namely B 211, is remarkably devoid of young stellar objects. We argue that in this region the initial filament collapse and fragmentation is still taking place and star formation is yet to occur. In the star-forming part of the filament, we identify 39 cores with masses from 0.4 to 10 M sun and preferred separations in agreement with the local Jeans length. Most of these cores exceed the Bonnor-Ebert critical mass, and are therefore likely to collapse and form stars. The dense core mass function follows a power law with exponent Γ = 1.2 ± 0.2, a form commonly observed in star-forming regions.

Influence of cow breed type, age and previous lactation status on cow height, calf growth, and patterns of body weight, condition, and blood metabolites for cows grazing bahiagrass pastures.

Science.gov (United States)

Coleman, S W; Chase, C C; Riley, D G; Williams, M J

2017-01-01

This study was initiated to evaluate performance and patterns of cow traits and blood metabolites of 3 breeds of cows grazing bahiagrass (Paspalum notatum Flügge) pastures in central Florida. Purebred cows (n = 411) of either Angus (Bos taurus), Brahman (Bos indicus), or Romosinuano (Bos taurus) breeding, rotationally grazed (moved twice weekly) bahiagrass pastures year-round, and received bahiagrass hay supplemented with molasses and soyhulls or legume hay supplemented with unfortified molasses from October to June each production year. At monthly intervals, all cows were weighed, measured at the hip (HH), scored for BCS, and blood samples collected by jugular puncture from 10 cows per cow breed/block group for plasma urea N (PUN), glucose and non-esterified fatty acids (NEFA). Data were analyzed on cows that calved with a statistical model that included fixed effects of year, cowage, cow breed, month, block, supplement group (n = 2, but not presented), and whether the cow weaned a calf the previous year. Cow was a repeated observation over mo. Three-way interactions involving monthly patterns for cowage x year, year x lactation status the previous year, cowage × cow breed, year × cow breed, and cow breed × lactation status the previous year were significant (P cow breed × month was important (P cows compared to 3-yr old cows; 2) greater BW and BCS before calving for cows that did not lactate the previous year; 3) PUN levels were above 11 mg/dl except for February, August and September, and was generally greater in tropically adapted breeds; 4) GLU was greatest in Brahman, lowest in Angus, and intermediate in Romosinuano cows; and 5) plasma levels of NEFA escalated at calving and then declined, but Brahman cows maintained greater (P Cows that lactated the previous year had less NEFA than those that did not lactate. Brahman cows were less fertile than Bos taurus breeds, and weaned heavier calves.

Food selection of the Malayan tapir (Tapirus indicus) under semi-wild conditions

Science.gov (United States)

Simpson, Boyd K.; Shukor, M. N.; Magintan, David

2013-11-01

A study on the selection of food plants by captive Malayan tapirs (Tapirus indicus) was undertaken in a 30 hectare natural forest enclosure at the Sungai Dusun Wildlife Reserve, Malaysia. Tapirs browsed on 217 species of plants (from 99 genera and 49 families) from a total of the 1142 specimens collected and identified. Food plants were heavily dominated by sapling trees and shrubs which comprised 93% of all plants taken, with the remainder comprising woody lianas, vines and herbaceous plants. Although tapirs browsed on a wide variety of plant species, the top 30 species consumed represented more than 60% of all the plants selected, whilst the vast majority of species were rarely eaten. More than 80 species of trees and shrubs were available, but not eaten at all. The most readily consumed species were the sub-canopy and understorey trees Xerospermum noronhianum, Aporosa prainiana and Baccaurea parviflora, while Aporosa, Knema and Xerospermum were the dominant plant genera. The Phyllanthaceae (leaf flowers), Myristicaceae (nutmegs) and Sapindaceae (rambutans) were the most commonly selected families comprising 45% of the diet. Tapirs fed on saplings trees up to 8.3 m in height, while plants taller than about 1.6 m were bent, broken or pushed to the ground to gain access to the foliage. Sapling stems up to 4.2 cm in diameter could be snapped by biting, while larger trees to 7 cm diameter could be pushed down. Tapirs typically fed on the newer leaves and shoots, however, often only consuming half of the available foliage on a plant. This study documents 160 new plant species suitable as Malayan tapir food, and is consistent with the generalist, but selective browsing nature of the Tapirus species in general.

Níveis decrescentes de proteína em dietas suplementadas com complexo enzimático para coelhos em crescimento. 1. Desempenho produtivo

Directory of Open Access Journals (Sweden)

Dias J.C.C.A.

2000-01-01

Full Text Available Estudou-se o efeito da redução do nível protéico da dieta, com e sem suplementação enzimática, sobre o desempenho produtivo de coelhos em crescimento. Em um delineamento inteiramente ao acaso, utilizaram-se 54 coelhos da raça Nova Zelândia Branco, de ambos os sexos, desmamados aos 35 dias de idade e divididos em cinco grupos (tratamentos, quatro de 11 e um de 10 coelhos. Os tratamentos constituíram-se de dietas calculadas como isoenergéticas e isoaminoacídicas com 17, 16, 15 e 14% de proteína bruta (PB, suplementadas com 0,05% de um complexo enzimático comercial (VegproÒ , com atividade de protease e de celulase, e uma dieta controle com 17% de PB sem adição de complexo enzimático. Os animais submetidos aos tratamentos com 14 e 15% PB apresentaram melhores resultados no ensaio de crescimento, observando-se influência significativa (P<0,05 do teor de PB sobre o peso vivo final, peso vivo final metabólico, ganho de peso diário, consumo diário de dieta, consumo diário de proteína bruta e conversão alimentar. A redução do nível de proteína bruta da dieta para 14% com suplementação enzimática e corrigida quanto aos aminoácidos mais limitantes para os teores recomendados pela literatura não influenciou negativamente as características estudadas.

Microbiota composition, gene pool and its expression in Gir cattle (Bos indicus) rumen under different forage diets using metagenomic and metatranscriptomic approaches.

Science.gov (United States)

Pandit, Ramesh J; Hinsu, Ankit T; Patel, Shriram H; Jakhesara, Subhash J; Koringa, Prakash G; Bruno, Fosso; Psifidi, Androniki; Shah, S V; Joshi, Chaitanya G

2018-03-09

Zebu (Bos indicus) is a domestic cattle species originating from the Indian subcontinent and now widely domesticated on several continents. In this study, we were particularly interested in understanding the functionally active rumen microbiota of an important Zebu breed, the Gir, under different dietary regimes. Metagenomic and metatranscriptomic data were compared at various taxonomic levels to elucidate the differential microbial population and its functional dynamics in Gir cattle rumen under different roughage dietary regimes. Different proportions of roughage rather than the type of roughage (dry or green) modulated microbiome composition and the expression of its gene pool. Fibre degrading bacteria (i.e. Clostridium, Ruminococcus, Eubacterium, Butyrivibrio, Bacillus and Roseburia) were higher in the solid fraction of rumen (Pcomparison of metagenomic shotgun and metatranscriptomic sequencing appeared to be a much richer source of information compared to conventional metagenomic analysis. Copyright © 2018 Elsevier GmbH. All rights reserved.

Worldwide Patterns of Ancestry, Divergence, and Admixture in Domesticated Cattle

Science.gov (United States)

Decker, Jared E.; McKay, Stephanie D.; Rolf, Megan M.; Kim, JaeWoo; Molina Alcalá, Antonio; Sonstegard, Tad S.; Hanotte, Olivier; Götherström, Anders; Seabury, Christopher M.; Praharani, Lisa; Babar, Masroor Ellahi; Correia de Almeida Regitano, Luciana; Yildiz, Mehmet Ali; Heaton, Michael P.; Liu, Wan-Sheng; Lei, Chu-Zhao; Reecy, James M.; Saif-Ur-Rehman, Muhammad; Schnabel, Robert D.; Taylor, Jeremy F.

2014-01-01

The domestication and development of cattle has considerably impacted human societies, but the histories of cattle breeds and populations have been poorly understood especially for African, Asian, and American breeds. Using genotypes from 43,043 autosomal single nucleotide polymorphism markers scored in 1,543 animals, we evaluate the population structure of 134 domesticated bovid breeds. Regardless of the analytical method or sample subset, the three major groups of Asian indicine, Eurasian taurine, and African taurine were consistently observed. Patterns of geographic dispersal resulting from co-migration with humans and exportation are recognizable in phylogenetic networks. All analytical methods reveal patterns of hybridization which occurred after divergence. Using 19 breeds, we map the cline of indicine introgression into Africa. We infer that African taurine possess a large portion of wild African auroch ancestry, causing their divergence from Eurasian taurine. We detect exportation patterns in Asia and identify a cline of Eurasian taurine/indicine hybridization in Asia. We also identify the influence of species other than Bos taurus taurus and B. t. indicus in the formation of Asian breeds. We detect the pronounced influence of Shorthorn cattle in the formation of European breeds. Iberian and Italian cattle possess introgression from African taurine. American Criollo cattle originate from Iberia, and not directly from Africa with African ancestry inherited via Iberian ancestors. Indicine introgression into American cattle occurred in the Americas, and not Europe. We argue that cattle migration, movement and trading followed by admixture have been important forces in shaping modern bovine genomic variation. PMID:24675901

Effect of shadow availability at pasture on reproductive traits of Nelore bulls (Bos indicus raised in southeastern Brazil

Directory of Open Access Journals (Sweden)

Octavio Fabián Bao Tarragó

2013-12-01

Full Text Available Solar radiation is responsible for bull body temperature elevation. An alternative to minimize heat stress is to use artificial shade. Thus, this study aimed to evaluate the effect of thermal stress reduction, through shade availability, on reproductive characteristics of Nellore bulls (Bos indicus. For this, ten bulls were divided in: Available artificial shade (AS, n = 5 and Unavailable shade (US, n = 5. Each group was kept in two hectare paddocks, in which shade availability for group AS was artificially created. Animals were submitted to a clinical-reproductive evaluation and seminal analyses. No interaction was observed between treatments (AS and US and time (8 collections for all analyzed variables (P>0.05. No significant effect (P > 0.05 of treatment was observed for all parameters analyzed. So, it can be concluded that the absence of shaded areas during summer does not negatively affect reproductive characteristics such as: scrotal circumference, testicular consistency, progressive motility, percentage of rapidly moving cells (Computer Assisted Semen Analysis - CASA, morphology or sperm viability in Nellore bulls raised in southeastern Brazil, considering that results could be different in other regions of the country where average temperature is higher.

Posición anatómica y longitud del apéndice vermiforme en una población de raza mestiza de la ciudad de Bucaramanga - Colombia

Directory of Open Access Journals (Sweden)

Mónica Saavedra Martínez

2009-12-01

Full Text Available Antecedentes: La posición y longitud del apéndice vermiforme en el ser humano no son constantes y los datos sobre sus variaciones son limitados. Estudios previos soportan que algunas posiciones particulares o apéndices muy largas pueden confundir los signos clínicos de una apendicitis. Algunos autores afirman que el curso de una apendicitis puede estar influenciada por la posición del apéndice. Método: La posición y longitud del apéndice cecal fueron estudiados en 100 especímenes cadavéricos de población mestiza de Bucaramanga - Colombia. La posición del apéndice se dividió en 6 grupos: pélvica, retrocecal, preileal, postileal, subcecal y paracecal. La posición fue estudiada in situ. Resultados: La posición predominante fue la retrocecal 41%. Igualmente se encontró un porcentaje elevado de posición pélvica 28%. El promedio de la longitud del apéndice fue de 7.1 cm. Conclusión: El porcentaje de la posición retrocecal de nuestro estudio concuerda con otros estudios realizados en especímenes cadavéricos. Algunos autores han reportado porcentajes elevados de posición pélvica especialmente en poblaciones de raza negra. La posición pélvica del apéndice cecal puede producir dolor hipogástrico confundiendo los síntomas clínicos principalmente en mujeres. Los resultados de este tipo de investigaciones son importantes porque las relaciones de variables anatómicas son usadas en imágenes clínicas de apendicitis aguda; además éstas observaciones pueden alentar la mayor realización de apendicectomías por laparoscopia.

The embedded young stars in the Taurus-Auriga molecular cloud. I - Models for spectral energy distributions

Science.gov (United States)

Kenyon, Scott J.; Calvet, Nuria; Hartmann, Lee

1993-01-01

We describe radiative transfer calculations of infalling, dusty envelopes surrounding pre-main-sequence stars and use these models to derive physical properties for a sample of 21 heavily reddened young stars in the Taurus-Auriga molecular cloud. The density distributions needed to match the FIR peaks in the spectral energy distributions of these embedded sources suggest mass infall rates similar to those predicted for simple thermally supported clouds with temperatures about 10 K. Unless the dust opacities are badly in error, our models require substantial departures from spherical symmetry in the envelopes of all sources. These flattened envelopes may be produced by a combination of rotation and cavities excavated by bipolar flows. The rotating infall models of Terebey et al. (1984) models indicate a centrifugal radius of about 70 AU for many objects if rotation is the only important physical effect, and this radius is reasonably consistent with typical estimates for the sizes of circumstellar disks around T Tauri stars.

Impact of Phosphate, Potassium, Yeast Extract, and Trace Metals on Chitosan and Metabolite Production by Mucor indicus.

Science.gov (United States)

Safaei, Zahra; Karimi, Keikhosro; Zamani, Akram

2016-08-30

In this study the effects of phosphate, potassium, yeast extract, and trace metals on the growth of Mucor indicus and chitosan, chitin, and metabolite production by the fungus were investigated. Maximum yield of chitosan (0.32 g/g cell wall) was obtained in a phosphate-free medium. Reversely, cell growth and ethanol formation by the fungus were positively affected in the presence of phosphate. In a phosphate-free medium, the highest chitosan content (0.42 g/g cell wall) and cell growth (0.66 g/g sugar) were obtained at 2.5 g/L of KOH. Potassium concentration had no significant effect on ethanol and glycerol yields. The presence of trace metals significantly increased the chitosan yield at an optimal phosphate and potassium concentration (0.50 g/g cell wall). By contrast, production of ethanol by the fungus was negatively affected (0.33 g/g sugars). A remarkable increase in chitin and decrease in chitosan were observed in the absence of yeast extract and concentrations lower than 2 g/L. The maximum chitosan yield of 51% cell wall was obtained at 5 g/L of yeast extract when the medium contained no phosphate, 2.5 g/L KOH, and 1 mL/L trace metal solution.

A case study of Malayan tapir (Tapirus indicus) husbandry practice across 10 zoological collections.

Science.gov (United States)

Rose, Paul E; Roffe, Sarah M

2013-01-01

The Malayan, or Asian, tapir (Tapirus indicus) has a diminishing wild population and is becoming more common in captivity as zoos attempt to manage sustainable ex situ populations. Tapirs can be relatively easy to maintain and breed, but captive animals appear to suffer from reduced activity budgets, obesity, and poor public image. A questionnaire-based survey was designed and sent specifically to 10 collections around the world that exhibit Malayan tapirs, with the aim of assessing husbandry regimes to determine prevalence of standardized practices as well as highlighting any key differences, and to showcase good practice, thus providing information beneficial to those maintaining this species in their zoo. Twenty-five animals were included in the survey from collections across four continents. The research's major conclusions show differing dietary make-up, with a lack of forage provision, contrasting with a diverse array of enrichment protocols used. Significant differences were noted between zoos for total amount of food offered (P = 0.000) as well as ratios of forage to concentrate pellet offered (P = 0.004). Comparing food offered to male and female tapirs with published requirements for an "average" of either gender shows not all zoos providing the amount suggested in husbandry guidelines. Intelligently designed and original enrichment was provided to all animals but differences between zoos were noted in the application and "usefulness" of enrichment for individual tapir. Overall, animals are benefiting from enrichment but welfare could be further improved via consistent feeding of ad libitum forage and regular use of browse as a constituent part of daily rations. © 2012 Wiley Periodicals, Inc.

Compression distance can discriminate animals by genetic profile, build relationship matrices and estimate breeding values.

Science.gov (United States)

Hudson, Nicholas J; Porto-Neto, Laercio; Kijas, James W; Reverter, Antonio

2015-10-13

Genetic relatedness is currently estimated by a combination of traditional pedigree-based approaches (i.e. numerator relationship matrices, NRM) and, given the recent availability of molecular information, using marker genotypes (via genomic relationship matrices, GRM). To date, GRM are computed by genome-wide pair-wise SNP (single nucleotide polymorphism) correlations. We describe a new estimate of genetic relatedness using the concept of normalised compression distance (NCD) that is borrowed from Information Theory. Analogous to GRM, the resultant compression relationship matrix (CRM) exploits numerical patterns in genome-wide allele order and proportion, which are known to vary systematically with relatedness. We explored properties of the CRM in two industry cattle datasets by analysing the genetic basis of yearling weight, a phenotype of moderate heritability. In both Brahman (Bos indicus) and Tropical Composite (Bos taurus by Bos indicus) populations, the clustering inferred by NCD was comparable to that based on SNP correlations using standard principal component analysis approaches. One of the versions of the CRM modestly increased the amount of explained genetic variance, slightly reduced the 'missing heritability' and tended to improve the prediction accuracy of breeding values in both populations when compared to both NRM and GRM. Finally, a sliding window-based application of the compression approach on these populations identified genomic regions influenced by introgression of taurine haplotypes. For these two bovine populations, CRM reduced the missing heritability and increased the amount of explained genetic variation for a moderately heritable complex trait. Given that NCD can sensitively discriminate closely related individuals, we foresee CRM having possible value for estimating breeding values in highly inbred populations.

Cinética do P nos tecidos de suínos em crescimento alimentados com dietas formuladas de acordo com o conceito de proteína ideal e suplementadas com enzima fitase

Directory of Open Access Journals (Sweden)

J.A. Moreira

2014-10-01

Full Text Available O presente estudo foi desenvolvido para avaliar os efeitos da enzima fitase sobre a cinética do P nos tecidos de suínos, alimentados com dietas formuladas de acordo com o conceito de proteína ideal e suplementadas com enzima fitase. Foram utilizados 20 suínos machos castrados, distribuídos em um delineamento em blocos ao acaso, com cinco tratamentos e quatro repetições. Os animais foram alojados em gaiolas metabólicas durante 17 dias, sendo 10 dias para adaptação e sete dias para coletas de fezes e urina. Amostras de sangue foram coletadas por cinco dias. No primeiro dia da fase experimental, cada animal recebeu, por via endovenosa, uma solução radioativa com 7,4MBq de 32P. No final do período experimental, os animais foram sacrificados, e amostras de tecidos do músculo (lombo, coração, fígado, rins e ossos foram coletadas. A enzima fitase interferiu na cinética do 32P, levando a uma menor incorporação nos tecidos dos ossos.

Qualidade da carne de frangos de corte submetidos a dietas suplementadas com crômio, criados em diferentes temperaturas ambientais = Meat quality of broiler chicks submeted the supplemented diets with chromium and reared in differents enviromental temperatures

Directory of Open Access Journals (Sweden)

Alexandre Oba

2007-04-01

Full Text Available Foram realizados dois experimentos. O experimento um objetivou avaliar a composição da carne do peito de frangos alimentados com dietas suplementadas com crômio (0, 400, 800 e 1.200 μg Cr kg-1 complexado a levedura, criados sob diferentes condições de temperatura (quente, termoneutra e fria. O experimento dois objetivou avaliar a qualidade da carne do peito de frangos alimentados com dietas suplementadas com crômio (0 e 400 μg Cr kg-1, criados nas mesmas condições do experimento um e desossados em diferentes períodos (0, 5 e 24 horas. Os resultados mostram que as aves criadas em ambiente frio apresentaram a carne com menor porcentagem de matéria mineral e crômio e maior intensidade de vermelho, enquanto as aves criadas em temperatura termoneutra apresentaram carne com menor porcentagem de umidade, e as aves criadas em temperatura quente, carne com maior luminosidade. Já a suplementação de crômio não proporcionou qualquer efeito na composição e na qualidade de carne, enquanto que o aumento no período de desossa proporcionou um menor comprimento de sarcômero, força de cisalhamento e intensidade de amarelo, porém uma maior luminosidade.Two experiments were conducted being the objective of the first experiment to evaluate the the composition of breast meat of broiler chicks fed with diets supplemented with chromium yeast (0; 400; 800and 1,200 μg Cr kg-1 reared in different environmental temperatures (hot, thermoneutral and cold. The second experiment aimed to evaluate the quality of breast meat of broiler chicks fed with diets supplemented with chromium yeast (0 and 400 μg Cr kg-1, reared in different environmental temperatures (hot, thermoneutral and cold and deboned in different periods (0, 5 and 24 hours. The results showed that birds reared in cold environmental temperature showed meat with lower mineral matter percentage and chromium and higher values of redness, whereas the birds reared in thermoneutral environment

Incidence and transplacental transmission of Neospora caninum in primiparous females from Bos indicus slaughtered in Presidente Prudente, São Paulo, Brazil / Incidência e transmissão transplacentária de Neospora caninum em fêmeas primíparas da raça Bos indicus abatidos em Presidente Prudente, São Paulo, Brasil

Directory of Open Access Journals (Sweden)

Sergio do Nascimento Kronka

2008-08-01

Full Text Available To produce an epidemiological map of neosporosis in Brazil and identify the types of transmission of this disease, the present study evaluated the occurrence of Neospora caninum in Nelore cattle (Bos indicus in Presidente Prudent, west region of Sao Paulo state; its vertical transmission; and the early stage in which fetuses are infected. To achieve this, serum samples from 518 slaughtered pregnant heifers and their fetuses were tested by ELISA technique and fetal brain tissues subjected to PCR. One hundred and three heifers (19.88% had antibodies to N. caninum, as well as 38 (36.8% of fetuses from 4 months of gestation. The conventional PCR failed to detect N. caninum DNA. These findings show that neosporosis occurs in the area studied and that it may be transmitted the transplacental route, althought N. caninum had not detected in brain tissue from non-aborted fetuses. The use of nested PCR it would be applied to increase the sensitivy of test.Para produzir um mapa epidemiológico da neosporose no Brasil e identificar os tipos de transmissão dessa doença, o presente estudo avaliou a ocorrência de Neospora caninum em fêmea Nelore (Bos Indicus em Presidente Prudente, região oeste do Estado de São Paulo e o risco de infecção fetal nos estágios iniciais da gestação. Para a realização deste estudo, amostras de soro de 518 novilhas prenhas abatidas e seus fetos foram testadas pela técnica de ELISA e para avaliação de transmissão vertical, tecido cerebral fetal foi submetido à reação da polimerase em cadeia (PCR. Dessas novilhas, 103 (19,88% tinham anticorpos para N. caninum dos quais 38 (36,8% estavam no 4 mês de gestação. Esses achados mostram que a Neosporose ocorre na área estudada e que pode ser transmitido pela via placentária, embora o N. caninum não tenha sido detectado em tecido cerebral de fetos não abortado. O uso de nested PCR poderia ser aplicado como forma de aumentar a sensibilidade do teste.

Effectiveness of a 95 SNP panel for the screening of breed label fraud in the Chinese meat market.

Science.gov (United States)

Rogberg-Muñoz, A; Wei, S; Ripoli, M V; Guo, B L; Carino, M H; Lirón, J P; Prando, A J; Vaca, R J A; Peral-García, P; Wei, Y M; Giovambattista, G

2016-01-01

Breed assignment has proved to be useful to control meat trade and protect the value of special productions. Meat-related frauds have been detected in China; therefore, 95 SNPs selected from the ISAG core panel were evaluated to develop an automated and technologically updated tool to screen breed label fraud in the Chinese meat market. A total of 271 animals from four Chinese yellow cattle (CYC) populations, six Bos taurus breeds, two Bos indicus and one composite were used. The allocation test distinguished European, Japanese and Zebu breeds, and two Chinese genetic components. It correctly allocated Japanese Black, Zebu and British breeds in 100, 90 and 89% of samples, respectively. CYC evidenced the Zebu, Holstein and Limousin introgression. The test did not detect CYC components in any of the 25 samples from Argentinean butchers. The method could be useful to certify Angus, Hereford and Japanese Black meat, but a modification in the panel would be needed to differentiate other breeds. Copyright © 2015 Elsevier Ltd. All rights reserved.

PRODUCTIVITY AND TICK LOAD IN Bos Indicus X B. taurus CATTLE IN A TROPICAL DRY FOREST SILVOPASTORAL SYSTEM

Directory of Open Access Journals (Sweden)

Raquel Sofía Salazar Benjumea

2015-04-01

Full Text Available Rhipicephalus (Boophilus microplus ticks cause significant economic losses to the Colombian cattle sector: reduction in meat and milk production, blood losses and transmission of blood parasites. The degree of infestation depends on the breed, physiological state and nutrition of the animal and on microclimatic characteristics, which affect the tick life cycle. Diverse studies suggest that given the characteristics of intensive silvopastoral systems (ISS, tick loads within these systems are lower. In this study, the tick loads of grazing animals were monitored for five animal groups: three at an ISS and two at traditional farms located on the Valley of Ibague (Tolima. within the ISS, there were greater tick loads in high production cows (P = 0.026 and a positive relationship (P < 0.05 between milk production and tick load in August sampling. Greater tick counts were also observed in the in San Javier (traditional farm group compared to all other animal groups. We conclude that the dynamics of ticks is a complex phenomenon affected by many factors, whose association determines the observed tick population at any given time.

Parâmetros sangüíneos de pacu Piaractus mesopotamicus (Holmberg, 1887 alimentados com dietas suplementadas com cromo trivalente em duas densidades de estocagem = Hematological parameters of pacu Piaractus mesopotamicus (Holmberg, 1887 fed diets supplemented with trivalent chromium in two stocking densities

Directory of Open Access Journals (Sweden)

Rodrigo Yudi Fujimoto

2007-10-01

Full Text Available O objetivo deste trabalho foi avaliar os efeitos da suplementação com cromo trivalente (0, 6, 12 e 18 mg kg-1 de ração sobre as variáveis hematológicas de Piaractus mesopotamicus, mantidos em duas densidades de estocagem (4 e 20 kg m-3. Os mantidos na maior densidade e alimentados com dietas suplementadas com 0 e 6 mg de cromo kg-1apresentaram redução do número de linfócitos circulantes, sugerindo má adaptação a essa condição de alta densidade. Nas dietas suplementadas com 12 e 18 mg kg-1, tal efeito não foi observado, porém verificou-se aumento do número de trombócitos no tratamento com 12 mg de cromo kg-1. A inexistência de diferença significativa entre os tratamentos, aos 30 dias, sugere a adaptação dos peixes ao tipo de alimento e à situação de alta densidade. Portanto, nas condições deste ensaio, a suplementação com 12 e 18 mg de cromo kg-1 é interessante como estratégia alimentar durante 15 dias.This work evaluated the effects of chromium supplementation on thehematological parameters of Piaractus mesopotamicus Holmberg, 1887 maintained in two stocking densities. Fish were fed diets supplemented with 0, 6, 12 and 18 mg trivalent chromium kg-1 dry ration and maintained at 4 and 20 kg m-3. The fish under high stockingdensity and fed diets supplemented with 0 and 6 mg kg-1 showed reduction in the number lymphocytes, which suggests non-adaptation to this condition of high density. This was not observed in fish fed diets supplemented with 12 and 18 mg chromium kg-1, but an increasein the number of thrombocytes was evident. The lack of difference between treatments after 30 days may suggest a possible adaptation of fish to the situation. It can be added that supplementation with 12 and 18 mg chromium kg-1 is an interesting feeding strategy for aperiod of 15 days.

Evaluation of Mucor indicus and Saccharomyces cerevisiae capability to ferment hydrolysates of rape straw and Miscanthus giganteus as affected by the pretreatment method.

Science.gov (United States)

Lewandowska, Małgorzata; Szymańska, Karolina; Kordala, Natalia; Dąbrowska, Aneta; Bednarski, Włodzimierz; Juszczuk, Andrzej

2016-07-01

Rape straw and Miscanthus giganteus was pretreated chemically with oxalic acid or sodium hydroxide. The pretreated substrates were hydrolyzed with enzymatic preparations of cellulase, xylanase and cellobiase. The highest concentration of reducing sugars was achieved after hydrolysis of M. giganteus pretreated with NaOH (51.53gdm(-3)). In turn, the highest yield of enzymatic hydrolysis determined based on polysaccharides content in the pretreated substrates was obtained in the experiments with M. giganteus and oxalic acid (99.3%). Rape straw and M. giganteus hydrolysates were fermented using yeast Saccharomyces cerevisiae 7, NRRL 978 or filamentous fungus Mucor rouxii (Mucor indicus) DSM 1191. The highest ethanol concentration was determined after fermentation of M. giganteus hydrolysate pretreated with NaOH using S. cerevisiae (1.92% v/v). Considering cellulose content in the pretreated solid, the highest degree of its conversion to ethanol (86.2%) was achieved after fermentation of the hydrolysate of acid-treated M. giganteus using S. cerevisiae. Copyright © 2016 Elsevier Ltd. All rights reserved.

METHANOL IN THE STARLESS CORE, TAURUS MOLECULAR CLOUD-1

Energy Technology Data Exchange (ETDEWEB)

Soma, Tatsuya; Sakai, Nami; Watanabe, Yoshimasa; Yamamoto, Satoshi, E-mail: soma@taurus.phys.s.u-tokyo.ac.jp [Department of Physics, The University of Tokyo, Bunkyo-ku, Tokyo 113-0033 (Japan)

2015-04-01

To explore the formation mechanisms of gas phase CH{sub 3}OH in cold starless cores, we have conducted high spectral resolution observations toward the cyanopolyyne peak of Taurus Molecular Cloud-1 (TMC-1 CP) with the IRAM 30 m telescope, the Green Bank Telescope, and the Nobeyama 45 m telescope. The spectral lines of CH{sub 3}OH toward TMC-1 CP are found to have a double-peaked profile separated by 0.5 km s{sup −1}. Since the double-peaked profile is observed for {sup 13}CH{sub 3}OH, it is not due to optical depth and/or self-absorption effects. The spectral line profile of CH{sub 3}OH is much different from those of C{sup 34}S, C{sub 3}S, and HC{sub 7}N observed toward this source. The H{sub 2} densities of the emitting region of CH{sub 3}OH for the blueshifted and redshifted components are derived to be (1.7 ± 0.5) × 10{sup 4} cm{sup −3} and (4.3 ± 1.2) × 10{sup 4} cm{sup −3}, respectively. These densities are similar to or slightly lower than those found for the other molecules. These results suggest a chemical differentiation between CH{sub 3}OH and the other molecules, which has indeed been confirmed by mapping observations of the CH{sub 3}OH and C{sup 34}S lines. These results are consistent with the general idea that CH{sub 3}OH is formed on dust grains and is liberated into the gas phase by non-thermal desorption. The grain-surface origin of CH{sub 3}OH is further confirmed by the CH{sub 3}OH/{sup 13}CH{sub 3}OH ratio. Weak shocks caused by accreting diffuse gas to the TMC-1 filament, photoevaporation caused by cosmic-ray induced UV radiation, and the desorption of excess reaction energy in the formation of CH{sub 3}OH on dust grains are discussed for the desorption mechanisms.

THE INFLUENCE OF AUTOLYSIS ON THE PROTEIN-PEPTIDE PROFILE OF Bos taurus AND Sus scrofa HEART AND AORTA TISSUES

Directory of Open Access Journals (Sweden)

I. M. Chernukha

2016-01-01

Full Text Available The article presents the results of autolytic processes impact on the protein-peptide profile of Bos taurus and Sus scrofa cardiac muscle and aorta. The results of tissue-specific protein identification are also presented as well as the effect of autolysis. Apolipoprotein A-1 involved in the formation of high-density lipoproteins, peroxiredoxin-1 involved in the suppression of oxidative stress, galectin-1 induced apoptosis of T-lymphocytes, as well as number of heat shock proteins with molecular weight less than 30 kDa were identified in Sus scrofa aorta tissue. It was discovered that functional proteins with molecular weight less than 30 kDa are retained during the freezing process, but destroyed under the action of autolytic enzymes. This work was supported by the Russian Science Foundation (project No. 16–16–10073.

Large-scale structure of the Taurus molecular complex. II. Analysis of velocity fluctuations and turbulence. III. Methods for turbulence

International Nuclear Information System (INIS)

Kleiner, S.C.; Dickman, R.L.

1985-01-01

The velocity autocorrelation function (ACF) of observed spectral line centroid fluctuations is noted to effectively reproduce the actual ACF of turbulent gas motions within an interstellar cloud, thereby furnishing a framework for the study of the large scale velocity structure of the Taurus dark cloud complex traced by the present C-13O J = 1-0 observations of this region. The results obtained are discussed in the context of recent suggestions that widely observed correlations between molecular cloud widths and cloud sizes indicate the presence of a continuum of turbulent motions within the dense interstellar medium. Attention is then given to a method for the quantitative study of these turbulent motions, involving the mapping of a source in an optically thin spectral line and studying the spatial correlation properties of the resulting velocity centroid map. 61 references

Características da carcaça e da carne de novilhos mantidos em pastagem de capim-marandu submetidos a diferentes estratégias de suplementação Carcass and meat traits from crossbred steers submitted to different supplementation strategies

Directory of Open Access Journals (Sweden)

Roberta Carrilho Canesin

2006-12-01

Full Text Available Este trabalho foi realizado com o objetivo de avaliar as características quantitativas e qualitativas da carcaça e da carne de 24 novilhos submetidos a três estratégias de suplementação em pastagem: SD - suplementação diária; DA - suplementação em dias alternados; e FS - suplementação oferecida de segunda à sexta-feira e suspensa aos sábados e domingos. Foram utilizados 24 bovinos mestiços (Bos indicus x Bos taurus com peso inicial de 230 kg mantidos em pastagem de Brachiaria brizantha cv. Marandu no período das águas de 2003 e nos períodos de seca e das águas de 2004, quando atingiram o peso de abate. O delineamento experimental utilizado foi o inteiramente casualizado, com três tratamentos e oito repetições. As características quantitativas e qualitativas da carcaça e da carne não foram influenciadas pelas diferentes estratégias de suplementação, mesmo quando o suplemento foi fornecido apenas em dias alternados ou quando não foi fornecido nos finais de semana. Na média, os animais apresentaram peso de abate de 468,21 kg de PV, rendimento de carcaça quente de 50,26%, área de olho-de-lombo de 59,67 cm² e espessura de gordura de 3,3 mm. A carne foi classificada como macia, com suculência e palatabilidade levemente acima da média.The objective of this trial was to evaluate quantitative and qualitative traits of carcass and meat from grazing steers submitted to one of the following three supplementation strategies: daily supplementation (DS, alternate days supplementation (AS or Monday to Friday supplementation (MFS. Twenty-four crossbred steers (Bos indicus x Bos taurus averaging 230 kg of initial body were used in a completely randomized block design (three treatments and eight replicates/treatment. Animals were maintained in pasture of Brachiaria brizantha cv. Marandu from the rainy season of 2003 to the dry and rainy seasons of 2004, when they reached the expected slaughter weight. The quantitative and

Do cattle (Bos taurus) retain an association of a visual cue with a food reward for a year?

Science.gov (United States)

Hirata, Masahiko; Takeno, Nozomi

2014-06-01

Use of visual cues to locate specific food resources from a distance is a critical ability of animals foraging in a spatially heterogeneous environment. However, relatively little is known about how long animals can retain the learned cue-reward association without reinforcement. We compared feeding behavior of experienced and naive Japanese Black cows (Bos taurus) in discovering food locations in a pasture. Experienced animals had been trained to respond to a visual cue (plastic washtub) for a preferred food (grain-based concentrate) 1 year prior to the experiment, while naive animals had no exposure to the cue. Cows were tested individually in a test arena including tubs filled with the concentrate on three successive days (Days 1-3). Experienced cows located the first tub more quickly and visited more tubs than naive cows on Day 1 (usually P visual cue with a food reward within a day and retain the association for 1 year despite a slight decay. © 2014 Japanese Society of Animal Science.

BREEDING SOUNDNESS EVALUATION OF TWO AND THREE YEAR OLD NELORE (BOS TAURUS INDICUS BULLS, RAISED UNDER PASTURE CONDITION CLASSIFICAÇÃO ANDROLÓGICA POR PONTOS (CAP DE TOUROS NELORE (Bos taurus indicus DE DOIS E TRÊS ANOS DE IDADE, CRIADOS SOB PASTEJO

Directory of Open Access Journals (Sweden)

Juliano Cesar Dias

2009-12-01

Full Text Available

Body condition and suckling as factors influencing the duration of postpartum anestrus in cattle: a review.

Science.gov (United States)

Montiel, F; Ahuja, C

2005-01-01

Prolonged postpartum anestrus is a main factor limiting reproductive efficiency in cattle, particularly in Bos indicus and Bos taurus/Bos indicus cows from tropical regions, because it prevents achievement of a 12 month calving interval. During anestrus, ovulation does not occur despite ovarian follicular development, because growing follicles do not mature. Although many factors affect postpartum anestrus, nutrition and suckling are the major factors influencing the resumption of postpartum ovarian cycles, as they affect hypothalamic, pituitary and ovarian activity and thus inhibit follicular development. Under-nutrition contributes to prolonged postpartum anestrus, particularly among cows dependent upon forages to meet their feed requirements and it apparently interacts with genetic, environmental or management factors to influence the duration of anestrus. The nutritional status or balance of an animal is evaluated through body condition score (BCS), as it reflects the body energy reserves available for metabolism, growth, lactation and activity. There is a converse relationship between energy balance and time to resumption of postpartum ovarian activity; inadequate nutrient intake results in loss of weight and BCS and finally cessation of estrous cycles. Suckling interferes with hypothalamic release of GnRH, provoking a marked suppression in pulsatile LH release, resulting in extended postpartum anestrus. The effects of suckling on regulation of tonic LH release are determined by the ability of the cow to identify a calf as her own or as unrelated. Vision and olfaction play critical roles in the development of the maternal-offspring bond, allowing the cow to identify her own calf, and abolition of both senses attenuates the negative effects of suckling on LH secretion. Thus, the maternal-offspring bond is essential for prolonged postpartum suckling-induced anovulation, and the suppressive influence of suckling is independent of neurosensory pathways within the

Factors affecting the first service conception rate of cows in smallholder dairy farms in Bangladesh.

Science.gov (United States)

Siddiqui, M A R; Das, Z C; Bhattacharjee, J; Rahman, M M; Islam, M M; Haque, M A; Parrish, J J; Shamsuddin, M

2013-06-01

The successful outcome of an insemination is a combination of both male and female fertility-linked factors. We investigated the first service conception rate of cows at artificial insemination (AI) in the smallholder dairy farms in Bangladesh. Frozen straws were prepared from ejaculates of Bos indicus (n = 7) and Bos indicus × Bos taurus (n = 7) AI bulls. Fertility was determined from 6101 first services in cows that were performed by 18 technicians in four regions between April 2004 and March 2005. Pregnancy was diagnosed by rectal palpation between 60 and 90 days post-insemination. The Asian version of Artificial Insemination Database Application (AIDA ASIA) was used for bulls-, cows- and AI-related data recording, and later retrieved for analysis. The mean ± SD number of inseminations performed from individual bulls and their conception rates were 436.0 ± 21.6 and 50.7 ± 1.9%, respectively. Logistic regression demonstrated body condition scores (BCS), heat detection signs, months of AI and their interactions had greatest effects (odds ratios: 1.24-16.65, p conception rate in cows. Fertility differed (p conception rate of 53.6%, 48.8% and 50.1%, respectively (p Conception rate between technicians ranged between 43.4% and 58.6% (p < 0.05). The days interval from calving to first service (overall mean ± SD = 153.4 ± 80.6) had relationship (p < 0.001) with BCS, months of previous calving and parity of the cows. Fertility at AI in smallholder farms can be improved by training farmers on nutrition and reproductive management of the cows. © 2012 Blackwell Verlag GmbH.

Subsurface density structure of Taurus-Littrow Valley using Apollo 17 gravity data

Science.gov (United States)

Urbancic, N.; Ghent, R.; Johnson, C. L.; Stanley, S.; Hatch, D.; Carroll, K. A.; Garry, W. B.; Talwani, M.

2017-06-01

The Traverse Gravimeter Experiment (TGE) from the Apollo 17 mission was the first and only successful gravity survey on the surface of the Moon, revealing the local gravity field at Taurus-Littrow Valley (TLV). TLV is hypothesized to be a basalt-filled graben, oriented radial to Serenitatis basin. We implemented modern 3-D modeling techniques using recent high-resolution Lunar Reconnaisance Orbiter topography and image data sets to reinvestigate the subsurface structure of TLV and constrain the volcanic and tectonic history of the region. Updated topography led to significant improvements in the accuracy of free-air, Bouguer, and terrain corrections. To determine the underlying geometry for TLV, we tested a range of possible thicknesses, dips, and wall positions for the graben fill. We found that the thickness and position previously determined by Talwani et al. (1973) represent our preferred model for the data, but with walls with dips of 30°, rather than 90°. We found large model misfits due to unmodeled 3-D structure and density anomalies, as well as parameter trade-offs. We performed a sensitivity analysis to quantify the parameter trade-offs in an ideal future survey, assuming dominantly 2-D geological structure. At the TGE survey noise level (2.5 mGal), the fill thickness was constrained to ±150 m, the wall angle to ±5∘20∘ and the wall positions to ±1 km of the preferred model. This information can be used to inform the design of future lunar gravimetry experiments in regions similar to TLV.

Altas concentrações de FSH-p na maturação in vitro de oócitos Bos indicus High concentrations of FSH-p on the in vitro maturation of Bos indicus oocytes

Directory of Open Access Journals (Sweden)

Joana D'Arc Rocha Alves

2001-08-01

Full Text Available O objetivo deste trabalho foi avaliar a eficiência de diferentes concentrações de um FSH-p comercial sobre a maturação nuclear de oócitos Bos indicus, clivagem e desenvolvimento in vitro de embriões até estádios de blastocisto. Após seleção e transferência para o meio TCM 199/HEPES suplementado com diferentes concentrações de FSH-p (T1 = 10mg/m ; T2 = 20mg/m ; T3 = 40mg/m, os oócitos foram incubados, durante 24 horas, a 39ºC em atmosfera úmida contendo 5% de CO2. Parte dos oócitos foram retirados para análise da maturação nuclear e os demais foram transferidos para o meio de fecundação (mDM. Após 18 horas de incubação nas mesmas condições atmosféricas mencionadas para os oócitos, os presumíveis zigotos foram distribuídos no meio de desenvolvimento embrionário (KSOM contendo monocamada de células da granulosa. As porcentagens de metáfase II, de clivagem e de blastocisto foram, respectivamente, de 81,8/62,5/17,6% (T1; 55,6/64,0/19,5% (T2 e 50,0/65,0/16,3% (T3. A análise estatística revelou que uma menor porcentagem (P £ 0,05 de oócitos tratados com 20mg/m e 40mg/m de FSH-p alcançou o estádio de metáfase II e que as taxas de clivagem e blastocisto não diferiram (P ³ 0,05 entre os tratamentos. Os resultados permitem concluir que a adição de 20mg/m e 40mg/m de FSH-p ao meio de cultura interfere no processo de maturação nuclear, mas todas as concentrações testadas podem ser utilizadas sem prejuízo aparente para a clivagem e o posterior desenvolvimento embrionário.The aim of this work was to evaluate the efficiency of different concentrations of a commercial FSH-p on the nuclear maturation of Bos indicus oocytes, cleavage and in vitro development of embryos until blastocyst stages. The oocytes were selected and transferred to the maturation medium (TCM 199/25 mM HEPES supplemented with different concentrations of FSH-p (T1 = 10mg/m ; T2 - 20mg/m ; T3 - 40mg/m and after 24 hours of incubation, at 39º

Cattle Tick Rhipicephalus microplus-Host Interface: A Review of Resistant and Susceptible Host Responses

Directory of Open Access Journals (Sweden)

Ala E. Tabor

2017-12-01

Full Text Available Ticks are able to transmit tick-borne infectious agents to vertebrate hosts which cause major constraints to public and livestock health. The costs associated with mortality, relapse, treatments, and decreased production yields are economically significant. Ticks adapted to a hematophagous existence after the vertebrate hemostatic system evolved into a multi-layered defense system against foreign invasion (pathogens and ectoparasites, blood loss, and immune responses. Subsequently, ticks evolved by developing an ability to suppress the vertebrate host immune system with a devastating impact particularly for exotic and crossbred cattle. Host genetics defines the immune responsiveness against ticks and tick-borne pathogens. To gain an insight into the naturally acquired resistant and susceptible cattle breed against ticks, studies have been conducted comparing the incidence of tick infestation on bovine hosts from divergent genetic backgrounds. It is well-documented that purebred and crossbred Bos taurus indicus cattle are more resistant to ticks and tick-borne pathogens compared to purebred European Bos taurus taurus cattle. Genetic studies identifying Quantitative Trait Loci markers using microsatellites and SNPs have been inconsistent with very low percentages relating phenotypic variation with tick infestation. Several skin gene expression and immunological studies have been undertaken using different breeds, different samples (peripheral blood, skin with tick feeding, infestation protocols and geographic environments. Susceptible breeds were commonly found to be associated with the increased expression of toll like receptors, MHC Class II, calcium binding proteins, and complement factors with an increased presence of neutrophils in the skin following tick feeding. Resistant breeds had higher levels of T cells present in the skin prior to tick infestation and thus seem to respond to ticks more efficiently. The skin of resistant breeds also

Characterization of potent odorants in male giant water bug (Lethocerus indicus Lep. and Serv.), an important edible insect of Southeast Asia.

Science.gov (United States)

Kiatbenjakul, Patthamawadi; Intarapichet, Kanok-Orn; Cadwallader, Keith R

2015-02-01

Potent odorants in frozen fresh (FFB) and salted boiled (SBB) male giant water bugs (Lethocerus indicus), or 'Maengdana' in Thai, were characterized by application of direct solvent extraction/solvent-assisted flavour evaporation (SAFE), gas chromatography-mass spectrometry (GC-MS), gas chromatography-olfactometry (GC-O), aroma extract dilution analysis (AEDA) and stable isotope dilution assays (SIDA). Twenty and 27 potent odorants were detected in FFB and SBB, respectively. Most odorants were lipid-derived compounds, including the two most abundant volatile components (E)-2-hexenyl acetate and (E)-2-hexenyl butanoate, which contributed banana-like odours. 2-Acetyl-1-pyrroline and 2-acetyl-2-thiazoline, responsible for popcorn-like odours, were detected in SBB only. An aroma reconstitution model of SBB was constructed in an oil-in-water emulsion matrix using 12 selected potent odorants based on the results of AEDA, accurate compound quantification and the calculated odour-activity values (OAV). Omission studies were carried out to verify the significance of esters, particularly (E)-2-hexenyl acetate was determined to be an important character-impact odorant in male giant water bug aroma. Copyright © 2014 Elsevier Ltd. All rights reserved.

Molecular characterization of Cryptosporidium spp. in calves (Bos taurus and Bos indicus in the Formiga city, Minas Gerais - Brazil

Directory of Open Access Journals (Sweden)

Roberto César Araujo Lima

2014-02-01

Full Text Available Cryptosporidiosis is a waterborne disease, has as aggravating the difficulty of preventing environmental contamination and lack of effective therapeutic measures. With marked importance to the cattle, causes inflammation and intestinal villous atrophy resulting in loss of absorptive surface. This study aimed to perform molecular characterization of Cryptosporidium spp. in calves in the city of Formiga, Minas Gerais. A total of 300 faeces samples from Holstein calves, Nelore and indefinite breed, both healthy, were evaluated by negative contrast staining technique of malachite green and through the reaction of nested PCR for amplification of DNA fragments of the 18S subunit of the RNA gene ribosomal. Occurrence of 5.33 % ( 16/300 for malachite green and 4.66 % ( 14/300 by PCR was observed, whereas no correlation was found between positive and variables studied. Through molecular characterization were identified Cryptosporidium andersoni and Cryptosporidium ryanae species. In conclusion, we observed a low incidence of infection and elimination of Cryptosporidium spp. oocysts, the absence of clinical signs in animals, strong agreement between the results obtained by the two techniques. Beyond, with the molecular characterization ( nested PCR , species of C. andersoni and C. ryanae were diagnosed in age groups not present in the literature. These two species of Cryptosporidium are described above for the first time parasitizing cattle in the state of Minas Gerais.

Mutagenic Potential ofBos taurus Papillomavirus Type 1 E6 Recombinant Protein: First Description

Directory of Open Access Journals (Sweden)

Rodrigo Pinheiro Araldi

2015-01-01

Full Text Available Bovine papillomavirus (BPV is considered a useful model to study HPV oncogenic process. BPV interacts with the host chromatin, resulting in DNA damage, which is attributed to E5, E6, and E7 viral oncoproteins activity. However, the oncogenic mechanisms of BPV E6 oncoprotein per se remain unknown. This study aimed to evaluate the mutagenic potential of Bos taurus papillomavirus type 1 (BPV-1 E6 recombinant oncoprotein by the cytokinesis-block micronucleus assay (CBMNA and comet assay (CA. Peripheral blood samples of five calves were collected. Samples were subjected to molecular diagnosis, which did not reveal presence of BPV sequences. Samples were treated with 1 μg/mL of BPV-1 E6 oncoprotein and 50 μg/mL of cyclophosphamide (positive control. Negative controls were not submitted to any treatment. The samples were submitted to the CBMNA and CA. The results showed that BPV E6 oncoprotein induces clastogenesis per se, which is indicative of genomic instability. These results allowed better understanding the mechanism of cancer promotion associated with the BPV E6 oncoprotein and revealed that this oncoprotein can induce carcinogenesis per se. E6 recombinant oncoprotein has been suggested as a possible vaccine candidate. Results pointed out that BPV E6 recombinant oncoprotein modifications are required to use it as vaccine.

Efficacy of Mycobacterium indicus pranii immunotherapy as an adjunct to chemotherapy for tuberculosis and underlying immune responses in the lung.

Directory of Open Access Journals (Sweden)

Ankan Gupta

Full Text Available BACKGROUND: The 9-month-long chemotherapy of tuberculosis often results in poor compliance and emergence of drug-resistant strains. So, improved therapeutic strategy is urgently needed. Immunotherapy could be beneficial for the effective management of the disease. Previously we showed the protective efficacy of Mycobacterium indicus pranii (MIP when given as prophylactic vaccine in animal models of tuberculosis. METHODS: We sought to investigate whether MIP can be used as an adjunct to the chemotherapy in guinea pig models of tuberculosis. Efficacy of MIP was evaluated when given subcutaneously or by aerosol. RESULTS: MIP-therapy as an adjunct to the chemotherapy was found to be effective in accelerating bacterial killing and improving organ pathology. MIP-immunotherapy resulted in higher numbers of activated antigen-presenting cells and lymphocytes in the infected lungs and also modulated the granulomatous response. Early increase in protective Th1 immune response was observed in the immunotherapy group. Following subsequent doses of MIP, decrease in the inflammatory response and increase in the immunosuppressive response was observed, which resulted in the improvement of lung pathology. CONCLUSION: MIP immunotherapy is a valuable adjunct to chemotherapy for tuberculosis. Aerosol route of immunotherapy can play a crucial role for inducing immediate local immune response in the lung.

Pulsed electric field processing of functional drink based on tender coconut water (Cococus nucifera L. - nannari (Hemidesmus indicus blended beverage

Directory of Open Access Journals (Sweden)

R. Kumar

2014-01-01

Full Text Available Tender coconut water (Cocos nucifera L. Nannari extract (Hemidesmus indicus L. ready-to serve (RTS blended beverage were optimised. Response Surface Methodology (RSM was employed to optimize the levels of independent variables (levels of tender coconut water, nannari extract and sugar. The responses of pH, ºBrix, CIE colour (L*, a* and b* value and OAA were studied. The data obtained were analysed by multiple regression technique to generate suitable mathematical models. The developed blended beverage was processed using pulsed electric field (PEF with electric field 31.2 kV/cm, 20 pulse widths at 100 Hz frequency to minimise nutritional and sensory attributes losses and compared with conventional thermal pasteurization (96 ºC for 360 s with p-value of 8.03. Thermal pasteurization showed a significant (p<0.05 decrease in colour value, radical scavenging activity and overall acceptability after treatment and also during storage, when compared to PEF treated tender coconut water-nannari blended beverage. PEF treatment also achieved a 3.01 ± 0.69 log inactivation, similar to thermal pasteurization of native micro flora. PEF treated tender coconut water-nannari blended beverage was stable up to 120 days under ambient storage condition (27-30 °C.

PCR diagnosis of tick-borne pathogens in Maharashtra state, India indicates fitness cost associated with carrier infections is greater for crossbreed than native cattle breeds.

Directory of Open Access Journals (Sweden)

Sunil W Kolte

Full Text Available Tick-borne pathogens (TBP are responsible for significant economic losses to cattle production, globally. This is particularly true in countries like India where TBP constrain rearing of high yielding Bos taurus, as they show susceptibility to acute tick borne disease (TBD, most notably tropical theileriosis caused by Theileria annulata. This has led to a programme of cross breeding Bos taurus (Holstein-Friesian or Jersey with native Bos indicus (numerous breeds to generate cattle that are more resistant to disease. However, the cost to fitness of subclinical carrier infection in crossbreeds relative to native breeds is unknown, but could represent a significant hidden economic cost. In this study, a total of 1052 bovine blood samples, together with associated data on host type, sex and body score, were collected from apparently healthy animals in four different agro-climatic zones of Maharashtra state. Samples were screened by PCR for detection of five major TBPs: T. annulata, T. orientalis, B. bigemina, B. bovis and Anaplasma spp.. The results demonstrated that single and co-infection with TBP are common, and although differences in pathogen spp. prevalence across the climatic zones were detected, simplistic regression models predicted that host type, sex and location are all likely to impact on prevalence of TBP. In order to remove issues with autocorrelation between variables, a subset of the dataset was modelled to assess any impact of TBP infection on body score of crossbreed versus native breed cattle (breed type. The model showed significant association between infection with TBP (particularly apicomplexan parasites and poorer body condition for crossbreed animals. These findings indicate potential cost of TBP carrier infection on crossbreed productivity. Thus, there is a case for development of strategies for targeted breeding to combine productivity traits with disease resistance, or to prevent transmission of TBP in India for economic

PCR diagnosis of tick-borne pathogens in Maharashtra state, India indicates fitness cost associated with carrier infections is greater for crossbreed than native cattle breeds.

Science.gov (United States)

Kolte, Sunil W; Larcombe, Stephen D; Jadhao, Suresh G; Magar, Swapnil P; Warthi, Ganesh; Kurkure, Nitin V; Glass, Elizabeth J; Shiels, Brian R

2017-01-01

Tick-borne pathogens (TBP) are responsible for significant economic losses to cattle production, globally. This is particularly true in countries like India where TBP constrain rearing of high yielding Bos taurus, as they show susceptibility to acute tick borne disease (TBD), most notably tropical theileriosis caused by Theileria annulata. This has led to a programme of cross breeding Bos taurus (Holstein-Friesian or Jersey) with native Bos indicus (numerous) breeds to generate cattle that are more resistant to disease. However, the cost to fitness of subclinical carrier infection in crossbreeds relative to native breeds is unknown, but could represent a significant hidden economic cost. In this study, a total of 1052 bovine blood samples, together with associated data on host type, sex and body score, were collected from apparently healthy animals in four different agro-climatic zones of Maharashtra state. Samples were screened by PCR for detection of five major TBPs: T. annulata, T. orientalis, B. bigemina, B. bovis and Anaplasma spp.. The results demonstrated that single and co-infection with TBP are common, and although differences in pathogen spp. prevalence across the climatic zones were detected, simplistic regression models predicted that host type, sex and location are all likely to impact on prevalence of TBP. In order to remove issues with autocorrelation between variables, a subset of the dataset was modelled to assess any impact of TBP infection on body score of crossbreed versus native breed cattle (breed type). The model showed significant association between infection with TBP (particularly apicomplexan parasites) and poorer body condition for crossbreed animals. These findings indicate potential cost of TBP carrier infection on crossbreed productivity. Thus, there is a case for development of strategies for targeted breeding to combine productivity traits with disease resistance, or to prevent transmission of TBP in India for economic benefit.

Ultrasonographic measurement of fetal growth parameters over three successive pregnancies in a captive Malayan tapir (Tapirus indicus).

Science.gov (United States)

Hoyer, M J; van Engeldorp Gastelaars, H M D

2014-01-01

This study was conducted to establish representative curves that allow evaluation of fetal growth and estimation of gestational age from measurement of fetal structures by ultrasound in Malayan tapirs (Tapirus indicus). Three pregnancies (i.e. 3 fetuses) were examined in one female Malayan tapir. Transabdominal ultrasonographic examination was performed without anesthesia from 79 ± 8 days to 281 ± 48 days (mean ± S.D.) post mating. To assess fetal growth attempts were made to measure biparietal diameter (BPD), head length (HL), thorax diameter A (TDA), thorax height A (THA), thorax diameter B (TDB), thorax height B (THB), abdomen diameter (AD), abdomen height (AH), humerus length (HUL) and Crown rump length (CRL). The value of each parameter as an estimator of gestational age was assessed by ease of observation and the length of time the parameter was measurable throughout gestation. The most precise predictors for gestational age in this study were BPD and CRL (weeks 10-20 of gestation), as well as AD and AH (weeks 14-43 of gestation). The parameters TDB, THB and HUL (weeks 15-41 of gestation) gave almost as good predictions. Fetal viability was assessed by identifying a fetal heartbeat and movement. All pregnancies resulted in normal deliveries and healthy offspring. The ultrasound examination was well tolerated by the female. The gestation lengths (399 ± 3 days) were within reported ranges. The serial transabdominal ultrasound, without the need for anesthesia, was an effective method to evaluate fetal growth, development and well being in a Malayan tapir. © 2014 Wiley Periodicals, Inc.

Effect of high pressure treatment on microbiological quality of Indian white prawn (Fenneropenaeus indicus) during chilled storage.

Science.gov (United States)

Ginson, J; Panda, Satyen Kumar; Bindu, J; Kamalakanth, C K; Srinivasa Gopal, T K

2015-04-01

High pressure treatment of 250 MPa for 6 min at 25 °C was applied to headless Indian white prawn (Fenneropenaeus indicus) to evaluate changes in microbiological characteristics of the species during chilled storage. Changes in load of mesophilic bacteria, psychrotrophic bacteria, proteolytic bacteria, Enterobacteriaceae, Pseudomonas spp., H2S producing bacteria, lactic acid bacteria, Brochothrix thermosphacta and yeast & mold were estimated in pressurized and un-pressurized samples during chilled storage. All microbes were reduced significantly after high pressure treatment and there was significant difference in microbial quality of control and high pressure treated samples in the entire duration of chilled storage (p high pressure treated samples. In high pressure treated sample, no lag phase (λ) was observed for psychrotrophic bacteria, H2S producing bacteria, B. thermosphacta, Pseudomonas spp. and lactic acid bacteria; however, other bacteria showed a reduced lag phase during chilled storage. Kinetic parameter such as specific growth rate (μmax) in high pressure treated samples was significantly reduced in most of the bacterial groups except for psychrotrophic bacteria, Enterobacteriaceae and lactic acid bacteria. Mesophilic bacterial count of control samples crossed the marginal limit of acceptability on 12th day and unacceptable limit on 18th day of storage, whereas high pressure treated samples never breached the acceptability limit during entire duration of chilled storage. The present study indicated that application of high pressure processing can be used to improve microbial quality of Indian white prawn and extend the chilled storage life. Copyright © 2014 Elsevier Ltd. All rights reserved.

South-East Asia bovine populations and the Japanese cattle breeds do not harbour the E211K variant of the PRNP

Directory of Open Access Journals (Sweden)

George Msalya

2014-02-01

Full Text Available An important outcome of intensive worldwide Bovine spongiform encephalopathy (BSE obtained with the surveillance by The National Creutzfeldt-Jakob Disease Surveillance Unit (http://www.cjd.ed.ac.uk/figures. htm, has been the detection of atypical BSE in cattle. The discovery of a prion protein gene (PRNP E211K variant in an atypical BSE case is particularly remarkable because it is analogous to the most common pathogenic mutation in humans (E200K, which causes hereditary Creutzfeldt-Jakob disease (CJD. Knowledge of the distribution and frequency of PRNP E211K variants in cattle populations is critical for understanding and managing atypical BSE. This study was carried out to investigate the prevalence of the E211K variant in the South-East Asia bovine populations and in the Japanese cattle breeds. It was discovered that E211K variant was monomorphic for a G allele and the GG genotype in the 745 animals analyzed in this study. Therefore, neither the Bos indicus nor the Bos taurus animals analyzed are presently known to harbor the 211K variant predicting that the number of carriers for this variant will also be vanishingly low.

Quantitative trait loci (QTL mapping for growth traits on bovine chromosome 14

Directory of Open Access Journals (Sweden)

Marcelo Miyata

2007-03-01

Full Text Available Quantitative trait loci (QTL mapping in livestock allows the identification of genes that determine the genetic variation affecting traits of economic interest. We analyzed the birth weight and weight at 60 days QTL segregating on bovine chromosome BTA14 in a F2 resource population using genotypes produced from seven microsatellite markers. Phenotypes were derived from 346 F2 progeny produced from crossing Bos indicus Gyr x Holstein Bos taurus F1 parents. Interval analysis to detect QTL for birth weight revealed the presence of a QTL (p < 0.05 at 1 centimorgan (cM from the centromere with an additive effect of 1.210 ± 0.438 kg. Interval analysis for weight at 60 days revealed the presence of a QTL (p < 0.05 at 0 cM from the centromere with an additive effect of 2.122 ± 0.735 kg. The region to which the QTL were assigned is described in the literature as responsible for some growth traits, milk yield, milk composition, fat deposition and has also been related to reproductive traits such as daughter pregnancy rate and ovulation rate. The effects of the QTL described on other traits were not investigated.

Revisiting the field geology of Taurus-Littrow

Science.gov (United States)

Schmitt, H. H.; Petro, N. E.; Wells, R. A.; Robinson, M. S.; Weiss, B. P.; Mercer, C. M.

2017-12-01

Integration of Apollo 17 field observations and photographs, sample investigations, Lunar Reconnaissance Orbiter Camera images, Chandrayaan-1 Moon Mineralogy Mapper (M3) spectra, and Miniature Radio Frequency (Mini-RF) S-band radar images provides new insights into the geology of the valley of Taurus-Littrow on the Moon. Connecting the various remote observations to sample data enables a set of new conclusions to be drawn regarding the geological evolution of the valley. Structural considerations and published and recalculated 40Ar/39Ar analyses of samples from the North Massif and the Sculptured Hills indicate that the Crisium basin formed about 3.93 Ga; the Serenitatis basin about 3.82 Ga; and the Imbrium basin no earlier than 3.82 Ga and no later than the average of 3.72 Ga for 33 age dates from samples of the valley's mare basalts. Strong evidence continues to support the conclusion of others (Lucchitta, 1972; Spudis et al., 2011; Fassett et al., 2012) that the Sculptured Hills physiographic unit consists of Imbrium ejecta. Interpretation of M3 spectral data and Apollo 17 samples indicate that rock units of the Sculptured Hills consist of a largely coherent, Mg-suite pluton. LROC NAC stereo images and Mini-RF data indicate the presence of several exposed pyroclastic fissures across the Sculptured Hills. Rim boulders at Camelot Crater constitute nearly in situ wall rocks of that crater rather than ejecta and provide an opportunity for investigations of remanent magnetic field orientation at the time of the eruption of late mare basalt lavas in the valley. Paleomagnetic field orientation information also may be obtained relative to melt-breccia contacts in North Massif boulders that suggest original horizontal orientations. LROC images indicate the existence of two temporally separate light mantle avalanche deposits. The origin, potential flow mechanisms, and geology of the youngest avalanche from the South Massif have been clarified. The existence of two

Revisiting the Field Geology of Taurus-Littrow

Science.gov (United States)

Schmitt, H. H.; Petro, N. E.; Wells, R. A.; Robinson, M. S.; Weiss, B. P.; Mercer, C. M.

2016-01-01

Integration of Apollo 17 field observations and photographs, sample investigations, Lunar Reconnaissance Orbiter Camera images, Chandrayaan-1 Moon Mineralogy Mapper (M(sup 3)) spectra, and Miniature Radio Frequency (Mini-RF) S-band radar images provides new insights into the geology of the valley of Taurus-Littrow on the Moon. Connecting the various remote observations to sample data enables a set of new conclusions to be drawn regarding the geological evolution of the valley. Structural considerations and published and recalculated Ar-40/Ar-39 analyses of samples from the North Massif and the Sculptured Hills indicate that the Crisium basin formed about 3.93 Ga; the Serenitatis basin about 3.82 Ga; and the Imbrium basin no earlier than 3.82 Ga and no later than the average of 3.72 Ga for 33 age dates from samples of the valley's mare basalts. Strong evidence continues to support the conclusion of others (Lucchitta, 1972; Spudis et al., 2011; Fassett et al., 2012) that the Sculptured Hills physiographic unit consists of Imbrium ejecta. Interpretation of M(sup 3) spectral data and Apollo 17 samples indicate that rock units of the Sculptured Hills consist of a largely coherent, Mg-suite pluton. LROC NAC stereo images and Mini-RF data indicate the presence of several exposed pyroclastic fissures across the Sculptured Hills. Rim boulders at Camelot Crater constitute nearly in situ wall rocks of that crater rather than ejecta and provide an opportunity for investigations of remanent magnetic field orientation at the time of the eruption of late mare basalt lavas in the valley. Paleomagnetic field orientation information also may be obtained relative to melt-breccia contacts in North Massif boulders that suggest original horizontal orientations. LROC images indicate the existence of two temporally separate light mantle avalanche deposits. The origin, potential flow mechanisms, and geology of the youngest avalanche from the South Massif have been clarified. The existence

GENERAL ASPECTS OF BODY MEASURES, WEIGHT AND SCORE CONDITION FEMALE NELORE BREED (Bos taurus indicus ON THE PERIOD OF 12 MONTHS ESTUDIO DE MEDIDAS CORPORALES, PESO VIVO Y CONDICIÓN CORPORAL DE BOVINOS HEMBRAS DE LA RAZA NELORE (Bos taurus indicus POR 12 MESES ESTUDO DE MEDIDAS CORPORAIS, PESO VIVO E CONDIÇÃO CORPORAL DE FÊMEAS DA RAÇA NELORE (Bos taurus indicus AO LONGO DE 12 MESES

Directory of Open Access Journals (Sweden)

Arcádio de Los Reys Borjas

2008-04-01

Full Text Available Four hundred and eighty cattle were used to verify alterations and correlations among corporal measures in Nelore zebu herd with cows and heifers. Body weight and length, corporal condition, heart girth, withers height and hip measures were evaluated. Eight collections were accomplished along the months of October of 2002 and October of 2003. In heifers there was increase of the averages of corporal measures with significant difference (p <0,05 among collections only the heart girth was different (p <0,05 in cows. The relationship between the body weight and body condition with the time were quadratic parallel curves (p <0,001. There were correlations among lineal measures body with hip measures (p<0,001 except for heart girth with hip length. The correlations of body weight and body condition among body measures were significant (p<0,001 except body condition with hip length in cows. It could be concluded that there was a growing variation of the body measures in heifers in the experimental period. The body weight, the body condition and heart girth were related with different periods of the year that the evaluation was accomplished. In cows the variations along the year were of 14,79%, 31,53% and 6,74%, respectively. The isquiun – iliun external measures, as height and width were correlated with size measures and weight. The body weight and body condition in heifers behave in way similar to cows. Further researches in relationship among body measures, body weight and body condition with productive and reproductive aspect are necessary. Con el objetivo de verificar alteraciones y correlaciones entre medidas corporales en un rebaño bovino de vaquillonas y vacas de la raza Nelore. Evaluaron-se 487 hembras en peso vivo, condición corporal, perímetro toráxico, largura corporal, altura de la cruz y medidas da anca. Fueron realizadas ocho coletas a lo largo de los meses de octubre de 2002 y octubre de 2003. En las vaquillonas hubo un aumento de las medidas corporales (p<0,05 entre colectas. Para las vacas el perímetro toráxico presentó diferencia significativa (p<0,05. La relación entre peso vivo condición corporal con el tiempo mostró ecuación cuadrática y fueron parecidas y paralelas para a condición corporal. En el peso vivo, la parte cóncava de la curva para las vacas fue mas abierta comparada a las de vaquillonas. Los coeficientes de correlación entre medidas corporales lineares con las medidas de la anca fueron elevadas (p<0,001, excepto para el perímetro toráxico con largura de la anca. Las correlaciones del peso vivo y condición corporal con medidas corporales fueron significativas (p<0,001, excepto para la condición corporal con la largura de la anca en las categorías; condición corporal versus altura de la anca y peso vivo con largura de la anca para las vacas. Como conclusiones de este trabajo: hubo una variación creciente de las medidas corporales en las vaquillonas en el período de las colecta. El peso vivo, la condición corporal y perímetro toráxico estuvieron relacionados con diferentes períodos del ano que fue realizada el experimento. En vacas las variações a lo largo de año fueron de 14,79%, 31,53% e 6,74%, respectivamente. Las medidas externas ísquio-iliacas, como altura e largura, estuvieron correlacionadas con medidas de tamaño y peso. Vaquillonas en fase de crecimiento tuvieron un comportamiento de forma análoga a las vacas con respecto al peso vivo y condición corporal. Mas investigaciones serian necesarias de las relaciones de las medidas corporales, peso vivo y condición corporal con los aspectos productivos e reproductivos. RESUMO – Objetivou-se verificar alterações e correlações entre medidas corporais em rebanho bovino de novilhas e vacas da raça Nelore. Avaliaram-se 487 fêmeas, quanto ao peso vivo, condição corporal, perímetro torácico, comprimento corporal, altura de cernelha e medidas da garupa. Foram realizadas oito coletas ao longo dos meses de outubro de 2002 e outubro de 2003. Nas novilhas houve aumento das médias de medidas corporais com diferença significativa (p<0,05 entre coletas. Para vacas o perímetro torácico apresentou diferença significativa (p<0,05. Na análise quadrática do peso vivo e condição corporal, as curvas se assemelharam, de maneira paralela para a condição corporal. Quanto ao peso vivo, a parte côncava da curva para vacas foi mais aberta comparada às novilhas. Coeficientes de correlação entre medidas lineares com medidas de garupa apresentaram significância (p<0,001, exceto para perímetro torácico com comprimento de garupa. Nas correlações do peso vivo e condição corporal com medidas corporais foram significativas (p<0,001, exceto para condição corporal versus comprimento de garupa nas categorias; condição corporal versus altura de garupa e peso vivo versus comprimento de garupa para vacas. Pode-se concluir que houve uma variação crescente das medidas corporais nas novilhas no período de coleta. O peso vivo, a condição corporal e perímetro torácico estiveram relacionados com diferentes períodos do ano que foi realizada a avaliação. Em vacas as variações ao longo do ano foram de 14,79%, 31,53% e 6,74%, respectivamente. As medidas externas ísquio-iliacas, como altura e largura, estão correlacionadas com medidas de tamanho e peso. Fêmeas em fase de crescimento comportam-se de maneira análoga às fêmeas adultas quanto ao peso vivo e condição corporal. Pesquisas da relação das medidas corporais, peso vivo e condição corporal com o aspecto produtivo e reprodutivo são necessários.

Nuclear and mitochondrial DNA reveals isolation of imperilled grey nurse shark populations (Carcharias taurus).

Science.gov (United States)

Ahonen, H; Harcourt, R G; Stow, A J

2009-11-01

Loss of sharks and other upper-trophic marine predators has sparked worldwide concern for the stability of ocean ecosystems. The grey nurse (ragged-tooth or sand tiger) shark (Carcharias taurus) is Vulnerable on a global scale, Critically Endangered in Australia and presumed extinct in parts of its historical range. We used 193 muscle and fin samples collected from six extant populations to assess global mtDNA and microsatellite diversity and the degree of global population genetic structure. Control region mtDNA diversity was low in every population, and two populations (eastern Australia and Japan) contained only a single mtDNA haplotype. Genetic signatures of recent losses of genetic variation were not yet apparent at microsatellite loci, indicating that this low mtDNA variation is not a result of anthropogenic population declines. Population differentiation was substantial between each population pair except Brazil and South Africa, F(ST) values ranged from 0.050 to 0.699 and 0.100 to 1.00 for microsatellite and mitochondrial data respectively. Bayesian analysis clearly partitioned individuals into five of the populations from which they were sampled. Our data imply a low frequency of immigrant exchange among each of these regions and we suggest that each be recognized as a distinct evolutionary significant unit. In contrast to pelagic species such as whale shark and white shark that may cross ocean basins and where cooperative international efforts are necessary for conservation, grey nurse shark, like many coastal species, need to be managed regionally.

The embedded young stars in the Taurus-Auriga molecular cloud. II - Models for scattered light images

Science.gov (United States)

Kenyon, Scott J.; Whitney, Barbara A.; Gomez, Mercedes; Hartmann, Lee

1993-01-01

We describe NIR imaging observations of embedded young stars in the Taurus-Auriga molecular cloud. We find a large range in J-K and H-K colors for these class I sources. The bluest objects have colors similar to the reddest T Tauri stars in the cloud; redder objects lie slightly above the reddening line for standard ISM dust and have apparent K extinctions of up to 5 mag. Most of these sources also show extended NIR emission on scales of 10-20 arcsec which corresponds to linear sizes of 1500-3000 AU. The NIR colors and nebular morphologies for this sample and the magnitude of linear polarization in several sources suggest scattered light produces most of the NIR emission in these objects. We present modeling results that suggest mass infall rates that agree with predictions for cold clouds and are generally consistent with rates estimated from radiative equilibrium models. For reasonable dust grain parameters, the range of colors and extinctions require flattened density distributions with polar cavities evacuated by bipolar outflows. These results support the idea that infall and outflow occur simultaneously in deeply embedded bipolar outflow sources. The data also indicate fairly large centrifugal radii and large inclinations to the rotational axis for a typical source.

A RESOLVED CENSUS OF MILLIMETER EMISSION FROM TAURUS MULTIPLE STAR SYSTEMS

International Nuclear Information System (INIS)

Harris, Robert J.; Andrews, Sean M.; Wilner, David J.; Kraus, Adam L.

2012-01-01

We present a high angular resolution millimeter-wave dust continuum imaging survey of circumstellar material associated with the individual components of 23 multiple star systems in the Taurus-Auriga young cluster. Combined with previous measurements in the literature, these new data permit a comprehensive look at how the millimeter luminosity (a rough tracer of disk mass) relates to the separation and mass of a stellar companion. Approximately one-third (28%-37%) of the individual stars in multiple systems have detectable millimeter emission, an incidence rate half that for single stars (∼62%) which does not depend on the number of companions. There is a strong, positive correlation between the luminosity and projected separation (a p ) of a stellar pair. Wide pairs (a p > 300 AU) have a similar luminosity distribution as single stars, medium pairs (a p ≈ 30-300 AU) are a factor of five fainter, and close pairs (a p < 30 AU) are ∼5× fainter yet (aside from a small, but notable population of bright circumbinary disks). In most cases, the emission is dominated by a disk around the primary (or a wide tertiary in hierarchical triples), but there is no clear relationship between luminosity and stellar mass ratio. A direct comparison of resolved disk sizes with predictions from tidal truncation models yields mixed results; some disks are much larger than expected given the projected distances of their companions. We suggest that the presence of a stellar companion impacts disk properties at a level comparable to the internal evolution mechanisms that operate in an isolated system, with both the multiple star formation process itself and star-disk tidal interactions likely playing important roles in the evolution of circumstellar material. From the perspective of the mass content of the disk reservoir, we expect that (giant) planet formation is inhibited around the components of close pairs or secondaries, but should be as likely as for single stars around the

Good genes and sexual selection in dung beetles (Onthophagus taurus: genetic variance in egg-to-adult and adult viability.

Directory of Open Access Journals (Sweden)

Francisco Garcia-Gonzalez

2011-01-01

Full Text Available Whether species exhibit significant heritable variation in fitness is central for sexual selection. According to good genes models there must be genetic variation in males leading to variation in offspring fitness if females are to obtain genetic benefits from exercising mate preferences, or by mating multiply. However, sexual selection based on genetic benefits is controversial, and there is limited unambiguous support for the notion that choosy or polyandrous females can increase the chances of producing offspring with high viability. Here we examine the levels of additive genetic variance in two fitness components in the dung beetle Onthophagus taurus. We found significant sire effects on egg-to-adult viability and on son, but not daughter, survival to sexual maturity, as well as moderate coefficients of additive variance in these traits. Moreover, we do not find evidence for sexual antagonism influencing genetic variation for fitness. Our results are consistent with good genes sexual selection, and suggest that both pre- and postcopulatory mate choice, and male competition could provide indirect benefits to females.

Effects of 12 hour calf withdrawal on conception rate and calf performance of Bos indicus cattle under extensive conditions.

Science.gov (United States)

Escrivão, R J A; Webb, E C; Garcês, A P J T

2009-01-01

Fifty-two multiparous Brahman type cows with reproductive tract scoring (RTS) >/=4 at 45 days post-partum were randomly assigned to two groups of 26 cows each separated into an ad libitum suckling group (C) and treatment group (T). Calves in the T group were separated for 12 h during the night from 45 days post-partum to the onset of the breeding season. Body condition score (BCS) and body weight (BW) were recorded 45 days post-partum, at the start of the breeding season, and at pregnancy diagnosis. Calves were weighed at calving and weaning. Weaning weights were corrected to 205 days. BW and BCS at the onset of the breeding season were similar (p > 0.05) between the experimental groups. Calving to breeding intervals were 93 +/- 18 d and 99 +/- 22 d for T and C groups, respectively. Calving to conception intervals differed significantly between the groups (111 +/- 10 d for T and 133 +/- 19 d for C) and a similar result was obtained for the breeding to conception intervals (18 +/- 15 d for T and 31 +/- 19 d for C). Conception rates were 80% for the T group and 59% for the C group, which correlated better with BW than BCS at the onset of the breeding season. Weaning weights differed (p conception rates and improves the calf weaning weights of Bos indicus beef cattle under extensive production systems in sub-tropical conditions.

Electrical conductivity modification using silver nano particles of Jatropha Multifida L. and Pterocarpus Indicus w. extracts films

Energy Technology Data Exchange (ETDEWEB)

Diantoro, Markus, E-mail: markus.diantoro.fmipa@um.ac.id; Hidayati, Nisfi Nahari Sani; Latifah, Rodatul; Fuad, Abdulloh; Nasikhudin,; Sujito,; Hidayat, Arif [Department of Physics, Faculty of Mathematics and Natural Science, Universitas Negeri Malang, Jl. Semarang 5 Malang 65145 (Indonesia)

2016-03-11

Natural polymers can be extracted from leaf or stem of plants. Pterocarpus Indicus W. (PIW) and Jatropha Multifida L. (JIL) plants are good candidate as natural polymer sources. PIW and JIW polymers contain chemical compound so-called flavonoids which has C{sub 6}-C{sub 3}-C{sub 6} carbons conjugated configuration. The renewable type of polymer as well as their abundancy of flavonoid provide us to explore their physical properties. A number of research have been reported related to broad synthesis method and mechanical properties. So far there is no specific report of electrical conductivity associated to PIW and JIL natural polymers. In order to obtain electrical conductivity and its crystallinity of the extracted polymer films, it was induced on them a various fraction of silver nano particles. The film has been prepared by means of spin coating method on nickel substrate. It was revealed that FTIR spectra confirm the existing of rutine flavonoid. The crystallinity of the samples increase from 0.66%, to 4.11% associated to the respective various of silver fractions of 0.1 M to 0.5 M. SEM images show that there are some grains of silver in the film. The nature of electric conductivity increases a long with the addition of silver. The electrical conductivity increase significantly from 3.22 S/cm, to 542.85 S/cm. On the other hand, PIW films also shows similar trends that increase of Ag induce the increase its crystallinity as well as its electrical conductivity at semiconducting level. This result opens a prospective research and application of the green renewable polymer as optoelectronic materials.

HERSCHEL KEY PROGRAM, ''DUST, ICE, AND GAS IN TIME'' (DIGIT): THE ORIGIN OF MOLECULAR AND ATOMIC EMISSION IN LOW-MASS PROTOSTARS IN TAURUS

Energy Technology Data Exchange (ETDEWEB)

Lee, Jeong-Eun; Lee, Seokho [Department of Astronomy and Space Science, Kyung Hee University, Yongin-shi, Kyungki-do 449-701 (Korea, Republic of); Lee, Jinhee [Department of Physics and Astronomy, The University of Georgia, Athens, GA 30602-2451 (United States); Evans II, Neal J.; Green, Joel D., E-mail: jeongeun.lee@khu.ac.kr [Department of Astronomy, University of Texas at Austin, 2515 Speedway, Stop C1400, Austin, TX 78712-1205 (United States)

2014-10-01

Six low-mass embedded sources (L1489, L1551-IRS5, TMR1, TMC1-A, L1527, and TMC1) in Taurus have been observed with Herschel-PACS to cover the full spectrum from 50 to 210 μm as part of the Herschel key program, ''Dust, Ice, and Gas In Time''. The relatively low intensity of the interstellar radiation field surrounding Taurus minimizes contamination of the [C II] emission associated with the sources by diffuse emission from the cloud surface, allowing study of the [C II] emission from the source. In several sources, the [C II] emission is distributed along the outflow, as is the [O I] emission. The atomic line luminosities correlate well with each other, as do the molecular lines, but the atomic and molecular lines correlate poorly. The relative contribution of CO to the total gas cooling is constant at ∼30%, while the cooling fraction by H{sub 2}O varies from source to source, suggesting different shock properties resulting in different photodissociation levels of H{sub 2}O. The gas with a power-law temperature distribution with a moderately high density can reproduce the observed CO fluxes, indicative of CO close to LTE. However, H{sub 2}O is mostly subthermally excited. L1551-IRS5 is the most luminous source (Ł{sub bol} = 24.5 L {sub ☉}) and the [O I] 63.1 μm line accounts for more than 70% of its FIR line luminosity, suggesting complete photodissociation of H{sub 2}O by a J shock. In L1551-IRS5, the central velocity shifts of the [O I] line, which exceed the wavelength calibration uncertainty (∼70 km s{sup –1}) of PACS, are consistent with the known redshifted and blueshifted outflow direction.

DISK BRAKING IN YOUNG STARS: PROBING ROTATION IN CHAMAELEON I AND TAURUS-AURIGA

International Nuclear Information System (INIS)

Duy Cuong Nguyen; Jayawardhana, Ray; Van Kerkwijk, Marten H.; Damjanov, Ivana; Brandeker, Alexis; Scholz, Alexander

2009-01-01

We present a comprehensive study of rotation, disk, and accretion signatures for 144 T Tauri stars in the young (∼2 Myr old) Chamaeleon I and Taurus-Auriga star-forming regions based on multi-epoch high-resolution optical spectra from the Magellan Clay 6.5 m telescope supplemented by mid-infrared photometry from the Spitzer Space Telescope. In contrast to previous studies in the Orion Nebula Cluster and NGC 2264, we do not see a clear signature of disk braking in Tau-Aur and Cha I. We find that both accretors and non-accretors have similar distributions of vsin i. This result could be due to different initial conditions, insufficient time for disk braking, or a significant age spread within the regions. The rotational velocities in both regions show a clear mass dependence, with F-K stars rotating on average about twice as fast as M stars, consistent with results reported for other clusters of similar age. Similarly, we find the upper envelope of the observed values of specific angular momentum j varies as M 0.5 for our sample which spans a mass range of ∼0.16-3 M sun . This power law complements previous studies in Orion which estimated j ∝ M 0.25 for ∼ sun . Furthermore, the overall specific angular momentum of this ∼10 Myr population is five times lower than that of non-accretors in our sample, and implies a stellar braking mechanism other than disk braking could be at work. For a subsample of 67 objects with mid-infrared photometry, we examine the connection between accretion signatures and dusty disks: in the vast majority of cases (63/67), the two properties correlate well, which suggests that the timescale of gas accretion is similar to the lifetime of inner disks.

THE DISK IMAGING SURVEY OF CHEMISTRY WITH SMA. I. TAURUS PROTOPLANETARY DISK DATA

International Nuclear Information System (INIS)

Oeberg, Karin I.; Qi Chunhua; Andrews, Sean M.; Espaillat, Catherine; Van Kempen, Tim A.; Wilner, David J.; Fogel, Jeffrey K. J.; Bergin, Edwin A.; Pascucci, Ilaria

2010-01-01

Chemistry plays an important role in the structure and evolution of protoplanetary disks, with implications for the composition of comets and planets. This is the first of a series of papers based on data from DISCS, a Submillimeter Array survey of the chemical composition of protoplanetary disks. The six Taurus sources in the program (DM Tau, AA Tau, LkCa 15, GM Aur, CQ Tau, and MWC 480) range in stellar spectral type from M1 to A4 and offer an opportunity to test the effects of stellar luminosity on the disk chemistry. The disks were observed in 10 different lines at ∼3'' resolution and an rms of ∼100 mJy beam -1 at ∼0.5 km s -1 . The four brightest lines are CO 2-1, HCO + 3-2, CN 2 33/4/2 - 1 22/3/1 , and HCN 3-2, and these are detected toward all sources (except for HCN toward CQ Tau). The weaker lines of CN 2 22 -1 11 , DCO + 3-2, N 2 H + 3-2, H 2 CO 3 03 -2 02 , and 4 14 -3 13 are detected toward two to three disks each, and DCN 3-2 only toward LkCa 15. CH 3 OH 4 21 -3 1 2 and c-C 3 H 2 are not detected. There is no obvious difference between the T Tauri and Herbig Ae sources with regard to CN and HCN intensities. In contrast, DCO + , DCN, N 2 H + , and H 2 CO are detected only toward the T Tauri stars, suggesting that the disks around Herbig Ae stars lack cold regions for long enough timescales to allow for efficient deuterium chemistry, CO freeze-out, and grain chemistry.

INFLUÊNCIA DO GENÓTIPO BOS INDICUS NA ATIVIDADE DE CALPASTATINA E NA TEXTURA DA CARNE DE NOVILHOS ABATIDOS NO SUL DO BRASIL EFFECTS OF THE BOS INDICUS GENOTYPE ON CALPASTATIN ACTIVITIY AND TEXTURE OF BEEF FROM STEERS SLAUGHTERED IN THE SOUTH OF BRAZIL

Directory of Open Access Journals (Sweden)

Jane M. RUBENSAM

1998-10-01

Full Text Available Amostras de contrafilé (músculo L. dorsi provenientes de 26 bovinos, sendo 14 Polled Hereford (HH, sete 3/4Hereford 1/4Nelore (3/4H1/4N e cinco 5/8Hereford 3/8Nelore (5/8H3/8N, machos castrados, abatidos aos dois anos de idade, foram coletadas 24 h após o abate e analisadas quanto à atividade de calpastatina e textura, tanto no 1o dia post mortem quanto após um período de maturação de 10 dias a 2o C. A atividade de calpastatina foi determinada pelo ensaio de inibição da m-calpaína e a textura através da força de cisalhamento (Warner-Bratzler. A carne de novilhos 5/8H3/8N apresentou, no 1o dia, maiores (p0,05 entre os grupos HH e 3/4H1/4N para as mesmas características. Após 10 dias, houve uma diferença na atividade de calpastatina, porém não significativa (p>0,05, entre o grupo 5/8H3/8N (1,57U/g e os demais (HH=1,23U/g; 3/4H1/4N=1,35U/g, e diferença significativa entre os grupos HH e 5/8H3/8N para força de cisalhamento (3,67 e 5,00kg, respectivamente. Conclui-se que a atividade de calpastatina determinada 24 h post mortem pode ser útil para a previsão da textura da carne, maturada ou não, em programas de melhoramento genético, e que a participação crescente do genótipo Bos indicus nos rebanhos da Região Sul, a par das conhecidas vantagens zootécnicas, poderá resultar em carne de pior textura.Boneless rib steaks (L. dorsi muscle from 26 two years old steers, 14 Polled Hereford, seven 3/4Hereford 1/4Nelore (3/4H1/4N and five 5/8Hereford 3/8Nelore (5/8H3/8N, were collected 24 hs after slaughter and analysed for calpastatin activity and texture at the 1st day post mortem and at the 10th day of aging at 2o C. Calpastatin activity was determined by m-calpain inhibition assay and texture by shear force (Warner-Bratzler. Beef from 5/8H3/8N steers showed higher (p0.05 were detected in the same traits between groups HH and 3/4H1/4N. After 10 days of aging, there was a difference in calpastatin activity, although non

Crescimento foliar e atividades das enzimas antioxidativas em plântulas de girassol suplementadas com percolado de aterro sanitário e submetidas a estresse hídrico

Directory of Open Access Journals (Sweden)

Francisco Holanda Nunes Junior

2017-01-01

Full Text Available Em regiões áridas ou semiáridas, a escassez hídrica tem sido um dos principais fatores limitantes da produção agrícola. Diante disso, o presente trabalho objetivou analisar os efeitos da aplicação de percolado de aterro sanitário no crescimento foliar (número de folhas e área foliar e as atividades das enzimas antioxidativas: superóxido dismutase (SOD, catalase (CAT, peroxidase do ascorbato (APX e peroxidase do guaiacol (GPX em folhas e raízes de plântulas de girassol submetidas às condições de estresse hídrico. O delineamento experimental foi o inteiramente casualizado, disposto em arranjo fatorial dois (irrigadas ou não irrigadas x quatro (areia; areia + adubo orgânico 100 kg N ha-1; areia + percolado de aterro sanitário 100 kg N ha-1; areia + percolado de aterro sanitário 150 kg N ha-1, com cinco repetições. Em relação aos parâmetros foliares, o tratamento 100 kg N ha-1 suplementado com percolado de aterro sanitário obteve os melhores incrementos no número de folhas e área foliar. Além disso, verificaram-se aumentos nas atividades das enzimas antioxidativas em folhas e raízes de plântulas de girassol suplementadas com percolado de aterro sanitário, sendo provável que as reduções dos efeitos deletérios do estresse hídrico nas variáveis foliares dos tratamentos suplementados com percolado de aterro sanitário tenham ocorrido em virtude das maiores atividades das enzimas antioxidativas, especialmente as da CAT nas folhas e GPX nas raízes.

Adjuvant effects and antiserum action potentiation by a (herbal) compound 2-hydroxy-4-methoxy benzoic acid isolated from the root extract of the Indian medicinal plant 'sarsaparilla' (Hemidesmus indicus R. Br.).

Science.gov (United States)

Alam, M I; Gomes, A

1998-10-01

The adjuvant effect and antiserum potentiation of a compound 2-hydroxy-4-methoxy benzoic acid were explored in the present investigation. This compound, isolated and purified from the Indian medicinal plant Hemidesmus indicus R. Br, possessed antisnake venom activity. Rabbits immunized with Vipera russellii venom in the presence and absence of the compound along with Freund's complete adjuvant, produced a precipitating band in immunogel diffusion and immunogel electrophoresis. The venom neutralizing capacity of this antiserum showed positive adjuvant effects as evident by the higher neutralization capacity (lethal and hemorrhage) when compared with the antiserum raised with venom alone. The pure compound potentiated the lethal action neutralization of venom by commercial equine polyvalent snake venom antiserum in experimental models. These observations raised the possibility of the use of chemical antagonists (from herbs) against snake bite, which may provide a better protection in presence of antiserum, especially in the rural parts of India.

Controle ultra-sonográfico de gestações, de mortalidades embrionárias e fetais e do sexo de fetos bovinos zebuínos

Directory of Open Access Journals (Sweden)

Breno José Pelozo de Barros

2001-01-01

Full Text Available Este trabalho avaliou a eficácia do ultra-som no diagnóstico precoce de prenhez e nas avaliações das mortalidades embrionárias e fetais e dos sexos de fetos em dois grupos de vacas zebuínas. Os animais que não retornaram ao estro aos 21 dias da Inseminação Artificial (G1 ou aos 14 dias da Transferência de Embriões (G2B foram examinados aos 25 dias de gestação para o diagnóstico precoce de prenhez, aos 45 dias para avaliação das perdas embrionárias entre 26 e 45 dias e aos 60 dias para avaliações das perdas fetais entre 45 e 60 dias e dos sexos de fetos. O Grupo G2A foi examinado por palpação retal aos 45 dias para diagnóstico de prenhez e aos 60 dias para avaliações das perdas fetais e dos sexos de fetos. As taxas de prenhez foram, respectivamente, 94,6%, 88,1% e 83,4% aos 25, 45 e 60 dias de gestação. As taxas de perdas embrionárias e fetais e de abortos foram, respectivamente, 4,6%, 4,7% e 1,2%. As taxas de acertos do diagnóstico precoce de gestação e dos sexos de fetos foram 88,5% e 90,7%, respectivamente. A ultra-sonografia mostrou-se eficaz no diagnóstico precoce de prenhez aos 25 dias, nas avaliações das perdas embrionárias aos 45 dias e fetais aos 60 dias e no diagnóstico do sexo de fetos a partir dos 60 dias de gestação. Os exames ultra-sonográficos não causaram perdas gestacionais nos animais Bos indicus ou Bos indicus X Bos taurus.

Spatial distribution of Brucella antibodies with reference to indigenous cattle populations among contrasting agro-ecological zones of Uganda.

Science.gov (United States)

Kabi, Fredrick; Muwanika, Vincent; Masembe, Charles

2015-09-01

Indigenous cattle populations exhibit various degrees of agro-ecological fitness and provide desirable opportunities for investments to improve sustainable production for better rural small-scale farmers' incomes globally. However, they could be a source of infection to their attendants and other susceptible livestock if their brucellosis status remains unknown. This study investigated the spatial distribution of Brucella antibodies among indigenous cattle populations in Uganda. Sera from a total of 925 indigenous cattle (410 Ankole Bos taurus indicus, 50 Nganda and 465 East African Shorthorn Zebu (EASZ) - B. indicus) obtained randomly from 209 herds spread throughout Uganda were sequentially analysed for Brucella antibodies using the indirect (I) and competitive (C) enzyme linked Immuno-sorbent assays (ELISA). Recent incidences of abortion within the previous 12 months and routine hygienic practices during parturition were explored for public health risks. Brucella antibodies occurred in approximately 8.64% (80/925) and 28.70% (95% CI: 22.52, 34.89) of the sampled individual cattle and herds, respectively. Findings have shown that Ankole and EASZ cattle had similar seroprevalences. Indigenous cattle from the different study agro-ecological zones (AEZs) exhibited varying seroprevalences ranging from approximately 1.78% (95% CI: 0, 5.29) to 19.67% (95% CI: 8.99, 30.35) in the Lake Victoria Crescent (LVC) and North Eastern Drylands (NED) respectively. Significantly higher odds for Brucella antibodies occurred in the NED (OR: 3.40, 95% CI: 1.34, 8.57, p=0.01) inhabited by EASZ cattle compared to the KP (reference category) AEZ. Recent incidences of abortions within the previous 12 months were significantly (p<0.001) associated with seropositive herds. These findings add critical evidence to existing information on the widespread occurrence of brucellosis among indigenous cattle populations in Uganda and could guide allocation of meagre resources for awareness creation

The GBT 3mm Survey of Infall and Fragmentation of Dense Cores in Taurus

Science.gov (United States)

Seo, Youngmin; Goldsmith, Paul; Shirley, Yancy L.; Church, Sara; Frayer, David

2018-01-01

We present preliminary results of the infall and fragmentation survey toward a complete population of prestellar cores in Taurus that was carried out with the 16-element W-band focal plane array receiver (Argus) on the 100m Green Bank Telescope. The survey is designed take advantage of the 8.5” angular resolution and high sensitivity of Argus on the GBT to trace infall motions in HCN 1-0 & HCO+ 1-0 and find any evidence of fragmentation in N2H+ & NH2D within prestellar cores ranging in size from 0.05 pc to 0.0075 pc (1500 AU), which is a typical size scale of individual planetary systems. The scientific goal is to estimate the fraction of infall candidates from a complete population of prestellar cores and to understand internal velocity structure during the final gravitational collapse before forming stars. The survey started in the winter of 2016 and is to continue to the end of January 2018. So far, we observed 23 prestellar cores out of 65 targets in HCN 1-0 and HCO+ 1-0. We have so far found only two prestellar cores (L1495A-N, L1521D) out of 23 observed that show infall signatures, which is a fraction of infalling cores less than half of that reported by the previous surveys toward the bright, dense cores in various molecular clouds (Lee et al. 2004; Sohn et al. 2007). We also found that L1495A-N has a highly asymmetric infall motion which does not fit to a conventional model of dense core collapse, while L1521D has a slow infall motion similar to L1544.

Características produtivas e imunológicas de frangos de corte submetidos a dietas suplementadas com cromo, criados sob diferentes condições de ambiente Productive and immunological traits of broiler chickens fed diets supplemented with chromium, reared under different environmental conditions

Directory of Open Access Journals (Sweden)

Alexandre Oba

2012-05-01

Full Text Available Objetivou-se avaliar o desempenho, a resposta imune e as características de carcaça de frangos de corte alimentados com dietas suplementadas com cromo complexado a levedura (Saccharomyces cerevisae, criados em diferentes condições de temperatura. O experimento foi conduzido em câmaras climáticas com sistema de aquecimento e refrigeração, utilizando-se as seguintes condições de temperatura, de acordo com as idades: 1 a 3 dias (35, 35 e 35 ºC ± 2, 4 a 7 dias (35, 30, 25 ºC ± 2, 8 a 14 dias (34, 27 e 20 ºC ± 2, 15 a 21 dias (33, 26 e 18 ºC ± 2 e de 22 a 47 dias (32, 26 e 18 ºC ± 2, respectivamente, para temperatura quente, termoneutra e fria. As dietas foram suplementadas com 0, 400, 800, 1.200 μg Cr/kg. A suplementação de 400 μg Cr/kg melhora a viabilidade e, em aves mantidas em temperatura quente, a conversão alimentar, enquanto a temperatura de criação mostrou ter grande influência sobre as características produtivas em todas as fases de criação. As aves criadas em temperatura quente apresentam melhor resposta imune, maior rendimento de carcaça e pernas e resultados inferiores de desempenho e rendimento de peito.The objective of this experiment was to evaluate performance, immune response and traits concerning carcass and poultry cuts of broiler chickens fed diets supplemented with chromium-yeast (Saccharomyces cerevisae, reared under different environmental temperature conditions. Birds were reared in climate chambers with heating and cooling system, using the following environmental temperatures according to ages: from 1 to 3 days of age (35, 35 and 35 ºC ± 2, from 4 to 7 days of age (35, 30 and 25 ºC ± 2, from 8 to 14 days old (34, 27 and 20 ºC ± 2, from 15 to 21 days of age (33, 26 and 18 ºC ± 2 and from 22 to 47 days of age (32, 26 and 18 ºC ± 2, respectively, for high, thermoneutral and low temperatures. Diets were supplemented with 0; 400; 800; and 1,200 μg Cr/kg. Supplementation with 400 μg Cr

Some effects of partial suckling on milk yield, reproduction and calf growth in crossbred dairy cattle in north east coastal Tanzania

International Nuclear Information System (INIS)

Bryant, M.J.; Msanga, Y.N.

1999-01-01

Two experiments are described where a progeny of Bos taurus x Bos indicus crossbred cows were reared by partial suckling or bucket rearing (Experiment I), and partially suckled calves were weaned at 12 or 24 weeks of age (Experiment II). The results of Experiment I suggest that calf rearing method had no significant effect in the yield of milk extracted from the cows by hand milking although there were effects on the shape of the lactation curve. Cows showed similar patterns of live weight and body condition losses and gains and there were no significant effects on the length of the post partum interval. Suckled calves were lighter at weaning (P <0.01) but there were no differences in live weight between treatments at 52 weeks of age. The main advantage of partial suckling was that the calves took advantage of residual milk which was estimated as 28-29% of the total yield. The results from Experiment II suggest that there were no advantages in terms of milk yield or calf growth by extending the suckling period to 24 weeks. The post partum intervals observed in Experiment II were substantially longer than those in Experiment I, possibly because of greater live weight/body condition losses experienced by cows in the second experiment. (author)

Efecto de la suplementación con grasa protegida sobre la producción y calidad de carne de toretes mexicanos doble propósito

Directory of Open Access Journals (Sweden)

German Mendoza M

2011-04-01

Full Text Available Objetivo. Evaluar la respuesta productiva y calidad de la carne de toretes doble propósito a la adición de grasa protegida (GP en su dieta. Materiales y métodos. Se utilizaron 45 toretes comerciales (B. taurus x B. indicus, divididos en tres bloques de 15 animales, de acuerdo con su peso vivo en pequeños, medianos y grandes. Cada bloque fue dividido en tres subgrupos de 5 animales, asignados aleatoriamente a los tratamientos 0, 1.5 y 3% de GP, en un diseño de bloques completamente al azar. Resultados. No hubo diferencias (p>0.05 en comportamiento productivo. La grasa dorsal fue mayor (p0.05 en área del ojo de la costilla (AC ni pH de la carne. El contenido de proteína cruda de la carne incrementó (p0.05 entre tratamientos. Conclusiones. Adicionar GP a dietas para bovinos doble propósito en finalización no modificó la respuesta productiva, pero mejoró algunas características de la canal y de la carne. Se sugiere realizar más investigación, utilizando el mismo tipo de animales, con niveles mayores de GP a los usados en este estudio, ya que la respuesta pudiera mejorar.

EFFECT OF FSH β-SUB UNIT AND FSHR GENES POLYMORPHISMS ON SUPEROVULATORY RESPONSE TRAITS

Directory of Open Access Journals (Sweden)

E. Andreas

2015-09-01

Full Text Available Follicle stimulating hormone (FSH is a pituitary expressed glycoprotein hormone that regulatesreproduction in mammals which composed of α and β-sub unit. The β-sub unit dictates its bindingspecificity with their receptor (FSHR. This study aimed to identify polymorphism of FSH β-sub unitand FSHR genes, and its effect to superovulatory response traits on superovulated cows. Study was doneon 32 cows including Angus, Friesian Holstein (FH, Limousin, Simmental and Brahman in CipelangLivestock Embryo Center. Cows used have been treated superovulation and mated by artificialinsemination. Superovulation response (SR, ovulation rate (OR, fertilization percentage (FP andviable transfer embryo percentage (VP were analyzed to investigate the effect of FSH β-sub unit andFSHR polymorphism. Allele frequency of FSH β-sub unit|PstI and FSH|AluI were opposite withinspecies. Mostly B allele and C allele for FSH β-sub unit and FSHR respectively have a high number inBos taurus species while those were in contrast in Bos indicus species. The highest heterozygosity wasfound in FH cattle (0.250 for FSH β-sub unit and Brahman (0.333 for FSHR. Significant effect was found between FSHR gene polymorphism with ovulation rate where CC genotype was higher (P<0.05than CG and GG genotypes.

Importance of silvopastoral systems on caloric stress reduction in tropical livestock productions

Directory of Open Access Journals (Sweden)

Alexander Navas Panadero

2010-06-01

Full Text Available Livestock systems in Colombia have been developed taking concepts and technologies from the green revolution, where gramineous monocrop is privileged over arboreal cover in grazing lands. This model has not taken into account the climatic conditions of the different tropical ecosystems, in which variables as temperature, relative humidity and evaporation can limit the animal´s productive and reproductive efficiency, besides being a risk factor for illness occurrence in the herd. Bos Taurus and Bos Indicus breeds show termoneutral ranges where its genetic potential can be express. However, out of this comfort area animals can enter in caloric stress which in consequence reduces its performance and sometimes can end up causing death. Silvopastoral systems comprise several functions; it contributes to lessen caloric stress since temperature under the tree canopy can reach between 2 and 9°C lower in comparison to open pastures. Differences in temperature reduction have been found among silvopastoral systems and species, being the tree group arrangements and the species with high density canopy, those with superior effect. Interactions among components should be analyzed in order to design systems that incorporate enough arboreal cover to achieve caloric stress reductions, but without affecting forage production in pastures. Silvopastoral systems contribute to improve animal welfare.

Withers height of pig - Sus scrofa domestica L. 1758, domestic cow - Bos taurus L. 1758 and sheep - Ovis aries L. 1758 at the “Gornja šuma” archaeological site (Novi Sad

Directory of Open Access Journals (Sweden)

Radmanović Darko P

2016-01-01

Full Text Available In spring 2012, osteological material was collected at the “Gornja Šuma” site (site no. 47, located in the territory of Novi Sad, and it was dated to the early 9th century. The withers heights of pig - Sus scrofa domestica, domestic cow - Bos taurus and sheep - Ovis aries, as the three most dominant species at this archaeological site, were analysed based on the length of bones and according to various authors [Boessneck 1956; Zalkin 1960; Matolcsi 1970; Teichert 1975]. It was determined that in these three species the withers heights mostly corresponded to the data from the Middle Ages.

Geographic variation in Bar-headed geese Anser indicus: connectivity of wintering and breeding grounds across a broad front

Science.gov (United States)

Takekawa, John Y.; Heath, Shane R.; Douglas, David C.; Perry, William M.; Javed, Sàlim; Newman, Scott H.; Suwal, Rajendra N.; Rahman, Asad R.; Choudhury, Binod C.; Prosser, Diann J.; Yan, Baoping; Hou, Yuansheng; Batbayar, Nyambayar; Natsagdorj, Tseveenmayadag; Bishop, Charles M.; Butler, Patrick J.; Frappell, Peter B.; Milsom, William K.; Scott, Graham R.; Hawkes, Lucy A.; Wikelski, Martin

2009-01-01

The connectivity and frequency of exchange between sub-populations of migratory birds is integral to understanding population dynamics over the entire species' range. True geese are highly philopatric and acquire lifetime mates during the winter, suggesting that the number of distinct sub-populations may be related to the number of distinct wintering areas. In the Bar-headed Goose Anser indicus, a species found exclusively in Central Asia, the connectivity between breeding and wintering areas is not well known. Their migration includes crossing a broad front of the Himalaya Cordillera, a significant barrier to migration for most birds. Many Bar-headed Geese fly to breeding areas on the Tibetan-Qinghai Plateau (TQP), the highest plateau in the world. From 2005-2008, 60 Bar-headed Geese were captured and marked with satellite transmitters in Nepal (n = 2), India (n = 6), China (n = 29), and Mongolia (n = 23) to examine their migration and distribution. Distinct differences were observed in their migration corridors and timing of movements, including an apparent leap-frog migration pattern for geese from Mongolia. Measurements of geese from Mongolia were larger than their counterparts from China, providing some evidence of morphological differences. Alteration of habitats in China, including the warming effects of climate change on glaciers increasing runoff to TQP wetlands, may be changing goose migration patterns and timing. With the exception of one individual, all geese from Qinghai Lake, China wintered in the southern TQP near Lhasa, and their increasing numbers in that region may be related to the effects of climate change and agricultural development. Thus, our findings document both morphological and geographical variation in sub-populations of Bar-headed Geese, but their resilience to environmental change may be lost if migratory short-stopping results in larger congregations restricted to a smaller number of wintering areas.

Comparative sensitivity to environmental variation and human disturbance of Asian tapirs (Tapirus indicus) and other wild ungulates in Thailand.

Science.gov (United States)

Lynam, Antony J; Tantipisanuh, Naruemon; Chutipong, Wanlop; Ngoprasert, Dusit; Baker, Megan C; Cutter, Passanan; Gale, George; Kitamura, Shumpei; Steinmetz, Robert; Sukmasuang, Ronglarp; Thunhikorn, Somying

2012-12-01

Southeast Asia's tropical forests suffer the highest rates of deforestation and disturbance of any on Earth, with poorly understood impacts on native fauna. Asian tapirs (Tapirus indicus) are among the least studied of the large mammals in these forests. Using records from 9 camera trap surveys in 7 of the largest (>1000 km(2) ) protected area complexes, we assessed the influence of environmental variation and human-induced disturbance on tapir occurrence. Tapirs were detected at 13% of locations sampled, significantly associated with evergreen forest (P tapir presence 87% of the time. According to this model, tapir occurrence was positively influenced by annual rainfall and proximity to the forest edge. However, tapirs may not avoid edges but instead prefer wetter evergreen forest, a habitat type that tended to occur further from the forest edge at higher elevations in our particular study sites (P tapirs showed a range of differing responses. Tapirs are expected to be less sensitive to disturbance because they are not targets for hunting and trade, and are almost entirely active at night, so avoid peak traffic periods in parks. Tapir populations in Thailand may be more stable than in other parts of their global range because rates of forest loss have decreased >40% over the past 20 years. We recommend surveys to fill gaps in the understanding of the status in lesser-known protected areas, research to better understand the fine-scale environmental influences on behavior and habitats of tapirs, and other forest ungulates, and continued legal status for tapirs in the highest category of protection. © 2012 Wiley Publishing Asia Pty Ltd, ISZS and IOZ/CAS.

Desempenho de frangos de corte alimentados com rações contendo diferentes níveis de cálcio suplementadas com fitase Performance of broilers fed diets with different calcium levels and supplemented with phytase

Directory of Open Access Journals (Sweden)

Daniella Carolina Zanardo Donato

2011-10-01

Full Text Available Um experimento foi conduzido para avaliar o efeito de rações contendo diferentes níveis de cálcio e suplementadas com fitase sobre o desempenho de frangos de corte nas fases inicial (1 a 21 dias, de crescimento (22 a 35 dias e final (36 a 42 dias. Foram utilizados 2.160 pintos de corte machos da linhagem AG Ross 308, de 1 a 42 dias de idade, distribuídos em 6 tratamentos, cada um com 6 repetições. Foi utilizado um delineamento inteiramente casualizado em esquema fatorial 3 × 2, com 3 níveis de fitase (0, 600 e 1.200 ftu/kg e 2 de cálcio (0,94 e 0,66%; 0,84 e 0,59%; e 0,78 e 0,54% para as fases inicial, de crescimento e final, respectivamente. As rações experimentais ainda tinham níveis reduzidos de fósforo disponível e níveis mínimos de proteína bruta. Ao final de cada fase, avaliaram-se o ganho de peso, o consumo de ração, a conversão alimentar e a mortalidade. Houve interação entre os níveis de fitase e de cálcio estudados para ganho de peso, consumo de ração e mortalidade nas três fases avaliadas. Os melhores resultados foram obtidos com a suplementação de fitase no nível de 1.200 ftu/kg de ração em associação aos menores níveis de cálcio. Nenhum resultado significativo foi observado para conversão alimentar. Os níveis nutricionais de cálcio podem ser reduzidos em 30% em dietas com baixos níveis de fósforo disponível e níveis mínimos de proteína bruta, desde que as dietas sejam suplementadas com 1.200 ftu/kg de fitase.An experiment was carried out to evaluate the effect of diets with different calcium levels and supplemented with phytase on the performance of broiler chickens in initial (1 to 21 days of age, growing (22 to 35 days of age and final (36 to 42 days of age phases. Two thousand one hundred and sixty male broilers from AG Ross 308 line, from 1 to 42 days old were distributed in 6 treatments, with 6 replicates each. A completely randomized design in a 3 × 2 factorial scheme was used

Whole-genome sequencing reveals mutational landscape underlying phenotypic differences between two widespread Chinese cattle breeds.

Directory of Open Access Journals (Sweden)

Yao Xu

Full Text Available Whole-genome sequencing provides a powerful tool to obtain more genetic variability that could produce a range of benefits for cattle breeding industry. Nanyang (Bos indicus and Qinchuan (Bos taurus are two important Chinese indigenous cattle breeds with distinct phenotypes. To identify the genetic characteristics responsible for variation in phenotypes between the two breeds, in the present study, we for the first time sequenced the genomes of four Nanyang and four Qinchuan cattle with 10 to 12 fold on average of 97.86% and 98.98% coverage of genomes, respectively. Comparison with the Bos_taurus_UMD_3.1 reference assembly yielded 9,010,096 SNPs for Nanyang, and 6,965,062 for Qinchuan cattle, 51% and 29% of which were novel SNPs, respectively. A total of 154,934 and 115,032 small indels (1 to 3 bp were found in the Nanyang and Qinchuan genomes, respectively. The SNP and indel distribution revealed that Nanyang showed a genetically high diversity as compared to Qinchuan cattle. Furthermore, a total of 2,907 putative cases of copy number variation (CNV were identified by aligning Nanyang to Qinchuan genome, 783 of which (27% encompassed the coding regions of 495 functional genes. The gene ontology (GO analysis revealed that many CNV genes were enriched in the immune system and environment adaptability. Among several CNV genes related to lipid transport and fat metabolism, Lepin receptor gene (LEPR overlapping with CNV_1815 showed remarkably higher copy number in Qinchuan than Nanyang (log2 (ratio = -2.34988; P value = 1.53E-102. Further qPCR and association analysis investigated that the copy number of the LEPR gene presented positive correlations with transcriptional expression and phenotypic traits, suggesting the LEPR CNV may contribute to the higher fat deposition in muscles of Qinchuan cattle. Our findings provide evidence that the distinct phenotypes of Nanyang and Qinchuan breeds may be due to the different genetic variations including SNPs

Parâmetros sangüíneos de pacu Piaractus mesopotamicus (Holmberg, 1887 alimentados com dietas suplementadas com cromo trivalente em duas densidades de estocagem - DOI: 10.4025/actascianimsci.v29i4.1019 Hematological parameters of pacu Piaractus mesopotamicus (Holmberg, 1887 fed diets supplemented with trivalent chromium in two stocking densities - DOI: 10.4025/actascianimsci.v29i4.1019

Directory of Open Access Journals (Sweden)

Flávio Ruas de Moraes

2008-03-01

Full Text Available O objetivo deste trabalho foi avaliar os efeitos da suplementação com cromo trivalente (0, 6, 12 e 18 mg kg-1 de ração sobre as variáveis hematológicas de Piaractus mesopotamicus, mantidos em duas densidades de estocagem (4 e 20 kg m-3. Os mantidos na maior densidade e alimentados com dietas suplementadas com 0 e 6 mg de cromo kg-1 apresentaram redução do número de linfócitos circulantes, sugerindo má adaptação a essa condição de alta densidade. Nas dietas suplementadas com 12 e 18 mg kg-1, tal efeito não foi observado, porém verificou-se aumento do número de trombócitos no tratamento com 12 mg de cromo kg-1. A inexistência de diferença significativa entre os tratamentos, aos 30 dias, sugere a adaptação dos peixes ao tipo de alimento e à situação de alta densidade. Portanto, nas condições deste ensaio, a suplementação com 12 e 18 mg de cromo kg-1 é interessante como estratégia alimentar durante 15 dias.This work evaluated the effects of chromium supplementation on the hematological parameters of Piaractus mesopotamicus Holmberg, 1887 maintained in two stocking densities. Fish were fed diets supplemented with 0, 6, 12 and 18 mg trivalent chromium kg-1 dry ration and maintained at 4 and 20 kg m-3. The fish under high stocking density and fed diets supplemented with 0 and 6 mg kg-1 showed reduction in the number lymphocytes, which suggests non-adaptation to this condition of high density. This was not observed in fish fed diets supplemented with 12 and 18 mg chromium kg-1, but an increase in the number of thrombocytes was evident. The lack of difference between treatments after 30 days may suggest a possible adaptation of fish to the situation. It can be added that supplementation with 12 and 18 mg chromium kg-1 is an interesting feeding strategy for a period of 15 days.

Determining the 3D Subsurface Density Structure of Taurus Littrow Valley Using Apollo 17 Gravity Data

Science.gov (United States)

Urbancic, N.; Ghent, R.; Stanley, S,; Johnson, C. L.; Carroll, K. A.; Hatch, D.; Williamson, M. C.; Garry, W. B.; Talwani, M.

2016-01-01

Surface gravity surveys can detect subsurface density variations that can reveal subsurface geologic features. In 1972, the Apollo 17 (A17) mission conducted the Traverse Gravimeter Experiment (TGE) using a gravimeter that measured the local gravity field near Taurus Littrow Valley (TLV), located on the south-eastern rim of the Serenitatis basin. TLV is hypothesized to be a basaltfilled radial graben resulting from the impact that formed Mare Serenitatis. It is bounded by both the North and South Massifs (NM and SM) as well as other smaller mountains to the East that are thought to be mainly composed of brecciated highland material. The TGE is the first and only successful gravity survey on the surface of the Moon. Other more recent satellite surveys, such as NASA's Gravity Recovery and Interior Laboratory (GRAIL) mission (2011- 2012), have produced the best global gravity field to date (approx. 13km resolution). However, these satellite surveys are not sensitive enough to detect fine-scale (<1km) lunar subsurface structures. This underscores the value of the data collected at the surface by A17. In the original analysis of the data a 2D forward-modelling approach was used to derive a thickness of the subsurface basalt layer of 1.0 km by assuming a simple flat-faced rectangular geometry and using densities derived from Apollo lunar samples. We are investigating whether modern 3D modelling techniques in combination with high-resolution topographical and image datasets can reveal additional fine-scale subsurface structure in TLV.

USO DE ANTI-HELMÍNTICOS E BIOESTIMULANTES NO DESEMPENHO DE BOVINOS DE CORTE SUPLEMENTADOS A PASTO NO ESTADO DO PARÁ EFFECTS OF VERMIFUGES AND BIOSTIMULANTS ON BEEF CATTLE PERFORMANCE UNDER PASTURE SUPPLEMENTATION IN PARÁ STATE

Directory of Open Access Journals (Sweden)

Sâmia Rubielle Silva de Castro

2009-07-01

Full Text Available O experimento avaliou o efeito da vermifugação e da utilização de bioestimulantes no ganho de peso e no escore de condição corporal (ECC de bovinos de corte, criados em sistema de pastejo rotacionado com suplementação a pasto, no Estado do Pará, durante 160 dias. Foram utilizados 132 bovinos machos não castrados, com idade média de 24 meses, da raça Nelore (Bos taurus indicus. Os grupos experimentais compreenderam o grupo G1 (controle; n=33, G2 (moxidectina 1%; n=33, G3 (moxidectina 10%; n=33 e G4 (ivermectina 3,15%; n=33. Em todos os grupos foram estabelecidas três subparcelas, a fim de serem testados dois bioestimulantes de crescimento animal (bioestimulante 1 e bioestimulante 2. Não houve diferença estatística significativa no ganho de peso médio, no ECC e nas contagens de OPG entre animais do G1, G2, G3 e G4, independentemente dos anti-helmínticos e/ou bioestimulantes usados. Contudo, o tratamento baseado na associação de moxidectina 1% e o bioestimulante 2 apresentou maior receita líquida e incrementou a lucratividade da terminação em 1,24%. Os resultados sugerem que não há necessidade de um controle contra nematódeos durante a terminação, desde que os animais apresentem uma baixa carga parasitária, porém o uso de fármacos pode, sob certas condições, apresentar resultado econômico favorável.

PALAVRAS-CHAVES: Anti-helmíntico, bovinocultura, crescimento, rentabilidade, sistema de produção.
The experiment evaluated the effect of vermifuges and biostimulants on weight gain and body condition score (BCS of beef cattle, created in pasture supplementation system, in the State of Pará, during 160 days. Experimental animal were 132 Nelore (Bos taurus indicus, non-castrated male, with average age of 24 months. Experimental groups were: G1 group (control; n=33, G2 (1% moxidectin; n=33, G3 (10% moxidectin; n=33 and G4 (3.15% ivermectin; n=33. Each group was divided in three plots, in order to test

The Gould's Belt Distances Survey (GOBELINS). IV. Distance, Depth, and Kinematics of the Taurus Star-forming Region

Science.gov (United States)

Galli, Phillip A. B.; Loinard, Laurent; Ortiz-Léon, Gisela N.; Kounkel, Marina; Dzib, Sergio A.; Mioduszewski, Amy J.; Rodríguez, Luis F.; Hartmann, Lee; Teixeira, Ramachrisna; Torres, Rosa M.; Rivera, Juana L.; Boden, Andrew F.; Evans, Neal J., II; Briceño, Cesar; Tobin, John J.; Heyer, Mark

2018-05-01

We present new trigonometric parallaxes and proper motions of young stellar objects in the Taurus molecular cloud complex from observations collected with the Very Long Baseline Array as part of the Gould’s Belt Distances Survey. We detected 26 young stellar objects and derived trigonometric parallaxes for 18 stars with an accuracy of 0.3% to a few percent. We modeled the orbits of six binaries and determined the dynamical masses of the individual components in four of these systems (V1023 Tau, T Tau S, V807 Tau, and V1000 Tau). Our results are consistent with the first trigonometric parallaxes delivered by the Gaia satellite and reveal the existence of significant depth effects. We find that the central portion of the dark cloud Lynds 1495 is located at d =129.5 ± 0.3 pc, while the B216 clump in the filamentary structure connected to it is at d = 158.1 ± 1.2 pc. The closest and remotest stars in our sample are located at d = 126.6 ± 1.7 pc and d = 162.7 ± 0.8 pc, yielding a distance difference of about 36 pc. We also provide a new distance estimate for HL Tau that was recently imaged. Finally, we compute the spatial velocity of the stars with published radial velocity and investigate the kinematic properties of the various clouds and gas structures in this region.

Qualidade da carne de frangos de corte submetidos a dietas suplementadas com crômio, criados em diferentes temperaturas ambientais - DOI: 10.4025/actascianimsci.v29i2.218 Meat quality of broiler chicks submeted the supplemented diets with chromium and reared in differents enviromental temperatures - DOI: 10.4025/actascianimsci.v29i2.218

Directory of Open Access Journals (Sweden)

Nívea Maria Brancaci Zeoula

2007-11-01

Full Text Available Foram realizados dois experimentos. O experimento um objetivou avaliar a composição da carne do peito de frangos alimentados com dietas suplementadas com crômio (0, 400, 800 e 1.200 μg Cr kg-1 complexado a levedura, criados sob diferentes condições de temperatura (quente, termoneutra e fria. O experimento dois objetivou avaliar a qualidade da carne do peito de frangos alimentados com dietas suplementadas com crômio (0 e 400 μg Cr kg-1, criados nas mesmas condições do experimento um e desossados em diferentes períodos (0, 5 e 24 horas. Os resultados mostram que as aves criadas em ambiente frio apresentaram a carne com menor porcentagem de matéria mineral e crômio e maior intensidade de vermelho, enquanto as aves criadas em temperatura termoneutra apresentaram carne com menor porcentagem de umidade, e as aves criadas em temperatura quente, carne com maior luminosidade. Já a suplementação de crômio não proporcionou qualquer efeito na composição e na qualidade de carne, enquanto que o aumento no período de desossa proporcionou um menor comprimento de sarcômero, força de cisalhamento e intensidade de amarelo, porém uma maior luminosidade.Two experiments were conducted being the objective of the first experiment to evaluate the the composition of breast meat of broiler chicks fed with diets supplemented with chromium yeast (0; 400; 800 and 1,200 μg Cr kg-1 reared in different environmental temperatures (hot, thermoneutral and cold. The second experiment aimed to evaluate the quality of breast meat of broiler chicks fed with diets supplemented with chromium yeast (0 and 400 μg Cr kg-1, reared in different environmental temperatures (hot, thermoneutral and cold and deboned in different periods (0, 5 and 24 hours. The results showed that birds reared in cold environmental temperature showed meat with lower mineral matter percentage and chromium and higher values of redness, whereas the birds reared in thermoneutral environment

Effect of Vitamin E and Polyunsaturated Fatty Acids on Cryopreserved Sperm Quality in Bos taurus Bulls Under Testicular Heat Stress.

Science.gov (United States)

Losano, João D A; Angrimani, Daniel S R; Dalmazzo, Andressa; Rocha, Carolina C; Brito, Maíra M; Perez, Eduardo G A; Tsunoda, Roberta H; Góes, Paola A A; Mendes, Camilla M; Assumpção, Mayra E O A; Barnabe, Valquiria H; Nichi, Marcilio

2018-04-03

Taurine bulls are highly susceptible to heat stress, leading to increased oxidative stress (OS) and impaired sperm viability. Polyunsaturated fatty acids (PUFAs) supplementation can be an alternative to improve semen quality, which also results in more sperm susceptibility to lipid peroxidation. Moreover, this deleterious effect can be exacerbated in animals affected by heat stress. Vitamin E is a key antioxidant that counteracts lipid peroxidation of sperm membrane caused by OS. Thus, combining PUFAs with vitamin E may improve sperm quality. In this context, this study aimed to evaluate the effect of interaction between PUFAs and vitamin E on sperm quality in Bos taurus bulls under testicular heat stress. Sixteen taurine bulls under testicular heat stress were randomly assigned in four groups: Control, Vitamin E, PUFA, and PUFA + Vitamin E. All groups lasted for 60 days. Samples were cryopreserved/thawed and analyzed for motility variables (CASA), membrane and acrosome integrity, mitochondrial activity, susceptibility to oxidative stress, DNA integrity, and sperm-binding capacity. Results showed that vitamin E had a beneficial effect on some sperm characteristics, whereas PUFA supplementation had an adverse effect when the two treatments were evaluated separately. Finally, the association between PUFAs and vitamin E did not improve sperm quality.

Dynamical Timescale of Pre-collapse Evolution Inferred from Chemical Distribution in the Taurus Molecular Cloud-1 (TMC-1) Filament

Energy Technology Data Exchange (ETDEWEB)

Choi, Yunhee; Lee, Jeong-Eun [School of Space Research, Kyung Hee University, 1732, Deogyeong-daero, Giheung-gu, Yongin-si, Gyeonggi-do 17104 (Korea, Republic of); Bourke, Tyler L. [Square Kilometre Array Organisation, Jodrell Bank Observatory, Lower Withington, Cheshire SK11 9DL (United Kingdom); II, Neal J. Evans, E-mail: yunhee.choi@khu.ac.kr, E-mail: jeongeun.lee@khu.ac.kr [Department of Astronomy, University of Texas at Austin, 2515 Speedway, Stop C1400, Austin, TX 78712-1205 (United States)

2017-04-01

We present observations and analyses of the low-mass star-forming region, Taurus Molecular Cloud-1 (TMC-1). CS ( J = 2–1)/N{sub 2}H{sup +} ( J = 1–0) and C{sup 17}O ( J = 2–1)/C{sup 18}O ( J = 2–1) were observed with the Five College Radio Astronomy Observatory and the Seoul Radio Astronomy Observatory, respectively. In addition, Spitzer infrared data and 1.2 mm continuum data observed with Max-Planck Millimetre Bolometer are used. We also perform chemical modeling to investigate the relative molecular distributions of the TMC-1 filament. Based on Spitzer observations, there is no young stellar object along the TMC-1 filament, while five Class II and one Class I young stellar objects are identified outside the filament. The comparison between column densities calculated from dust continuum and C{sup 17}O 2–1 line emission shows that CO is depleted much more significantly in the ammonia peak than in the cyanopolyyne peak, while the column densities calculated from the dust continuum are similar at the two peaks. N{sub 2}H{sup +} is not depleted much in either peak. According to our chemical calculation, the differential chemical distribution in the two peaks can be explained by different timescales required to reach the same density, i.e., by different dynamical processes.

Dicty_cDB: Contig-U16181-1 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available s taurus Y Chr NOVECTOR CH240-507F20 (Children'... 48 0.79 1 ( AC232941 ) Bos taurus Y Chr NOVECTOR CH240-255J15 (Children...'... 48 0.79 1 ( AC232940 ) Bos taurus Y Chr NOVECTOR CH240-62I11 (Children's... 48 0.79 1 ( A...C232929 ) Bos taurus Y Chr NOVECTOR CH240-291F15 (Children'... 48 0.79 1 ( AC232768 ) Bos taurus Y Chr NOVECTOR CH240-460C15 (Childre...n'... 48 0.79 1 ( AC232755 ) Bos taurus Y Chr NOVECTOR CH240-409J7 (Children...'s... 48 0.79 1 ( AC232753 ) Bos taurus Y Chr NOVECTOR CH240-45P20 (Children's... 48 0.7

Suplementos energéticos para recria de novilhas de corte em pastagens anuais: desempenho animal Energy supplements for beef heifers rearing at annual pastures: animal performance

Directory of Open Access Journals (Sweden)

Davi Teixeira dos Santos

2005-02-01

Full Text Available Foi avaliado o desempenho de novilhas de corte dos três aos doze meses de idade, mantidas em pastagem cultivada logo após o desmame (experimento 1 e no primeiro inverno pós-desmame (experimento 2, com ou sem o fornecimento de suplementos energéticos. No período de 16/02 a 21/04/2001, as novilhas permaneceram em pastagem de milheto, exclusivamente sob pastejo (PAST1, suplementadas com grão de milho moído (PAST1/M ou com polpa cítrica peletizada e moída (PAST1/P. No período de 13/07 a 09/10/2001, as novilhas foram mantidas em pastagem de aveia preta e azevém, sem suplementação (PAST2, suplementadas com grão de milho moído (PAST2/M ou suplementadas com casca de soja (PAST2/C. Peso vivo (PV, ganho de peso diário médio (GDM e escore de condição corporal (ECC foram avaliados. No experimento 1, os animais suplementados apresentaram maior PV final, GDM e ECC que os não-suplementados, não diferindo entre si. No experimento 2, as novilhas suplementadas com casca de soja apresentaram maior GDM e PV final que as não-suplementadas, enquanto as suplementadas com grão de milho ficaram em posição intermediária. O maior ECC foi obtido pelos animais de PAST2/C, seguidos de PAST2/M e, por último, de PAST2. Novilhas de corte desmamadas aos 60-90 dias devem ser suplementadas no período inicial pós-desmama, para que atinjam desenvolvimento satisfatório nesta fase do crescimento. Os subprodutos polpa cítrica e casca de soja podem substituir o grão de milho como suplementos energéticos para recria de novilhas de corte.It was evaluated beef heifers performance from three until twelve months of age, when they were reared in cultivated pasture soon after their weaning (experiment 1 and in the first winter post-weaning (experiment 2, with or without the supply of energy supplements to the animals. From 02/16 to 04/21/2001, the heifers stayed in Pearl Millet pasture, exclusively under grazing (PAST1; supplemented with milled corn grain (PAST

A Novel Protocol to Assess Acclimation Rate in Bos taurus Heifers during Yard Weaning

Directory of Open Access Journals (Sweden)

Jessica E. Monk

2018-04-01

Full Text Available The speed with which animals acclimate to a new environment could be an important measure of ability to cope with management induced stress. This study developed a measure of acclimation rate in a group of 50 Bos taurus heifers during yard weaning over nine days. We recorded the time and order in which heifers moved through a novel funnel structure into a feeding yard daily. We hypothesised that addition of an obstacle at the entrance would increase the time it took heifers to move through the funnel, but that they would acclimate to the obstacle over a three-day period. The change in latency to move through could then be used as a measure of acclimation rate. We hypothesised that individuals which acclimated to obstacles at a faster rate might display favourable temperament as assessed by flight time. All heifers took longer to move through the funnel after a novel object was introduced, then latency decreased over the following two days while the object was present. This indicates the protocol could be useful for measuring acclimation rate at a group level. Individual acclimation rate variables, measured as change in times and orders of heifers between test days, did not appear to have any consistent relationships with flight time or weight change during or post-weaning (p > 0.05. We concluded that the protocol was inappropriate for assessing acclimation rate at an individual level, due to social effects while testing heifers as a group. Heifers which were consistently one of the first 20 to move through the funnel had a significantly greater average weight 5 and 10 months post-weaning (345 ± 9 kg and 518 ± 10 kg respectively than heifers which were consistently one of the last 20 through the funnel (311 ± 8 kg and 484 ± 8 kg respectively; p < 0.001. This may indicate order of movement through the funnel was related to feeding motivation or another aspect of temperament not reflected by flight time.

Investigation of body and udder skin surface temperature differentials as an early indicator of mastitis in Holstein Friesian crossbred cows using digital infrared thermography technique

Directory of Open Access Journals (Sweden)

M. Sathiyabarathi

2016-12-01

Full Text Available Aim: The objective of this study was to investigate the ability of infrared thermography (IRT technique and its interrelationship with conventional mastitis indicators for the early detection of mastitis in Holstein Friesian (HF crossbred cows. Materials and Methods: A total of 76 quarters of lactating HF crossbred (Bos indicus × Bos taurus cows (n=19 were monitored for body temperature (i.e., eye temperature and udder skin surface temperature (USST before milking using forward-looking infrared (FLIR i5 camera. Milk samples were collected from each quarter and screened for mastitis using Somatic Cell Count (SCC, Electrical Conductivity (EC, and California mastitis test. Thermographic images were analyzed using FLIR Quick Report 1.2 image analysis software. Data on body and USST were compiled and analyzed statistically using SPSS 16.0 and Sigmaplot 11. Results: The mean±standard deviation (SD body (37.23±0.08°C and USST (37.22±0.04°C of non-mastitic cow did not differ significantly; however, the mean USST of the mastitis-affected quarters were significantly higher than the body temperature and USST of unaffected quarters (p37.61°C. Conclusion: It is concluded that infrared thermal imaging technique could be used as a potential noninvasive, quick cowside diagnostic technique for screening and early detection of SCM and clinical mastitis in crossbred cows.

Some effects of partial suckling on milk yield, reproduction and calf growth in crossbred dairy cattle in north east coastal Tanzania

Energy Technology Data Exchange (ETDEWEB)

Bryant, M J [Department of Agriculture, University of Reading, Reading (United Kingdom); Msanga, Y N [Livestock Research Centre, Ministry of Agriculture, Tanga (Tanzania)

1999-07-01

Two experiments are described where a progeny of Bos taurus x Bos indicus crossbred cows were reared by partial suckling or bucket rearing (Experiment I), and partially suckled calves were weaned at 12 or 24 weeks of age (Experiment II). The results of Experiment I suggest that calf rearing method had no significant effect in the yield of milk extracted from the cows by hand milking although there were effects on the shape of the lactation curve. Cows showed similar patterns of live weight and body condition losses and gains and there were no significant effects on the length of the post partum interval. Suckled calves were lighter at weaning (P <0.01) but there were no differences in live weight between treatments at 52 weeks of age. The main advantage of partial suckling was that the calves took advantage of residual milk which was estimated as 28-29% of the total yield. The results from Experiment II suggest that there were no advantages in terms of milk yield or calf growth by extending the suckling period to 24 weeks. The post partum intervals observed in Experiment II were substantially longer than those in Experiment I, possibly because of greater live weight/body condition losses experienced by cows in the second experiment. (author) 22 refs, 8 figs, 2 tabs

Influence of season of birth on growth and reproductive development of Brahman bulls.

Science.gov (United States)

Tatman, Shawn R; Neuendorff, Don A; Wilson, Timothy W; Randel, Ronald D

2004-07-01

Seasonal effects on reproduction are more dramatic in Bos indicus than Bos taurus cattle. This experiment evaluated reproductive development of fall- (n=7) versus spring- (n = 10) born Brahman bulls to determine if season of birth affects reproductive development. Measurements of growth and reproductive development began after weaning and continued at bi-weekly intervals until each bull reached sexual maturity. Different stages of sexual development were classified according to characteristics of the ejaculate and included first sperm in the ejaculate, puberty (> 50 x 10(6) sperm/ejaculate), and sexual maturity (two ejaculates with > 500 = 10(6) sperm/ejaculate). Average daily increases in all measured traits were similar in fall- and spring-born bulls and there were no differences in age, body weight, scrotal circumference, or paired testis volume between groups at first sperm or puberty. However, fall-born bulls were older (P days versus 481 days, respectively) as the interval between puberty and sexual maturity was longer (P days versus 54 days, respectively). The prolonged interval between puberty and sexual maturity in fall-born calves coincided with a short photoperiod (winter) whereas the short interval between puberty and sexual maturity in spring-born calves coincided with a long photoperiod (summer). In conclusion, season of birth affected sexual development; photoperiod might be involved in regulating testicular function immediately after puberty in Brahman bulls.

EFFECT OF THREE PROTOCOLS OF SYNCHRONIZATION OF ESTRUS IN THE RATE OF PREGNANCY OF TWO RACIAL GROUPS OF LACTATING COWS IN PUERTO INCA DISTRICT

Directory of Open Access Journals (Sweden)

Ramirez RJ

2015-12-01

Full Text Available Las bajas tasas de preñez en vacas cruzadas en el trópico húmedo, ha dificultado la implementación de los programas de inseminación. El objetivo del presente estudio fue determinar el efecto de tres protocolos de inseminación a tiempo fijo utilizando implante de progesterona y combinaciones, en la fertilidad de dos grupos raciales de bovinos. Se utilizaron vacas post parto (60 a 80 días de 4 a 6 años edad y condición corporal 3 a 3.5, que pertenecían a dos grupos raciales; B. indicus (n=30 y B. taurus (n=30; y cada grupo racial subdivididos en tres tratamientos de sincronización de celo CIDR+BE (n=10, CIDR+BE+GnRH (n=10 y CIDR+Synch (n=10. La eficiencia reproductiva lograda después de la aplicación de los protocolos de sincronización de celo a base de progesterona en combinación con bajas dosis estradiol y GnRH, fue de 80 – 100% de tasa de detección de celo y 45 a 60% de tasa de preñez. Concluyendo que no existe efecto de los tres protocolos de inseminación a tiempo fijo utilizando implante de progesterona y combinaciones en la fertilidad de dos grupos raciales de bovinos.

Nonparticipation in Adult Education: From Self-Perceptions to Alternative Explanations

Science.gov (United States)

Porras-Hernandez, Laura Helena; Salinas-Amescua, Bertha

2012-01-01

In this article, the authors propose that dispositional factors do not sufficiently explain nonparticipation in adult education programs. Many nations report low participation rates, but empirical studies have usually been conducted with enrolled adults. This study, however, included 279 poorly educated mestizas and Native women in two regions of…

Grey Nurse Shark ( Carcharias taurus) Diving Tourism: Tourist Compliance and Shark Behaviour at Fish Rock, Australia

Science.gov (United States)

Smith, Kirby; Scarr, Mark; Scarpaci, Carol

2010-11-01

Humans can dive with critically endangered grey nurse sharks ( Carcharias taurus) along the east coast of Australia. This study investigated both compliance of tourist divers to a code of conduct and legislation and the behaviour of grey nurse sharks in the presence of divers. A total of 25 data collection dives were conducted from December 2008 to January 2009. Grey nurse shark and diver behaviour were documented using 2-min scan samples and continuous observation. The proportion of time spent observing human-shark interactions was 9.4% of total field time and mean human-shark interaction time was 15.0 min. Results were used to gauge the effectiveness of current management practices for the grey nurse shark dive industry at Fish Rock in New South Wales, Australia. Grey nurse shark dive tourists were compliant to stipulations in the code of conduct and legislation (compliance ranged from 88 to 100%). The research detailed factors that may promote compliance in wildlife tourism operations such as the clarity of the stipulations, locality of the target species and diver perceptions of sharks. Results indicated that grey nurse sharks spent the majority of their time milling (85%) followed by active swimming (15%). Milling behaviour significantly decreased in the presence of more than six divers. Distance between sharks and divers, interaction time and number of sharks were not significantly correlated with grey nurse shark school behaviour. Jaw gaping, rapid withdrawal and stiff or jerky movement were the specific behaviours of grey nurse sharks that occurred most frequently and were associated with distance between divers and sharks and the presence of six or more divers. Revision of the number of divers allowed per interaction with a school of grey nurse sharks and further research on the potential impacts that shark-diving tourism may pose to grey nurse sharks is recommended.

Grey nurse shark (Carcharias taurus) diving tourism: Tourist compliance and shark behaviour at Fish Rock, Australia.

Science.gov (United States)

Smith, Kirby; Scarr, Mark; Scarpaci, Carol

2010-11-01

Humans can dive with critically endangered grey nurse sharks (Carcharias taurus) along the east coast of Australia. This study investigated both compliance of tourist divers to a code of conduct and legislation and the behaviour of grey nurse sharks in the presence of divers. A total of 25 data collection dives were conducted from December 2008 to January 2009. Grey nurse shark and diver behaviour were documented using 2-min scan samples and continuous observation. The proportion of time spent observing human-shark interactions was 9.4% of total field time and mean human-shark interaction time was 15.0 min. Results were used to gauge the effectiveness of current management practices for the grey nurse shark dive industry at Fish Rock in New South Wales, Australia. Grey nurse shark dive tourists were compliant to stipulations in the code of conduct and legislation (compliance ranged from 88 to 100%). The research detailed factors that may promote compliance in wildlife tourism operations such as the clarity of the stipulations, locality of the target species and diver perceptions of sharks. Results indicated that grey nurse sharks spent the majority of their time milling (85%) followed by active swimming (15%). Milling behaviour significantly decreased in the presence of more than six divers. Distance between sharks and divers, interaction time and number of sharks were not significantly correlated with grey nurse shark school behaviour. Jaw gaping, rapid withdrawal and stiff or jerky movement were the specific behaviours of grey nurse sharks that occurred most frequently and were associated with distance between divers and sharks and the presence of six or more divers. Revision of the number of divers allowed per interaction with a school of grey nurse sharks and further research on the potential impacts that shark-diving tourism may pose to grey nurse sharks is recommended.

Evidence of solitary chemosensory cells in a large mammal: the diffuse chemosensory system in Bos taurus airways

Science.gov (United States)

Tizzano, Marco; Merigo, Flavia; Sbarbati, Andrea

2006-01-01

The diffuse chemosensory system (DCS) of the respiratory apparatus is composed of solitary chemosensory cells (SCCs) that resemble taste cells but are not organized in end organs. The discovery of the DCS may open up new approaches to respiratory diseases. However, available data on mammalian SCCs have so far been collected from rodents, the airways of which display some differences from those of large mammals. Here we investigated the presence of the DCS and of SCCs in cows and bulls (Bos taurus), in which the airway cytology is similar to that in humans, focusing our attention on detection in the airways of molecules involved in the transduction cascade of taste [i.e. α-gustducin and phospholipase C of the β2 subtype (PLCβ2)]. The aim of the research was to extend our understanding of airway chemoreceptors and to compare the organization of the DCS in a large mammal with that in rodents. Using immunocytochemistry for α-gustducin, the taste buds of the tongue and arytenoid were visualized. In the trachea and bronchi, α-gustducin-immunoreactive SCCs were frequently found. Using immunocytochemistry for PLCβ2, the staining pattern was generally similar to those seen for α-gustducin. Immunoblotting confirmed the expression of α-gustducin in the tongue and in all the airway regions tested. The study demonstrated the presence of SCCs in cows and bulls, suggesting that DCSs are present in many mammalian species. The description of areas with a high density of SCCs in bovine bronchi seems to indicate that the view of the DCS as made up of isolated cells totally devoid of ancillary elements is probably an oversimplification. PMID:16928202

Correlations of capture, transport, and nutrition with spinal deformities in sandtiger sharks, Carcharias taurus, in public aquaria.

Science.gov (United States)

Anderson, Paul A; Huber, Daniel R; Berzins, Ilze K

2012-12-01

A number of captive sandtiger sharks (Carcharias taurus) in public aquaria have developed spinal deformities over the past decade, ranging in severity from mild curvature to spinal fracture and severe subluxation. To determine the frequency and etiologic basis of this disease, U.S. public aquaria participated in a two-stage epidemiologic study of resident sharks: 1) a history and husbandry survey and 2) hematology, clinical chemistry, and radiography conducted during health exams. Eighteen aquaria submitted data, samples, or both from 73 specimens, including 19 affected sharks (26%). Sharks caught off the Rhode Island coast or by pound net were smaller at capture and demonstrated a higher prevalence of deformity than did larger sharks caught from other areas via hook and line. Relative to healthy sharks, affected sharks were deficient in zinc, potassium, and vitamins C and E. Capture and transport results lead to two likely etiologic hypotheses: 1) that the pound-net capture process induces spinal trauma that becomes exacerbated over time in aquarium environments or 2) that small (and presumably young) sharks caught by pound net are exposed to disease-promoting conditions (including diet or habitat deficiencies) in aquaria during the critical growth phase of their life history. The last hypothesis is further supported by nutrient deficiencies among affected sharks documented in this study; potassium, zinc, and vitamin C play critical roles in proper cartilage-collagen development and maintenance. These correlative findings indicate that public aquaria give careful consideration to choice of collection methods and size at capture and supplement diets to provide nutrients required for proper development and maintenance of cartilaginous tissue.

Estimación de la Heterosis para Producción de Leche Vendible, Intervalo entre Partos y Duración de la Lactancia en Ganado Cruzado

Directory of Open Access Journals (Sweden)

Montoya S. Camilo

1998-12-01

Full Text Available En la presente investigación se revisaron 4948 datos referentes a lactancias de vacas en razas B taurus y B indicus, los cuales se obtuvieron entre los años 1986 y 1994 en las Ganaderías La Unión y La K, localizadas en los municipios Plato y Santa Ana en el departamento de Magdalena; San Fernando Pinillos y Magangué en el departamento de Bolívar; y Playones de Sucre y Buenavista en el departamento de Sucre. Para determinar la influencia de los diferentes efectos tanto genéticos como no genéticos sobre las características a estudiar, se utilizó el programa de mínimos cuadrados de Harvey (1988. Los efectos tenidos en cuenta en los modelos para las características leche vendible, días de lactancia e intervalo entre partos fueron: El grupo genético materno, la época y año de parto, número de parto, y hato. Como cavariables se tuvieron en cuenta el peso al destete, la producción de leche duración de la lactancia y el intervalo entre partos según el modelo a estudiar. De los factores 110 genéticos la gran mayoría dieron efecto significativo a los niveles del (P~0.05; no presentaron significancia la época para la duració1l de la lactancia y el grupo genético para el intervalo entre partos; y las covariables intervalo entre partos para la producción de leche y producción de leche en el modelo para el intervalo entre partos. La estimación de la heterosis se hizo una vez realizados los contrastes ortogonales entre los grupos genéticos para las características en las cuales el grupo racial presentó significancia en los ANAVAS. La heterosis obtenida para la producción de leche teniendo como base el promedio de las raza Criolla y el promedio entre el Criollo y el Cebú fue respectivamente: ½ Taurus-1/2 Criollo (17.95% y 22.5%; ½ Taurus - ½ Cebú (9% y 14%; Trihíbrido (7.7% y 11. 7%; ¼ Taurus- ¾ Cebú (5% y 9%; ½ Cebú- ½ Criollo (1.05% y 4.8%; y el ¾ Cebú- ½ Criollo (-7.88% y -4.46%; todas altamente

Evaluation of indirect TaSP enzyme-linked immunosorbent assay for diagnosis of tropical theileriosis in cattle (Bos indicus) and water buffaloes (Bubalus bubalis) in Egypt.

Science.gov (United States)

Mohamed, Amr M; Abdel-Rady, Ahmed; Ahmed, Laila S; El-Hosary, Amira

2012-05-25

The aim of the present study was to evaluate the validity of Theileria annulata surface protein (TaSP)-ELISA, in comparison with traditional microscopic test, for the diagnosis of T. annulata infection among Egyptian baladi cattle (Bos taurus) and water buffaloes (Bubalus bubalis). Molecular confirmation of infection using T. annulata merozoite surface (Tams-1) target amplification by PCR was used as a gold standard. A total of 76 clinically suspected animals including 64 baladi cattle and 12 water buffaloes were investigated in the current study by the three methods. Based on the PCR-confirmed results, the evaluation study revealed higher sensitivity of TaSP-ELISA (72.9% and 75%) as compared to microscopic examination (58.3% and 50%) among cattle and buffaloes, respectively. On the other hand, the specificity of TaSP-ELISA in diagnosis of T. annulata infection was higher (87.5%) in baladi cattle as compared to water buffaloes (37.5%). In conclusion, TaSP-ELISA was shown to be suitable for the diagnosis of T. annulata infection in cattle under field conditions. Copyright © 2011 Elsevier B.V. All rights reserved.

Dietas pós-eclosão suplementadas com fontes de gordura e acrescidas de taurina e glicina sobre a morfometria intestinal e o desempenho de frangos de corte de um a 21 dias

Directory of Open Access Journals (Sweden)

J.I.M. Fernandes

Full Text Available RESUMO O objetivo deste estudo foi avaliar o efeito do fornecimento de dietas pós-eclosão suplementadas com diferentes fontes de gordura insaturada e adicionadas ou não de taurina e glicina sobre o desempenho produtivo, a biometria e a morfometria do intestino delgado de pintos de corte de um a 21 dias de idade. Foram utilizados 480 pintos de corte machos de um dia de idade da linhagem Cobb. O delineamento foi inteiramente ao acaso, em esquema fatorial 2 x 4, com e sem suplementação de taurina e glicina e quatro dietas (controle, óleo de peixe, de soja e de girassol, totalizando oito tratamentos com seis repetições de 10 aves cada. As rações experimentais foram fornecidas de zero a quatro dias de idade. O desempenho zootécnico foi avaliado ao alojamento e aos quatro, sete e 21 dias de idade. Nestas mesmas datas, foram sacrificadas duas aves por unidade experimental para biometria do intestino e histomorfometria da mucosa do intestino. A adição de diferentes fontes de gordura e a suplementação de glicina e taurina às dietas de transição não influenciaram o desempenho produtivo de um a 21 dias. A suplementação das dietas com glicina e taurina alterou a morfologia da mucosa intestinal, principalmente do duodeno, resultando em maior comprimento do vilo e relação vilo:cripta. Entretanto, parte dos efeitos positivos depende do tipo de óleo adicionado, mostrando que dietas pós-eclosão acrescidas de fontes de lipídios podem ser benéficas no desenvolvimento da capacidade funcional do intestino de frangos de corte.

Effect of refrigeration systems upon frozen bull sperm viability assessed by computer-assisted sperm analysis and fluorescent probesEfeito de sistemas de refrigeração sobre a viabilidade do sêmen bovino congelado analisado por meio de sistema computadorizado e sondas fluorescentes

Directory of Open Access Journals (Sweden)

Frederico Ozanam Papa

2012-10-01

Full Text Available Sperm cryopreservation success depends upon the maintenance of spermatozoa fertility potential. Sperm cells must preserve both integrity and functionality of several cell structures. The stabilization phase must allow the exit of water from the sperm cells via osmosis. This study aimed to compare the effect of refrigeration in the commercial refrigerator (CR and the transport/refrigeration box (TRB upon the viability of frozen bull sperm diluted in three different extenders (A, B and C. Ten Nellore bulls, Bos taurus indicus maintained in Artificial Insemination Center were used and the spermatozoa samples was assessed for Plasma Membrane Integrity and CASA evaluation. The stabilization phase (5°C/4 hours was performed in the CR as well as in the TRB, and then samples were exposed to nitrogen vapor during 20 minutes and then plunged into nitrogen. The statistical analysis was done using the variance analysis and the significance level was set at 5%. In the CR the post-thawing parameters for PM and ALH were higher (p O sucesso da criopreservação do sêmen depende da manutenção do potencial de fertilidade dos espermatozoides. Nos espermatozoides deve haver a preservação da integridade e funcionalidade de várias das suas estruturas. A fase de estabilização permite a saída de água dos espermatozoides por osmose. Este estudo tem o objetivo de comparar o efeito da refrigeração em refrigerador comercial (RC e em caixa de transporte refrigerada (CTR na viabilidade do sêmen congelado bovino diluído em três diferentes meios (A, B e C. Dez touros Nelore, Bos taurus indicus mantidos em central de inseminação artificial foram utilizados e as amostras de sêmen analisadas para checar a integridade das membranas plasmáticas e por meio da análise computadorizada (CASA. A fase de estabilização (5°C/4 horas foi realizada em RC e em CTR, sendo as amostras expostas ao vapor de nitrogênio durante 20 minutos e após mergulhadas no nitrog

Genome-wide identification, classification, and functional analysis of the basic helix-loop-helix transcription factors in the cattle, Bos Taurus.

Science.gov (United States)

Li, Fengmei; Liu, Wuyi

2017-06-01

The basic helix-loop-helix (bHLH) transcription factors (TFs) form a huge superfamily and play crucial roles in many essential developmental, genetic, and physiological-biochemical processes of eukaryotes. In total, 109 putative bHLH TFs were identified and categorized successfully in the genomic databases of cattle, Bos Taurus, after removing redundant sequences and merging genetic isoforms. Through phylogenetic analyses, 105 proteins among these bHLH TFs were classified into 44 families with 46, 25, 14, 3, 13, and 4 members in the high-order groups A, B, C, D, E, and F, respectively. The remaining 4 bHLH proteins were sorted out as 'orphans.' Next, these 109 putative bHLH proteins identified were further characterized as significantly enriched in 524 significant Gene Ontology (GO) annotations (corrected P value ≤ 0.05) and 21 significantly enriched pathways (corrected P value ≤ 0.05) that had been mapped by the web server KOBAS 2.0. Furthermore, 95 bHLH proteins were further screened and analyzed together with two uncharacterized proteins in the STRING online database to reconstruct the protein-protein interaction network of cattle bHLH TFs. Ultimately, 89 bHLH proteins were fully mapped in a network with 67 biological process, 13 molecular functions, 5 KEGG pathways, 12 PFAM protein domains, and 25 INTERPRO classified protein domains and features. These results provide much useful information and a good reference for further functional investigations and updated researches on cattle bHLH TFs.

Taurus

Science.gov (United States)

Murdin, P.

2000-11-01

(the Bull; abbrev. Tau, gen. Tauri; area 797 sq. deg.) A northern zodiacal constellation which lies between Aries and Orion, and culminates at midnight in late November. It is one of the oldest constellations, dating back to when the Sun was in that part of the sky at the vernal (spring) equinox, between about 4000 and 1800 BC. Later, in Greek mythology, it was identified with the form assumed by...

Democratizing Academic Writing: A Revision of an Experience of Writing an Autoethnographic Dissertation in Color

Science.gov (United States)

Polanco, Marcela

2013-01-01

In this paper, I revise my experience of writing an autoethnographic (Ellis, 2004) dissertation in the field of family therapy as a Colombian mestiza. I discuss how I grappled with my writing, and, in the process, stumbled into matters of democratizing texts. I problematize male-dominant academic standards, telling of the tensions when maneuvering…

A deterministic simulation study of embryo marker-assisted selection for age at first calving in Nellore (Bos indicus beef cattle

Directory of Open Access Journals (Sweden)

Artur J.M. Rosa

2007-01-01

Full Text Available We used deterministic simulation of four alternative multiple ovulation and embryo manipulation (MOET closed nucleus schemes to investigate the benefits of using marker-assisted selection (MAS of Nellore (Bos indicus beef cattle embryos prior to transplantation to reduce the age at first calving (AFC. We found that MAS resulted in increased genetic gain as compared to selection without AFC quantitative trait loci (AFC-QTL information. With single-stage selection the genetic response (GR increased as follows: GR = 0.68% when the AFC-QTL explained 0.02 of the AFC additive genetic variance (sigma2A; GR = 1.76% for AFC-QTL explaining 0.05 sigma2A; GR = 3.7% for AFC-QTL explaining 0.1 sigma2A; and GR = 55.76% for AFC-QTL explaining 0.95 sigma2A. At the same total selected proportion, two-stage selection resulted in less genetic gain than single stage MAS at two-years of age. A single stage selection responses of > 95% occurred with pre-selected proportions of 0.4 (0.1 sigma2A explained by AFC-QTL, 0.2 (0.3 sigma2A explained by AFC-QTL and 0.1 (0.5 sigma2A explained by AFC-QTL, indicating that the combined use of MAS and pre-selection can substantially reduce the cost of keeping recipient heifers in MOET breeding schemes. When the number of recipients was kept constant, the benefit of increasing embryo production was greater for the QTL explaining a higher proportion of the additive genetic variance. However this advantage had a diminishing return especially for QTL explaining a small proportion of the additive genetic variance. Thus, marker assisted selection of embryos can be used to achieve increased genetic gain or a similar genetic response at reduced expense by decreasing the number of recipient cows and number of offspring raised to two-years of age.

Resposta hemática de tilápias-do-nilo alimentadas com dietas suplementadas com colina e submetidas a estímulo por baixa temperatura Hematic response of Nile tilapia fed diets supplemented with choline and submitted to stimulus by low temperature

Directory of Open Access Journals (Sweden)

Ademir Calvo Fernandes Junior

2010-08-01

Full Text Available Esta pesquisa foi realizada com o objetivo de avaliar a resposta hemática de tilápias-do-nilo (Oreochromis niloticus arraçoadas com dietas suplementadas com colina e submetidas a estímulo por baixa temperatura. O período experimental foi realizado em duas etapas: a primeira, de 109 dias, e a segunda, de 7 dias. Durante a primeira etapa, foram utilizados 192 alevinos com peso médio inicial de 4 g, distribuídos em 32 tanques-rede de 200 L instalados em aquários de mil litros. As rações foram formuladas de modo a apresentar 28,0% de proteína digestível e 3.100,0 kcal ED/kg e mesma concentração de aminoácidos. O delineamento experimental foi inteiramente casualizado com oito tratamentos e quatro repetições. As rações foram suplementadas com colina (cloreto de colina 60,0%, de modo a apresentar 100,0; 200,0; 400,0; 600,0; 800,0; 1.000,0 e 1.200,0 mg/kg de ração, e avaliadas em comparação a uma ração sem suplementação. Após o período de 109 dias, foram efetuadas as análises hematológicas dos peixes. Após as análises, os peixes foram transferidos para a sala de desafio e distribuídos em 24 aquários, onde foram mantidos a 17ºC durante sete dias. Após esse período, foram feitas as mesmas análises do período anterior ao desafio. A suplementação de colina não influenciou a eritropoiese ao estímulo pelo frio. A suplementa��ão dietética de colina não interfere na síntese de eritrócitos e leucócitos e a temperatura de 17,0ºC determina linfopenia e neutrofilia.The aim of this study was to evaluate the hematic response of Nile tilapia (Oreochromis niloticus fed diets supplemented with choline and submitted to temperature stress. The experimental period was realized in two phases: the first, during 109 days, and the second, for seven days. During the first stage, 192 fingerlings with average initial weight of 4 g were distributed in 32 net cages (200 L allocated in 1,000-L aquaria. The diets were formulated

Níveis decrescentes de proteína em dietas suplementadas com complexo enzimático, para coelhos em crescimento. 2. Parâmetros digestivos e composição química do conteúdo cecal

Directory of Open Access Journals (Sweden)

Santiago G.S.

2000-01-01

Full Text Available Estudou-se o efeito da redução do nível protéico da dieta, com e sem suplementação enzimática, sobre as características digestivas e composição do conteúdo cecal de coelhos em crescimento. Usou-se um delineamento inteiramente ao acaso, com 54 coelhos da raça Nova Zelândia Branco, de ambos os sexos, desmamados com 35 dias de idade, e divididos em cinco grupos (tratamentos, quatro de 11 e um de 10 coelhos. Os tratamentos constituíram-se de dietas calculadas como isoenergéticas e isoaminoacídicas, com 17, 16, 15 e 14% de proteína bruta (PB, suplementadas com 0,05% de um complexo enzimático comercial (Vegproâ com atividades de protease e celulase e uma dieta controle com 17% PB sem adição do complexo enzimático. Os pesos do trato digestivo cheio, ceco cheio, ceco vazio e conteúdo cecal foram significativamente afetados pelo nível de PB da dieta. Das frações químicas do conteúdo cecal (matéria seca, proteína bruta, fibra em detergente ácido, matéria orgânica e nitrogênio amoniacal, matéria orgânica, nitrogênio amoniacal e proporções molares dos ácidos acético e propiônico foram significativamente afetadas pelo nível de PB da dieta. Os resultados permitem concluir que a redução do nível de PB da dieta para 14 % não influenciou negativamente as características estudadas.

Physical composition, primary cuts and meat cuts of carcasses from Zebu and Bos taurus X Bos indicus crossbred cattle Composição física, cortes primários e cortes cárneos da carcaça de bovinos Zebu e de mestiços Bos taurus X Bos indicus

Directory of Open Access Journals (Sweden)

Daniel Perotto

2009-09-01

Full Text Available Data on hot carcass weight, hot carcass yield, hindquarter weights and physical components, forequarter and spare ribs, and the weights of the main commercial cuts from the hindquarters of twenty young intact bulls were assessed. The animals, belonging to four genetic groups (Nellore, ½ Guzerath + ½ Nellore (½ G + ½ N, ½ Red Angus + ½ Nellore (½ R + ½ N and ½ Marchigiana + ½ Nellore (½ M + ½ N, were raised on pastures, finished in dry lot and slaughtered at live weights ranging from 445 to 517 kg, and at ages ranging from 679 to 863 days. During the dry lot period, which lasted 114 days, animals were fed sorghum silage offered ad libitum, and a concentrate (13.5 MJ of ME, 18% CP in the DM at 1% live weight per day. Genetic group influenced hot carcass weight, forequarter weight, meat weight in the spare ribs, as well as meat and bone weights in the forequarter. Animals in the ½ M + ½ N group were superior both to those in the Nellore and in the ½ G + ½ N groups for hot carcass weight, forequarter weight and meat weight in the spare ribs. The ½ M + ½ N group also differed from the ½ R + ½ N and from the ½ G + ½ N groups in terms of forequarter weight and meat weight in the forequarter, respectively. Conversely, forequarter bone weight of ½ M + ½ N animals was higher than in animals from the Nellore and the ½ R + ½ N groups, respectively. There was no effect of genetic group on hindquarter cuts, except for higher shank and knuckle weights in the ½ M + ½ N group compared to the ½ G + ½ N and Nellore groups, respectively.Foram avaliados o peso e o rendimento de carcaça quente, os pesos dos cortes primários, os pesos dos componentes físicos dos cortes primários e os pesos dos principais cortes comerciais do traseiro especial de 20 bovinos machos não-castrados dos grupos genéticos Nelore, ½ Guzerá + ½ Nelore (½ G + ½ N, ½ Red Angus + ½ Nelore (½ R + ½ N e ½ Marchigiana + ½ Nelore (½ M + ½ N terminados em confinamento. O experimento durou em média 114 dias, período no qual os animais foram alimentados com silagem de sorgo à vontade e concentrado composto de 73,5% de grão de milho, 25% de caroço de algodão e 1,5% de ureia, perfazendo 13,5 MJ de EM e 18% de PB por kg de MS, fornecido à base de 1% do peso vivo do animal por dia. O grupo genético influenciou os pesos de carcaça quente, do dianteiro, da carne do costilhar e os pesos da carne e dos ossos do dianteiro. Animais do grupo ½ M + ½ N superaram os Nelore e os ½ G + ½ N em peso de carcaça quente e em peso do corte dianteiro e da porção de carne do costilhar. O grupo ½ M + ½ N distinguiu-se também do ½ R + ½ N quanto ao peso de dianteiro e do ½ G + ½ N quanto ao peso da carne do dianteiro. Por outro lado, a quantidade de ossos do dianteiro dos animais ½ M + ½ N foi superior à dos animais dos grupos Nelore e ½ R + ½ N. Não houve efeito de grupo genético sobre os cortes resultantes do desdobramento do traseiro especial, exceto pelo fato de os animais ½ M + ½ N apresentarem maior peso de músculo em comparação aos ½ G + ½ N e maior peso de patinho em comparação aos Nelore.

Serum biochemical reference intervals for free-living Sand Tiger sharks (Carcharias taurus) from east Australian waters.

Science.gov (United States)

Otway, Nicholas M

2015-06-01

Sharks are top-order predators in ocean food chains and the star attractions in aquaria worldwide. Unfortunately, blood biochemistry reference intervals (RI) have been determined for few species. The study aims to establish serum biochemical RI for free-living Sand Tiger sharks (Carcharias taurus) off eastern Australia. Thirty-seven sharks were captured and their sex, length, weight, reproductive maturity, and health status were recorded. After blood collection, serum analytes were quantified using standard analytical and statistical methods. Reference intervals, means, medians, and 90% confidence intervals were generated. Physiologic data from live and necropsied sharks were used to enhance the study results. Thirty healthy sharks were included in the study. Albumin could not be detected. With the exception of ALP activity, values were unaffected by sex, length, weight, age, and life-history stage. The means (RI) were: sodium 258 (249-267) mmol/L, potassium 5.0 (4.3-5.7) mmol/L, chloride 242 (227-257) mmol/L, inorganic phosphate 1.8 (1.7-2.0) mmol/L, total calcium 3.9 (3.3-4.4) mmol/L, magnesium 1.9 (1.6-2.2) mmol/L, glucose 2.7 (2.2-3.2) mmol/L, urea 377 (360-394) mmol/L, ALP 20 (8-31) U/L, ALT 3 U/L (no RI), AST 29 (13-45) U/L, CK 42 (5-79) U/L, total protein 30 (24-36) g/L, triglyceride 0.3 (0.1-0.6) mmol/L, cholesterol 1.4 (0.9-2.1) mmol/L, creatinine 32 μmol/L (no RI), total bilirubin 1.5 μmol/L (no RI), and osmolarity 1082 (1027-1136) mmol/L. These preliminary RI will assist with the clinical evaluation and treatment of captive and free-living Sand Tiger sharks worldwide. Studies with more animals will increase the precision of upper and lower reference limits. © 2015 American Society for Veterinary Clinical Pathology.

Situación de la violencia de género en comunidades indígenas y mestizas de los municipios de Siuna y Rosita, RAAN

Directory of Open Access Journals (Sweden)

Jacoba Dávila Molina

2012-10-01

Full Text Available Esta investigación se realizó en cuatro comunidades mestizas y una indígena, en los municipios de Siuna y Rosita de la Región Autónoma del Atlántico Norte de Nicaragua en el 2010, la cual aborda la violencia basada en género. La metodología que se utilizó fue cualitativa y recoge las vivencias, percepciones y sentimientos de las mujeres víctimas de violencia y de las instancias encargadas de la atención a estos casos. Para el levantamiento de la información se utilizaron las técnicas de entrevista guiada y observación, las que se aplicaron a los grupos formados por representantes de las instituciones encargadas de hacer justicia, líderes comunitarios y mujeres víctimas de la violencia.Los resultados muestran que  existen mujeres en el área rural afectadas en sus derechos y deberes, que merecen una atención  especial por parte de las instancias competentes, y que en su estado de vulnerabilidad no afrontan la situación de manera adecuada dado que este tipo de acontecimiento, que pone en riesgo su integridad física y moral, donde prevalece la violencia psicológica,  seguida de la violencia física, económica  y sexual, es aceptada hasta el punto de convertirse en su propia manera de vivir. En la investigación se identificaron dos rutas críticas  a donde la minoría de mujeres entrevistadas ha acudido. Se cuenta con instituciones que brindan atención especializada a las mujeres; sin embargo, no se dispone del apoyo de la sociedad, hay carencia de recursos económicos y humanos para dar respuesta  de manera beligerantes a esta problemática.SummaryThis research is related to violence based on gender, and it was conducted in four mestizo communities and one indigenous community, from the municipalities of Siuna and Rosita in the North Autonomous Atlantic Region of Nicaragua in the year 2010. The methodology used was qualitative and it reflects the experiences, perceptions and feelings of women victims of violence and the

Comparison of SNP Variation and Distribution in Indigenous Ethiopian and Korean Cattle (Hanwoo Populations

Directory of Open Access Journals (Sweden)

Zewdu Edea

2012-09-01

Full Text Available Although a large number of single nucleotide polymorphisms (SNPs have been identified from the bovine genome-sequencing project, few of these have been validated at large in Bos indicus breeds. We have genotyped 192 animals, representing 5 cattle populations of Ethiopia, with the Illumina Bovine 8K SNP BeadChip. These include 1 Sanga (Danakil, 3 zebu (Borana, Arsi and Ambo, and 1 zebu × Sanga intermediate (Horro breeds. The Hanwoo (Bos taurus was included for comparison purposes. Analysis of 7,045 SNP markers revealed that the mean minor allele frequency (MAF was 0.23, 0.22, 0.21, 0.21, 0.23, and 0.29 for Ambo, Arsi, Borana, Danakil, Horro, and Hanwoo, respectively. Significant differences of MAF were observed between the indigenous Ethiopian cattle populations and Hanwoo breed (p < 0.001. Across the Ethiopian cattle populations, a common variant MAF (≥0.10 and ≤0.5 accounted for an overall estimated 73.79% of the 7,045 SNPs. The Hanwoo displayed a higher proportion of common variant SNPs (90%. Investigation within Ethiopian cattle populations showed that on average, 16.64% of the markers were monomorphic, but in the Hanwoo breed, only 6% of the markers were monomorphic. Across the sampled Ethiopian cattle populations, the mean observed and expected heterozygosities were 0.314 and 0.313, respectively. The level of SNP variation identified in this particular study highlights that these markers can be potentially used for genetic studies in African cattle breeds.

Avaliação comparativa da ultraestrutura e propriedades físicas do esmalte bovino, bubalino e humano

Directory of Open Access Journals (Sweden)

Bárbara C.L. Nogueira

2014-05-01

Full Text Available Este estudo teve como finalidade comparar a morfologia e propriedades físicas da estrutura do esmalte dos dentes bovinos, bubalinos e humanos. A análise deste tecido foi realizada por meio de microscopia eletrônica de varredura, composição mineral, microdureza e rugosidade superficial do esmalte em 41 incisivos bubalinos (Bos taurus indicus, 41 incisivos bovinos (Pelorovis antiques e 30 incisivos permanentes de humanos. Os resultados mostraram que a ultraestrutura do esmalte revela uma significativa similaridade das espécies estudadas com a encontrada em amostras humanas. No esmalte bovino e bubalino os elementos químicos que apresentaram maior concentração foram: O, Ca e P, justamente os que formam os cristais de hidroxiapatita - Ca10(PO46(OH2. Na microdureza Knoop não houve diferença estatisticamente significante entre as três espécies. Porém, a rugosidade superficial do esmalte bubalino (2,16µm ±0,23 foi significativamente maior quando comparada aos dentes humano (0,36µm ±0,05 e bovino (0,41µm ±0,07. Conclui-se que as características e propriedades do esmalte bovino e bubalino, por meio de análises e testes, apresentou uma morfologia semelhante à de humanos, arquitetura ultraestrutural similar, microdureza e composição mineral equivalente ao tecido dental humano, tornando-se modelos de referência para pesquisas.

Effect of feed supplements on dry season milk yield and profitability of crossbred cows in Honduras.

Science.gov (United States)

Reiber, Christoph; Peters, Michael; Möhring, Jens; Schultze-Kraft, Rainer

2013-06-01

The contribution of dry season silage feeding on daily milk yield (MY) and dairying profitability in terms of income over feed cost (IOFC) was evaluated in dual-purpose cattle production systems in Honduras. MY records of 34 farms from two milk collection centres were collected over a 2-year period. Farms were surveyed to obtain information on the type, quantity and cost of supplemented feed, breed type and number of lactating cows in each month. Farms were classified in silage farms (SF, with a short silage supplementation period), non-silage farms (NSF) and prototype farms (PF, with an extended silage supplementation period). Data were analysed using descriptive statistics and a linear mixed model approach. PF had significantly higher MY than SF and NSF but, due to higher expenses for both concentrate and silage, similar IOFC compared to NSF. SF had similar MY but lower IOFC compared to NSF, due to higher feed expenses. The effect of silage feeding, particularly maize silage, on MY was significant and superior to that of other forage supplements. Silage supplementation contributed to the highest MY and IOFC on farms with crossbred cows of >62.5 % Bos taurus and to the second highest profitability on farms with >87.5 % Bos indicus share. It is concluded that silage can play an important role in drought-constrained areas of the tropics and can contribute to profitable dairying, irrespective of breed.

Performance of holsteins cows in pasture of Cynodon dactylon cv. Coast-cross supplemented with concentrate Desempenho de vacas da raça Holandesa em pastagem de Cynodon dactylon cv. Coast-cross suplementada com concentrado

Directory of Open Access Journals (Sweden)

Rodrigo Carvalho Cardoso

2009-12-01

Minas Gerais. Objetivou-se avaliar o desempenho produtivo de vacas da raça Holandesa mantidas em pastagem de 'Coast-cross' (Cynodon dactylon (L. Pears fertilizada, irrigada e suplementada com 3 ou 6 kg de concentrado/vaca/dia. Os dados foram coletados durante 3 anos consecutivos (outubro/2000 a outubro/2003, num total de 108 lactações. Adotou-se o delineamento experimental em blocos, ao acaso, com duas repetições de área por tratamento, sendo utilizados 9 animais por área e 18 por tratamento, com lotação fixa de 5 vacas/ha. Foi utilizado o sistema de pastejo rotacionado, com um dia de ocupação e 25 e 35 dias de descanso dos piquetes, nas épocas de chuvas e seca, respectivamente. O pasto foi irrigado nos meses de menor precipitação e fertilizado com adubo formulado (NPK distribuído a lanço, em 6 aplicações anuais. A disponibilidade de matéria seca foi de 7.280 e 6.167 kg/ha no início do pastejo, com resíduo pós-pastejo de 4.885 e 3.994 kg/ha, nas épocas de chuvas (primavera/verão e seca (outono/inverno, respectivamente. Durante parte do período experimental, algumas características morfogênicas do pasto foram avaliadas, registrando-se disponibilidade de 83,9, 125,6 e 89,5 kg de MS de lâminas foliares/ha, nas estações de primavera, verão e outono, respectivamente. As produções médias diárias de leite (corrigidas para 3,5% de gordura foram de 15,6 e 18,8 kg/vaca e de 77,8 e 94,0 kg/ha, quando se forneceu para cada vaca 3 ou 6 kg de concentrado, respectivamente. Concluiu-se que com a pastagem de 'Coast-cross', quando suplementada, fertilizada e manejada adequadamente, obtém-se elevada produtividade de leite por animal e por área, podendo-se considerar ser essa uma das forrageiras mais promissoras para produção de leite, em pasto, com vacas de elevado potencial produtivo.

Effects of retinol on the in vitro development of Bos indicus embryos to blastocysts in two different culture systems.

Science.gov (United States)

Lima, P F; Oliveira, M A L; Gonçalves, P B D; Montagner, M M; Reichenbach, H-D; Weppert, M; Neto, C C C; Pina, V M R; Santos, M H B

2004-10-01

The objective of this study was to evaluate the effect of retinol on the in vitro development of early embryos of cultured Bos indicus (Expt 1) to the blastocyst stage in medium simplex of optimization (KSOM) or sintetic fluid of oviduct (SOF) or co-cultured (Expt 2) with an oviduct cell monolayer (OCM) in KSOM or SOF. A total of 3149 cumulus-oocyte complexes obtained by aspirating follicles (2-5 mm diameter) from ovaries of slaughtered animals were selected for IVM and incubated in TCM 199 supplemented with 25 mM HEPES at 39 degrees C in air with 5% CO(2) and maximum humidity for 24 h. In vitro fertilization (IVF) was performed in modified defined medium (mDM) medium. Eighteen hours after IVF, cumulus cells were removed and presumptive zygotes were randomly allocated to the experimental groups. Zygotes cultured (Expt 1) in KSOM + retinol, KSOM, SOF + retinol and SOF were incubated in maximum humidity at 39 degrees C, 5% CO(2), 5% O(2) and 90% N(2). Zygotes co-cultured (Expt 2) in KSOM + retinol + OCM, KSOM + OCM, SOF + retinol + OCM and SOF + OCM were incubated at 39 degrees C, 5% CO(2). In both experiments media were partially changed 48 h after IVF and unfertilized ova were removed. Afterwards embryos were kept in culture or co-culture for further 9 days. In Expt 1, blastocyst rates (day 7) were 14.6% (KSOM + retinol), 15.8% (KSOM), 16.4% (SOF + retinol) and 15.9% (SOF). In Expt 2, the blastocyst rates (day 7) were 25.4% (KSOM + retinol + OCM) 14.2% (KSOM + OCM), 24.3% (SOF + retinol + OCM) and 15.9% (SOF + OCM). The same influence profile of retinol was observed in the formation of the expanded (day 9) and hatched (day 11) blastocysts. The results obtained in Expt 2 demonstrated that the addition of 0.28 microg/ml retinol to the embryo culture media used in this study had a significant (p < 0.05) positive effect on bovine early embryonic development, under the conditions tested, and can be used to enhance in vitro embryo production.

Antibody titers to vaccination are not predictive of level of protection against a BVDV type 1b challenge in Bos indicus - Bos taurus steers

Science.gov (United States)

Subclinical illness associated with infection is thought to reduce performance and increase production costs in feedlot cattle, but underlying components remain largely unidentified. Vaccination is frequently used in feedlot settings but producers lack metrics that evaluate the effectiveness of vacc...

Valle de México, 2000

Directory of Open Access Journals (Sweden)

Héctor Hiram Hernández Bringas

2006-01-01

y, por supuesto, presentan peores niveles de vida que la población mestiza o no indígena. Se plantea aquí hacer visibles sus montos, particularidades y características, mismas que se comparan a cada paso con las de los no indígenas para presentar una visión de su situación en la actualidad

Co-Production of Fungal Biomass Derived Constituents and Ethanol from Citrus Wastes Free Sugars without Auxiliary Nutrients in Airlift Bioreactor.

Science.gov (United States)

Satari, Behzad; Karimi, Keikhosro; Taherzadeh, Mohammad J; Zamani, Akram

2016-02-26

The potential of two zygomycetes fungi, Mucor indicus and Rhizopus oryzae, in assimilating citrus waste free sugars (CWFS) and producing fungal chitosan, oil, and protein as well as ethanol was investigated. Extraction of free sugars from citrus waste can reduce its environmental impact by decreasing the possibility of wild microorganisms growth and formation of bad odors, a typical problem facing the citrus industries. A total sugar concentration of 25.1 g/L was obtained by water extraction of citrus waste at room temperature, used for fungal cultivation in shake flasks and airlift bioreactor with no additional nutrients. In shake flasks cultivations, the fungi were only able to assimilate glucose, while fructose remained almost intact. In contrast, the cultivation of M. indicus and R. oryzae in the four-liter airlift bioreactor resulted in the consumption of almost all sugars and production of 250 and 280 g fungal biomass per kg of consumed sugar, respectively. These biomasses correspondingly contained 40% and 51% protein and 9.8% and 4.4% oil. Furthermore, the fungal cell walls, obtained after removing the alkali soluble fraction of the fungi, contained 0.61 and 0.69 g chitin and chitosan per g of cell wall for M. indicus and R. oryzae, respectively. Moreover, the maximum ethanol yield of 36% and 18% was obtained from M. indicus and R. oryzae, respectively. Furthermore, that M. indicus grew as clump mycelia in the airlift bioreactor, while R. oryzae formed spherical suspended pellets, is a promising feature towards industrialization of the process.

Co-Production of Fungal Biomass Derived Constituents and Ethanol from Citrus Wastes Free Sugars without Auxiliary Nutrients in Airlift Bioreactor

Directory of Open Access Journals (Sweden)

Behzad Satari

2016-02-01

Full Text Available The potential of two zygomycetes fungi, Mucor indicus and Rhizopus oryzae, in assimilating citrus waste free sugars (CWFS and producing fungal chitosan, oil, and protein as well as ethanol was investigated. Extraction of free sugars from citrus waste can reduce its environmental impact by decreasing the possibility of wild microorganisms growth and formation of bad odors, a typical problem facing the citrus industries. A total sugar concentration of 25.1 g/L was obtained by water extraction of citrus waste at room temperature, used for fungal cultivation in shake flasks and airlift bioreactor with no additional nutrients. In shake flasks cultivations, the fungi were only able to assimilate glucose, while fructose remained almost intact. In contrast, the cultivation of M. indicus and R. oryzae in the four-liter airlift bioreactor resulted in the consumption of almost all sugars and production of 250 and 280 g fungal biomass per kg of consumed sugar, respectively. These biomasses correspondingly contained 40% and 51% protein and 9.8% and 4.4% oil. Furthermore, the fungal cell walls, obtained after removing the alkali soluble fraction of the fungi, contained 0.61 and 0.69 g chitin and chitosan per g of cell wall for M. indicus and R. oryzae, respectively. Moreover, the maximum ethanol yield of 36% and 18% was obtained from M. indicus and R. oryzae, respectively. Furthermore, that M. indicus grew as clump mycelia in the airlift bioreactor, while R. oryzae formed spherical suspended pellets, is a promising feature towards industrialization of the process.

Nuclear and mitochondrial DNA markers in traceability of retail beef samples Marcadores de DNA nuclear e mitocondrial para rastreabilidade da carne bovina comercializada

Directory of Open Access Journals (Sweden)

Aline S.M. Cesar

2010-09-01

Full Text Available Several characteristics are important in a traceability system of animal products, such as age at slaughter, breed composition, besides information of the productive chain. In general, the certification agent records information about the animals and the system which it came from, although cannot guarantee that the slaughtering, meat processing and distribution are error proof. Besides, there is a differential price, at least at the international market, based on sex and breed composition of the animals. Genetic markers allow identification of characteristics controlled in the beef cattle traceability program, as sex and breed composition, in order to correctly identify and appraise the final product for the consumer. The hypothesis of this study was that the majority beef samples retailed in the local market originate from female with a great participation of zebu breeds. Therefore, the objective of this work was to characterize retail beef samples with DNA markers that identify cattle sex and breed composition. Within 10 beef shops localized in Pirassununga, SP, Brazil, 61 samples were collected, all were genotyped as harboring Bos taurus mitochondrial DNA and 18 were positive for the Y chromosome amplification (male. For the marker sat1711b-Msp I the frequency of the allele A was 0.278 and for the marker Lhr-Hha I the frequency of the allele T was 0.417. The results of sat1711b-Msp I and Lhr-Hha I allelic frequencies are suggestive that the proportion of indicus genome compared with the taurine genome in the market meat is smaller than the observed in the Nellore breed. The procedure described in this study identified sex and subspecies characteristics of beef meat samples, with potential application in meat products certification in special as an auxiliary tool in beef cattle traceability programs.Várias características são importantes no sistema de rastreabilidade, como o sexo, a idade, a raça e/ou a composição racial dos animais, al

doublesex alters aggressiveness as a function of social context and sex in the polyphenic beetle Onthophagus taurus.

Science.gov (United States)

Beckers, Oliver M; Kijimoto, Teiya; Moczek, Armin P

2017-10-01

Despite sharing nearly the same genome, individuals within the same species can vary drastically in both morphology and behaviour as a function of developmental stage, sex or developmental plasticity. Thus, regulatory processes must exist that enable the stage-, sex- or environment-specific expression of traits and their integration during ontogeny, yet exactly how trait complexes are co-regulated and integrated is poorly understood. In this study, we explore the developmental genetic basis of the regulation and integration of environment-dependent sexual dimorphism in behaviour and morphology in the horn-polyphenic dung beetle Onthophagus taurus through the experimental manipulation of the transcription factor doublesex (dsx). The gene dsx plays a profound role in the developmental regulation of morphological differences between sexes as well as alternative male morphs by inhibiting horn formation in females but enabling nutrition-responsive horn growth in males. Specifically, we investigated whether experimental downregulation of dsx expression affects male and female aggressive and courtship behaviours in two social contexts: interactions between individuals of the same sex and interactions between males and females. We find that dsx downregulation significantly alters aggressiveness in both males and females, yet does so differently for both sexes as a function of social context: dsx RNAi males exhibited elevated aggression towards males but showed reduced aggression towards females, whereas dsx RNAi females became more aggressive towards males, while their aggressiveness towards other females was unaffected. Moreover, we document unexpectedly high levels of female aggression independent of dsx treatment in both wild-type and control-injected individuals. Lastly, we found no effects of dsx RNAi on courtship and mating behaviours. We discuss the role of dsx in the regulation of sex-specific and plastic behaviours, the unexpectedly high levels of aggression of

Pesquisa de anticorpos contra Leptospira spp. em animais silvestres e em estado feral da região de Nhecolândia, Mato Grosso do Sul, Brasil: utilização da técnica de imuno-histoquímica para detecção do agente Investigation of antibodies to Leptospira spp. in wild and feral animals from the region of Nhecolândia, Mato Grosso do Sul, Brazil: use of the immunohistochemistry technique for the agent detection

Directory of Open Access Journals (Sweden)

Raul José Silva Girio

2004-02-01

Full Text Available Foram examinadas 315 amostras de soros sangüíneos de diversas espécies de animais que vivem em estado feral ou silvestre na região de Nhecolândia, Corumbá, MS, por meio da prova de soroaglutinação microscópica para leptospirose. Dessas amostras, 67 foram de bois baguás (Bos taurus indicus, 39 de porcos-monteiros (Sus scrofa, 39 de búfalos (Bubalus bubalis, nove de quatis (Nasua nasua, 41 de veados-campeiros (Ozotoceros bezoarticus, 10 de veados-mateiros (Mazama americana e 110 amostras de ovinos (Ovis aries. Em 12 animais que vieram a óbito, seis porcos-monteiros, quatro veados-campeiros e dois ovinos, foram realizadas tentativas de isolamento de Leptospira do fígado e dos rins por cultura em meio semi-sólido. Fragmentos desses órgãos foram submetidos a exame histopatológico e também a exame para detecção das Leptospiras pela técnica de imuno-histoquímica. Os resultados dos exames sorológicos mostraram que 64 (20,3% das amostras foram reagentes para, pelo menos, um sorovar de Leptospira patogênica; foram reagentes 41,0% das amostras de búfalos, 40,3% das de bois baguás, 17,9% das de porcos-monteiros, 9% das de ovinos e 9,7% das amostras de veados-campeiros; nenhuma das amostras de veados-mateiros e de quatis foi reagente. Os sorovares mais freqüentes foram: pomona, para búfalos e ovinos; icterohaemorrhagiae, para ovinos, veados-campeiros e suínos; e copenhageni, para veados-campeiros e suínos. As tentativas de isolamento dos rins e fígados foram todas negativas, e pela técnica da imuno-histoquímica foi detectada Leptospira no fígado de um porco-monteiro. As principais alterações estruturais, encontradas nos rins de dois veados-campeiros e de um porco-monteiro, foram infiltrado inflamatório intersticial com congestão associada a hemorragias.Three hundred and fifteen serum samples of several animal species living in wild or in feral state in the area of Nhecolândia, Corumbá, MS, Brazil, were examined by the

Inseminação artificial em tempo fixo e diagnóstico precoce de gestação em vacas leiteiras mestiças Timed artificial insemination and early pregnancy diagnosis in crossbred dairy cows

Directory of Open Access Journals (Sweden)

Cláudio França Barbosa

2011-01-01

Full Text Available Avaliou-se, durante um ano, o desempenho reprodutivo de 94 vacas leiteiras mestiças Bos taurus x Bos indicus submetidas a um programa de reprodução assistida. Um protocolo de inseminação artificial em tempo fixo (IATF foi executado por meio de dispositivo intravaginal contendo progesterona e das injeções de prostaglandina F2α e de cipionato de estradiol. Por meio de ultrassonografia, entre 7 e 14 dias após as inseminações ou montas controladas, realizou-se a detecção de corpo lúteo nos ovários a fim de determinar a taxa de ovulação e, no 28º dia, fez-se o diagnóstico de gestação para cálculo da taxa de concepção. Respeitou-se um período mínimo de 34 dias após o parto antes do tratamento. Não houve influência do escore de condição corporal e da presença de corpo lúteo no início do protocolo, nem da reutilização do dispositivo intravaginal e da monta controlada ou inseminação artificial, sobre as taxas de ovulação, concepção e concepção das vacas ovuladas. As taxas de concepção e de concepção das vacas ovuladas foram afetadas negativamente pelo elevado número de dias pós-parto (DPP, ou dias em lactação e pela época quente do ano, primavera/verão. A resposta ao protocolo de inseminação artificial em tempo fixo baseado no uso de progesterona, PGF2α e cipionato de estradiol é prejudicada pelo aumento dos dias em lactação e pela época quente do ano. A condição corporal não afeta a resposta ao protocolo de inseminação artificial, desde que as vacas tratadas apresentem escore acima de 2,25 pontos.It was evaluated, during a period of one year, the reproductive performance of 94 Bos taurus x Bos indicus crossbred dairy cows submitted to an assisted reproduction program. A timed artificial insemination (TAI protocol was carried out by using an intra-vaginal progesterone device containing progesterone and through injections with Prostaglandin F2α and estradiol cypionate. By using ultrasound

Soil bulk density and biomass partitioning of Brachiaria decumbens in a silvopastoral system Densidade do solo e partição de biomassa de Brachiaria decumbens em um sistema silvopastoril

Directory of Open Access Journals (Sweden)

Domingos Sávio Campos Paciullo

2010-10-01

Full Text Available Shade in silvopastoral systems improves the thermal comfort of animals, but it may also affect the pasture productivity and can contribute to soil compaction in the shaded areas due to the increase in the number of animals looking for comfort. The effect of grazing at various distances from tree rows (under the tree canopy, at 6 and at 12 m away from the trees on the soil bulk density and on the aerial and root biomass of Brachiaria decumbens was evaluated in both the dry and the rainy seasons. The study was carried out on an Orthic Ferralsol in a randomized block design with two replications. Tree rows were composed of Eucalyptus grandis and Acacia mangium species, and the paddocks were submitted to a rotational stocking management, using Holstein (Bos taurus × Zebu (Bos indicus heifers. The shade intensity in the pasture decreased with an increasing distance from the tree row. Soil bulk density did not vary with the distance from the tree row, but varied seasonally, being greater in the rainy season (1.47 g cm-3 than in the dry season (1.28 g cm-3. Green forage and root mass, expressed as dry matter, were lower under the tree canopy and were greater in the rainy season. There were decreases of 22.3 and 41.4% in the aerial and root biomasses, respectively, in the tree rows. The greatest shoot/root ratio for B. decumbens under moderate and intensive shading indicates a modification in the forage biomass allocation pattern that favours the aerial development in detriment of the root system.O sombreamento em sistemas silvipastoris concorre para o conforto térmico dos animais; no entanto pode afetar a produção do pasto e contribuir para a compactação do solo, pelo aumento da concentração de animais nas áreas sombreadas. Avaliou-se o efeito da distância do renque de árvores (sob a copa das árvores, 6 e 12 m de distancia das árvores na densidade do solo e na biomassa aérea e de raízes de Brachiaria decumbens, nas épocas seca e chuvosa

EFECTO DE LA SUPLEMENTACIÓN DE L-Glutamina y L-Glutamato (Aminogut® SOBRE EL CRECIMIENTO TEMPRANO DE POLLOS DE ENGORDE

Directory of Open Access Journals (Sweden)

Y Avellaneda

2008-01-01

Full Text Available este estudio se llevó a cabo con el objeto de evaluar el impacto de la suplementación de una mezcla comercial de L-glutamina y L-glutamato (amino-gut® sobre diferentes parámetros de producción asociados al crecimiento temprano de pollos de engorde. se utilizaron 455 hembras y 455 machos de la estirpe COBB para evaluar tres niveles de inclusión de mezcla comercial de L-glutamina y L-glutamato (0,5, 1,0 y 1,5% y dos tiempos de duración de la suplementación (7 y 14 días. Las dietas de los tratamientos fueron isocalóricas e isoprotei-cas. Las aves se pesaron a los días 1, 8, 15 y 25 de edad, el consumo de alimento se deter-minó para estos intervalos y la mortalidad se registró diariamente. el desempeño corporal de los pollos de engorde fue mejor en los grupos suplementados con la mezcla comercial de L-glutamina y L-glutamato respecto al grupo control, mientras que el consumo de alimento disminuyó linealmente con el nivel de inclusión de la mezcla; de tal forma que la conversión alimenticia en una interacción con el sexo fue mejor para el mayor nivel de inclusión de la mezcla comercial de L-glutamina y L-glutamato en los machos, mientras que las hembras suplementadas con 1,0 o 1,5% mostraron una mejor conversión alimenticia. Las aves su-plementadas durante 7 días mostraron una mayor mortalidad (P = 0,0814 comparadas con las suplementadas durante 14 días. Un nivel de inclusión de 1,5% registró el menor costo de producción frente al grupo de aves no suplementadas. de tal forma que la respuesta a la suplementación con la mezcla comercial de L-glutamina y L-glutamato es inherente al sexo del ave y afecta positivamente el desempeño bioeconómico del pollo de engorde durante la fase de crecimiento temprano.

Genotyping of β-Lactoglobulin gene by PCR-RFLP in Sahiwal and Tharparkar cattle breeds

Directory of Open Access Journals (Sweden)

Gupta Neelam

2006-05-01

population. Conclusion Genotype frequencies of AA were the lowest compared to that of BB genotype in Sahiwal cattle while AB genotypes were more frequent in Tharparkar cattle. The frequency of A allele was found to be lower than that of B allele in both the breeds studied. These results further confirm that Bos indicus cattle are predominantly of β-Lactoglobulin B type than Bos taurus breeds.

in silico identification of cross affinity towards Cry1Ac pesticidal protein with receptor enzyme in Bos taurus and sequence, structure analysis of crystal proteins for stability.

Science.gov (United States)

Ebenezer, King Solomon; Nachimuthu, Ramesh; Thiagarajan, Prabha; Velu, Rajesh Kannan

2013-01-01

Any novel protein introduced into the GM crops need to be evaluated for cross affinity on living organisms. Many researchers are currently focusing on the impact of Bacillus thuringiensis cotton on soil and microbial diversity by field experiments. In spite of this, in silico approach might be helpful to elucidate the impact of cry genes. The crystal a protein which was produced by Bt at the time of sporulation has been used as a biological pesticide to target the insectivorous pests like Cry1Ac for Helicoverpa armigera and Cry2Ab for Spodoptera sp. and Heliothis sp. Here, we present the comprehensive in silico analysis of Cry1Ac and Cry2Ab proteins with available in silico tools, databases and docking servers. Molecular docking of Cry1Ac with procarboxypeptidase from Helicoverpa armigera and Cry1Ac with Leucine aminopeptidase from Bos taurus has showed the 125(th) amino acid position to be the preference site of Cry1Ac protein. The structures were compared with each other and it showed 5% of similarity. The cross affinity of this toxin that have confirmed the earlier reports of ill effects of Bt cotton consumed by cattle.

Identification and isolation of gene differentially expressed on scrotal ...

African Journals Online (AJOL)

Results of BLAST with GenBank show that three genes or expressed sequence tag (ESTs) were unknown, and there were eight sequences highly identified to be Bos taurus mRNA for proline-rich protein P-B and other sequences were B. taurus ebd-P2 pseudogene, B. taurus similar to F-box only protein 21 isoform 2, ...

Efecto de la manipulación del semen criopreservado de bovinos Bos Taurus sobre la integridad espermática

Directory of Open Access Journals (Sweden)

Norberto Villa-Duque

2016-01-01

Full Text Available En el estudio se evaluó el efecto de descongelar y aplicar semen de bovinos Bos Taurus en 33 ganaderías del Magdalena Medio colombiano, y se estudió in vitro el efecto de la injuria encontrada sobre la integridad de las membranas espermáticas. La información en fincas se recopiló mediante formulario específico, mientras que el estudio in vitro se ejecutó en el laboratorio de Biotecnología Reproductiva Animal del Instituto Universitario de la Paz (Barrancabermeja, Santander. El estudio consistió en someter pajillas comerciales de 0.5 ml de toros Holstein y Pardo Suizo a la técnica convencional y a tres modificaciones de esta (injurias mediante un diseño randomizado. Ninguna de las fincas evaluadas aplicó correctamente la práctica de la inseminación artificial; errores notorios fueron: exceso de tiempo durante la extracción de la pajilla, descongelación en la región axilar y no combinación correcta entre tiempo y temperatura. Los resultados evidenciaron diferencia significativa (P<0.05 por efecto de la raza para la integridad y resistencia de las membranas espermáticas, para la integridad de las membranas por efecto de los tratamientos cuando la pajilla se descongelo a temperatura corporal en la región axilar y para la integridad de la membrana acrosomal cuando la extracción de la pajilla se realizó en forma incorrecta. El semen de la raza Holstein evidencia una ligera tendencia a ser más resistente que el de la raza Pardo Suizo.

Comparative Analyses of Nonpathogenic, Opportunistic, and Totally Pathogenic Mycobacteria Reveal Genomic and Biochemical Variabilities and Highlight the Survival Attributes of Mycobacterium tuberculosis

Science.gov (United States)

Singh, Yadvir; Kohli, Sakshi; Ahmad, Javeed; Ehtesham, Nasreen Z.; Tyagi, Anil K.

2014-01-01

ABSTRACT Mycobacterial evolution involves various processes, such as genome reduction, gene cooption, and critical gene acquisition. Our comparative genome size analysis of 44 mycobacterial genomes revealed that the nonpathogenic (NP) genomes were bigger than those of opportunistic (OP) or totally pathogenic (TP) mycobacteria, with the TP genomes being smaller yet variable in size—their genomic plasticity reflected their ability to evolve and survive under various environmental conditions. From the 44 mycobacterial species, 13 species, representing TP, OP, and NP, were selected for genomic-relatedness analyses. Analysis of homologous protein-coding genes shared between Mycobacterium indicus pranii (NP), Mycobacterium intracellulare ATCC 13950 (OP), and Mycobacterium tuberculosis H37Rv (TP) revealed that 4,995 (i.e., ~95%) M. indicaus pranii proteins have homology with M. intracellulare, whereas the homologies among M. indicus pranii, M. intracellulare ATCC 13950, and M. tuberculosis H37Rv were significantly lower. A total of 4,153 (~79%) M. indicus pranii proteins and 4,093 (~79%) M. intracellulare ATCC 13950 proteins exhibited homology with the M. tuberculosis H37Rv proteome, while 3,301 (~82%) and 3,295 (~82%) M. tuberculosis H37Rv proteins showed homology with M. indicus pranii and M. intracellulare ATCC 13950 proteomes, respectively. Comparative metabolic pathway analyses of TP/OP/NP mycobacteria showed enzymatic plasticity between M. indicus pranii (NP) and M. intracellulare ATCC 13950 (OP), Mycobacterium avium 104 (OP), and M. tuberculosis H37Rv (TP). Mycobacterium tuberculosis seems to have acquired novel alternate pathways with possible roles in metabolism, host-pathogen interactions, virulence, and intracellular survival, and by implication some of these could be potential drug targets. PMID:25370496

Evaluation of pregnancy rates of Bos indicus cows subjected to different synchronization ovulation protocols using injectable progesterone or an intravaginal device

Directory of Open Access Journals (Sweden)

Jefferson Tadeu Campos

2016-12-01

Full Text Available This study evaluated the pregnancy rate in Nelore cows (Bos indicus that were subjected to fixed-time artificial insemination (FTAI using different protocols consisting of injectable progesterone (P4 or an intravaginal device (impregnated with P4. Multiparous cows 72-84 months in age, 30-45 days postpartum, were selected on the basis of the absence of a corpus luteum (CL and follicles < 8 mm after transrectal palpation and ultrasound examinations. On a random day of the estrus cycle (D0, the selected animals (n = 135 were randomly assigned to one of three experimental groups (n = 45 each. Group I (injectable P4/FTAI 36 hours received 250 mg of injectable P4 and 2 mg EB on D0; on D7, they received 500 µg of cloprostenol; on D8, 300 IU of eCG and 1 mg of EB were administered; and finally, FTAI was performed 36 hours after the application of EB. Group II (injectable P4/FTAI 48 hours received the same protocol as Group I, except that the FTAI was performed 48 hours after ovulation induction. The animals of Group III (Control/CIDR received a conventional protocol for FTAI using an intravaginal device (D0: P4 and 2 mg EB; D8: device removal, 500 µg cloprostenol, 300 IU eCG, 1 mg EB; and FTAI performed 48 hours after removal of the device. The results showed that cows synchronized with the conventional protocol for FTAI (Control/CIDR had a higher pregnancy rate (60 %, 27/45 than those synchronized with an injectable P4/FTAI 36 hours (33.33 %; 15/45, P = 0.010. However, the group receiving injectable P4 group/FTAI 48 hours had a similar pregnancy rate (48.9 %; 22/45; P = 0.290 when compared to both the group receiving the conventional protocol and that receiving injectable P4/FTAI 36 hours (P = 0.134. Although the injectable P4 may affect pregnancy rate with the FTAI performed in 36 hours, we found similar pregnancy rates from cows inseminated 48 hours after induction ovulation, considering injectable or intravaginal P4. Therefore, we suggest that

HERSCHEL/PACS SURVEY OF PROTOPLANETARY DISKS IN TAURUS/AURIGA—OBSERVATIONS OF [O I] AND [C II], AND FAR-INFRARED CONTINUUM

International Nuclear Information System (INIS)

Howard, Christian D.; Sandell, Göran; Vacca, William D.; Duchêne, Gaspard; Mathews, Geoffrey; Augereau, Jean-Charles; Ménard, Francois; Pinte, Christophe; Podio, Linda; Thi, Wing-Fai; Barrado, David; Riviere-Marichalar, Pablo; Dent, William R. F.; Eiroa, Carlos; Meeus, Gwendolyn; Grady, Carol; Roberge, Aki; Kamp, Inga; Vicente, Silvia; Williams, Jonathan P.

2013-01-01

The Herschel Space Observatory was used to observe ∼120 pre-main-sequence stars in Taurus as part of the GASPS Open Time Key project. Photodetector Array Camera and Spectrometer was used to measure the continuum as well as several gas tracers such as [O I] 63 μm, [O I] 145 μm, [C II] 158 μm, OH, H 2 O, and CO. The strongest line seen is [O I] at 63 μm. We find a clear correlation between the strength of the [O I] 63 μm line and the 63 μm continuum for disk sources. In outflow sources, the line emission can be up to 20 times stronger than in disk sources, suggesting that the line emission is dominated by the outflow. The tight correlation seen for disk sources suggests that the emission arises from the inner disk (<50 AU) and lower surface layers of the disk where the gas and dust are coupled. The [O I] 63 μm is fainter in transitional stars than in normal Class II disks. Simple spectral energy distribution models indicate that the dust responsible for the continuum emission is colder in these disks, leading to weaker line emission. [C II] 158 μm emission is only detected in strong outflow sources. The observed line ratios of [O I] 63 μm to [O I] 145 μm are in the regime where we are insensitive to the gas-to-dust ratio, neither can we discriminate between shock or photodissociation region emission. We detect no Class III object in [O I] 63 μm and only three in continuum, at least one of which is a candidate debris disk

CN in dark clouds

International Nuclear Information System (INIS)

Churchwell, E.; Bieging, J.H.

1983-01-01

We have detected CN (N = 1--0) emission toward six locations in the Taurus dark cloud complex, but not toward L183 or B227. The two hyperfine components, F = 3/2--1/2 and F = 5/2--3/2 (of J = 3/2--1/2), have intensity ratios near unity toward four locations in Taurus, consistent with large line optical depths. CN column densities are found to be > or approx. =6 x 10 13 cm -2 in those directions where the hyperfine ratios are near unity. By comparing CN with NH 3 and C 18 O column densities, we find that the relative abundance of CN in the Taurus cloudlets is at least a factor of 10 greater than in L183. In this respect, CN fits the pattern of enhanced abundances of carbon-bearing molecules (in partricular the cyanopolyynes) in the Taurus cloudlets relative to similar dark clouds outside Taurus

Ovarian activity and estrus behavior in early postpartum cows grazing Leucaena leucocephala in the tropics.

Science.gov (United States)

Bottini-Luzardo, Maria; Aguilar-Perez, Carlos; Centurion-Castro, Fernando; Solorio-Sanchez, Francisco; Ayala-Burgos, Armin; Montes-Perez, Ruben; Muñoz-Rodriguez, David; Ku-Vera, Juan

2015-12-01

The legume Leucaena leucocephala (Leucaena) is widely used to supplement forage in silvopastoral livestock systems in Latin America. Little is known about its possible effects on the cow reproductive dynamic. The aim was to evaluate the effect of Leucaena foliage intake on re-establishment of ovarian activity and estrus behavior in early postpartum (7-90 days) cows. Twenty-four multiparous Bos taurus × Bos indicus cows were divided into two homogenous groups and assigned to one of two treatments: a silvopastoral system (SS, n = 12), consisting of an association of Cynodon nlemfuensis grass and L. leucocephala; and a control system (CS, n = 12), consisting of C. nlemfuensis alone. Intake of Leucaena in the SS ranged from 3.80 to 6.43 kg DM/cow/day. Plasma mimosine concentrations ranged from 1270 to 1530 μg/mL, and those for 2,3-dihydroxypyridine (DHP) from 147 to 729 μg/mL. No 3,4-DHP was detected in plasma. No difference (P > 0.05) between treatments was observed for the number of cows exhibiting small, medium, or dominant follicles, or estrus behavior. The number of cows which re-established ovarian cyclicity (n = 6) was lower (P < 0.05) in the SS than in the CS (n = 9). Corpus luteum lifespan was longer (P < 0.05) in the SS than in the CS. Intake of Leucaena affected the number of cows exhibiting ovarian cyclicity and extended corpus luteum life, but did not affect follicular development and estrus behavior.

Effects of energy supplementation on productivity of dual-purpose cows grazing in a silvopastoral system in the tropics.

Science.gov (United States)

Tinoco-Magaña, Juan Carlos; Aguilar-Pérez, Carlos Fernando; Delgado-León, Roger; Magaña-Monforte, Juan Gabriel; Ku-Vera, Juan Carlos; Herrera-Camacho, Jose

2012-06-01

The aim of the present work was to evaluate milk yield, postpartum (pp) ovarian activity and pregnancy rate in dual-purpose cows grazing Cynodon nlemfuensis and browsing L. leucocephala, with or without energy supplementation. Twenty-four Bos taurus × B. indicus cows were divided in two groups from calving to 70 days post-calving: supplemented group (SG) with ground sorghum grain offered at 0.4% of live weight at calving and control group (CG) without supplement. There was a trend for milk yield (kg day(-1)) to be greater (p = 0.08) for SG (10.55 ± 0.51) compared to CG (9.53 ± 0.61), although without differences in fat (0.42 ± 0.02 vs. 0.38 ± 0.03 kg day(-1)), protein (0.29 ± 0.02 vs. 0.29 ± 0.02 kg day(-1)) or lactose (0.49 ± 0.02 vs. 0.49 ± 0.03 kg day(-1)) concentration. Populations of large, medium and small follicles were similar between treatments. Percentage of cows which showed corpus luteum tended to be greater in SG (50%), compared to CG (33%). Supplemented cows tended to have a shorter calving-first corpus luteum interval (40 ± 10 vs. 51 ± 10 days) and had a significantly higher (χ (2) = 0.03) pregnancy rate (42% vs. 0%). It is concluded that energy supplementation helped to improve ovarian activity and pregnancy rate. Since supplementation did not avoid loss of body condition, the higher pregnancy rate in SG suggests beneficial effects of supplementation probably mediated by metabolic hormones.

Viabilidade financeira da inseminação artificial em tempo fixo de bezerros cruzados Nelore e Aberdeen Angus = Economic feasibility of timed artificial insemination of Nellore and Aberdeen Angus crossbred calves

Directory of Open Access Journals (Sweden)

Nelson Zuchi Neto

2017-07-01

Full Text Available O cruzamento entre taurinos e zebuínos através de Inseminação Artificial em Tempo Fixo [IATF] é uma realidade presente em várias propriedades rurais no Brasil. Visando as vantagens da IATF em conjunto com as vantagens do cruzamento industrial o objetivo foi verificar a viabilidade financeira desta atividade em uma propriedade no município de Nova Lacerda, MT. Para tal, utilizou-se as ferramentas de matemática financeira Valor Presente Líquido [VPL], Taxa Interna de Retorno [TIR] e Payback. O projeto se mostrou viável com um VPL acima de R$ 300 mil, TIR de 23,03% e Payback descontado de aproximadamente oito anos. A venda de descartes e a suplementação dos bezerros em sistema de “creep feeding” se mostraram importantes para a viabilidade deste projeto. = Bos taurus and Bos indicus crossbred through Timed Artificial Insemination [TAI] is present in several farms in Brazil. Aiming the advantages of the TAI together with industrial crossing, the objective was to verify the economic feasibility of this activity on a farm in the city of Nova Lacerda, MT. Financial mathematics tools like Net Present Value [NPV], Internal Rate of Return [IRR] and Payback were used. The project was feasible with a NPV above R$ 300 thousand, an IRR of 23.03% and a Discounted Payback of approximately eight years. The sale of discards matrix and the supplementation of calves in a creep feeding system showed to be important for the viability of this project.

PEMBIAKAN NEMATODA PATOGEN SERANGGA (Rhabditida: Heterorhabditis DAN Steinernema PADA MEDIA SEMI PADAT

Directory of Open Access Journals (Sweden)

. Chaerani

2011-11-01

Full Text Available Field application of entomopathogenic nematodes (EPN is still hampered by inefficient mass production. The aim of this study was to compare three published in vitro media (medium Wouts, Bedding and Han for mass propagation of three indigenous EPNs (Heterorhabditis indicus PLR2, H. indicus isolate 5, and Steinernema T96 and one commercial strain (S. carpocapsae #25. The media were impregnated in shredded polyurethane sponge, pre-inoculated with symbiotic bacteria of each nematode and inoculated with the respective infective juveniles (Ijs of the nematode. Nematode yields at three weeks after nematode inoculation were inconsistent accross replications and experiments and generally not significantly influenced by the kind of media tested. Average yields showed that the highest IJ productions were obtained on medium Han for  H. indicus PLR2 (0,4×105 Ijs/g medium and for S. carpocapsae #25  (2.2×105 IJs/g medium, and on  medium Wouts for H. indicus  isolate 5 (6.5×105 Ijs/g medium and Steinernema T96 (1.5×105 IJs/g medium. The Ijs’ body were significantly shorter than those of in vivo propagated, which may impair the nematode pathogenicity. Modifications of the propagation technique and media formulation are needed to improve the quantity and quality of Ijs.

ORF Alignment: NT_033779 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available rEMBL::g2674107:GUANINE NUCLEOTIDE-EXCHANGE ... PROTEIN. organism:BOS TAURUS (BOVINE). dbxref:GenBank...; ... AF023451; g2674107; -.'', species:''BOS TAURUS ... Length = 185 ... Query: 586 METGIELFNRKP

Perfil nutricional de recém-nascidos de mães adolescentes suplementadas com ferro, em diferentes concentrações, zinco e ácido fólico Nutritional profile of newborns of adolescent mothers supplemented with iron, in different concentrations, zinc and pholic acid

Directory of Open Access Journals (Sweden)

Nadir do Nascimento NOGUEIRA

2002-08-01

Full Text Available O objetivo deste estudo foi avaliar o estado nutricional de recém-nascidos de mães adolescentes com até 18 anos de idade, de baixa renda, suplementadas durante a gravidez com ferro, em diferentes concentrações, zinco e ácido fólico. Estas mães fizeram pré-natal no Instituto de Perinatologia Social do Piauí, Maternidade Dona Evangelina Rosa, no município de Teresina, Piauí, Nordeste do Brasil. As adolescentes foram aleatoriamente distribuídas em cinco grupos: grupos I e II receberam quantidades constantes de ácido fólico (250 µg e diferentes concentrações de ferro, na forma de sulfato ferroso (120 e 80 mg, respectivamente; grupos III e IV receberam quantidades constantes de ácido fólico (250 µg associado ao sulfato de zinco (5 mg e ferro nas concentrações de 120 e 80 mg, respectivamente; e grupo V, considerado controle, recebeu apenas ferro (120 mg (rotina da Instituição. A avaliação do estado nutricional de 74 recém-nascidos foi feita através de dados referentes à idade, peso, comprimento e perímetro cefálico, por ocasião do nascimento. De acordo com os resultados, as médias de peso (3000 ± 418 g, comprimento (48,07 ± 2,15 cm e perímetro cefálico (33,53 ± 1,50 cm encontradas para os filhos de mães do grupo V (rotina local não diferem dos grupos de intervenção. Conclui-se que os recém-nascidos de adolescentes suplementadas com ferro em diferentes concentrações (120 e 80 mg, zinco e ácido fólico apresentaram um bom perfil nutricional. No entanto, não se observou, entre os grupos de intervenção e o controle, diferenças significativas na duração da gravidez ou no estado nutricional dos bebês.The objective of this study was to evaluate the nutritional status of newborn infants of low income adolescent mothers, aged up to 18 years old, supplemented during pregnancy with iron, in different concentrations, zinc and folic acid. These mothers received prenatal care supervision in the Institute of

The use of hormonal treatments to improve reproductive performance of anestrous beef cattle in tropical climates.

Science.gov (United States)

Baruselli, P S; Reis, E L; Marques, M O; Nasser, L F; Bó, G A

2004-07-01

Most of the world's bovine herd is found in tropical regions. Bos indicus predominates, due to their adaptation to the climate and management conditions. Anestrous is the main factor that negatively affects reproductive performance of animals bred in these regions of the globe. Several factors affect postpartum anestrous, including suckling and maternal-offspring bond, and pre- and postpartum nutritional status. The short duration of estrus and the tendency to show estrus during the night, greatly affect the efficiency of artificial insemination (AI) programs in B. indicus cattle managed in tropical areas. Several restricted suckling or weaning procedures (temporary or permanent), and hormonal treatments have been used to induce ovulation and cyclicity in postpartum cows. Most hormonal treatments are based on progesterone/progestogen (P4) releasing devices associated with estradiol benzoate (EB), or a combination of GnRH/PGF(2alpha)/GnRH (Ovsynch). Treatments with GnRH/PGF(2alpha)/GnRH has presented inconsistent results, probably due to the variable number of cows in anestrous. Treatments using P4 devices and EB have resulted in apparently more consistent results than Ovsynch programs in B. indicus cattle; however, pregnancy rates are low in herds presenting high anestrous rates and moderate to low body condition. The addition of an eCG treatment at the time of device removal, which increased plasma progesterone concentrations and pregnancy rates in anestrous postpartum suckled B. indicus cows, may be useful to improve reproductive performance of beef cattle in tropical climates.

Heat-tolerant versus heat-sensitive Bos taurus cattle: influence of air temperature and breed on the acute phase response to a provocative immune challenge.

Science.gov (United States)

Carroll, J A; Burdick Sanchez, N C; Chaffin, R; Chase, C C; Coleman, S W; Spiers, D E

2013-10-01

The difference in the acute phase response of a heat-tolerant and a heat-sensitive Bos taurus breed to a lipopolysaccharide (LPS) challenge when housed at different air temperatures (Ta) was studied. Angus (ANG; heat-sensitive; n = 11; 306 ± 26 kg BW) and Romosinuano (RO; heat-tolerant; n = 10; 313 ± 32 kg BW) heifers were transported from the USDA Agricultural Research Service SubTropical Agricultural Research Station in Florida to the Brody Environmental Chambers at the University of Missouri, Columbia. Heifers were housed in stanchions in 4 temperature-controlled environmental chambers. Initially, Ta in the 4 chambers was cycling at thermoneutrality (TN; 18.5°C-23.5°C) for a 1-wk adjustment period, followed by an increase in 2 of the 4 chambers to cycling heat stress (HS; 24°C-38°C) for 2 wk. On day 19, heifers were fitted with jugular catheters and rectal temperature (RT) recording devices. On day 20, heifers were challenged with LPS (0.5 μg/kg BW; 0 h), sickness behavior scores (SBSs) were recorded, and blood samples were collected at 0.5-h intervals from -2 to 8 h and again at 24 h relative to LPS challenge at 0 h. Serum was isolated and stored at -80°C until analyzed for cortisol and cytokine concentrations. A breed by Ta interaction (P heat-tolerant RO and heat-sensitive ANG heifers under different Ta which may aid in elucidating differences in productivity, disease resistance, and longevity among cattle breeds. Published by Elsevier Inc.

Social relationships enhance the time spent eating and intake of a novel diet in pregnant Hanwoo (Bos taurus coreanae) heifers.

Science.gov (United States)

Shin, Dong-Han; Kang, Hyun-Min; Seo, Seongwon

2017-01-01

The objective of this study was to evaluate the effects of social relationships on the feed intake, eating behavior, and growth, upon exposure to a novel diet, in Hanwoo ( Bos taurus coreanae ) heifers during pregnancy. Twenty-four pregnant Hanwoo heifers, averaging 438 ± 27.8 kg in weight, 21 months in age, and 194 ± 8.5 days in pregnancy, were involved in a two-month (eight weeks) experiment. The heifers were randomly assigned to either the single housing group (SG; one individual per pen, n = 12), or the paired housing group (PG; two individuals per pen, n = 12). All pens were of the same size (5 × 5 m) and provided with one feed bin, which automatically recorded the individual feed intake and eating behavior. As the experiment began, the diet of the heifers was switched from a total mixed ration (TMR; 250 g/kg ryegrass straw and 750 g/kg concentrate mix) to a forage-only diet (mixed hay cubes composed of 500 g/kg alfalfa, 250 g/kg timothy, and 250 g/kg blue grass hay). The heifers were fed ad libitum twice a day. The individual feed intake and eating behavior were recorded daily throughout the experiment, and body weights (BWs) were measured every four weeks before the morning feeding. PG animals visited the feed bin 22% less often than SG. PG, however, stayed 39% longer in the feed bin and consumed 40% more feed per visit, compared with SG. Consequently, PG heifers spent 23% more time in eating and had 16% more daily dry matter intake than SG during the experiment. Average daily gain during the experimental period tended to be greater in PG than in SG. When pregnant Hanwoo heifers encountered a novel diet, social relationships (i.e., presence of a pen-mate) enhanced their time spent eating and feed intake. Social interactions, even with an unfamiliar individual, may be helpful for pregnant Hanwoo heifers cope with a diet challenge compared to solitary situation.

Photon-dominated region modeling of the [C I], [C II], and CO Line Emission From A Boundary In The Taurus molecular cloud

Energy Technology Data Exchange (ETDEWEB)

Orr, Matthew E. [Physics and Astronomy Department, University of Southern California, Los Angeles, CA 90089 (United States); Pineda, Jorge L.; Goldsmith, Paul F. [Jet Propulsion Laboratory, California Institute of Technology, 4800 Oak Grove Drive, Pasadena, CA 91109-8099 (United States)

2014-11-01

We present [C I] and [C II] observations of a linear edge region in the Taurus molecular cloud, and model this region as a cylindrically symmetric photon-dominated region (PDR) exposed to a low-intensity UV radiation field. The sharp, long profile of the linear edge makes it an ideal case to test PDR models and determine cloud parameters. We compare observations of the [C I], {sup 3} P {sub 1} → {sup 3} P {sub 0} (492 GHz), [C I] {sup 3} P {sub 2} → {sup 3} P {sub 1} (809 GHz), and [C II] {sup 2} P {sub 3/2} → {sup 2} P {sub 1/2} (1900 GHz) transitions, as well as the lowest rotational transitions of {sup 12}CO and {sup 13}CO, with line intensities produced by the RATRAN radiative transfer code from the results of the Meudon PDR code. We constrain the density structure of the cloud by fitting a cylindrical density function to visual extinction data. We study the effects of variation of the FUV field, {sup 12}C/{sup 13}C isotopic abundance ratio, sulfur depletion, cosmic ray ionization rate, and inclination of the filament relative to the sky-plane on the chemical network of the PDR model and resulting line emission. We also consider the role of suprathermal chemistry and density inhomogeneities. We find good agreement between the model and observations, and that the integrated line intensities can be explained by a PDR model with an external FUV field of 0.05 G {sub 0}, a low ratio of {sup 12}C to {sup 13}C ∼43, a highly depleted sulfur abundance (by a factor of at least 50), a cosmic ray ionization rate (3-6) × 10{sup –17} s{sup –1}, and without significant effects from inclination, clumping or suprathermal chemistry.

A microsatellite-based analysis for the detection of selection on BTA1 and BTA20 in northern Eurasian cattle (Bos taurus populations

Directory of Open Access Journals (Sweden)

Li Meng-Hua

2010-08-01

Full Text Available Abstract Background Microsatellites surrounding functionally important candidate genes or quantitative trait loci have received attention as proxy measures of polymorphism level at the candidate loci themselves. In cattle, selection for economically important traits is a long-term strategy and it has been reported that microsatellites are linked to these important loci. Methods We have investigated the variation of seven microsatellites on BTA1 (Bos taurus autosome 1 and 16 on BTA20, using bovine populations of typical production types and horn status in northern Eurasia. Genetic variability of these loci and linkage disequilibrium among these loci were compared with those of 28 microsatellites on other bovine chromosomes. Four different tests were applied to detect molecular signatures of selection. Results No marked difference in locus variability was found between microsatellites on BTA1, BTA20 and the other chromosomes in terms of different diversity indices. Average D' values of pairwise syntenic markers (0.32 and 0.28 across BTA 1 and BTA20 respectively were significantly (P FST-test indicated elevated or decreased genetic differentiation, at SOD1 and AGLA17 markers respectively, deviating significantly (P SOD1 and AGLA17. Our data also indicate significant intergenic linkage disequilibrium around the candidate loci and suggest that hitchhiking selection has played a role in shaping the pattern of observed linkage disequilibrium. Conclusion Hitchhiking due to tight linkage with alleles at candidate genes, e.g. the POLL gene, is a possible explanation for this pattern. The potential impact of selective breeding by man on cattle populations is discussed in the context of selection effects. Our results also suggest that a practical approach to detect loci under selection is to simultaneously apply multiple neutrality tests based on different assumptions and estimations.

Juliana Ströbele-Gregor, Olaf Kaltmeier y Cornelia Giebeler (comp.), Construyendo Interculturalidad: Pueblos Indígenas, Educación y Políticas de Identidad en América Latina, GTZ Programa Fortalecimiento de Organizaciones Indígenas en América La

OpenAIRE

Elizalde, Antonio

2011-01-01

Este libro, resultado de un esfuerzo compartido por diversas instituciones, investigadores y editores, encabezados por el Grupo de Investigación E Pluribus Unum? Ethnic Identities in Transnational Integration Processes in the Americas de la Universidad de Bielefeld, trata un tema central para el futuro de nuestras mestizas sociedades latinoamericanas: la necesaria construcción -en el presente que vivimos- de la interculturalidad en nuestra América Latina. Esto en el nuevo contexto  donde los ...

Gene : CBRC-PABE-07-0025 [SEVENS

Lifescience Database Archive (English)

Full Text Available e-82 48% ref|XP_001253185.1| PREDICTED: similar to seven transmembrane helix receptor [Bos taurus] ref|XP_00...1250982.1| PREDICTED: similar to seven transmembrane helix receptor [Bos taurus] 1e-130 78% MINDSYFSGFILLGFT...QIFIDVALYSVECILLAMMSCDRLNAICKPLHHMTIMNLQLCQGLVVISWVVGVINCIIPSPYAMSLPRSMEVTTFAMCLIIVLVPLLLILVSYGFIAVAVLKIKSAA

Gene : CBRC-PTRO-07-0026 [SEVENS

Lifescience Database Archive (English)

Full Text Available e-79 50% ref|XP_001253185.1| PREDICTED: similar to seven transmembrane helix receptor [Bos taurus] ref|XP_00...1250982.1| PREDICTED: similar to seven transmembrane helix receptor [Bos taurus] 1e-120 76% MINDSRFSGFILLGFT...QLFIDVALYSVECILLSMMSYDRLNAICKPLHHMTIMNLQLCQGLVVISWIVGVINCIIPSPYAMSLPRSMEVTTFAMCLIIVLVPLLLILVSYGFIAVAVLKIKSAAGRQKAFGTCSSHLIVVSIFYGTVRYMYTQPGNSPSQDEGKLLHIFYSIFTPTLNPSH ...

Black gram ( L. foliage supplementation to crossbred cows: effects on feed intake, nutrient digestibility and milk production

Directory of Open Access Journals (Sweden)

Avijit Dey

2017-02-01

Full Text Available Objective An experiment was conducted to examine the effect of dietary supplementation of dried and ground foliage of black gram (Vigna mungo L. on feed intake and utilization, and production performance of crossbred lactating cows. Methods Eighteen lactating crossbred (Bos taurus×Bos indicus cows (body weight 330.93± 10.82 kg at their second and mid lactation (milk yield 6.77±0.54 kg/d were randomly divided into three groups of six each in a completely randomized block design. Three supplements were formulated by quantitatively replacing 0, 50, and 100 per cent of dietary wheat bran of concentrate mixture with dried and ground foliage of black gram. The designated supplement was fed to each group with basal diet of rice straw (ad libitum to meet the requirements for maintenance and milk production. Daily feed intake and milk yield was recorded. A digestion trial was conducted to determine the total tract digestibility of various nutrients. Results The daily feed intake was increased (p0.05, the fibre digestibility was increased (p0.05 among the groups, milk yield was increased by 10 per cent with total replacement of wheat bran in concentrate mixture with of black gram foliage. The economics of milk production calculated as feed cost per kg milk yield (INR 10.61 vs 7.98 was reduced by complete replacement of wheat bran with black gram foliage. Conclusion Black gram foliage could be used as complete replacement for wheat bran in concentrate mixture of dairy cows in formulating least cost ration for economic milk production in small holders’ animal production.

Idade de desmame e suplementação no desenvolvimento e em características de carcaças de novilhos de corte

Directory of Open Access Journals (Sweden)

Almeida Luciane Salgueiro Pio de

2003-01-01

Full Text Available O experimento foi conduzido na Estação Experimental da Universidade Federal do Rio Grande do Sul, município de Eldorado do Sul, Brasil, a fim de avaliar o desempenho de 40 bezerros filhos de vacas cruzas Bos indicus x Bos taurus até os dois anos de idade, desmamados precocemente (DP, com média de idade de 91 dias e mínimo de 70 kg de peso vivo, ou desmamados à idade convencional (DC, média de 170 dias de idade e peso médio de 131,2 kg, suplementados (Su ou não (NSu com ração energético-protéica com 14% de proteína bruta e 75% de nutrientes digestíveis totais, durante 91 dias no primeiro inverno. O delineamento experimental utilizado foi o delineamento completamente casualizado. Os novilhos do DP foram mais leves até um ano de idade (DP=208,7 kg x DC=233,5 kg. Aos 18-20 meses de idade, os novilhos não eram mais estatisticamente diferentes em seus pesos vivos (DP=279,9 kg x DC=292,5 kg. Ao abate, os pesos vivos médios foram de 432,3 kg (DC e 414,0 kg (DP, não diferindo também no rendimento, acabamento, conformação e classificação das carcaças. O desmame precoce não impediu o desenvolvimento e o abate dos novilhos aos dois anos de idade. A suplementação no primeiro inverno não alterou o desempenho dos novilhos ao abate.

Action of exogenous oxytocin on stress modulation in crossbred Red Angus cows

Directory of Open Access Journals (Sweden)

Janne Paula Neres de Barros

2016-10-01

Full Text Available Cattle (Bos taurus and Bos indicus are organised on the basis of leadership and dominance in such a manner that a disturbance by an external stressor causes negative effects on their health, productivity, well-being, and behaviour. One of these effects is the excessive release of glucocorticoids, which results in increased alertness. We evaluated the action of exogenous oxytocin (OT on serum cortisol levels in crossbred Red Angus heifers. Twelve Red Angus crossbred heifers were moved daily from the pasture to the corral in weeks 1 and 2 for adaptation to human contact and handling in the cattle crush. In weeks 3 and 4, they were divided into two groups of six (T1 and T2. The T1 group was administered 20 IU (2 mL of OT via intramuscular injection and the T2 group was administered 2 mL of saline solution 0.85% (SS. In weeks 5 and 6, they were only contained in the cattle crush for evaluation. On days 01, 07, 14, 21, 28, 35, and 42, blood samples were collected by jugular venepuncture in vacuum tubes without anticoagulants. Then, serum cortisol levels were measured using a radioimmunoassay. In the period of adaptation, during weeks 1 and 2, serum cortisol levels decreased in both the groups, with higher levels in the SS group; the same result was obtained in weeks 5 and 6. During treatment, however, there was a significant difference between the two groups in week 4, with a reduction in cortisol levels in the OT group. This result suggests a modulator effect of OT on neuroendocrine response to stress.

con dietas suplementadas con Cromo-L-metionina

Directory of Open Access Journals (Sweden)

Ram\\u00F3n Garc\\u00EDa-Castillo

2006-01-01

Full Text Available Un total de 48 cerdos (Sus scrofa domesticus; 24 machos castrados y 24 hembras cruzados (Yorkshire, Hampshire, Duroc y Landrace de 3,5 a 4,0 meses de edad y 60,0 ± 5,0 kg PV en finalización. Se alimentaron con dietas isoproteícas (14,5 % PC e isoenergéticas (3.400 kcal EM/kg de MS, adicionadas con Cr-L-metionina (MiCroPlex® (0, 200, 400 y 600 ppb. El experimento tuvo una duración de 45 días y se realizó de agosto a noviembre del 2002 en las instalaciones de la Universidad Autónoma Agraria Antonio Narro, localizada en Saltillo, Coahuila, México. Al tener los animales aproximadamente 95 kg PV, se tomó muestra de 15 ml de sangre por cada animal para determinar la concentración de glucosa, ácido úrico, creatinina, urea, proteinas totales y colesterol. Se aplicó un diseño completamente al azar con arreglo factorial 2 x 4; dos para el factor sexo y cuatro para nivel de cromo. Los metabolitos en suero no fueron afectados (P>0,05 por el factor sexo. La glucosa en suero disminuyó (P<0,05 y el colesterol incrementó (P<0,05 con cromo en la dieta. Se concluye que el Cr incrementa el metabolismo de glucosa y disminuye el de colesterol, con lo cual puede haber energía disponible para síntesis de proteína la cual es necesaria para el crecimiento de los animales

Prevalencia de la deficiencia de glucosa - 6 - fosfato deshidrogenasa en donadores voluntarios de sangre que acuden a los hospitales nacionales Cayetano Heredia y Arzobispo Loayza: Lima - Perú

Directory of Open Access Journals (Sweden)

Wilson Ruiz

1997-01-01

Full Text Available Objetivos: El presente trabajo tuvo como objetivo, conocer la Prevalencia de la deficiencia de la G-6-PDH, en la población masculina mestiza, aparentemente sana que acude a los Bancos de Sangre de los hospitales nacionales Cayetano Heredia (HNCH y Arzobispo Loayza (HNAL. Material y métodos: Se examinó 140 muestras de hemodonadores entre junio y julio, 60 (42.85% correspondieron al HNCH y 80 (57.15% al HNCH. Se aplicó un cuestionario a todos los donantes indagando por: raza en los ancestros y antecedentes patológicos compatibles con episodios de hemólisis enzimopática. En todas las muestras se empleó el método cualitativo de Brewer (tamizaje y posteriormente fueron sometidos a la prueba cuantitativa SIGMA. Resultados: Con el método de Brewer resultaron 9 casos positivos (6.42% de los cuales sólo uno resultó positivo con el método confirmatorio, lo cual da una prevalencia de 0.71%. La totalidad de los participantes fueron de raza mestiza, carecían de antecedentes importantes, las edades estuvieron comprometidas entre los 18 y 58 años y el hematocrito entre 40 y 48%. Conclusiones: Se confirma que la prevalencia de esta deficiencia, en nuestra población es bastante baja. (Rev Med Hered 1997; 8: 11-18.

NCBI nr-aa BLAST: CBRC-OLAT-15-0022 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-OLAT-15-0022 ref|NP_001073692.1| solute carrier family 29 (nucleoside transporters...), member 3 [Bos taurus] gb|AAI26742.1| Solute carrier family 29 (nucleoside transporters), member 3 [Bos taurus] NP_001073692.1 9e-68 49% ...

NCBI nr-aa BLAST: CBRC-ETEL-01-0499 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-ETEL-01-0499 ref|NP_001033642.1| progestin and adipoQ receptor family member V...II [Bos taurus] gb|AAI11285.1| Progestin and adipoQ receptor family member VII [Bos taurus] NP_001033642.1 1e-175 86% ...

NCBI nr-aa BLAST: CBRC-MDOM-07-0106 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-MDOM-07-0106 ref|NP_001071419.1| progestin and adipoQ receptor family member I...X [Bos taurus] gb|AAI22754.1| Progestin and adipoQ receptor family member IX [Bos taurus] NP_001071419.1 0.0 87% ...

NCBI nr-aa BLAST: CBRC-STRI-01-2314 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-STRI-01-2314 ref|NP_001033642.1| progestin and adipoQ receptor family member V...II [Bos taurus] gb|AAI11285.1| Progestin and adipoQ receptor family member VII [Bos taurus] NP_001033642.1 1e-161 89% ...

NCBI nr-aa BLAST: CBRC-PCAP-01-0894 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-PCAP-01-0894 ref|NP_001033642.1| progestin and adipoQ receptor family member V...II [Bos taurus] gb|AAI11285.1| Progestin and adipoQ receptor family member VII [Bos taurus] NP_001033642.1 1e-176 84% ...

NCBI nr-aa BLAST: CBRC-RNOR-05-0235 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-RNOR-05-0235 ref|NP_001033642.1| progestin and adipoQ receptor family member V...II [Bos taurus] gb|AAI11285.1| Progestin and adipoQ receptor family member VII [Bos taurus] NP_001033642.1 1e-169 83% ...

NCBI nr-aa BLAST: CBRC-GGAL-23-0005 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-GGAL-23-0005 ref|NP_001033642.1| progestin and adipoQ receptor family member V...II [Bos taurus] gb|AAI11285.1| Progestin and adipoQ receptor family member VII [Bos taurus] NP_001033642.1 1e-120 65% ...

NCBI nr-aa BLAST: CBRC-MDOM-04-0428 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-MDOM-04-0428 ref|NP_001033642.1| progestin and adipoQ receptor family member V...II [Bos taurus] gb|AAI11285.1| Progestin and adipoQ receptor family member VII [Bos taurus] NP_001033642.1 1e-149 76% ...

NCBI nr-aa BLAST: CBRC-SARA-01-0771 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-SARA-01-0771 ref|NP_001033642.1| progestin and adipoQ receptor family member V...II [Bos taurus] gb|AAI11285.1| Progestin and adipoQ receptor family member VII [Bos taurus] NP_001033642.1 1e-180 87% ...

NCBI nr-aa BLAST: CBRC-PVAM-01-1596 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-PVAM-01-1596 ref|NP_001033642.1| progestin and adipoQ receptor family member V...II [Bos taurus] gb|AAI11285.1| Progestin and adipoQ receptor family member VII [Bos taurus] NP_001033642.1 0.0 89% ...

NCBI nr-aa BLAST: CBRC-TTRU-01-1190 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-TTRU-01-1190 ref|NP_001071419.1| progestin and adipoQ receptor family member I...X [Bos taurus] gb|AAI22754.1| Progestin and adipoQ receptor family member IX [Bos taurus] NP_001071419.1 0.0 96% ...

NCBI nr-aa BLAST: CBRC-TTRU-01-0287 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-TTRU-01-0287 ref|NP_001033642.1| progestin and adipoQ receptor family member V...II [Bos taurus] gb|AAI11285.1| Progestin and adipoQ receptor family member VII [Bos taurus] NP_001033642.1 0.0 94% ...

NCBI nr-aa BLAST: CBRC-MMUR-01-1487 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-MMUR-01-1487 ref|NP_001033642.1| progestin and adipoQ receptor family member V...II [Bos taurus] gb|AAI11285.1| Progestin and adipoQ receptor family member VII [Bos taurus] NP_001033642.1 1e-179 87% ...

NCBI nr-aa BLAST: CBRC-PVAM-01-1010 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-PVAM-01-1010 ref|NP_001071419.1| progestin and adipoQ receptor family member I...X [Bos taurus] gb|AAI22754.1| Progestin and adipoQ receptor family member IX [Bos taurus] NP_001071419.1 0.0 92% ...

NCBI nr-aa BLAST: CBRC-TTRU-01-0672 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-TTRU-01-0672 ref|NP_001039933.1| protein kinase C and casein kinase substrate in neurons... 2 [Bos taurus] gb|AAI14746.1| Protein kinase C and casein kinase substrate in neurons 2 [Bos taurus] NP_001039933.1 1e-178 74% ...

Prevalence of infection and molecular confirmation by using ITS-2 region of Fasciola gigantica found in domestic cattle from Chiang Mai province, Thailand.

Science.gov (United States)

Phalee, Anawat; Wongsawad, Chalobol

2014-03-01

To investigate the infection of Fasciola gigantica (F. gigantica) in domestic cattle from Chiang Mai province and molecular confirmation using ITS-2 region. The liver and gall bladder of Bubalus bubalis (B. bubalis) and Bos taurus (B. taurus) from slaughterhouses were examined adult worms and prevalence investigation. The species confirmation with phylogenetic analysis using ITS-2 sequences was performed by maximum likelihood and UPGMA methods. The total prevalences of infection in B. bubalis and Bubalus taurus (B. taurus) were 67.27% and 52.94% respectively. The respective prevalence in both B. bubalis and B. taurus were acquired from Doi-Saket, Muang, and Sanpatong districts, with 81.25%, 62.50% and 60.00% for B. bubalis and 62.50%, 50.00% and 47.06% for Bos taurus respectively. The species confirmation of F. gigantica and some related species by basing on maximum likelihood and UPGMA methods used, 4 groups of trematodes were generated, first F. gigantica group including specimen of Chiang Mai, second 2 samples of F. hepatica, third group of 3 rumen flukes; Orthocoelium streptocoelium, F. elongatus and Paramphistomum epliclitum and fourth group of 3 minute intestinal flukes; Haplorchis taichui, Stellantchasmu falcatus, Haplorchoides sp. and liver fluke; Opisthorchis viverrini respectively. These results can be confirmed the Giant liver fluke which mainly caused fascioliasis in Chiang Mai was identified as F. gigantica and specimens were the same as those of F. gigantica recorded in other different countries. Nucleotide sequence of ITS-2 region has been proven as effective diagnostic tool for the identification of F. gigantica. Copyright © 2014 Hainan Medical College. Published by Elsevier B.V. All rights reserved.

16S partial gene mitochondrial DNA and internal transcribed spacers ribosomal DNA as differential markers of Trichuris discolor populations.

Science.gov (United States)

Callejón, R; Halajian, A; de Rojas, M; Marrugal, A; Guevara, D; Cutillas, C

2012-05-25

Comparative morphological, biometrical and molecular studies of Trichuris discolor isolated from Bos taurus from Spain and Iran was carried out. Furthermore, Trichuris ovis isolated from B. taurus and Capra hircus from Spain has been, molecularly, analyzed. Morphological studies revealed clear differences between T. ovis and T. discolor isolated from B. taurus but differences were not observed between populations of T. discolor isolated from different geographical regions. Nevertheless, the molecular studies based on the amplification and sequencing of the internal transcribed spacers 1 and 2 ribosomal DNA and 16S partial gene mitochondrial DNA showed clear differences between both populations of T. discolor from Spain and Iran suggesting two cryptic species. Phylogenetic studies corroborated these data. Thus, phylogenetic trees based on ITS1, ITS2 and 16S partial gene sequences showed that individuals of T. discolor from B. taurus from Iran clustered together and separated, with high bootstrap values, of T. discolor isolated from B. taurus from Spain, while populations of T. ovis from B. taurus and C. hircus from Spain clustered together but separated with high bootstrap values of both populations of T. discolor. Furthermore, a comparative phylogenetic study has been carried out with the ITS1and ITS2 sequences of Trichuris species from different hosts. Three clades were observed: the first clustered all the species of Trichuris parasitizing herbivores (T. discolor, T. ovis, Trichuris leporis and Trichuris skrjabini), the second clustered all the species of Trichuris parasitizing omnivores (Trichuris trichiura and Trichuris suis) and finally, the third clustered species of Trichuris parasitizing carnivores (Trichuris muris, Trichuris arvicolae and Trichuris vulpis). Copyright © 2011 Elsevier B.V. All rights reserved.

Genetic parameters of infectious bovine keratoconjunctivitis and its relationship with weight and parasite infestations in Australian tropical Bos taurus cattle

Directory of Open Access Journals (Sweden)

Ali Abdirahman A

2012-07-01

Full Text Available Abstract Background Infectious bovine keratoconjunctivitis (IBK or ‘pinkeye’ is an economically important ocular disease that significantly impacts animal performance. Genetic parameters for IBK infection and its genetic and phenotypic correlations with cattle tick counts, number of helminth (unspecified species eggs per gram of faeces and growth traits in Australian tropically adapted Bos taurus cattle were estimated. Methods Animals were clinically examined for the presence of IBK infection before and after weaning when the calves were 3 to 6 months and 15 to 18 months old, respectively and were also recorded for tick counts, helminth eggs counts as an indicator of intestinal parasites and live weights at several ages including 18 months. Results Negative genetic correlations were estimated between IBK incidence and weight traits for animals in pre-weaning and post-weaning datasets. Genetic correlations among weight measurements were positive, with moderate to high values. Genetic correlations of IBK incidence with tick counts were positive for the pre-weaning and negative for the post-weaning datasets but negative with helminth eggs counts for the pre-weaning dataset and slightly positive for the post-weaning dataset. Genetic correlations between tick and helminth eggs counts were moderate and positive for both datasets. Phenotypic correlations of IBK incidence with helminth eggs per gram of faeces were moderate and positive for both datasets, but were close to zero for both datasets with tick counts. Conclusions Our results suggest that genetic selection against IBK incidence in tropical cattle is feasible and that calves genetically prone to acquire IBK infection could also be genetically prone to have a slower growth. The positive genetic correlations among weight traits and between tick and helminth eggs counts suggest that they are controlled by common genes (with pleiotropic effects. Genetic correlations between IBK incidence

Genetic parameters of infectious bovine keratoconjunctivitis and its relationship with weight and parasite infestations in Australian tropical Bos taurus cattle.

Science.gov (United States)

Ali, Abdirahman A; O'Neill, Christopher J; Thomson, Peter C; Kadarmideen, Haja N

2012-07-27

Infectious bovine keratoconjunctivitis (IBK) or 'pinkeye' is an economically important ocular disease that significantly impacts animal performance. Genetic parameters for IBK infection and its genetic and phenotypic correlations with cattle tick counts, number of helminth (unspecified species) eggs per gram of faeces and growth traits in Australian tropically adapted Bos taurus cattle were estimated. Animals were clinically examined for the presence of IBK infection before and after weaning when the calves were 3 to 6 months and 15 to 18 months old, respectively and were also recorded for tick counts, helminth eggs counts as an indicator of intestinal parasites and live weights at several ages including 18 months. Negative genetic correlations were estimated between IBK incidence and weight traits for animals in pre-weaning and post-weaning datasets. Genetic correlations among weight measurements were positive, with moderate to high values. Genetic correlations of IBK incidence with tick counts were positive for the pre-weaning and negative for the post-weaning datasets but negative with helminth eggs counts for the pre-weaning dataset and slightly positive for the post-weaning dataset. Genetic correlations between tick and helminth eggs counts were moderate and positive for both datasets. Phenotypic correlations of IBK incidence with helminth eggs per gram of faeces were moderate and positive for both datasets, but were close to zero for both datasets with tick counts. Our results suggest that genetic selection against IBK incidence in tropical cattle is feasible and that calves genetically prone to acquire IBK infection could also be genetically prone to have a slower growth. The positive genetic correlations among weight traits and between tick and helminth eggs counts suggest that they are controlled by common genes (with pleiotropic effects). Genetic correlations between IBK incidence and tick and helminth egg counts were moderate and opposite between pre

Identification of a two-marker-haplotype on Bos taurus autosome 18 associated with somatic cell score in German Holstein cattle

Directory of Open Access Journals (Sweden)

Reinsch Norbert

2009-09-01

Full Text Available Abstract Background The somatic cell score (SCS is implemented in routine sire evaluations in many countries as an indicator trait for udder health. Somatic cell score is highly correlated with clinical mastitis, and in the German Holstein population quantitative trait loci (QTL for SCS have been repeatedly mapped on Bos taurus autosome 18 (BTA18. In the present study, we report a refined analysis of previously detected QTL regions on BTA18 with the aim of identifying marker and marker haplotypes in linkage disequilibrium with SCS. A combined linkage and linkage disequilibrium approach was implemented, and association analyses of marker genotypes and maternally inherited two-marker-haplotypes were conducted to identify marker and haplotypes in linkage disequilibrium with a locus affecting SCS in the German Holstein population. Results We detected a genome-wide significant QTL within marker interval 9 (HAMP_c.366+109G>A - BMS833 in the middle to telomeric region on BTA18 and a second putative QTL in marker interval 12-13 (BB710 - PVRL2_c.392G>A. Association analyses with genotypes of markers flanking the most likely QTL positions revealed the microsatellite marker BMS833 (interval 9 to be associated with a locus affecting SCS within the families investigated. A further analysis of maternally inherited two-marker haplotypes and effects of maternally inherited two-marker-interval gametes indicated haplotype 249-G in marker interval 12-13 (BB710 - PVRL2_c.392G>A to be associated with SCS in the German Holstein population. Conclusion Our results confirmed previous QTL mapping results for SCS and support the hypothesis that more than one locus presumably affects udder health in the middle to telomeric region of BTA18. However, a subsequent investigation of the reported QTL regions is necessary to verify the two-QTL hypothesis and confirm the association of two-marker-haplotype 249-G in marker interval 12-13 (BB710 - PVRL2_c.392G>A with SCS. For this

Efektivitas Nematoda Patogenik Serangga (Rhabditida: Steinernema dan Heterorhabditis terhadap Penggerek Batang Padi Putih (Scirpophaga innotata

Directory of Open Access Journals (Sweden)

Chaerani Chaerani

2006-12-01

Full Text Available White rice stem borer (Scirpophaga innotata is a destructive insect pest which is difficult to control with various tactics. The possibility of the use of non-endemic natural enemies such as entomopathogenic nematodes (Rhabditida: Steinernema and Heterorhabditis has been investigated in green house trials. Test of 12 isolates and species of Steinernema and Heterorhabditis originated from local and exotic sources revealed that H. indicus INA H4 was the most efficacious nematode by causing 74% larval and pupal mortality within rice stems. Reduction in plant damage due to nematode application could not be demonstrated as the experiment was limited to potted plants. Subsequent test using H. indicus INA H4 showed that increasing nematode concentration from 0.5 to 2.0x10^4 IJs/ml did not significantly affect insect mortality. The survival ability of H. indicus INA H4 infective juveniles on rice plant was less than 96 hours. Improvement of nematode application strategies including repeated spray, addition of antidesiccant, increasing spray volume and application at plant damage threshold or plant critical stage are therefore necessary to increase nematode effectiveness and simultaneously to reduce plant damage in field.

Application of progesterone and testosterone in the diagnose and control of reproduction in crossbreds animal husbandry; Aplicacion de progesterona y testosterona en el diagnostico y control de la reproduccion en ganaderias mestizas

Energy Technology Data Exchange (ETDEWEB)

Madrid-Bury, Ninoska [Fondo Nacional de Investigaciones Agropecuarias (FONAIAP), Centro de Investigaciones Agropecuarias del Estado Zulia, Maracaibo (Venezuela)

1997-07-01

identificacion y control de los problemas reproductivos. En ganaderias mestizas la P4 ha servido para identificar: 1) Dinamica de los ciclos estrales normales, frecuencia de celos anovulatorios, silenciosos y ciclos cortos; 2) Estado reproductivo de las vacas en el hato (94% de exito para identificar gestacion, anestro o ciclicidad); 3) Momento del servicio, destacando error de 19-23% en las observaciones de celo y su reduccion hasta 6-11% aplicando medidas de manejo; 13,7% de vacas repetidoras fueron inseminadas con P4 elevada; 4) Estado de nogestacion (95% de exactitud); 5) Inicio de pubertad (628 d y 309 k), los celos anovulatorios no puberales (8,2%) y los ciclos cortos (16,5%) y su relacion con la Calificacion del Tracto Reproductivo (CTR), Condicion Corporal (CC) y con la mejora nutricional; 6) Reinicio de la ciclicidad posparto, destacando la disociacion celo-ovulacion al caracterizar la actividad luteal al inicio del posparto (63% de FL cortas); 7) Diferentes perfiles del ciclo en vacas repetidoras (10 categorias); 8) Frecuencia de mortalidad embrionaria con variaciones de 6,6-11 y 8-23%; 9) Diagnostico de problemas ovaricos, en especial la presencia de quistes; 10) Una mayor fertilidad (62%) se observa con niveles de 3 o mas ng/ml de P4 4-5 d antes del servicio; y 11) Su integracion en la estrategia para el manejo de los Programas de Control Reproductivo y seguimiento de los tratamientos de sincronizacion del celo. En toretes mestizos, los niveles sericos de testosterona (1,6-1,9 ng/ml) senalan el momento de pubertad.

A Detached Protostellar Disk around a ˜0.2 M ⊙ Protostar in a Possible Site of a Multiple Star Formation in a Dynamical Environment in Taurus

Science.gov (United States)

Tokuda, Kazuki; Onishi, Toshikazu; Saigo, Kazuya; Hosokawa, Takashi; Matsumoto, Tomoaki; Inutsuka, Shu-ichiro; Machida, Masahiro N.; Tomida, Kengo; Kunitomo, Masanobu; Kawamura, Akiko; Fukui, Yasuo; Tachihara, Kengo

2017-11-01

We report ALMA observations in 0.87 mm continuum and 12CO (J = 3-2) toward a very low-luminosity (<0.1 L ⊙) protostar, which is deeply embedded in one of the densest cores, MC27/L1521F, in Taurus with an indication of multiple star formation in a highly dynamical environment. The beam size corresponds to ˜20 au, and we have clearly detected blueshifted/redshifted gas in 12CO associated with the protostar. The spatial/velocity distributions of the gas show there is a rotating disk with a size scale of ˜10 au, a disk mass of ˜10-4 M ⊙, and a central stellar mass of ˜0.2 M ⊙. The observed disk seems to be detached from the surrounding dense gas, although it is still embedded at the center of the core whose density is ˜106 cm-3. The current low-outflow activity and the very low luminosity indicate that the mass accretion rate onto the protostar is extremely low in spite of a very early stage of star formation. We may be witnessing the final stage of the formation of ˜0.2 M ⊙ protostar. However, we cannot explain the observed low luminosity with the standard pre-main-sequence evolutionary track unless we assume cold accretion with an extremely small initial radius of the protostar (˜0.65 {R}⊙ ). These facts may challenge our current understanding of the low mass star formation, in particular the mass accretion process onto the protostar and the circumstellar disk.

Quantitative trait loci mapping of calving and conformation traits on Bos taurus autosome 18 in the German Holstein population.

Science.gov (United States)

Brand, B; Baes, C; Mayer, M; Reinsch, N; Seidenspinner, T; Thaller, G; Kühn, Ch

2010-03-01

Linkage, linkage disequilibrium, and combined linkage and linkage disequilibrium analyses were performed to map quantitative trait loci (QTL) affecting calving and conformation traits on Bos taurus autosome 18 (BTA18) in the German Holstein population. Six paternal half-sib families consisting of a total of 1,054 animals were genotyped on 28 genetic markers in the telomeric region on BTA18 spanning approximately 30 Mb. Calving traits, body type traits, and udder type traits were investigated. Using univariately estimated breeding values, maternal and direct effects on calving ease and stillbirth were analyzed separately for first- and further-parity calvings. The QTL initially identified by separate linkage and linkage disequilibrium analyses could be confirmed by a combined linkage and linkage disequilibrium analysis for udder composite index, udder depth, fore udder attachment, front teat placement, body depth, rump angle, and direct effects on calving ease and stillbirth. Concurrence of QTL peaks and a similar shape of restricted log-likelihood ratio profiles were observed between udder type traits and for body depth and calving traits, respectively. Association analyses were performed for markers flanking the most likely QTL positions by applying a mixed model including a fixed allele effect of the maternally inherited allele and a random polygenic effect. Results indicated that microsatellite marker DIK4234 (located at 53.3 Mb) is associated with maternal effects on stillbirth, direct effects on calving ease, and body depth. A comparison of effects for maternally inherited DIK4234 alleles indicated a favorable, positive correlation of maternal and direct effects on calving. Additionally, the association of maternally inherited DIK4234 marker alleles with body depth implied that conformation traits might provide the functional background of the QTL for calving traits. For udder type traits, the strong coincidence of QTL peaks and the position of the QTL in a

Demographic consequences of increased winter births in a large aseasonally breeding mammal (Bos taurus) in response to climate change.

Science.gov (United States)

Burthe, Sarah; Butler, Adam; Searle, Kate R; Hall, Stephen J G; Thackeray, Stephen J; Wanless, Sarah

2011-11-01

1. Studies examining changes in the scheduling of breeding in response to climate change have focused on species with well-defined breeding seasons. Species exhibiting year-round breeding have received little attention and the magnitudes of any responses are unknown. 2. We investigated phenological data for an enclosed feral population of cattle (Bos taurus L.) in northern England exhibiting year-round breeding. This population is relatively free of human interference. 3. We assessed whether the timing of births had changed over the last 60 years, in response to increasing winter and spring temperatures, changes in herd density, and a regime of lime fertilisation. 4. Median birth date became earlier by 1·0 days per year. Analyses of the seasonal distribution of calving dates showed that significantly fewer calves were born in summer (decline from 44% of total births to 20%) and significantly more in winter (increase from 12% to 30%) over the study period. The most pronounced changes occurred in winter, with significant increases in both the proportion and number of births. Winter births arise from conceptions in the previous spring, and we considered models that investigated climate and weather variables associated with the winter preceding and the spring of conceptions. 5. The proportion of winter births was higher when the onset of the plant growing season was earlier during the spring of conceptions. This relationship was much weaker during years when the site had been fertilised with lime, suggesting that increased forage biomass was over-riding the impacts of changing plant phenology. When the onset of the growing season was late, winter births increased with female density. 6. Recruitment estimates from a stage-structured state-space population model were significantly negatively correlated with the proportion of births in the preceding winter, suggesting that calves born in winter are less likely to survive than those born in other seasons. 7.�

Resultados preliminares del forraje de Morus alba en la alimentación de vacas lecheras

Directory of Open Access Journals (Sweden)

M. Milera

2007-01-01

Full Text Available El objetivo del presente trabajo consistió en evaluar el potencial del forraje de M. alba con vacas mestizas para la producción de leche. El trabajo se desarrolló en Cuba, la cual se encuentra localizada entre los 19° y 81’ de longitud oeste. La Estación Experimental de Pastos y Forrajes “Indio Hatuey” está ubicada en el municipio de Perico, provincia de Matanzas, sobre un suelo ferralítico rojo, a los 22° 40’ 7’’ de latitud norte y 81° 2’ de longitud oeste, a una altura de 10.91 msnm. La evaluación se hizo con vacas mestizas del cruce Holstein x Cebú, que tenían 54 días de lactancia. El estudio se dividió en dos periodos: en el primero (que duró 53 días se suministró el forraje de morera ad libitum, sin trocear, y se pastoreó de forma restringida en gramíneas mejoradas de secano, sin fertilización; en el segundo periodo, los animales dispusieron de pastoreo de gramíneas mejoradas con un 10% de un área establecida con Leucaena leucocephala y recibieron forraje de morera restringido hasta el 1% del peso vivo; éste tuvo una duración de 87 días. Se determinó la disponibilidad de pasto, la composición bromatológica y el consumo de forraje de Morus alba, así como la producción de leche de las vacas. El forraje de morera presentó altos va- lores de proteína y bajos contenidos de fibra; los consumos en el primer periodo llegaron hasta 2.7% del peso vivo. La producción de leche promedio fue de 10.6 kg/vaca/día durante los 140 días de evaluación y la máxima producción se registró en los primeros 53 días (1 kg/vaca/día. Los resultados demostraron la alta calidad de la morera cuando se utiliza como forraje para la alimentación de vacas mestizas. En las condiciones evaluadas, es posible obtener producciones de 10 litros por animal diariamente, cuando se utiliza el forraje de morera en adición al pasto de especies mejoradas, sin suplementación de concentrados.

A Pan-STARRS1 Proper-Motion Survey for Young Brown Dwarfs in the Nearest Star-Forming Regions and a Reddening-Free Classification Method for Ultracool Dwarfs

Science.gov (United States)

Zhang, Zhoujian; Liu, Michael C.; Best, William M. J.; Magnier, Eugene; Aller, Kimberly

2018-01-01

Young brown dwarfs are of prime importance to investigate the universality of the initial mass function (IMF). Based on photometry and proper motions from the Pan-STARRS1 (PS1) 3π survey, we are conducting the widest and deepest brown dwarf survey in the nearby star-forming regions, Taurus–Auriga (Taurus) and Upper Scorpius (USco). Our work is the first to measure proper motions, a robust proxy of membership, for brown dwarf candidates in Taurus and USco over such a large area and long time baseline (≈ 15 year) with such high precision (≈ 4 mas yr-1). Since extinction complicates spectral classification, we have developed a new approach to quantitatively determine reddening-free spectral types, extinctions, and gravity classifications for mid-M to late-L ultracool dwarfs (≈ 100–5 MJup), using low-resolution near-infrared spectra. So far, our IRTF/SpeX spectroscopic follow-up has increased the substellar and planetary-mass census of Taurus by ≈ 50% and almost doubled the substellar census of USco, constituting the largest single increases of brown dwarfs and free-floating planets found in both regions to date. Most notably, our new discoveries reveal an older (> 10 Myr) low-mass population in Taurus, in accord with recent studies of the higher-mass stellar members. In addition, the mass function appears to differ between the younger and older Taurus populations, possibly due to incompleteness of the older stellar members or different star formation processes. Upon completion, our survey will establish the most complete substellar and planetary-mass census in both Taurus and USco associations, make a significant addition to the low-mass IMF in both regions, and deliver more comprehensive pictures of star formation histories.

DISCOVERY OF A WIDE BINARY BROWN DWARF BORN IN ISOLATION

International Nuclear Information System (INIS)

Luhman, K. L.; Allen, P. R.; Mamajek, E. E.; Muench, A. A.; Finkbeiner, D. P.

2009-01-01

During a survey for stars with disks in the Taurus star-forming region using the Spitzer Space Telescope, we have discovered a pair of young brown dwarfs, FU Tau A and B, in the Barnard 215 dark cloud. They have a projected angular separation of 5.''7, corresponding to 800 AU at the distance of Taurus. To assess the nature of these two objects, we have obtained spectra of them and constructed spectral energy distributions. Both sources are young (∼1 Myr) according to their Hα emission, gravity-sensitive spectral features, and mid-infrared excess emission. The proper motion of FU Tau A provides additional evidence of its membership in Taurus. We measure spectral types of M7.25 and M9.25 for FU Tau A and B, respectively, which correspond to masses of ∼0.05 and ∼0.015 M sun according to the evolutionary models of Chabrier and Baraffe. FU Tau A is significantly overluminous relative to an isochrone passing through FU Tau B and relative to other members of Taurus near its spectral type, which may indicate that it is an unresolved binary. FU Tau A and B are likely to be components of a binary system based on the low probability (∼3 x 10 -4 ) that Taurus would produce two unrelated brown dwarfs with a projected separation of a ≤ 6''. Barnard 215 contains only one other young star and is in a remote area of Taurus, making FU Tau A and B the first spectroscopically confirmed brown dwarfs discovered forming in isolation rather than in a stellar cluster or aggregate. Because they were born in isolation and comprise a weakly bound binary, dynamical interactions with stars could not have played a role in their formation, and thus are not essential for the birth of brown dwarfs.

Tienie du Plessis: maker van boeke

African Journals Online (AJOL)

28 Mrt. 2016 ... huldeblyk. Na 'n heupoperasie sterf hy aan 'n hartaanval op. Vrydagoggend 9 Oktober 2015 in die Little Company of Mary Hospitaal in Pretoria. Ons het mekaar leer ken deur sy betrokkenheid by die uitgewery Taurus en. Stet, die kortstondige little magazine van die 1980's. Hy het Taurus se boeke ontwerp.

Revisiting AFLP fingerprinting for an unbiased assessment of genetic structure and differentiation of taurine and zebu cattle

Science.gov (United States)

2014-01-01

Background Descendants from the extinct aurochs (Bos primigenius), taurine (Bos taurus) and zebu cattle (Bos indicus) were domesticated 10,000 years ago in Southwestern and Southern Asia, respectively, and colonized the world undergoing complex events of admixture and selection. Molecular data, in particular genome-wide single nucleotide polymorphism (SNP) markers, can complement historic and archaeological records to elucidate these past events. However, SNP ascertainment in cattle has been optimized for taurine breeds, imposing limitations to the study of diversity in zebu cattle. As amplified fragment length polymorphism (AFLP) markers are discovered and genotyped as the samples are assayed, this type of marker is free of ascertainment bias. In order to obtain unbiased assessments of genetic differentiation and structure in taurine and zebu cattle, we analyzed a dataset of 135 AFLP markers in 1,593 samples from 13 zebu and 58 taurine breeds, representing nine continental areas. Results We found a geographical pattern of expected heterozygosity in European taurine breeds decreasing with the distance from the domestication centre, arguing against a large-scale introgression from European or African aurochs. Zebu cattle were found to be at least as diverse as taurine cattle. Western African zebu cattle were found to have diverged more from Indian zebu than South American zebu. Model-based clustering and ancestry informative markers analyses suggested that this is due to taurine introgression. Although a large part of South American zebu cattle also descend from taurine cows, we did not detect significant levels of taurine ancestry in these breeds, probably because of systematic backcrossing with zebu bulls. Furthermore, limited zebu introgression was found in Podolian taurine breeds in Italy. Conclusions The assessment of cattle diversity reported here contributes an unbiased global view to genetic differentiation and structure of taurine and zebu cattle

Studies on the growth and reproduction of cattle in the tropics

International Nuclear Information System (INIS)

Frisch, J.E.

1990-01-01

The results of a number of studies that had the long term aim of increasing the productivity of cattle in the tropics are reported. The studies were conducted on the B (Brahman), HS (interbred Hereford x Shorthorn), F 1 BX (first cross B x HS) and F n BX (interbred B x HS) lines. These breeds were used to demonstrate the origins of the heterosis that occurs in both the realized growth and the reproductive rate of Bos indicus x Bos taurus. Genetic and environmental factors that limit the realized reproductive rates were also investigated. The reproductive rate of cows of each breed that differed in lactation status during the breeding season was compared in contrasting environments. It was shown that the main limitation to HS achieving high realized reproductive rates was of environmental origin. For B cows, the main limitation was associated with the stress of lactation. Unsuccessful attempts were made to overcome this limitation by using progesterone releasing intravaginal devices alone or in combination with temporary calf weaning to try to induce a fertile oestrus. Improvement of the realized reproductive rates in the HS line was achieved by increasing their resistance to environmental stresses. The prospects for increasing the realized reproductive rate of maiden heifers by increasing their live weight at the start of their first breeding season were also investigated. About half of the heifers of each breed were implanted with the synthetic growth promotant Synovex 'H' on three occasions before the start of the breeding season. Although the live weight of all breeds increased in response to Synovex 'H', the magnitude of the response was dependent on the presence or absence of parasite control. Previously implanted heifers had a lower pregnancy rate than non-implanted heifers. 4 refs, 6 tabs

RELAÇÃO ENTRE COMPONENTES DO CORPO VAZIO E RENDIMENTOS DE CARCAÇA DE NOVILHOS DE CORTE

Directory of Open Access Journals (Sweden)

Miguelangelo Ziegler Arboitte

2006-10-01

Full Text Available O objetivo deste experimento foi avaliar a relação entre os vários componentes das partes do corpo não-integrantes da carcaça com os rendimentos de carcaça quente (RCQ e fria (RCF expressos em relação ao peso de abate (PAB ou de corpo vazio (PCV de novilhos de corte. Foram utilizados 24 animais mestiços Charolês – Nelore,terminados em confinamento. Nenhum componente do corpo vazio, bem como os conjuntos dos componentes apresentaram relação significativa com os RCQ e RCF quando ajustados para PAB. Quando avaliados em relação ao PCV, o RCQ correlacionou-se positivamente com coração (r=0,41 e negativamente com as gorduras internas: inguinal (r=-0,62, renal (r=-0,48, toalete (r=-0,51 e ruminal+intestinal (r=-0,57. E o RCF apresentou relação positiva com cabeça (r=0,42, coração (r=0,45 e omaso (r=0,49, e negativa com couro (r=-0,45, abomaso (r=-0,52 e gorduras internas:inguinal (r=-0,46, renal (r=-0,43, toalete (r=-0,68 e ruminal+intestinal (r=-0,72. Para os conjuntos dos componentes, apenas as gorduras internas correlacionaram-se significativamente com os RCQ (r=-0,68 e RCF (r=-0,76 expressos em relação ao PCV. Correlação significativa foi verificada entre os conjuntos gorduras internas com componentes externos (r=0,50 e entre os conjuntos trato digestivo vazio com órgãos vitais (r=0,74. PALAVRAS-CHAVE: Bos indicus, Bos taurus, couro, cruzamento, gordura interna.

Suplementación y metabolismo de hierro en neonatos bovinos en condiciones de trópico

Directory of Open Access Journals (Sweden)

Paola Andrea Páez

2013-01-01

Full Text Available Se estudió el efecto del suministro de hierro en la dinámica hemática y su metabolismo en terneros; para el efecto se seleccionaron 72 neonatos bovinos pertenecientes a tres grupos raciales: dos de origen Bos taurus (Hartón de Valle y Holstein Friesian y uno de origen Bos indicus (Cebú Brahmán para un total de 24 animales por raza y ocho animales por grupo experimental. Los animales del grupo 1 recibieron 500 mg de hierro dextran intramuscular (T1, al grupo 2 se le suministraron 100 mg de espirulina oral (T2 y el grupo 3 permaneció como control (T3. El suministro de hierro se hizo cada mes desde el nacimiento hasta los 6 meses de edad de los terneros, mensualmente se tomaron muestras de sangre mediante venipunción yugular y sistema vacutainer en tubos con y sin anticoagulante (EDTA. El promedio de ganancia de peso vivo animal fue 509 ± 0.40 g/día. El número de leucocitos/mm³ fue de 16,059. El promedio de hemoglobina en sangre fue de 12.11 ± 2.8 g/dl, el hematocrito presentó un valor de 38.4% ± 7.6 y la concentración promedio de hemoglobina corpuscular fue de 31.62% ± 4.7. La proteína sérica presentó un valor promedio de 5.55 ± 0.7 g/dl, el valor promedio de hierro sérico fue de 18.70± 11.8 µmol/lt. Los análisis estadísticos mostraron que el factor mes de muestreo y raza fueron significativos para los valores séricos de los metabolitos analizados, mientras que los valores de la concentración promedio de hemoglobina corpuscular lo fueron para tratamiento (P < 0.01.

ÓPTIMO TÉCNICO Y ECONÓMICO EN BOVINOS PRODUCTORES DE CARNE ENGORDADOS EN CORRAL

Directory of Open Access Journals (Sweden)

S. Rebollar-Rebollar

2011-01-01

Full Text Available The feedlot cattle producers in the south zone of the State of Mexico, generally does not an correct planning of sale to the market of yours finished hooky. Likewise, they lack a technical and administrative managing in his productive units, focused with the efficient use of inputs, which has prevented that they maximize her monetary earnings. The present research was realized to estimate the levels technical (TOL and economic optimal (EOL in feedlot cattle, using two cubic functions of production with diminishing marginal returns. There was in use 100 hooky Bos taurus x Bos indicus. Alive weight-LW to beginning of the fattens of 290 ± 15 kg, age 21 to 24 months fattened in feedlot during 93 days consuming a diet totally mixed (Protein: 133.33, FDN: 237.44, FDA 114.33 g/kg MS and 2.62 MS's Mcal/kg of metabolisable energy. To estimate the both functions (TOL and EOL, the profit of weight was considered to be a dependent variable. For the first production function the food consumption was taken as an independent variable and in the second the time defined in days. For the first production function the TOL was of 475.04 and the EOL was of 473.94 kg of LW; with a food consumption of 12.58 and 12.36 kg/day. For the second production function the TOL it was 475.01 and the EOL of 460.21 kg of LW, with a period of 93.29 and 77.21 days. The ideal point of sale and the maximum profit is obtained by the second production function, when the animals they come an LW of 460.21 kg during a food period of 77.21 days