WorldWideScience

Sample records for mesenchymateuses humaines csm

  1. Study of human mesenchymal stem cells plasticity into radiation injured tissues in a N.O.D./S.C.I.D. mouse model: therapeutic approach of the multiple organ dysfunction; Etude de la capacite plastique des Cellules Souches Mesenchymateuses humaines (CSM) apres irradiation du tissu receveur: approche therapeutique de l'atteinte multiorgane radio-induite

    Energy Technology Data Exchange (ETDEWEB)

    Francois, S

    2006-01-15

    The therapeutic potential of bone marrow-derived human mesenchymal stem cells (h.M.S.C.) has recently been brought into the spotlight of many fields of research. One possible application of the approach is the repair of injured tissues arising from side effects of radiation treatments and accidents. The first challenge in cell therapy is to assess the quality of the cell and the ability to retain their differentiation potential during the expansion process. Efficient delivery to the sites of intended action is also necessary. We addressed both questions using h.M.S.C. cultured and then infused to Non Obese Diabetes/Severe Combined Immunodeficiency (N.O.D./S.C.I.D.) mice submitted to total body irradiation. Further, we tested the impact of additional local irradiation superimposed to total body irradiation (T.B.I.), as a model of accidental irradiation. Our results showed that the h.M.S.C. used for transplant have been expanded without significant loss in their differentiation capacities. After transplantation into adult unconditioned mice, h.M.S.C. not only migrate in bone marrow but also into other tissues. Total body irradiation increased h.M.S.C. implantation in bone marrow and muscle and further led to engraftment in brain, heart, and liver. Local irradiation, in addition to T.B.I., increased both specific homing of injected cells to the injured tissues and to other tissues outside the local irradiation field. M.S.C. may participate to restoration of intestinal homeostasis 3 days post abdominal irradiation. This study suggests that using the potential of h.M.S.C. to home to various organs in response to tissue injuries could be a promising strategy to repair the radiation induced damages. (author)

  2. Humain behavior

    CERN Multimedia

    James,M

    1979-01-01

    Le Dr.Muriel James est ingénieur, conseiller/consultant dans plusieurs commissions (p.ex.justice criminelle au Japon) et universités et est l'auteur de nombreux livres (11) traduits dans plusieurs langues. Le plus connu de ses ouvrages est "Born to win". Dans son exposé elle se réfère à son livre "O.K.Boss" et parle d'un modèle spécifique du comportement humain et de ses qualités essentielles qui est la base de son travail.

  3. Cervical Spondylotic Myelopathy (CSM)

    Science.gov (United States)

    ... to normal aging. Arthritis of the spine and spinal cord trauma can be other causes of CSM. How is cervical spondylotic myelopathy diagnosed? Your doctor will do a ... can confirm if you have spinal cord compression in your neck. It also can ...

  4. CSM: Profamilia's approach in Colombia.

    Science.gov (United States)

    Samuel, S

    1982-03-01

    Colombia's PROFAMILIA has successfully operated a contraceptive social marketing (CSM) program since 1973. Beginning with 1 salesperson distributing primarily to Cajas de Subsideio, the CSM program is now distributed through 70-80% of the 6000 registered pharmacies in the country, as well as pharmacy counters of several supermakets in urban areas. During 1981, PROFAMILIA's 5 salespersons accountd for commerical sales of oral contraceptives (OCs) to 225,000 couples and sales of barrier methods to another 75,000. Program sales of contraceptives and other products generated approximately US $1.7 million in revenue for the same year. PROFAMILIA's marketing approach is unique in its product and promotinal characteristics. Supplies are obtained directly from local and foreign manufacturers and are resold without any repackaging. While it is generally believed that CSM programs expand the market for contraceptives, data analysis and analysis of PROFAMILIA's distribution system suggests that the PROFAMILIA CSM program has simply absorbed some of the previously existing commerical market. Total commerical market sales of oral contraceptives (OCs) have grown at an annual rate of 3-4% since 1975. During the same period, direct sales of Schering, Wyeth, and other competitors have declined. PROFAMILIA's community-based program operates mainly among urban and semi-rural lower income populations. It sells products through established retail outlets rather than through institutional or non-retail outlets. PROFAMILIA's community-based program in all respects but its use of a staff of 112 salaried "instructoras" is as much a marketing program as PROFAMILIA's sales through pharmacies. Taken together, the 2 program expanded the commerical makert by about 1/2 since 1975. The contraceptive social marketing or pharmacy sales program appears to excel at generation of revenue and delivery of products to higher income clients. The community-based program excels at delivery of information

  5. Chamber service module (CSM1) for MDT

    CERN Document Server

    Binchi, P

    2002-01-01

    CSM-1 is the second and latest version of the high speed electronic unit whose primary task is to multiplex serial data from up to 18 ASD /TDC cards located at the ends of the Monitored Drift Tubes. Each CSM will capture data from all 24 channel TDC (AMT-2 units) of a given chamber and transfer it along a single optic fiber to the MROD, the event builder and readout driver. The core of the board is a Xilinx VirtexII FPGA which will use JTAG protocol (IEEE Std. 1149.1) for logic configuration parameter loading.

  6. Crystal structure of the Csm3-Csm4 subcomplex in the type III-A CRISPR-Cas interference complex.

    Science.gov (United States)

    Numata, Tomoyuki; Inanaga, Hideko; Sato, Chikara; Osawa, Takuo

    2015-01-30

    Clustered, regularly interspaced, short palindromic repeat (CRISPR) loci play a pivotal role in the prokaryotic host defense system against invading genetic materials. The CRISPR loci are transcribed to produce CRISPR RNAs (crRNAs), which form interference complexes with CRISPR-associated (Cas) proteins to target the invading nucleic acid for degradation. The interference complex of the type III-A CRISPR-Cas system is composed of five Cas proteins (Csm1-Csm5) and a crRNA, and targets invading DNA. Here, we show that the Csm1, Csm3, and Csm4 proteins from Methanocaldococcus jannaschii form a stable subcomplex. We also report the crystal structure of the M. jannaschii Csm3-Csm4 subcomplex at 3.1Å resolution. The complex structure revealed the presence of a basic concave surface around their interface, suggesting the RNA and/or DNA binding ability of the complex. A gel retardation analysis showed that the Csm3-Csm4 complex binds single-stranded RNA in a non-sequence-specific manner. Csm4 structurally resembles Cmr3, a component of the type III-B CRISPR-Cas interference complex. Based on bioinformatics, we constructed a model structure of the Csm1-Csm4-Csm3 ternary complex, which provides insights into its role in the Csm interference complex. Copyright © 2014 Elsevier Ltd. All rights reserved.

  7. Verification and Evaluation of Aquatic Contaminant Simulation Module (CSM)

    Science.gov (United States)

    2016-08-01

    compartment can be considered a sink for volatile contaminants . In CSM, contaminants can enter the water column via surface runoff, atmospheric deposition, and...Approved for public release; distribution is unlimited. ERDC/TN EQT-16-2 August 2016 Verification and Evaluation of Aquatic Contaminant ...developed the aquatic contaminant simulation module (CSM). The overall purpose of the CSM is to provide a “plug in” contaminant simulation module for

  8. Egypt site of first CSM marketing audit.

    Science.gov (United States)

    1982-01-01

    The 1st application of the marketing audit concept to a CSM project was implemented in Egypt's Family of the Future (FOF) contraceptive social marketing program in 1982. The audit defined the basic mission of the FOF as one of assisting the government in achieving its long range family planning goals. The stated FOF objectives are as follows: to create an awareness or an increase in demand for family planning services, particularly among the lower socioeconomic strata in urban Egypt; to establish and maintain a reliable supply mechanism to make FOF products more readily acceptable and available from pharmacies; and to consolidate the CSM operations and services first in the greater Cairo area and then expand to other urban areas in Egypt. The core strategy of the FOF incorporates several elements, including intensive media based advertising and personal promotion to promote the concept of family planning and to educate the general public about contraceptive alternatives. FOF product prices are considerably lower than commercial prices. Dr. Alan R. Andreasen, who conducted the audit on behalf of the FOF technical assistance contractor, noted that the FOF is growing rapidly and stated that the audit recommendations were intended to help FOF management. Dr. Andreasen conducted interviews with all the senior personnel at FOF and met with various specialized staff members such as the Public Relations Manager. Dr. Andreasen noted that at the time of the audit the FOF could claim major accomplishments in creating an awareness of the need for family planning and in product sales. From the time products were launched in 1979 through 1981 condom sales increased 260%. Foaming tablet sales increased more than 320% and IUD sales increased nearly 330%. The introduction of the Copper 7 IUD accounted for 35% of the growth of IUD sales in 1981. Couple years of protection (CYP) provided by all products increased from 45,533 in 1979 to 190,831 in 1981, an increase over 300%. The

  9. Nigerian CSM project ready to roll.

    Science.gov (United States)

    1985-01-01

    Nigeria's contraceptive social marketing (CSM) project is ready to be launched. Population Services Intenational (PSI) had completed the groundwork for the project, funded primarily by a $200,000 grant from the nonpofit D.K. Tyagi Fund. The Population Crisis Committee also provided support for the new project. At presstime, PSI was negotiating for continued project funding from the US Agency for International Development (USAID) and The Futures Group. PSI already has identified suitable products, researched brand names, arranged for distribution, appointed an advertising agency, designed packaging, written a marketing plan, and taken steps to create a local, nonprofit marketing organization to manage the project. PSI has named Tim Barton as the resident manager. He will take up his post once the issue of future funding is resolved. Contraceptives now available are distributed through the private sector and by the Planned Parenthood Federation of Nigeria, the Local International Planned Parenthood Federation affiliate. Nigeria's annual rate of population growth is about 3% and the country is urbanizing rapidly. A 1983 fertility report revealed that only 14% of Nigerian women had ever used any type of contraception; 6% of married women were using a contraceptive method at the time of the survey.

  10. Culture entrepreneuriale et developpement humain: quelle articulation

    African Journals Online (AJOL)

    apprentissage de l'entrepreneuriat sur l'insertion socio-professionnelle des jeunes diplômés de l'enseignement supérieur au regard du développement humain. Les indicateurs tels que la possession d'outils adéquats permettant aux jeunes d'avoir ...

  11. Coordonnateur des ressources humaines | CRDI - Centre de ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Le coordonnateur des ressources humaines appuie les partenaires d'affaires en RH dans le cadre de la prestation de services intégrés aux clients selon une approche reposant sur le portefolio. Plus particulièrement, le titulaire fournit des services opérationnels tels que la prestation de renseignements sur la rémunération ...

  12. Coordonnateur, (h/f) Ressources humaines | CRDI - Centre de ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Sous la direction de directrice des ressources humaines, le coordonnateur, Ressources humaines procure à la directrice une aide opérationnelle et administrative, fournit un éventail de services d'administration, de recherche, de coordination et de logistique à l'appui des activités de la direction des RH et contribue à ...

  13. Geological and structural setting of the CSM/OCRD test site: CSM experimental mine, Idaho Springs, Colorado

    International Nuclear Information System (INIS)

    Hutchinson, R.M.

    1983-09-01

    This report is the second in a series describing research conducted by the Colorado School of Mines (CSM) for the Office of Crystalline Repository Development (OCRD) to determine the extent of blast damage in rock surrounding an underground opening. A special room, called the CSM/OCRD room, was excavated for the purpose of assessing blast damage in the rock around the room. Even though this mine is not proposed as a nuclear waste repository site, the instrumentation and methods of blast damage assessment developed in this project are applicable to proposed repository sites. In order to understand which instruments and techniques are most applicable and what types of fractures existed before blasting, a thorough description of the rock mass surrounding the room is necessary. This report describes the geologic history of the area surrounding the Colorado School of Mines' Experimental Mine. The purpose of the historical description is to explain the probable origin of faults, fractures, and joints that affect rock mass permeability around the excavation site. This report will also provide probable cause of original rock mass stress in existence prior to excavating the experimental room. Furthermore, it provides a basis for detailed mapping of the CSM/OCRD experimental room wall rock. 19 references, 19 figures

  14. Des relations plus humaines ?

    Directory of Open Access Journals (Sweden)

    Ferruccio Ricciardi

    2012-05-01

    Full Text Available À partir d’une approche sociohistorique, cet article s’intéresse aux effets de la croissance économique sur l’identité des cadres, en l’occurrence les groupements de cadres et patrons italiens qui, au lendemain de la Seconde Guerre mondiale, essaient de conjuguer les principes du catholicisme social dont ils se réclament dans l’arène publique avec les logiques issues du productivisme managérial américain qui s’impose en Europe occidentale. Le prisme des méthodes de « relations humaines » pour la gestion des salariés est ici utilisé pour rendre compte des modes de construction d’une identité professionnelle prise entre l’« esprit du religieux » et l’« esprit du capitalisme ». La déclinaison des « relations humaines » en fonction du projet de justice sociale préconisé par la doctrine sociale de l’Église en ressort amendée, car elles sont perçues moins comme un levier pour l’intégration des salariés que comme un instrument au service du contrôle politique de ceux-ci.Are the relations more human? Catholic executives and the employers facing the managerial productivism (Italy, ‘50s-‘60sThis article deals with the effects of economic growth on the identity of managers and the employers, especially the Italian ones who, after the World War II, try to combine their catholic principles with the issues of the managerial productivism spreading in the Western Europe. Adopting a socio-historical framework, the article analyses the implementation of the human relations techniques for the management of personnel in order to grasp a split professional identity between the ‘spirit of religious’ and the ‘spirit of capitalism’. The declination of the human relations theories according to the principles of social justice advocated by the social doctrine of the Church has been amended, because of the perception of the human relations as a means for political control of workers rather than an

  15. Analyse, Modélisation et Simulation du Mouvement Humain

    OpenAIRE

    Multon , Franck

    2006-01-01

    Comprendre le mouvement humain mobilise des chercheurs de nombreuses disciplines scientifiques : physiologie, biomécanique, neurosciences comportementales, anatomie fonctionnelle, les sciences du sport... Mes travaux s'inscrivent donc dans une démarche pluridisciplinaire d'analyse/synthèse du mouvement humain. Pour mener à bien cette démarche, une première tâche consiste à modéliser et à simuler le système moteur ainsi qu'un ensemble d'hypothèses. L'objectif est de disposer d'une représentati...

  16. Les indicateurs de developpement humain au niveau infranational ...

    African Journals Online (AJOL)

    Chaque année l'Algérie est tenu d'élaborer un rapport sur le développement humain. Pour ce faire l'ensemble des indicateurs de développement humain préconisé par le PNUD sont calculés au niveau national. Bien que l'équilibre régional a été et reste un objectif de la politique économique et sociale algérienne, des ...

  17. Autonomisation des femmes au moyen de lieux de travail humains ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Autonomisation des femmes au moyen de lieux de travail humains : Ateliers de confection en Asie du SudEst. En Asie, les ateliers de confection constituent un secteur d'emplois dominant, néanmoins les conditions dans ces lieux de travail sont parmi les plus rudes dans la région. Dans beaucoup d'ateliers de confection en ...

  18. Global Positioning System (GPS) civil signal monitoring (CSM) trade study report

    Science.gov (United States)

    2014-03-07

    This GPS Civil Signal Monitoring (CSM) Trade Study has been performed at the direction of DOT/FAA Navigation Programs as the agency of reference for consolidating civil monitoring requirements on the Global Positioning System (GPS). The objective of ...

  19. Comparison of two matrix data structures for advanced CSM testbed applications

    Science.gov (United States)

    Regelbrugge, M. E.; Brogan, F. A.; Nour-Omid, B.; Rankin, C. C.; Wright, M. A.

    1989-01-01

    The first section describes data storage schemes presently used by the Computational Structural Mechanics (CSM) testbed sparse matrix facilities and similar skyline (profile) matrix facilities. The second section contains a discussion of certain features required for the implementation of particular advanced CSM algorithms, and how these features might be incorporated into the data storage schemes described previously. The third section presents recommendations, based on the discussions of the prior sections, for directing future CSM testbed development to provide necessary matrix facilities for advanced algorithm implementation and use. The objective is to lend insight into the matrix structures discussed and to help explain the process of evaluating alternative matrix data structures and utilities for subsequent use in the CSM testbed.

  20. Developpement du systeme de gestion des ressources humaines ...

    African Journals Online (AJOL)

    Il s'agit d'une enquête transversale descriptive et analytique dont les données recueillies par la méthode Delphi ont couvert cinq catégories de variables relatives au système de gestion des ressources humaines : la capacité de GRH, les politiques et pratiques en faveur des RH, les informations sur le personnel, le système ...

  1. Distribution des Glossines vecteurs de la Trypanosomose humaine ...

    African Journals Online (AJOL)

    SARAH

    28 févr. 2015 ... RESUME. Objectifs : Dans le but de connaitre la densité apparente et la composition spécifique des glossines dans un ancien foyer de la Trypanosome humaine africaine au Gabon, une enquête entomologique a été menée dans deux biotopes du Parc National de Moukalaba Doudou (Sud Gabon) : le ...

  2. Gestionnaire, Solutions d'affaires en ressources humaines | CRDI ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Résumé des fonctions Le gestionnaire, Solutions d'affaires en ressources humaines (RH) est responsable de la prestation de solutions d'affaires intégrées en RH aux clients afin de veiller au respect et à la réalisation des objectifs stratégiques et des plans d'activités du CRDI, ce qui comprend le Plan de mise en œuvre des ...

  3. SOMARC teams with private distribution firm to implement CSM program in Ghana.

    Science.gov (United States)

    1985-01-01

    SOMARC, together with a private manufacturer and distributor of pharmaceutical products (Danafco, Limited), is launching a new contraceptive social marketing (CSM) program designed to make low cost, modern contraceptive products widely available in Ghana's cities. Danafco will directly implement the CSM program. Both the US Agency for International Development (USAID) and the government of Ghana will provide support to the program. James R. Kirland, USAID Population Officer, will assume overall responsibility for coordination and monitoring of CSM program activities. By a special amendment to the Pharmacy and Drug Act of 1961, the Ghanaian government has enabled the CSM program to conduct a demonstration project. Under the project, chemical sellers and retailers who successfully complete a special training session will be entitled to dispense oral contraceptives (OCs) without prescription. With the successful completion of this project, it is hoped that the Ghanaian government will further amend the Pharmacy Act to make contraceptives available nationwide on a nonprescription basis. Initially, the Ghana CSM program will market 3 products: a standard dosage OC; a foaming vaginal tablet; and an uncolored condom. Market research is now underway to determine product names for the OCs and vaginal tablets. The condom will be marketed under the name Panther. The project plans to conduct a retail audit to define current prices in the Ghanaian contraceptive market. Danafco will subcontract with Lintas Ghana Limited to provide advertising, package design, and promotion for the Ghana CSM program. Overall campaign efforts will focus on generating a positive climate for the program among influentials in government, religion, education, and health as well as consumers. The advertising campaign will include radio, television, print, and outdoor media. SOMARC, in collaboration with the USAID/Accra mission, hopes to establish an appropriate climate prior to the advertising launch

  4. The Proteome of the Differentiating Mesencephalic Progenitor Cell Line CSM14.1 In Vitro

    Directory of Open Access Journals (Sweden)

    B. Weiss

    2014-01-01

    Full Text Available The treatment of Parkinson's disease by transplantation of dopaminergic (DA neurons from human embryonic mesencephalic tissue is a promising approach. However, the origin of these cells causes major problems: availability and standardization of the graft. Therefore, the generation of unlimited numbers of DA neurons from various types of stem or progenitor cells has been brought into focus. A source for DA neurons might be conditionally immortalized progenitor cells. The temperature-sensitive immortalized cell line CSM14.1 derived from the mesencephalon of an embryonic rat has been used successfully for transplantation experiments. This cell line was analyzed by unbiased stereology of cell type specific marker proteins and 2D-gel electrophoresis followed by mass spectrometry to characterize the differentially expressed proteome. Undifferentiated CSM14.1 cells only expressed the stem cell marker nestin, whereas differentiated cells expressed GFAP or NeuN and tyrosine hydroxylase. An increase of the latter cells during differentiation could be shown. By using proteomics an explanation on the protein level was found for the observed changes in cell morphology during differentiation, when CSM14.1 cells possessed the morphology of multipolar neurons. The results obtained in this study confirm the suitability of CSM14.1 cells as an in vitro model for the study of neuronal and dopaminergic differentiation in rats.

  5. NATO Human Resources (Manpower) Management (Gestion des ressources humaines (effectifs) de l’OTAN)

    Science.gov (United States)

    2012-02-01

    SAS-059 NATO Human Resources (Manpower) Management (Gestion des ressources humaines (effectifs) de l’OTAN) This Technical Report includes...Human Resources (Manpower) Management (Gestion des ressources humaines (effectifs) de l’OTAN) This Technical Report includes best practices... SECURITY CLASSIFICATION LEVEL Recommended for the activity – NATO Unclassified Releasable to PfP Nations. Recommended for the publication – NATO

  6. Ressources humaines pour la recherche en santé en Afrique | IDRC ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Ressources humaines pour la recherche en santé en Afrique. Les gouvernements, les responsables des politiques et les bailleurs de fonds prennent de plus en plus conscience que les ressources humaines sont le principal élément moteur de la recherche en santé dans les pays en développement. Cette subvention ...

  7. Ressources humaines pour la recherche en santé en Afrique | CRDI ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Ressources humaines pour la recherche en santé en Afrique. Les gouvernements, les responsables des politiques et les bailleurs de fonds prennent de plus en plus conscience que les ressources humaines sont le principal élément moteur de la recherche en santé dans les pays en développement. Cette subvention ...

  8. Touraine, A. (2015). Nous, sujets humains. Paris: Seuil, 416 pp.

    OpenAIRE

    Eguzki Urteaga

    2016-01-01

    Alain Touraine acaba de publicar Nous, sujets humains. En continuidad con sus obras anteriores, el sociólogo desarrolla su teoría del sujeto definido por su búsqueda de la dignidad y su rechazo a la humillación. El autor considera que en la era post-social, caracterizada por el debilitamiento e incluso la desaparición de los movimientos propiamente sociales dominantes en la sociedad industrial, se imponen movimientos ético-democráticos. El ser humano se convierte en sujeto a través del proces...

  9. The GATA-Type Transcription Factor Csm1 Regulates Conidiation and Secondary Metabolism in Fusarium fujikuroi

    Science.gov (United States)

    Niehaus, Eva-Maria; Schumacher, Julia; Burkhardt, Immo; Rabe, Patrick; Münsterkötter, Martin; Güldener, Ulrich; Sieber, Christian M. K.; Dickschat, Jeroen S.; Tudzynski, Bettina

    2017-01-01

    GATA-type transcription factors (TFs) such as the nitrogen regulators AreA and AreB, or the light-responsive TFs WC-1 and WC-2, play global roles in fungal growth and development. The conserved GATA TF NsdD is known as an activator of sexual development and key repressor of conidiation in Aspergillus nidulans, and as light-regulated repressor of macroconidia formation in Botrytis cinerea. In the present study, we functionally characterized the NsdD ortholog in Fusarium fujikuroi, named Csm1. Deletion of this gene resulted in elevated microconidia formation in the wild-type (WT) and restoration of conidiation in the non-sporulating velvet mutant Δvel1 demonstrating that Csm1 also plays a role as repressor of conidiation in F. fujikuroi. Furthermore, biosynthesis of the PKS-derived red pigments, bikaverin and fusarubins, is de-regulated under otherwise repressing conditions. Cross-species complementation of the Δcsm1 mutant with the B. cinerea ortholog LTF1 led to full restoration of WT-like growth, conidiation and pigment formation. In contrast, the F. fujikuroi CSM1 rescued only the defects in growth, the tolerance to H2O2 and virulence, but did not restore the light-dependent differentiation when expressed in the B. cinerea Δltf1 mutant. Microarray analysis comparing the expression profiles of the F. fujikuroi WT and the Δcsm1 mutant under different nitrogen conditions revealed a strong impact of this GATA TF on 19 of the 47 gene clusters in the genome of F. fujikuroi. One of the up-regulated silent gene clusters is the one containing the sesquiterpene cyclase-encoding key gene STC1. Heterologous expression of STC1 in Escherichia coli enabled us to identify the product as the volatile bioactive compound (–)-germacrene D. PMID:28694801

  10. Les sciences cognitives ne sont pas des sciences humaines

    Directory of Open Access Journals (Sweden)

    Albert Ogien

    2011-10-01

    Full Text Available Cet article analyse les limites du naturalisme social que Laurence Kaufman et Laurent Cordonier proposent d’adopter dans cette même revue, en critiquant leur plaidoyer pour l’intégration des savoirs des sciences cognitives et des sciences humaines et sociales. Cette critique repose sur la réfutation de trois idées soutenues par les auteurs : 1 la description scientifique des mécanismes cognitifs élémentaires fournit une explication causale des conduites sociales qui doit se substituer à celles des sciences humaines et sociales ; 2 le recours au naturalisme permet de falsifier les préconceptions que ces dernières continuent à entretenir ; 3 le programme de naturalisation de l’esprit n’implique aucune forme de réductionnisme. Cette triple critique permet de rejeter leur appel en faveur d’un modèle intégré de la conduite humaine, en avançant un constat : dans la mesure où on ne sait pas comment combler le hiatus qui sépare les descriptions détaillées du cerveau au travail de l’explication des conduites des individus et de la manière dont ils en assurent la coordination dans le temps même où ils agissent en commun, les sciences humaines et sociales ont peu de choses à aller glaner du côté des sciences cognitives pour améliorer la manière dont elles analysent l’action. C’est que le travail de celles-ci se situe soit au niveau infra-humain du fonctionnement moléculaire, soit au niveau supra-humain de l’évolution ; et que seules les sciences humaines et sociales placent leurs analyses à un niveau simplement humain, en faisant des individus tels qu’ils vivent ensemble la mesure de toutes les choses qui les concernent. Ce qu’elles ne peuvent faire sur un mode naturaliste.Cognitive sciences are not social sciencesThis article examines the limits of the social naturalism proposed by Laurence Kauffman and Laurent Cordonier in this journal by criticizing their plea concerning knowledge integration of

  11. Le facteur humain comme source de risque opérationnel dans le secteur bancaire

    OpenAIRE

    Ferrary, Michel

    2001-01-01

    Les ressources humaines sont l'une des composantes de la combinaison productive de la firme. Cependant, la mobilisation de ressources humaines fait courir un risque spécifique à l'entreprise. Ce risque peut être défini comme l'incertitude que fait peser l'emploi de ressources humaines sur la compétitivité et la pérennité de l'entreprise. Les risques humains sont spécifiques dans la mesure où ils sont liés à l'usage d'une ressource douée d'une volonté propre, dotée d'une intention stratégie pe...

  12. L'infection a virus de l'Immunodeficience Humaine (VIH), facteur ...

    African Journals Online (AJOL)

    L'infection a virus de l'Immunodeficience Humaine (VIH), facteur predictif de gravite et de mortalite des accidents vasculaires cerebraux au Centre National Hospitalier et Universitaire-Hubert Koutoukou Maga (CNHU-HKM) de Cotonou, Benin.

  13. Limitations of BCC_CSM's ability to predict summer precipitation over East Asia and the Northwestern Pacific

    KAUST Repository

    Gong, Zhiqiang

    2017-04-05

    This study examines the ability of the Beijing Climate Center Climate System Model (BCC_CSM) to predict the meridional pattern of summer precipitation over East Asia-Northwest Pacific (EA-NWP) and its East Asia-Pacific (EAP) teleconnection. The differences of summer precipitation modes of the empirical orthogonal function and the bias of atmospheric circulations over EA-NWP are analyzed to determine the reason for the precipitation prediction errors. Results indicate that the BCC_CSM could not reproduce the positive-negative-positive meridional tripole pattern from south to north that differs markedly from that observed over the last 20 years. This failure can be attributed to the bias of the BCC_CSM hindcasts of the summer EAP teleconnection and the low predictability of 500 hPa at the mid-high latitude lobe of the EAP. Meanwhile, the BCC_CSM hindcasts\\' deficiencies of atmospheric responses to SST anomalies over the Indonesia maritime continent (IMC) resulted in opposite and geographically shifted geopotential anomalies at 500 hPa as well as wind and vorticity anomalies at 850 hPa, rendering the BCC_CSM unable to correctly reproduce the EAP teleconnection pattern. Understanding these two problems will help further improve BCC_CSM\\'s summer precipitation forecasting ability over EA-NWP.

  14. ÉTUDE DE CAS — Cuba : Le logement et le capital humain à Cuba ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    10 janv. 2011 ... ÉTUDE DE CAS — Cuba : Le logement et le capital humain à Cuba .... Elle reconnaît qu'il existe des liens inéluctables entre les humains et les milieux biophysique, social et économique qui ont des répercussions sur la santé des gens », explique le Dr Mariano Bonet, l'un des chercheurs de l'équipe et ...

  15. Productivité du Capital Humain dans les Pays de l’UEMOA et de la CEMAC : Une Analyse Comparative

    OpenAIRE

    Élisé Wendlassida Miningou

    2012-01-01

    La présente étude pose le problème de la productivité du capital humain dans les pays de l’UEMOA et de la CEMAC. Dans ce papier, nous mesurons l’efficience avec laquelle le capital humain est mis à contribution dans la production. Pour ce faire, nous appliquons la méthode du Data Envelopment Analysis (DEA) pour mesurer et comparer la productivité du capital humain entre ces deux ensembles de pays. Nos résultats montrent que le capital humain dans la zone UEMOA a été moins productif ...

  16. Pour une recherche technologique en sciences humaines et sociales

    Directory of Open Access Journals (Sweden)

    Lenay Charles

    2014-01-01

    Full Text Available Nous proposons ici une approche originale de la technologie dans les sciences humaines et sociale (SHS, approche qui sera développée dans le cadre d'un groupement d'intérêt scientifique (GIS pour l'unité des technologies et des sciences de l'homme. En effet, la place des SHS dans l'organisation de la recherche et des enseignements dispensés dans les écoles d'ingénieurs pose question. Les attentes vis-à-vis des enseignants-chercheurs sont souvent l'objet de malentendus et renvoient pour partie à une méconnaissance réciproque entre SHS et sciences pour l'ingénieur (SPI mais aussi, plus fondamentalement à une coupure entre enseignement et recherche. Ces obstacles illustrent également la difficulté à mettre en place une recherche interdisciplinaire pérenne qui associe SHS et SPI. Nous proposons ici une initiative qui vise à fonder une recherche interdisciplinaire de ce type sur la question de la « constitutivité mutuelle » de l'Homme et de la technique.

  17. Touraine, A. (2015. Nous, sujets humains. Paris: Seuil, 416 pp.

    Directory of Open Access Journals (Sweden)

    Eguzki Urteaga

    2016-01-01

    Full Text Available Alain Touraine acaba de publicar Nous, sujets humains. En continuidad con sus obras anteriores, el sociólogo desarrolla su teoría del sujeto definido por su búsqueda de la dignidad y su rechazo a la humillación. El autor considera que en la era post-social, caracterizada por el debilitamiento e incluso la desaparición de los movimientos propiamente sociales dominantes en la sociedad industrial, se imponen movimientos ético-democráticos. El ser humano se convierte en sujeto a través del proceso de subjetivación que designa el movimiento por el cual el individuo se transforma en actor social, es decir en agente activo de la promoción y defensa de los derechos humanos fundamentales (DHF que tienen una vocación universal y que se plasman en los discursos, las conductas y las prácticas. En ese sentido, “este libro tiene como objeto principal buscar los tiempos, los lugares, los medios más favorables al encuentro, la fusión y la transformación interna de los movimientos democráticos y de los movimientos éticos, para llegar a la formación de movimientos” (p. 22 que puedan combatir los poderes totales y los anti-movimientos sociales.

  18. Hard rock excavation at the CSM/OCRD test site using Swedish blast design techniques

    International Nuclear Information System (INIS)

    Holmberg, R.

    1983-09-01

    This report is the third in a series describing research conducted by the Colorado School of Mines for the Office of Crystalline Repository Development (OCRD) to determine the extent of blast damage in rock surrounding an underground opening. A special room, called the CSM/OCRD room, was excavated at the CSM experimental mine for the purpose of assessing blast damage in the rock around the room. Even though this mine is not proposed as a nuclear waste repository site, the instrumentation and methods of blast damage assessment developed in this project are applicable to proposed repository sites. This report describes the application of Swedish blasting technology for the excavation of the test room. The design of the blasting patterns including the selection of explosives, hole sizes and location, explosive loading densities, and delay intervals is based upon the theories of Langefors and Kihlstrom in combination with methods used at the Swedish Detonic Research Foundation for minimizing unwanted rock damage. The practical application of the design procedures to seven rounds and the achieved results is discussed

  19. Corps et esprit : l’identité humaine selon Spinoza

    Directory of Open Access Journals (Sweden)

    Lamine Hamlaoui

    2005-09-01

    Full Text Available Contrairement à Descartes, Spinoza refuse à l’esprit humain et par conséquent à l’homme le statut de substance : l’homme est défini comme l’union de deux modes, un corps et une âme. On ne peut donc plus comme chez Descartes distinguer une identité substantielle, conférée au corps par l’âme, et une identité modale, déterminée par le rapport du corps humain aux autres corps. Ces deux identités sont fondues dans une identité essentielle. L’objet de cet article est de mettre en évidence le statut problématique de cette identité dans l’Éthique. L’esprit humain y est en effet déduit et défini comme l’idée du corps humain, c’est-à-dire le concept que Dieu forme du corps humain. Mais tantôt Spinoza identifie cette idée du corps humain à l’essence de l’esprit humain, tantôt il établit une distinction entre les deux. De même, tantôt en vertu du parallélisme des attributs il identifie l’idée du corps humain à l’idée de l’esprit humain, tantôt il distingue les deux. D’où des tensions qui travaillent le système de l’intérieur.Contrary to Descartes, Spinoza refuses to human mind and therefore to man the status of substance : man is defined as the union of two modes, body and mind. We can’t distinguish, as in Descartes, a substantial identity, conferred to the body by the mind, and a modal identity, determined by the relation between human body and other bodies. Both identities form an essential identity. This paper explains the problematical character of this identity in Spinoza’s Ethic. Human mind is indeed deduced and defined as the idea of human body, namely the concept of human body formed by God. But sometimes Spinoza identifies the idea of human body with the essence of human body, sometimes he makes a distinction between both. In the same way, sometimes he identifies the idea of human body with the idea of human mind, in accordance with parallelism of attributes, sometimes he

  20. Assessment and correction of BCC_CSM's performance in capturing leading modes of summer precipitation over North Asia

    KAUST Repository

    Gong, Zhiqiang

    2017-11-07

    This article examines the ability of Beijing Climate Center Climate System Model (BCC_CSM) in demonstrating the prediction accuracy and the leading modes of the summer precipitation over North Asia (NA). A dynamic-statistic combined approach for improving the prediction accuracy and the prediction of the leading modes of the summer precipitation over NA is proposed. Our results show that the BCC_CSM can capture part of the spatial anomaly features of the first two leading modes of NA summer precipitation. Moreover, BCC_CSM regains relationships such that the first and second mode of the empirical orthogonal function (EOF1 and EOF2) of NA summer precipitation, respectively, corresponds to the development of the El Niño and La Niña conditions in the tropical East Pacific. Nevertheless, BCC_CSM exhibits limited prediction skill over most part of NA and presents a deficiency in reproducing the EOF1\\'s and EOF2\\'s spatial pattern over central NA and EOF2\\'s interannual variability. This can be attributed as the possible reasons why the model is unable to capture the correct relationships among the basic climate elements over the central NA, lacks in its ability to reproduce a consistent zonal atmospheric pattern over NA, and has bias in predicting the relevant Sea Surface Temperature (SST) modes over the tropical Pacific and Indian Ocean regions. Based on the proposed dynamic-statistic combined correction approach, compared with the leading modes of BCC_CSM\\'s original prediction, anomaly correlation coefficients of corrected EOF1/EOF2 with the tropical Indian Ocean SST are improved from 0.18/0.36 to 0.51/0.62. Hence, the proposed correction approach suggests that the BCC_CSM\\'s prediction skill for the summer precipitation prediction over NA and its ability to capture the dominant modes could be certainly improved by choosing proper historical analogue information.

  1. Les perspectives nutritionnelles offertes par les OGM en alimentation humaine

    Directory of Open Access Journals (Sweden)

    Pascal Gérard

    2004-03-01

    Full Text Available Une étude des brevets récents, des publications scientifiques ainsi que des documents présentant les projets des firmes de biotechnologie constituent la base de cet article qui présente les perspectives de développement en alimentation humaine des organismes génétiquement modifiés (OGM présentant un intérêt nutritionnel. Si l’on trouve dans les brevets et les publications scientifiques des applications qui concernent l’amélioration ou l’enrichissement de la composition en macro- et micronutriments, ces applications restent curieusement à l’état de projets, très loin de la mise sur le marché. Les critiques aussi bien que les louanges dont sont l’objet les rares cas dont on pourrait envisager une mise en œuvre à moyen terme, comme le « riz doré », sont aussi injustifiées et excessives les unes que les autres. Les violentes polémiques autour des OGM risquent de handicaper le développement d’une technique puissante, qui n’est certes pas indispensable pour apporter une solution à l’éradication de la faim dans le monde, mais qui peut apporter des améliorations à la nutrition des populations, aussi bien des populations des pays en développement que des pays développés.

  2. Determination of keystone species in CSM food web: A topological analysis of network structure

    Directory of Open Access Journals (Sweden)

    LiQin Jiang

    2015-03-01

    Full Text Available The importance of a species is correlated with its topological properties in a food web. Studies of keystone species provide the valuable theory and evidence for conservation ecology, biodiversity, habitat management, as well as the dynamics and stability of the ecosystem. Comparing with biological experiments, network methods based on topological structure possess particular advantage in the identification of keystone species. In present study, we quantified the relative importance of species in Carpinteria Salt Marsh food web by analyzing five centrality indices. The results showed that there were large differences in rankings species in terms of different centrality indices. Moreover, the correlation analysis of those centralities was studied in order to enhance the identifying ability of keystone species. The results showed that the combination of degree centrality and closeness centrality could better identify keystone species, and the keystone species in the CSM food web were identified as, Stictodora hancocki, small cyathocotylid, Pygidiopsoides spindalis, Phocitremoides ovale and Parorchis acanthus.

  3. Dossier 3 : Les dimensions humaine et sociale du développement durable

    Directory of Open Access Journals (Sweden)

    2004-11-01

    Full Text Available Si le concept de développement durable continue d’étendre son influence, cette montée en puissance repose encore largement sur la dimension environnementale. C’est en effet la prudence et la précaution sur les écosystèmes qui inspirent l’essentiel des discours, des actions et des analyses de la soutenabilité du développement ou de la croissance.Or les dimensions humaine et sociale ont toute leur place dans la problématique du développement durable. Ces composantes humaine et sociale ne sont d...

  4. Les estimations du capital humain au Canada : approche fondee sur le revenu de la vie entiere

    OpenAIRE

    Gu, Wulong; Wong, Ambrose

    2010-01-01

    Dans le present document, nous produisons une estimation de l'investissement en capital humain fonde sur le marche et du stock de ce capital au Canada au cours de la periode s'etendant de 1970 a 2007 selon l'approche fondee sur le revenu de la vie entiere. Nous comparons cette estimation a celle de l'investissement en capital physique et naturel et du stock de ce capital. En suivant la methode elaboree par Jorgenson et Fraumeni, nous estimons le stock de capital humain sous forme du revenu de...

  5. [A contraceptive social marketing (CSM) program needs continuity of management: the Asociacion Demografica Salvadorena (ADS) in 1983].

    Science.gov (United States)

    Kraus, G

    1984-01-01

    The Association Demografica Salvadorena (ADS) learned an important lesson during 1983--a contraceptive social markeing (CSM) program needs continuity of management to ensure that all components remain inegrated and all actions are coordinated within the organization. Ever since in early 1983, ADS has not had an executive specifically assigned to run the CSM project and make the important month-by-month, tactical decisions that keep a program's activities focused on meeting sales goals. Instead, executive tasks were delegated on an ad hoc basis to ADS' administrative staff. Fortunately, the program's administrative design was well-developed, and ADS' dedicated personnel were able to effectively accomplish the daily business of keeping records and getting products out to retailers. Advertising, promotion and product development suffered, however. So the new executive or general manager will need to examine these areas 1st. Although El Salvador's CSM operates in unstable social and economic conditions, and despite a dramatic fall in condom sales last year, the ADS can still do much to increase its couple years of protection at costs significantly lower than those of clinic and community-based distribution systems. Research done thus far indicates a substantial demand for ADS products. Consequently, while not set in ideal conditions, physical distribution and marketing functions can be accomplished. But, as the ADS has discovered, even with a strong leader like Dr. Gustavo Argueta, CSM enterprises do not function automatically. Producing projected sales goals depends on the continuity of "hands-on" management. full text

  6. Determination of task group 43 dosimetric parameters for CSM40 137Cs source for use in brachytherapy.

    Science.gov (United States)

    Firoozabadi, Mohammad Mehdi; Jimabadi, Elaheh; Ghorbani, Mahdi; Behmadi, Marziyeh

    2018-03-01

    The CSM40 137 Cs source model is currently being used in clinical brachytherapy. According to the recommendations of task group No. 43 (TG-43) of the American Association of Physicists in Medicine, dosimetry parameters of brachytherapy sources should be determined by two independent investigators before their clinical use. The aim of this study was to determine the TG-43 dosimetry parameters for a medium-dose-rate CSM40 137 Cs source. The determined dosimetric parameters included the air kerma strength, dose rate constant, radial dose function, and anisotropy function. To determine the source's dosimetric parameters, the CSM40 source was stimulated by the Monte Carlo N-Particle MCNP code. The TG-43 parameters were compared with the data of Vijande et al. on this source. The results showed that the dosimetry parameters for this source had good agreement with the results of Vijande et al. The dosimetric parameters of the CSM40 source can be used in treatment-planning systems incorporating this source model. The data can also be used for the quality assurance of treatment-planning systems.

  7. Capital humain, croissance, équité et réformes structurales dans le ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Rares sont les recherches qui ont porté sur les facteurs particuliers qui empêchent le Soudan de tirer pleinement parti de son capital humain, ainsi que sur la ... qui permettraient d'appuyer des politiques qui stimuleront une croissance soutenue et favoriseront l'accès des pauvres aux nouveaux débouchés économiques.

  8. Paix, sécurité humaine et développement durable en Afrique | IDRC ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Paix, sécurité humaine et développement durable en Afrique. Le Partenariat Afrique Canada (PAC) collabore avec des organisations partenaires d'Afrique et d'ailleurs pour établir un dialogue sur les enjeux prioritaires qui touchent le continent africain. Le PAC participe activement au processus de Kimberley visant à mettre ...

  9. Paix, sécurité humaine et développement durable en Afrique | CRDI ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Paix, sécurité humaine et développement durable en Afrique. Le Partenariat Afrique Canada (PAC) collabore avec des organisations partenaires d'Afrique et d'ailleurs pour établir un dialogue sur les enjeux prioritaires qui touchent le continent africain. Le PAC participe activement au processus de Kimberley visant à mettre ...

  10. Changer le travail des animaux, pour changer le travail des humains

    OpenAIRE

    Porcher, Jocelyne

    2016-01-01

    Animaux et hommes construisent des liens par le travail, explique l’auteure de cette tribune. Il existe même un « travailler » de l’animal, où celui-ci s’investit et recherche du sens. Réfléchir au travail des animaux, c’est aussi s’interroger sur le travail humain.

  11. Génétique humaine de la tuberculose

    Science.gov (United States)

    El Baghdadi, J.; Grant, A.V.; Sabri, A.; El Azbaoui, S.; Zaidi, H.; Cobat, A.; Schurr, E.; Boisson-Dupuis, S.; Casanova, J.L.; Abel, L.

    2013-01-01

    . L’identification des facteurs génétiques prédisposant à la tuberculose est fondamentale pour comprendre la physiopathologie de cette maladie et permettre ainsi le développement de nouvelles stratégies vaccinales et thérapeutiques. Mots clés: tuberculose, mycobactérie, variant génétique, polymorphisme, génétique humaine, susceptibilité/résistance, étude d’association, analyse de liaison génétique, prédisposition mendélienne PMID:23399414

  12. Analyse du capital humain : diagnostic des dépenses d'éducation au Sénégal

    OpenAIRE

    Youssouph Ba

    2011-01-01

    Le but de notre travail consistait dans un premier temps à revisiter les soubassements théoriques du capital humain et savoir si l'augmentation du capital humain a un effet ponctuel sur la croissance économique (aussi bien dans la sphère des pays industrialisés que dans celle des pays en développement). Dans un second temps, il consistait à mesurer la politique du Sénégal en terme de capital humain : mesurer les efforts de financement de l'éducation d'une part et d'autre part, voir si ces eff...

  13. Improving Human Effectiveness Through Embedded Virtual Simulation (Amelioration de l’efficacite humaine grace a la simulation virtuelle integree)

    Science.gov (United States)

    2014-01-01

    REPORT TR-HFM-165 Improving Human Effectiveness Through Embedded Virtual Simulation (Amélioration de l’efficacité humaine grâce à la simulation...Amélioration de l’efficacité humaine grâce à la simulation virtuelle intégrée) Findings of Task Group HFM-165. The NATO Science and...art, validated knowledge for defence and security purposes. S&T activities embrace scientific research, technology development, transition

  14. Multi-scheme corrected dynamic-analogue prediction of summer precipitation in northeastern China based on BCC_CSM

    Science.gov (United States)

    Fang, Yihe; Chen, Haishan; Gong, Zhiqiang; Xu, Fangshu; Zhao, Chunyu

    2017-12-01

    Based on summer precipitation hindcasts for 1991-2013 produced by the Beijing Climate Center Climate System Model (BCC_CSM), the relationship between precipitation prediction error in northeastern China (NEC) and global sea surface temperature is analyzed, and dynamic-analogue prediction is carried out to improve the summer precipitation prediction skill of BCC_CSM, through taking care of model historical analogue prediction error in the real-time output. Seven correction schemes such as the systematic bias correction, pure statistical correction, dynamic-analogue correction, and so on, are designed and compared. Independent hindcast results show that the 5-yr average anomaly correlation coefficient (ACC) of summer precipitation is respectively improved from -0.13/0.15 to 0.16/0.24 for 2009-13/1991-95 when using the equally weighted dynamic-analogue correction in the BCC_CSM prediction, which takes the arithmetical mean of the correction based on regional average error and that on grid point error. In addition, probabilistic prediction using the results from the multiple correction schemes is also performed and it leads to further improved 5-yr average prediction accuracy.

  15. Dynamical feedback between synoptic eddy and low-frequency flow as simulated by BCC_CSM1.1(m)

    Science.gov (United States)

    Zhou, Fang; Ren, Hong-Li

    2017-11-01

    Since the interaction between atmospheric synoptic eddy (SE) (2-8 days) activity and low-frequency (LF) (monthly) flow (referred to as SELF) plays an essential role in generating and maintaining dominant climate modes, an evaluation of the performance of BCC_CSM1.1(m) in simulating the SE feedback onto the LF flow is given in this paper. The model captures well the major spatial features of climatological eddy vorticity forcing, eddy-induced growth rate, and patterns of SELF feedback for the climate modes with large magnitudes in cold seasons and small magnitudes in warm seasons for both the Northern and Southern Hemisphere. As in observations, the eddy-induced growth rate and SELF feedback patterns in the model also show positive SE feedback. Overall, the relationships between SE and LF flow show that BCC_CSM1.1(m) satisfactorily captures the basic features of positive SE feedback, which demonstrates the simulation skill of the model for LF variability. Specifically, such an evaluation can help to find model biases of BCC_CSM1.1(m) in simulating SE feedback, which will provide a reference for the model's application.

  16. Qui a peur de l’éthologie ? Action humaine et action animale chez Aristote

    OpenAIRE

    Morel, Pierre-Marie

    2013-01-01

    On décèle une tension entre deux tendances dans la philosophie aristotélicienne de la praxis : d’une part; une insistance claire sur la spécificité de l’action humaine par rapport à la conduite animale ; d’autre part; la volonté de définir un genre commun pour les différents types d’activités; humaines et animales. Si cette tension peut être surmontée; c’est sans doute en distinguant les différents registres (axiologique; psychologique; éthologique) du discours aristotélicien. C’est aussi en ...

  17. La revue scientifique : un élément d'analyse des sciences humaines ...

    African Journals Online (AJOL)

    L'article se propose d'aborder la question de la structuration du champ des sciences humaines et sociales, en prenant pour “entrée” les revues scientifiques de ces disciplines, en particulier dans le cas de la production scientifique marocaine. Il s'agit, à travers l'analyse de la structure et du fonctionnement d'un ensemble ...

  18. Lutte intégrée contre les maladies humaines et animales pour les ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Lutte intégrée contre les maladies humaines et animales pour les bergers contraints à la sédentarisation en Tanzanie. Dans les terres arides de l'Afrique orientale et australe, les bergers se heurtent à la détérioration de leur environnement en raison de la croissance démographique, des changements climatiques et des ...

  19. La mondialisation au banc des accusés : La condition humaine et la ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Brillant, profond et tout à fait opportun pour quiconque veut saisir le sens et les implications du phénomène actuel de la mondialisation » — William F. Ryan, S.J. (auteur de Culture, Spirituality, and Economic Development). Quelle est la condition humaine, à l'aube de l'ère mondiale? Puisant à même sa vaste expérience ...

  20. Renforcement de la capacité des ressources humaines dans le ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Les effets des antibiotiques administrés en bas âge sur la fonction cérébrale et le comportement. Le tractus gastro-intestinal de l'être humain accueille 100 mille milliards de micro-organismes. Voir davantageLes effets des antibiotiques administrés en bas âge sur la fonction cérébrale et le comportement ...

  1. Influence de la fertilisation à base des déchets humains recyclés ...

    African Journals Online (AJOL)

    SARAH

    31 mai 2014 ... 2014. Influence de la fertilisation a base des déchets humains recycles , des engrais minéraux et de leur combinaison sur le comportement de maïs. 6502 permettent d'obtenir des rendements compétitifs à ceux obtenus avec la fumure minérale en culture maraîchère et céréalière (Kiba, 2005). Les études.

  2. TIC pour un accès équitable aux ressources humaines en sante en ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Ce projet vise à mieux comprendre comment les TIC peuvent faciliter la distribution équitable des ressources humaines en santé en renforçant et consolidant des activités de recherche déjà en cours dans le domaine au Centre d'expertise et de recherche en télémédecine en e-santé (CERTES), un projet du REIMICOM.

  3. Échec à la pauvreté : Les besoins humains, la science et la ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Mettre en valeur ce potentiel dépendra, pour reprendre les mots du président du groupe de travail, Arnoldo K. Ventura, de "la volonté sociale et politique, d'une conscience morale suffisante, d'un intérêt personnel éclairé et de l'acceptation de l'unité de tous les membres de la famille humaine et de sa position précaire sur ...

  4. Échec à la pauvreté : Les besoins humains, la science et la ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Échec à la pauvreté : Les besoins humains, la science et la technologie. Couverture du livre Échec à la pauvreté. Author(s):. Groupe d'étude sur la technologie au service des besoins, Commission des sciences et de la technologie au service du développement des Nations Unies. Publisher(s):. UNCTAD, CRDI. January 1 ...

  5. Thermo-mechanical Characterisation of In-plane Properties for CSM E-glass Epoxy Polymer Composite Materials

    DEFF Research Database (Denmark)

    Jakobsen, Johnny; Jensen, Martin; Andreasen, Jens Henrik

    2013-01-01

    The in-plane Young’s modulus of a CSM E-glass/epoxy material is characterised through the use of dynamic mechanical analysis (DMA). The measured data is used to generate material models which describe the property behaviour as a function of conversion and temperature. Gelation of the epoxy resin...... by time and temperature, and is graphically illustrated through a Modulus-Temperature- Transformation (MTT) diagram. Based on the established material models presented in this paper and models in Part-1, it is feasible to assess residual stresses and shape distortions of composite parts made from...

  6. L’humain, cet être interactivement prédisposé ?Une histoire du déterminisme de l’inné en génétique humaine

    OpenAIRE

    Perbal, Laurence

    2010-01-01

    Cet article propose de retracer l’histoire du couple dichotomique de l’inné et de l’acquis, au XXème siècle et en génétique humaine, grâce aux concepts de déterminisme et de prédisposition. Plus spécifiquement, la génétique humaine a évolué d’un déterminisme essentialiste, faisant des facteurs innés les causes ultimes de la nature humaine, vers un déterminisme probabiliste, reconnaissant l’importance des facteurs environnementaux et l’exprimant en termes de prédisposition génétique. Cette évo...

  7. La cryptosporidiose zoonosique humaine due à Cryptosporidium felis dans le monde

    Directory of Open Access Journals (Sweden)

    Raccurt C.P.

    2007-03-01

    Full Text Available La cryptosporidiose est l’une des principales causes de diarrhée aiguë de l’enfant dans les pays en voie de développement, et de diarrhée chronique chez les sujets immunodéprimés infectés par le virus de l’immunidéficience humaine (VIHj. L’identification de l’espèce est impossible par les méthodes conventionnelles et fait appel aux techniques de biologie moléculaire. La cryptosporidiose humaine est due le plus souvent à Cryptosporidium hominis et à Cryptosporidium parvum. Des espèces et des génotypes spécifiques d’animaux, dont Cryptosporidium felis, parasitent également l’Homme. Une revue systématique des cas humains dus à C. felis publiés dans le monde pjermet d’en décompter 58 dans toutes les régions biogéographiques, excepté l’Australie et l’Océanie. Adultes et enfants sont la cible de ce parasite. Chez ces 58 sujets parasités par C. felis, 83% sont VIH-positifs. Cette zoonose se rencontre également chez des sujets apparemment immunocompétents. Les pays en voie de développement semblent plus concernés probablement à cause d’une transmission environnementale plus présente que dans les pays développés. Cette cryptosporidiose zoonosique demande à être plus largement évaluée dans les pays tropicaux.

  8. Structure and RNA-binding properties of the type III-A CRISPR-associated protein Csm3.

    Science.gov (United States)

    Hrle, Ajla; Su, Andreas A H; Ebert, Judith; Benda, Christian; Randau, Lennart; Conti, Elena

    2013-11-01

    The prokaryotic adaptive immune system is based on the incorporation of genome fragments of invading viral genetic elements into clusters of regulatory interspaced short palindromic repeats (CRISPRs). The CRISPR loci are transcribed and processed into crRNAs, which are then used to target the invading nucleic acid for degradation. The large family of CRISPR-associated (Cas) proteins mediates this interference response. We have characterized Methanopyrus kandleri Csm3, a protein of the type III-A CRISPR-Cas complex. The 2.4 Å resolution crystal structure shows an elaborate four-domain fold organized around a core RRM-like domain. The overall architecture highlights the structural homology to Cas7, the Cas protein that forms the backbone of type I interference complexes. Csm3 binds unstructured RNAs in a sequence non-specific manner, suggesting that it interacts with the variable spacer sequence of the crRNA. The structural and biochemical data provide insights into the similarities and differences in this group of Cas proteins.

  9. Pour une ingénierie des Environnements Informatiques pour l'Apprentissage Humain

    OpenAIRE

    Tchounikine , Pierre

    2002-01-01

    Nous proposons dans cet article une réflexion sur la notion d'ingénierie des EIAH (Environnements Informatiques pour l'Apprentissage Humain). Nous posons tout d'abord une définition de l'ingénierie des EIAH : travaux visant à définir des éléments de méthodes et de techniques reproductibles et/ou réutilisables facilitant la mise en place (conception – réalisation – expérimentation – évaluation - diffusion) d'environnements de formation ou d'apprentissage (dans leur articulation avec les dispos...

  10. Robots humains, avez-donc une réalité ?

    OpenAIRE

    Amblard , Maxime; Boumaza , Amine

    2015-01-01

    International audience; Plusieurs laboratoires dans le monde travaillent à la création de robots humanoïdes . La technologie ayant considérablement évolué, il apparaît réaliste d’imaginer un quotidien accompagné de tels systèmes, à l’image du robot Nao, dont on discute encore comment lui faire partager des émotions pour simuler un comportement humain. Mais finalement, les robots sont déjà partout et depuis longtemps, dans les usines, les jouets électroniques, nos ordinateurs, nos tablettes, l...

  11. ÉTUDE DE CAS — Cuba : Le logement et le capital humain à Cuba ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    10 janv. 2011 ... Colin Campbell. Des projets communautaires améliorent la santé du cœur de La Havane. La vie en plein centre-ville peut mettre à rude épreuve la résistance des gens. Lorsque les quartiers périclitent, le dépérissement de la santé humaine suit de près. Un projet mené à Cuba avec l'appui du Centre de ...

  12. Fertilisation du maïs ( Zea mays L.) à base d'urines humaines ...

    African Journals Online (AJOL)

    Les urines contenues dans les eaux usées nécessitent de gros moyens pour leur traitement. Elles contiennent pourtant de l'azote que l'on peut rentabiliser. La culture du maïs, fertilisée à l'urine humaine à différentes doses, a été comparée à celle fertilisée à l'engrais minéral. L'urine a été hygiénisée, puis appliquée sur ...

  13. Impact de la gestion des ressources humaines sur la survie des ...

    African Journals Online (AJOL)

    Partant de là, le risque relatif, la fraction préventive et les années potentielles de vie gagnées ont été estimés. Résultats: Nous avons trouvé que le développement du système de gestion des ressources humaines a significativement contribué à réduire le ratio de mortalité des enfants de moins de 5 ans de 136 pour 1000 ...

  14. Le facteur humain et la sûreté de fonctionnement dans le ...

    African Journals Online (AJOL)

    Notre contribution porte sur le rôle fondamental du facteur humain dans le management intégré des risques d'une part et du rôle déterminant qu'il peut avoir à jouer pour que la sûreté de fonctionnement réponde à sa propriété d'autre part. Un rôle illustré à travers une analyse de risque dans un complexe de Gaz Naturel ...

  15. Le modèle de l’erreur humaine de James Reason

    OpenAIRE

    Larouzée, Justin; Guarnieri, Franck; Besnard, Denis

    2014-01-01

    Ce papier de recherche a pour objet de revenir en détail sur les travaux de recherche du psychologue anglais James Reason, mondialement célèbre pour sa taxonomie de l’erreur humaine et son modèle étiologique de l’accident immensément connu sous le nom de Swiss Cheese Model (SCM) ou Modèle du Fromage Suisse. Ce papier de recherche est une synthèse du parcours scientifique de Reason, il revient aussi sur la conception du modèle et ses évolutions, il traite de ses usages, apports et limites. Il ...

  16. A Designer’s Guide to Human Performance Modelling (La Modelisation des Performances Humaines: Manuel du Concepteur).

    Science.gov (United States)

    1998-12-01

    humaine et de r6seaux de t~ches. Une description de la logique dont HOMER s’inspire (les crit~res de choix des mod~les par exemple), est incluse dans le...REPORT 356 A Designer’s Guide to Human Performance Modelling ( la Modelisation des performances humaines: manuel du concepteur) This Advisory Report has...DEVELOPMENT BP 25, 7 RUE ANCELLE, F-92201 NEUILLY-SUR-SEINE CEDEX, FRANCE AGARD ADVISORY REPORT 356 A Designer’s Guide to Human Performance Modelling ( la

  17. Des humains et des animaux dans L’oeil américain et Le Moineau domestique

    Directory of Open Access Journals (Sweden)

    Josée Laplante

    2011-12-01

    Full Text Available Cet article propose d’examiner la représentation des rapports humain-animal dans L’oeil américain de Pierre Morency et dans Le Moineau domestique de Serge Bouchard en cherchant à dégager les aspects de ces deux textes qui tendent à mettre en évidence le caractère arbitraire de la frontière conceptuelle, érigée par une tradition occidentale, entre humains et animaux.

  18. Physiologie humaine

    OpenAIRE

    Sherwood, Lauralee

    2015-01-01

    "Apprendre et comprendre comment fonctionne l'organisme en 750 pages en couleurs, couvrant toutes les grandes fonctions physiologiques" Nouveautés et adaptations de la 3e édition Dans cette 3e édition près de 90% des figures ont été retouchées. La plupart des images des cellules et des figures anatomiques sont nouvelles, elles sont plus réalistes et en perspective. Dans cette édition, des fiches de révision pour chaque chapitre ont été ajoutées à la fin du livre afin que les étudian...

  19. Le facteur humain. Réinventer notre rapport à la technologie de Vicente

    OpenAIRE

    Leplat, Jacques

    2013-01-01

    Kim Vicente est connu du milieu ergonomique pour son très bon ouvrage « Cognitive work analysis » qui manifeste à la fois son expertise et son talent pédagogique. Ingénieur de formation, il a enseigné ensuite à l’université en tant que « professeur en ingénierie des facteurs humains ». Professeur invité au MIT et conseiller à la NASA, il est l’auteur de nombreuses publications de recherche qu’on rangerait dans l’ergonomie cognitive. Le présent ouvrage, qu’il a publié en anglais en 2003, est d...

  20. Le facteur humain. Réinventer notre rapport à la technologie de Vicente

    Directory of Open Access Journals (Sweden)

    Jacques Leplat

    2005-11-01

    Full Text Available Kim Vicente est connu du milieu ergonomique pour son très bon ouvrage « Cognitive work analysis » qui manifeste à la fois son expertise et son talent pédagogique. Ingénieur de formation, il a enseigné ensuite à l’université en tant que « professeur en ingénierie des facteurs humains ». Professeur invité au MIT et conseiller à la NASA, il est l’auteur de nombreuses publications de recherche qu’on rangerait dans l’ergonomie cognitive. Le présent ouvrage, qu’il a publié en anglais en 2003, est d...

  1. BIOFILIA DAN NEKROFILIA: ANALISIS SOSIOLOGI SASTRA NOVEL LA BÊTE HUMAINE KARYA EMILE ZOLA

    Directory of Open Access Journals (Sweden)

    Ali Shahab

    2011-04-01

    Full Text Available Using the genetic structural analysis suggested by Lucien Goldmann, it has been shown that Emile Zola, an adherent of naturalism, has managed to expose a distinctive world view through the mediation of his work bring La bête humaine. Through his career as an author who fully engaged in the social and political life of his time, Zola firmly demonstrated a world view different than contemporary rulers. His involvement in the political field, his support and empathy for the weak who became victims of an unjust capitalist system, and his commitment to the truth in which he believed, produced changes in the social and political fields. This is evident from the contemporary recognition of social rights of workers and the release of Alfred Dreyfus from prison. Yet for all that he paid with his life; Zola was assassinated by political opponents.

  2. L’environnement sous le regard de la Société d’écologie humaine

    OpenAIRE

    Aschan-Leygonie, Christina

    2011-01-01

    L'ouvrage Société, environnements, santé a été publié sous la direction de trois anthropologues, dont un est également biologiste. Il recueille quinze contributions, issues des 18èmes journées de la Société d’Ecologie Humaine (SEH) et intitulées « Milieu de vie et santé. Quelles pratiques interdisciplinaires ? », qui se sont tenues à l’université de Provence (Marseille) en juillet 2006. La Société d’Écologie Humaine a été créée en 1987 à l’initiative de chercheurs et enseignants en sciences ...

  3. Contribution à la théorie du capital humain : Les bénéfices à court ...

    African Journals Online (AJOL)

    Les enfants scolarisés communiquent-ils à leurs parents paysans des connaissances reçues de l'école ? C'est la problématique de notre étude qui se fixe pour objectif de revisiter la théorie classique du capital humain, plus singulièrement dans le registre du délai des bénéfices que l'on en tire (court ou long terme).

  4. Les Comités mixtes de sécurité humaine (CMSH) au Burundi : un ...

    African Journals Online (AJOL)

    Mots clés: Burundi, police nationale, comités mixtes de sécurité humaine, régime de sécurité, approche socio-criminologique. English Abstract. The National Police of Burundi, set up in 2004, has opted for a management and action philosophy known as community policing. The operationalization of this philosophy required ...

  5. Association of bacteriochlorophyll a with the CsmA protein in chlorosomes of the photosynthetic green filamentous bacterium Chloroflexus aurantiacus

    DEFF Research Database (Denmark)

    Sakuragi, Y; Frigaard, N-U; Shimada, K

    1999-01-01

    The protein assumed to be associated with bacteriochlorophyll (BChl) a in chlorosomes from the photosynthetic green filamentous bacterium Chloroflexus aurantiacus was investigated by alkaline treatment, proteolytic digestion and a new treatment using 1-hexanol, sodium cholate and Triton X-100. Upon...... alkaline treatment, only the 5.7 kDa CsmA protein was removed from the chlorosomes among six proteins detected by sodium dodecyl sulfate polyacrylamide gel electrophoresis (SDS-PAGE) analysis, concomitantly with the disappearance of BChl a absorption at 795 nm. Trypsin treatment removed two proteins...... of BChl a to CsmA in isolated chlorosomes, which was estimated to be between 1.2 and 2.7 by amino acid analysis of the SDS-PAGE-resolved protein bands....

  6. Selective Protein Extraction from Chlorobium tepidum Chlorosomes Using Detergents. Evidence That CsmA Forms Multimers and Binds Bacteriochlorophyll a

    DEFF Research Database (Denmark)

    Bryant, Donald A; Vassilieva, Elena V; Frigaard, Niels-Ulrik

    2002-01-01

    and location of this BChl a are not yet clearly understood. Chlorosomes were treated with sodium dodecyl sulfate (SDS), Lubrol PX, or Triton X-100, separately or in combination with 1-hexanol, and the extracted components were separated from the residual chlorosomes by ultrafiltration on centrifugal filters....... When chlorosomes were treated with low concentrations of SDS, all proteins except CsmA were extracted. However, this treatment did not significantly alter the size and shape of the chlorosomes, did not extract the BChl a, and caused only minor changes in the absorption spectrum of the chlorosomes....... Cross-linking studies with SDS-treated chlorosomes revealed the presence of multimers of the major chlorosome protein, CsmA, up to homooctamers. Extraction of chlorosomes with SDS and 1-hexanol solubilized all ten chlorosome envelope proteins as well as BChl a. Although the size and shape...

  7. Leadership et confiance développer le capital humain pour des organisations performantes

    CERN Document Server

    Duluc, Alain

    2003-01-01

    Aujourd'hui, l'encadrement des hommes consiste à tirer le meilleur parti de soi-même et des autres pour contribuer au développement de la performance. Ce type de leadership repose sur des valeurs telle qu'honnêteté, confiance, exemplarité, etc. Cet ouvrage propose une définition opérationnelle de ces valeurs et une façon de les mettre en ouvre. Il repose sur les méthodes et outils de développement personnel et organisationnel, élaborés par Will Schutz, un thérapeute américain. Sommaire : La complexité, nouveau passage des entreprises; Développer la confiance et la dimension humaine pour faire face à la complexité; Quelle forme de leadership pour demain?; Développer la confiance dans l'entreprise; La connaissance de soi et des autres, premier pas vers la confiance.

  8. Une science du langage pour une science de l'humain

    Directory of Open Access Journals (Sweden)

    Jean-Paul Bronckart

    2011-01-01

    Full Text Available L'auteur de cet article propose d'abord une analyse de l'évolution des sciences du langage au cours des dernières décennies, qui fait apparaître la difficulté d'identifier un cadre épistémologique susceptible de se substituer au défunt programme chomskyen. Il soutient ensuite que l'enjeu central des sciences sociales est de comprendre comment s'est constitué, et comment se développe, l'espace gnoséologique proprement humain, et il examine à ce propos les apports des courants du cognitivisme, du constructivisme (de Piaget et de l'interactionnisme social. L'auteur procède alors à une description détaillée de divers apports des sciences du langage: la conception saussurienne du statut des signes ainsi que les rapports entre textes et langues; la conception de Volochinov du rôle des discours dans le développement social; les approches de l'architecture des textes. Sur ces bases, il démontre enfin en quoi les sciences du langage peuvent fournir un appui décisif aux sciences de l'homme.

  9. FORMER A L’EXERCICE D’UNE MEDECINE BIOTECHNOLOGIQUE ET HUMAINE

    Directory of Open Access Journals (Sweden)

    Jacques BRINGER

    2017-05-01

    Full Text Available Le bond en avant de la médecine au cours des dernières décennies s’est appuyé sur la recherche, l’innovation dans les nouvelles biotechnologies permettant le développement de soins plus efficaces, moins invasifs, mieux ciblés pour nombre de maladies. Dans le même temps, une meilleure gestion des risques et une organisation plus centrée sur le patient impliquent une étroite coopération entre les professionnels de santé activés selon les besoins du patient. Les étudiants en médecine doivent être entrainés à acquérir la pratique des nouvelles technologies et à se préparer à l’action en équipe avant d’intervenir dans le soin. Un tel entrainement par simulation vise à développer des mises en situation de « vraie vie » incluant l’obtention de compétences individuelles ou collectives et l’aptitude des cliniciens à une décision partagée et aux relations humaines telles que la capacité d’écoute, d’annonce et d’accompagnement s’appuyant sur le questionnement éthique et le souci de la personne.

  10. [Social marketers' lack of success in using CSM discipline to harness commercial resources and increase contraceptive prevalence].

    Science.gov (United States)

    Davies, J

    1984-01-01

    Social marketers have certainly shown that the CSM discipline can quickly and cost-effectively harness commercial resources to increase contraceptive prevalence. But why hasn't the social marketing idea caught on in more countries? According to Social Marketing Forum, only a tiny number of countries have active programs after more than a decade of effort. The most likely reason for this lack of success is doubt and fear on the part of both developing countries' officials and donor agencies about allowing marketing enthusiasts--with our very noticeable advertising methods--to join the family planning fight. And what has our answer been? Usually, a head-on retort such as, "But look at all the condoms we've sold]" And that gets us nowhere, because the successful peddling of 1 not-so-impressive method doesn't begin to balance the fears of a possible backlash that brash condom promotions could bring down on official heads. The lesson we should be learning is that social marketers possess to narrow an outlook and promote a small range of products that don't enthuse decisionmakers. Hence, we are often perceived as condom salesmen--and not much more. What should we be doing? We should be selling the idea of using private sector experience to assist national development. That means social development, particularly improved health, family planning and women's education. These 3 activities have proven effective in reducing fertility and would add up to a marketing opportunity--a longterm challenge that should enthuse dicisionmakers, private sector entrepreneurs and donor agencies alike. Further, our model--the commercial sector--is renowned for branching out and secceeding in a broad range of endeavors. As an example, Procter and Gamble uses separate divisions to market different products. Initiatives already exist in many countries to harness the private sector as a development tool. Social marketers should be leading the initiative--and benefitting from it, too. full text

  11. Parole et identité humaine à l’âge classique

    Directory of Open Access Journals (Sweden)

    Pascale Gillot

    2010-03-01

    Full Text Available En prenant appui sur des textes de Descartes et de philosophes post-cartésiens comme Géraud de Cordemoy, ou encore des théoriciens de Port-Royal, tels Lancelot, Arnauld et Nicole, nous nous intéressons au statut double et paradoxal que revêt la parole dans la philosophie classique, au moment où se construit la question de l’union psychophysique et où sont proposées diverses « réponses » à cette question, dans la perspective d’une conceptualisation nouvelle d’une identité humaine rendue problématique. Le paradoxe tient au fait que l’activité de langage est d’abord manifestation de la pensée, indice publiquement observable ou témoignage extérieur de l’existence d’un esprit à l’origine des actes linguistiques, conformément à la théorie cartésienne à ce sujet ; mais la parole dénote aussi, dans la philosophie même de Descartes, une faculté spécifiquement humaine, propre au « vrai homme », en tant qu’il est indissolublement esprit et corps. Nous tentons de montrer que ce qui est en jeu dans les études brèves et éparses que Descartes consacre au langage, puis dans les développements ultérieurs de la Grammaire générale et raisonnée et de la Logique de Port-Royal, à travers la théorie du signe linguistique et de la signification, c’est la compréhension de la relation, nécessairement postulée et pourtant constamment renvoyée à l’ordre d’un lien contre-nature, et par là arbitraire, fruit d’une institution, entre la parole comme phénomène physique et la parole comme activité symbolique par excellence ; si bien que le prodige du phénomène humain du langage, comme expression publique des pensées, donne la mesure de l’énigme que constitue l’unité en l’homme du corps et de l’esprit.The aim of this paper is to lay emphasis on the connection between the mind-body problem and the theory of language which is developed in early-modern philosophy by Descartes and post

  12. Description d'un processus de debureaucratisation de l'appareil administratif etatique au moyen de differentes techniques de gestion des ressources humaines

    Directory of Open Access Journals (Sweden)

    Thibault DUVILLIER

    2000-06-01

    Full Text Available Le but de cet exposé1 consiste à expliquer un processus de débureaucratisation de l'appareil administratif étatique au moyen de techniques de gestion des Ressources humaines. Pour ce faire, il convient de s'entendre sur le concept de bureaucratie autant que sur celui de gestion des Ressources humaines. En disséquant une organisation définie comme bureaucratique en ses diverses composantes, nous pourrons ainsi mieux émettre des pistes de débureaucratisation. Précisément, les différentes techniques de gestion des Ressources humaines dont je ferai état ici permettront de faciliter le changement organisationnel souhaité.

  13. Chaire en écosanté sur la santé des humains et des animaux dans ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Chaire en écosanté sur la santé des humains et des animaux dans les écosystèmes protégés d'Afrique centrale et d'Afrique de l'Est ... Le programme de recherche et d'établissement de partenariats de la chaire sera intégré à One Health Central and Eastern Africa (OHCEA), un réseau régional de santé locale et d'écoles ...

  14. Les Comités mixtes de sécurité humaine (CMSH) au Burundi : un ...

    African Journals Online (AJOL)

    Le conflit burundais a la particularité, au-delà d'un bilan humain non encore établi, d'avoir érigé des barrières structurelles entre les « ethnies », les régions, les genres, etc. (Accord d'Arusha, protocole I). C'est ainsi que l'accord a cherché à redresser les corps de sécurité pour en faire des forces républicaines ouvertes à ...

  15. La prolongation de la vie humaine selon Francis Bacon. Ou : quel Tithon voulons-nous être ?

    Directory of Open Access Journals (Sweden)

    Dominique Weber

    2011-07-01

    Full Text Available Afin de comprendre avec exactitude la manière dont Francis Bacon envisage la question de la prolongation de la vie humaine, il faut impérativement examiner l’assise théologique de la réflexion du philosophe à ce sujet. Il convient aussi de restituer l’intégration de cette réflexion dans les objectifs plus amples de la philosophie naturelle nouvelle. Enfin, il est nécessaire de comprendre les dimensions proprement morales de la question. Car la prolongation de la vie humaine n’est pas seulement, au sein de la philosophie naturelle nouvelle, un cas parmi d’autres des recherches qu’il faut désormais effectuer : en réalité, c’est elle qui lui donne et qui lui fixe son sens ; avec elle se joue l’effectivité de l’identité espérée entre science et puissance. Mais il faut encore préciser qu’il ne s’agit aucunement pour l’homme de vieillir pour vieillir : il s’agit pour lui de pouvoir vieillir bien. Les leçons que Bacon tire de la fable de Tithon sont ici véritablement décisives.

  16. Entre guajiros et espagnols, les humains: récits Añun

    Directory of Open Access Journals (Sweden)

    1990-01-01

    Full Text Available L’article présente une série de textes tirés de la tradition orale añun, groupe arawak en voie d’extinction (côte nord-ouest du Lac de Maracaïbo, Venezuela. Sans prendre de position théorique, l’auteur se propose de montrer comment la tradition orale, à travers des récits allégoriques évoquant les dangers de l’intégration, reflète les relations que les Añun entretiennent avec les autres groupes humains de la région et qui dans les contes, se traduisent par des métaphores animales. ENTRE GUAJIROS Y ESPAÑOLES, LOS HUMANOS - RELATOS AÑÚN. Este artículo presenta una serie de relatos de la tradición oral añún, grupo arawak en vías de extinción, localizado en el litoral noroeste del Lago de Maracaibo, Venezuela. Sin tomar ninguna posición teórica, la autora se propone mostrar a través de unos relatos alegóricos que evocan los peligros de la integración, cómo la tradición oral refleja las relaciones experimentadas por los Añún con los demás grupos humanos de la región, traducidas en los cuentos por metáforas animales. BETWEEN GUAJIROS AND SPANIARDS, THE HUMANS - AÑUN TALES. This article presents a selection of tales belonging to the oral tradition of the Añun people, an Arawak group threatened with extinction (North West coast of Maracaibo Lake, Venezuela. Leaving aside all theoretical discussion, the author attempts to show how oral tradition, through allegorical tales illustrating the dangers of integration, reflects the relationships held by the Añun with the other human groups living in the area and which, in the narrative, find expression in animal metaphors.

  17. Simulation de mouvement humain sur postes de travail pour le diagnostic et l'aide à la conception

    OpenAIRE

    Hue, Valentin

    2008-01-01

    Les travaux présentés dans ce mémoire concernent la génération automatique de postures et mouvements humains sur poste de travail industriel. L'objectif poursuivi est d'animer de façon réaliste un mannequin numérique afin de simuler un opérateur dans l'exécution de sa tâche. Cette animation doit permettre d'aider à l'analyse des facteurs biomécaniques pouvant engendrer des Troubles Musculo-Squelettiques. Dans un premier temps, des choix de modélisation sont proposés en fonction de ce contexte...

  18. L’avenir des légumineuses dans l’alimentation humaine : enjeux dans un nouveau contexte

    OpenAIRE

    Thompson, Richard

    2012-01-01

    Face au défi de l’alimentation d’une population humaine mondiale croissante, il faut produire mieux en utilisant moins de ressources et en utilisant des stratégies plus respectueuses de l’environnement. Les légumineuses représentent un élément-clé pour une agriculture durable de par leur capacité de fixer l’azote atmosphérique et ainsi réduire l’utilisation des engrais de synthèse. D’autre part, les produits de légumineuses peuvent être des sources riches en protéines pour l’alimentation huma...

  19. Thermo-Mechanical Characterisation of In-Plane Properties for CSM E-glass Epoxy Polymer Composite Materials – Part 1

    DEFF Research Database (Denmark)

    Jakobsen, Johnny; Jensen, Martin; Andreasen, Jens H.

    2013-01-01

    -plane thermal expansion coefficient (a) of the composite material decreases above the glass transition temperature (Tg), which is compensated by a higher out of plane deformation above Tg. Comparison of a and chemical shrinkage measurements suggests that chemical bonds between the polymer matrix and the glass......The in-plane thermo-mechanical properties and residual stresses of a CSM E-glass/Epoxy material are characterised through the use of DSC and TMA. The measured data is used to generate material models which describe the mechanical behaviour as a function of conversion and temperature. The in...... in the composite material are mainly a result of restricted cure shrinkage rather than mismatch between thermal expansion coefficients....

  20. Hard rock excavation at the CSM/OCRD test site using crater theory and current United States controlled smooth wall blasting practices, June 1982

    International Nuclear Information System (INIS)

    Sperry, P.E.; Chitombo, G.P.; Hustrulid, W.A.

    1984-08-01

    This report is the fourth in a series describing experiments conducted by the Colorado School of Mines for the Office of Crystalline Repository Development (OCRD) to determine the extent of blast damage in rock surrounding an underground opening. The report describes the application of tunnel design procedures based upon crater theory and current United States controlled smooth wall blasting practices for the excavation of the CSM/OCRD test room in the Colorado School of Mines, Experimental Mine (Edgar Mine) in Idaho Springs, Colorado. Ten blast rounds were used to excavate the test room. The first seven rounds were designed with Swedish Techniques, and described in the third report in this series, and the design of rounds eight through ten used crater theory. Crater theory is described in this document along with its application to the CSM/OCRD Room excavation. Calculation for spacing, burden, number and type of holes, explosives placement, and overall powder factor are discussed. A series of single charge cratering test shots, designed to evaluate some of the input data for the blast designs, are discussed. The input data include: Strain Energy Factor E, a dimensionless factor which varies according to the explosive and rock type; Critical Depth, N, the charge depth at which the explosive begins to fracture rock at the free face; Optimum Depth Ratio Δ 0 , which is a ratio between Optimum Charge Depth, d 0 , and Critical Charge Depth, d/sub c/; and charge Weight, W. A non-linear least squared regression method to best fit the general bell-shape curve of the crater results is discussed. Both scaled weight and scaled volume criteria are reported in the analysis of results. 10 references, 17 figures, 16 tables

  1. Sensor Data Fusion and Integration of the Human Element. (la Fusion de donnees de senseur et l’integration du facteur humain)

    Science.gov (United States)

    1999-02-01

    information generated. Dr George E A Reid Chairman, Technical Planning Committee La fusion de donnees de senseur et l’integration du facteur humain...RTO MP-12) Synthese Les Operateurs des futurs systemes militaires sur un champ de bataille en environnement numerise devront faire face ä des...seulement d’appretier les capacites du Systeme, mais aussi d’avoir confiance dans les informations qu’il genere. Dr George E A Reid President du

  2. L'écosanté, pour améliorer la santé humaine et préserver l ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    27 oct. 2010 ... Puis, en 1992, il a lancé le programme Santé, société et environnement, qui réunissait des spécialistes de divers domaines dans le but d'étudier les répercussions des facteurs environnementaux sur la santé. La création du programme Écosystèmes et santé humaine (ÉCOSANTÉ) en 1996 a permis de ...

  3. EFFET DES VITAMINES B12, B9 ET B6 ET LEURS INTERACTIONS SUR LA FRAGILITE OSMOTIQUE DES ERYTHROCYTES HUMAINS

    Directory of Open Access Journals (Sweden)

    B HOUCHER

    2001-06-01

    Full Text Available L’effet des vitamines B12, B9 et B6 sur la fragilité osmotique des érythrocytes humains a été exploré in vitro. De fortes concentrations de vitamines B12 et B6 ont protégé les érythrocytes de l’hémolyse hypotonique, avec une protection maxima atteinte respectivement à 10 et 500 µg/ml. A concentrations plus faibles, cependant, ces vitamines ont favorisé grandement l’hémolyse hypotonique. Par contre, la vitamine B9 a montré uniquement un effet hémolytique de 4 à 200 µg/ml. Cet effet peut être expliqué par la nature acide de la molécule. L’effet nul sur la fragilité osmotique de deux vitamines antagonistes, peut probablement être expliqué par l’antagonisme partiel ou par la présence de ces deux vitamines simultanément: ces dernières se lient en quantités appréciables à la cellule intacte de même qu’à l’hémolysat et il y’ a compétition mutuelle entre ces vitamines et leur transport.

  4. Nuclear wastes management: the lessons from the C.S.M. disposal site (Centre de Stockage de la Manche. Memory-less Centre, Future-less Centre?

    International Nuclear Information System (INIS)

    2006-05-01

    With its 527 217 m 3 of low and medium activity wastes put in storage between 1969 and 1994, the C.S.M.( center of storage of Manche) is and remains to this day a necessary element to understand the problems posed by the eternal storage of nuclear materials and the limits of the notion of reversibility. There are therefore teachings to be drawn. We cannot repeat past mistakes in particular with high activity wastes which we wish to bury deep underground. This report is based on the analysis of the existing bibliography, of the internal A.N.D.R.A. documents which we released to the public, of the lessons drawn from our participation in the official concerting and work groups, and finally of the data obtained after inquiries were done in the region in the framework of R.I.V.I.E;R.E. (citizens network of radioecological surveillance, information and evaluation). In spite of all efforts produced, many questions remain unanswered regarding this site so it is sometimes difficult to be more precise. (N.C.)

  5. Applying CSM-CERES-Maize to define a sowing window for irrigated maize crop - The Riacho´s Farm case study

    Directory of Open Access Journals (Sweden)

    Denise Freitas Silva

    2011-08-01

    Full Text Available Irrigation use constitutes an alternative to improve maize production in Central Minas Gerais State, Brazil. However, even under adequate water supply conditions, other environmental factors may influence maize crop growth and development and may, ultimately, affect grain yield. This study aimed to establish a sowing window for irrigated maize crop, based on simulation results obtained with the decision support model CSM-CERES-Maize. Simulations were made for crop management conditions of Riacho´s Farm, located in Matozinhos, Minas Gerais State, Brazil. It was employed the model´s seasonal tool, along with a data set containing 46 years of weather data records, to simulate maize yield for weekly sowing scenarios, starting on August 1st and ending on July 24th of each year. One defined an irrigated maize sowing window, taking into account the yield break risk that a farmer would be willing to take. The model proved to be an interesting tool to assist in decision making, regarding crop and irrigation management, for an irrigated maize production system. Assuming a 10% yield break in the expected average maximum maize yield, it was defined as sowing window, the period from January 23rd to March 6th, with February 20th as the best sowing date. Other sowing windows may be established according to the risk that the farmer would be willing to take.

  6. Trois modèles « éducatifs » : droit, potentialité et capital humain

    Directory of Open Access Journals (Sweden)

    Ingrid Robeyns

    2011-05-01

    Full Text Available Dans cet article, j’analyse trois logiques normatives qui peuvent fonder les politiques éducatives en portant une attention particulière aux questions liées aux spécificités des sexes. Ces trois modèles éducatifs sont la théorie du capital humain, le discours du droit et l’approche des potentialités. D’abord, je décris cinq rôles que l’éducation peut jouer. Ensuite, j’analyse les trois modèles pouvant fonder les politiques éducatives. La théorie du capital humain pose un certain nombre de problèmes parce qu’elle s’avère économiciste, fragmentée et essentiellement instrumentaliste. Le discours du droit et l’approche des potentialités sont en principe des modèles multidimensionnels et inclusifs et peuvent par le fait même tenir compte des rôles intrinsèques et non économicistes de l’éducation. Toutefois, selon la manière dont quelqu’un satisfait aux exigences spécifiques des cadres théoriques du droit et des potentialités, ceux-ci peuvent également présenter des difficultés. Je termine cet article en soutenant que la visée intrinsèque des politiques éducatives devrait être d’augmenter les potentialités des individus et que nous devrions employer les discours du droit de façon stratégique, c’est-à-dire lorsqu’il est probable qu’ils amènent les gens à réaliser leurs potentialités.In this paper, I discuss three normative approaches that can establish educational policies with special attention to gender issues. These three models of education are human capital theory, the discourse of law and the capabilities theory. First, I describe five roles that education can play. Then I analyze the three foundational models of educational policies. The human capital theory raises a number of problems because it is economistic, fragmented and largely instrumental. The discourse of law and the capabilites theory are usually multidimensional and inclusive; they can thereby take into account

  7. Activités humaines et trypanosomose américaine. Revue de la littérature

    Directory of Open Access Journals (Sweden)

    Walter A.

    2003-09-01

    Full Text Available La trypanosomose américaine est une anthropozoonose due à Trypanosoma cruzi, parasite des mammifères sauvages d'Amérique latine, capté secondairement par l'homme à qui il est transmis par un insecte vecteur de la famille des Reduviidae. Dans le cadre d'une étude multidisciplinaire sur l'écoépidémiologie de cette parasitose, une approche de type ethnologique tente, à partir des données de la littérature, de préciser les différentes modalités selon lesquelles l'homme agit sur le cycle épidémiologique de la maladie. Les activités quotidiennes favorisent souvent la domiciliation du vecteur, mais les modes d'occupation du sol perturbent les écotopes des vecteurs ou des hôtes, entraînant une recomposition des foyers infectieux et leur déplacement vers l'habitat humain ; les modes de prise en charge de la maladie par les institutions, les collectivités ou les individus, jouent également un rôle. Si certaines catégories d'actions anthropiques (telles que les structures de l'habitat ont été bien étudiées, d'autres (telles que l'impact réel des activités agropastorales sur le cycle épidémiologique sont moins connues. L'étude fine et structurée du rôle des facteurs anthropiques dans la structuration des foyers de trypanosomose américaine reste donc, en grande partie, à faire.

  8. Écrire le personnage, dire l’humain : La Celestina (1499-1502 de rupture en rupture jusqu’aux confins de la modernité

    Directory of Open Access Journals (Sweden)

    Odile Lasserre Dempure

    2013-03-01

    Full Text Available Née à l’instant du passage entre Moyen Âge et Modernité, La Celestina (1499-1502 de Fernando de Rojas épouse la dynamique de rupture au sein de laquelle elle voit le jour. Un examen des divers modes d’écriture du personnage, mais aussi des visages de l’humain qu’ils façonnent, permettra de saisir ce mouvement fait de ruptures et dissidences qui emporte La Celestina de la fin du Moyen Âge jusqu’à la dernière modernité.

  9. Resenha de: Applications de la photographie aérienne aux recherches des Sciences humaines dans le régions tropicales

    Directory of Open Access Journals (Sweden)

    Eurípedes Simões de Paula

    1965-03-01

    Full Text Available JHURAULT (J.. — Applications de la photographie aérienne aux recherches des Sciences humaines dans le régions tropicales. Coleção "Mémoires de photo-interprétation" dirigida por R. Chevalier. Publicação da "École Pratique des Hautes Études" (6e Section . Paris. S.E.V.P.E.N. 1964. 111 páginas de texto, 7 figuras e 19 pranchas fora do texto, 4 cartas coloridas, 8 fotos estereoscópicas.

  10. Etude des sédiments lacustres. L'impact des activités humaines sur la qualité des ressources naturelles en eau.

    OpenAIRE

    Thevenon F.; Poté J.; Girardclos S.; Adatte T.; de Alencastro L.F.

    2014-01-01

    En Suisse, environ 20% de la consommation d’eau potable est couverte par les eaux des lacs, après plusieurs paliers de traitement et de nettoyage. Les lacs sont des écosystèmes complexes et la qualité de leur eau est directement menacée par les effluents domestiques, agricoles, urbains, industriels et hospitaliers. L’étude des sédiments, qui enregistrent de façon continue l’impact des activités humaines sur la qualité des eaux, permet d’identifier les sources de pollution, d’évaluer leur impa...

  11. CSM a success in Bangladesh.

    Science.gov (United States)

    1983-01-01

    The Bangladesh Social Marketing Project (SMP), providing contraceptives at an annual rate of 931,000 couple years of protection (CYP) as of June 1983, is a success. This figure has grown markedly since the start of the program in late 1975, when the SMP provided 80,000 CYPs, or 8% of nonclinical protection provided. The SMP has contributed to the steadily increasing national nonclinical contraceptive distribution. Currently, SMP distribution accounts for as much as the government and nongovernment programs combined. When clinical methods (including sterilizations) are added to national distribution, the SMP share represents about 28% of total contraceptive use. The SMP does not provide clinical methods, but the entire increase in nonclinical protection provided by the national program since 1975 has been the result of SMP product sales. The SMP utilizes the available mass media for promotion, including print, radio, television, as well as outdoor media and point of purchase materials. Mobile Film Units (MFUs) are an innovative promotional method employed by the SMP. Approximately 80 night time outdoor showings are organized each month in rural areas by SMP promoters. Typically, several short films, usually a popular story with a family planning theme, are run. Between each film the SMP products are of advertised. Products are often sold during and after the films. Retail outlets for SMP products include general stores, pharmacies, and other small shops. When products were introduced in 1975 retail outlets totaled 7500. By August 1983 the number of country wide retailers carrying SMP products had grown to nearly 100,000. In 1982 a marketing strategy emphasizing the role of doctors and rural medical practitioners (RMPs) was introduced. There are between 70,00-100,000 RMPs in Bangladesh. They are well known and respected "doctors" in their villages and add an extensive family planning outreach to the SMP system. The most important advantage of using the RMPs is their personal contact with OC users. Since October 1981 the SMP has detailed approximately 30,000 RMPs; 15,000 have attended conferences and 6600 have purchased OCs. Consumers targeted by the SMP have annual incomes ranging from US$200-$400. A well defined organizational system has evolved that delineates the roles of government, the contractor, and the project personnel regarding specific policy, enterprise, management, and operational functions. The project staff of nearly 300 includes managers for the sales, development, marketing, and finance and administration departments.

  12. Guidelines for CSM project development.

    Science.gov (United States)

    1983-01-01

    This document summarizes guidelines for contraceptive social marketing project development prepared by the International Contraceptive Social Marketing Project (ICSMP) as an aid to consultants and technical assistance contractors. The ICSMP has developed a checklist to guide planning in 4 major areas: 1) project organization and management structure, 2) target market, 3) product line, and 4) pricing strategy and project costs. A clear statement of project objectives is essential, and these objectives must be internally consistent so that strategies to accomplish them can be unified. The position of each governmental entity and sponsoring agency involved in the social marketing project must be clearly understood. Projects receiving US government funds must have a mechanism for financial and programmatic reporting and accountability. Thorough knowledge of commercial rules and regulations in a country is necessary for planning. To ascertain whether the necessary resources are available, it is necessary to examine the existing marketing infrastructure in terms of distribution, advertising, market research, and packagaing capabilities. The target market should be specified in quantifiable terms; in addition, a consumer profile that defines the overall demographics of the country, the family planning environment, and potential social marketing consumers should be developed. The couple years of protection projection can be translated into the percentage of the target market that the project expects to capture. It is necessary to price products early in project development in order to assess program costs. Revenue projections should be based on previous calculations of couple year of protection goals, product line, product price, and price structure. Each element of the advertsing budget should be justifiable in terms of project objectives. Finally, positions and anticpated salaries for staff should be specified through the 1st 3 years of project implementation.

  13. Mise à jour sur le nouveau vaccin 9-valent pour la prévention du virus du papillome humain

    Science.gov (United States)

    Yang, David Yi; Bracken, Keyna

    2016-01-01

    Résumé Objectif Informer les médecins de famille quant à l’efficacité, à l’innocuité, aux effets sur la santé publique et à la rentabilité du vaccin 9-valent contre le virus du papillome humain (VPH). Qualité des données Des articles pertinents publiés dans PubMed jusqu’en mai 2015 ont été examinés et analysés. La plupart des données citées sont de niveau I (essais randomisés et contrôlés et méta-analyses) ou de niveau II (études transversales, cas-témoins et épidémiologiques). Des rapports et recommandations du gouvernement sont aussi cités en référence. Message principal Le vaccin 9-valent contre le VPH, qui offre une protection contre les types 6, 11, 16, 18, 31, 33, 45, 52 et 58 du VPH, est sûr et efficace et réduira encore plus l’incidence des infections à VPH, de même que les cas de cancer lié au VPH. Il peut également protéger indirectement les personnes non immunisées par l’entremise du phénomène d’immunité collective. Un programme d’immunisation efficace peut prévenir la plupart des cancers du col de l’utérus. Les analyses montrent que la rentabilité du vaccin 9-valent chez les femmes est comparable à celle du vaccin quadrivalent original contre le VPH (qui protège contre les types 6, 11, 16 et 18 du VPH) en usage à l’heure actuelle. Toutefois, il faut investiguer plus en profondeur l’utilité d’immuniser les garçons avec le vaccin 9-valent contre le VPH. Conclusion en plus d’être sûr, le vaccin 9-valent protège mieux contre le VPH que le vaccin quadrivalent. Une analyse coûtefficacité en favorise l’emploi, du moins chez les adolescentes. Ainsi, les médecins devraient recommander le vaccin 9-valent à leurs patients plutôt que le vaccin quadrivalent contre le VPH.

  14. Nuclear wastes management: the lessons from the C.S.M. disposal site (Centre de Stockage de la Manche). Memory-less Centre, Future-less Centre?; Gestion des dechets radioactifs: les lecons du Centre de Stockage de la Manche (C.S.M.). Centre Sans Memoire, Centre Sans Avenir?

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    2006-05-15

    With its 527 217 m{sup 3} of low and medium activity wastes put in storage between 1969 and 1994, the C.S.M.( center of storage of Manche) is and remains to this day a necessary element to understand the problems posed by the eternal storage of nuclear materials and the limits of the notion of reversibility. There are therefore teachings to be drawn. We cannot repeat past mistakes in particular with high activity wastes which we wish to bury deep underground. This report is based on the analysis of the existing bibliography, of the internal A.N.D.R.A. documents which we released to the public, of the lessons drawn from our participation in the official concerting and work groups, and finally of the data obtained after inquiries were done in the region in the framework of R.I.V.I.E;R.E. (citizens network of radioecological surveillance, information and evaluation). In spite of all efforts produced, many questions remain unanswered regarding this site so it is sometimes difficult to be more precise. (N.C.)

  15. Application of csm- ceres-maize model for seasonal and multi-decadal predictions of maize yield in under subtropical condition of Chitwan, Nepal

    Directory of Open Access Journals (Sweden)

    Lal Prasad Amgain

    2015-12-01

    Full Text Available The average maize yield of 2.5 t/ha in sub-tropical terai and inner terai of Nepal has been very less than its potential yield of about 5.0 t/ha, for which changing climatic scenarios have been reported the critical factors. Cropping system Model (CSM-Crop Estimation through Resource and Environment Synthesis (CERES-Maize, embedded under Decision Support System for Agro-technology Transfer (DSSAT ver. 4.2 was evaluated from a datasets of field experimentation by growing four diverse maize genotypes viz. full season OPV (Rampur Composite, Quality Protein Maize (Posilo Makai-1, Hybrid (Gaurav and Pop corn (Pool-12 under three different planting dates (September 1, October 1 and November 1 in 2009-10 at Rampur Campus, Chitwan. The experiment was laid out in two factor factorial randomized complete block design (RCBD with three replications in slightly acidic (pH 6.7 sandy loam soil having low soil available N( 0.49% and K (148 kg/ha and medium P (16.3 kg/ha status. The ancillary and yield data obtaining from field experiment was analyzed from the M-Stat C software and recorded that Gaurav hybrid produced significantly higher yield under September 1 planting (5.86 t/ha followed by Posilo Makai 1 (5.55 t/ha, Rampur Composite (5.1t/ha and the least with Pool-12 (3.45 t/ha. Further, the heat use efficiency of diverse maize genotypes were also calculated by using the mean temperature based accumulative heat unit system and found the stable yields only with Rampur Composite for all planting dates and the rest genotypes were suitable only to the early winter plantings. Model calibration was done by using September 1 planting date for all 4 maize genotypes while validation was accomplished by using the remaining treatments for predicting growth and yield of different maize genotypes. The year 2006- 07 was found 13, 18, 23 and 7% higher in producing the maize yield than the standard year 2009-10 for Rampur Composite, Posilo Makai-1, Gaurav and Pool-12

  16. Comparing the imitative skills of children and nonhuman apes Comparaison des capacités d’imitation des enfants humains et des grands singes

    Directory of Open Access Journals (Sweden)

    Malinda Carpenter

    2009-10-01

    Full Text Available We propose a framework which breaks down the mechanisms of social learning into their four constituent elements: actions, results, goals, and context. We review what is known about the use of each of these elements in children’s and apes’ social learning, with special attention to possible differences among apes with different rearing histories. We conclude that, by 12 months of age, human infants use each of the four elements when interpreting and selectively copying others’ behavior. Apes, on the other hand, appear to focus solely on the results of demonstrations (although there is some suggestive evidence that enculturated apes may copy actions and goals more than other apes. Finally, we show how these (and other related findings can be explained by uniquely human skills and motivations for shared intentionality.Nous proposons ici de décomposer les mécanismes de l'apprentissage social en quatre éléments constitutifs : actions, résultats, objectifs et  contexte. Nous passons en revue ce que l'on sait de l'utilisation de chacun de ces éléments au cours de l'apprentissage social chez les enfants humains et les grands singes, en prenant en compte les différents contextes d’élevage dans lesquels les grands singes ont pu se développer. Nous concluons qu'à 12 mois, les jeunes enfants emploient chacun des quatre éléments pour interpréter et copier sélectivement le comportement des autres. Les grands singes, eux, semblent se concentrer uniquement sur le résultat des démonstrations (bien qu'il y ait des preuves suggérant que des individus acculturés copieraient plus les actions et les objectifs des démonstrateurs que les autres individus. Finalement, nous montrons comment  ces découvertes (et d'autres qui en découlent peuvent être expliquées par le caractère unique des compétences humaines et la motivations des être humains à partager les intentions d’autrui.(Traduit par la Rédaction.

  17. Strontium-90 content of human bone collected in 1967; Teneur en strontium 90 d'os humains preleves en 1967

    Energy Technology Data Exchange (ETDEWEB)

    Jeanmaire, L.; Patti, F. [Commissariat a l' Energie Atomique, Fontenay-Aux-Roses (France). Centre d' Etudes Nucleaires

    1969-07-01

    This report follows report CEA-R-3381 and presents the strontium 90 content of human bones collected in 1967 in the Paris area. The main trend is much the same as during 1966; contamination levels are falling down in infants up to 5 year old. Beyond this age, the values are the same or experience a slight increase. (authors) [French] Ce rapport fait suite au rapport CEA-R-3381 et indique les teneurs en strontium 90 d'os humains preleves au cours de l'annee 1967 dans la region parisienne. L'evolution generale des resultats est sensiblement la meme qu'au cours de l'annee 1966; nous assistons a une baisse de la contamination chez les enfants jusqu'a 5 ans. Au-dela de cet ge, les valeurs sont les memes, ou en legere augmentation. (auteurs)

  18. management stratégique des ressources humaines et leur efficacité dans le système d’insertion professionnel

    OpenAIRE

    Mehdid, Yamina; Bahri, Abou- Bakr

    2014-01-01

    Résumé: L'objectif de ce travail consistait à observer les pratiques de gestion stratégique des ressources humaine mises en œuvre par les organisations algériennes privés et publics et à estimer leurs impacts sur l'efficacité du système d'insertion professionnel. A ces fins, une étude de cas comparative fut réalisée sur deux organisations : l’une privé et l’autre public. Dans le cadre de cette étude, un questionnaire fut administré et des entretiens furent entretenus avec des acteurs des ...

  19. Strontium-90 content of human bones collected from 1962 to 1966; Teneur en strontium 90 d'os humains preleves de 1962 a 1966

    Energy Technology Data Exchange (ETDEWEB)

    Jeanmaire, L. [Commissariat a l' Energie Atomique, Fontenay-aux-Roses (France). Centre d' Etudes Nucleaires

    1967-07-01

    The aim of this report is essentially to present results of {sup 90}Sr determination made on human bones collected in the Paris region from 1962 to 1966. The results are classified according to the year and the age-group in, two tables and one figure which show the general evolution of the contamination during this period. (author) [French] Le but de ce rapport est essentiellement de presenter les resultats des dosages de {sup 90}Sr effectues sur les os humains, preleves de 1962 a 1966 dans la region parisienne. L'ensemble des resultats a ete groupe par annee et par tranche d'age en deux tableaux et une figure, qui montrent l'evolution generale de la contamination au cours de cette periode. (auteur)

  20. Comparaison des méthodes d’évaluation de la qualité de la semence dans les espèces bovine, canine et humaine

    OpenAIRE

    Cabannes, Carole

    2008-01-01

    L’évaluation de la qualité du sperme est indispensable pour son utilisation en insémination artificielle et dans les techniques de procréation médicalement assistée. Les enjeux et les finalités de l’examen de la semence sont fondamentalement différents dans les espèces bovine, canine et humaine. Cette étude décrit et compare les méthodes d’évaluation de la qualité du sperme utilisées en pratique dans des centres spécialisés en France et les critères de conservation et d’élimination de la seme...

  1. La gestion des ressources humaines peut-elle être un facteur de fidélisation de la clientèle du centre E. Leclerc Casteldis ?

    OpenAIRE

    Laurie Ple

    2010-01-01

    Le secteur de la grande distribution est un domaine passionnant par son histoire, son évolution et sa place au cœur de nombreuses mutations de notre société. L'explorer à travers la gestion des ressources humaines est tout de suite paru attirant. Étant donné que la grande distribution évolue dans un contexte de plus en plus compétitif, la fidélisation de la clientèle est devenue un de ses grands enjeux. La grande distribution a développé des outils de fidélisation, mais ils sont largement rep...

  2. "A epopeia da decadência": um estudo sobre o Essai sur l'inégalité des races humaines (1853-1855, de Arthur de Gobineau

    Directory of Open Access Journals (Sweden)

    Helga da Cunha Gahyva

    2011-12-01

    Full Text Available O presente artigo discute a concepção racial de Arthur de Gobineau a partir de sua mais famosa obra, o Essai sur l'inégalité des races humaines. Se comumente este tratado é associado à discussão racialista que toma corpo nas últimas décadas do século XIX, pretendo relacioná-lo a uma polêmica característica da virada do século XVII para o XVIII, a Querela das duas raças. Neste sentido, o objetivo do artigo é revelar, em primeiro lugar, como a reflexão de Gobineau é tributária de um conceito de linhagem tornado paulatinamente anacrônico no mundo pós-revolucionário. Em segundo, demonstrar a hipótese segundo a qual o Essai, menos do que um estudo sobre raças pretensamente "biológicas", representa fundamentalmente uma recusa à nova ordem igualitária que se impõe na era moderna.The present article discusses the racial concepts of Arthur de Gobineau based on his most famous work, Essai sur l'inegalité des races humaines. Instead of associating these with the racialist debate of the last decades of the XIX the century, I relate them to a polemical text characteristic of the late XVII and early XVIII century: The Quarrel of the Two Races. In this sense, my main objective is to show that, in the first place, the Gobineau's work owes significant debts to the concept of the "bloodline", an idea which gradually became anachronistic after the French Revolution. In addition, I argue that, rather than being a study of supposedly "biological" races, Gobineau's "Essay" should be regarded as a refusal of the new egalitarian order of modern times.

  3. Des dimensions collectives comme dimensions génériques du travail humain et leurs déclinaisons dans des activités d’enseignement partenariales

    OpenAIRE

    Champy-Remoussenard, Patricia

    2014-01-01

    Les recherches en analyse du travail montrent que les dimensions collectives constituent une caractéristique quasi universelle du travail humain que l’on peut donc considérer comme générique et transversale. Elles trouvent des déclinaisons spécifiques dans des secteurs d’activité et des « métiers » différents. A l’heure où le travail humain se transforme de façon considérable et accélérée, les dimensions collectives évoluent elles aussi et participent d’une transformation des métiers de la re...

  4. Danièle Linhart, La comédie humaine du travail. De la déshumanisation taylorienne à la sur-humanisation managériale

    OpenAIRE

    Pencolé, Marc-Antoine

    2015-01-01

    Dans La comédie humaine du travail, Danièle Linhart poursuit ses précédentes recherches en sociologie du travail sur la « modernisation » des entreprises et l’évolution de l’organisation du travail qui l’accompagne, en abordant cette fois plus spécifiquement le nouveau management dit « humaniste », qui entend respecter l’humain, la personne, être à son écoute et lui donner les moyens de son épanouissement dans l’entreprise. En une décennie, la souffrance au travail a été progressivement média...

  5. Le développement humain local dans les contextes de crise permanente : l’expérience des femmes au Sahara Occidental

    Directory of Open Access Journals (Sweden)

    María López Belloso

    2009-04-01

    Full Text Available Les femmes sahraouies sont des agents actifs dans la dynamique sociale des camps de réfugiés, au sein desquels elles ont défini un certain nombre de stratégies de résolution de problèmes pour surmonter les obstacles liés à une situation humanitaire qui se détériore. Depuis le début du conflit et le déplacement forcé à Tindouf, en Algérie, les femmes sont en e%et intégralement responsables de la gestion des camps de réfugiés, et ont assumé un rôle de dirigeantes dans de nombreux secteurs de la société. Cet article souligne la contribution des femmes sahraouies au processus de développement humain local dans un contexte de refuge prolongé tel celui que connaît le Sahara Occidental. En plus d’améliorer la capacité d’accès des réfugiés aux ressources matérielles, physiques, sociales et organisationnelles ainsi qu’aux forces motivationnelles, les femmes sahraouies ont été en mesure de mettre en place leur propre processus de renforcement des capacitésII individuelle et collective dans la vie du camp.

  6. La Trypanosomose Humaine Africaine dans l’espace ivoiro-burkinabé : optimisation des stratégies de surveillance épidémiologique

    Directory of Open Access Journals (Sweden)

    Kambiré R.

    2012-11-01

    Full Text Available L’objectif de cet article est de décrire les récentes données de surveillance médicale de la Trypanosomose Humaine Africaine (THA au Burkina Faso et en Côte d’Ivoire afin (i de dresser un bilan de la situation actuelle de la maladie dans ces deux pays qui entretiennent depuis plus d’un siècle des liens migratoires, économiques et épidémiologiques intimes et (ii de définir les stratégies à mettre en place dans l’objectif d’une élimination durable. Les résultats de la surveillance active et passive ont montré que les trypanosomés dépistés au Burkina-Faso ces dernières années sont tous des cas importés provenant de Côte d’Ivoire. Cependant, la réintroduction du parasite est effective et le risque d’une reprise de la transmission existe. En Côte d’Ivoire, plusieurs foyers “historiques” toujours endémiques font craindre des phénomènes de réémergence et de propagation. Dans l’objectif d’une élimination durable de la THA dans ces deux pays, les acteurs de la lutte doivent adapter leur système de surveillance en fonction des différents contextes épidémiologiques. Les prévalences actuelles ne justifient plus, excepté des cas particuliers, l’usage systématique et très onéreux du dépistage actif par prospections médicales exhaustives. Elles tendent plutôt à privilégier des systèmes intégrés aux systèmes de santé nationaux et utiliser des méthodes permettant de cibler les zones prioritaires d’intervention à partir notamment d’un échange d’informations épidémiologiques entre les deux pays. Pour accompagner le processus d’élimination durable, les acteurs de la recherche doivent étudier le rôle respectif des réservoirs humain et animal dans le maintien de la transmission, participer au suivi sur le long terme des cas traités et des suspects sérologiques, et évaluer en termes de coût/efficacité les stratégies mises en place par les Programmes Nationaux afin de les

  7. Landslide causes: Human impacts on a Himalayan landslide swarm Les impacts humains sur une séquence de glissements de terrain dans l’Himalaya

    Directory of Open Access Journals (Sweden)

    Martin Haigh

    2012-12-01

    healing as they have in the undisturbed forest along the Kilbury Road. However, past surveys confirm that landslide numbers on the Almora Lower Mall have remained steady since 1985. Since, the impacts of this rainfall event were manifest only as increased landslide outfall, not increased numbers, the chief influences of outfall volume remain hillslope angle, height of the initial roadcut, undermining by channel incision and the fact that these hillsides exist close to criticality, their limits of stability.Les géographes se voient régulièrement sollicités pour diagnostiquer les causes des catastrophes naturelles et fournir des pistes aux décideurs politiques. Notre étude porte sur un des cataclysmes - glissements de terrain et inondations - ayant touché le district himalayen d’Almora (Uttarakhand, durant la fin de la mousson de 2010. Le phénomène a affecté des milliers de kilomètres de routes et ses ravages se sont chiffrés à plus de 125 000 000 $. Les causes ont été investiguées sur une portion de route de 7,4 km qui avait fait l’objet d’une étude antérieure. Les glissements de terrain ont été examinés un par un, avec identification d’une série d’indicateurs environnementaux rendant compte de causes possibles. Les résultats ont montré que le nombre de glissements enregistrés sur la route n’était pas inhabituel. L’étude se porta dès lors sur l’exploration des facteurs susceptibles d’avoir accru leur volume. L’opinion locale y voyait principalement des impacts humains, en particulier le développement urbain récent, ou encore certaines faiblesses géologiques. Cependant, les résultats prouvent que les impacts humains tels que la construction, la déforestation et l’effondrement des terrasses agricoles étaient associés à des glissements de moindre ampleur, tandis que les facteurs géologiques ne montraient pas de corrélations significatives avec le volume des glissements. Les facteurs de génie routier comme la pr

  8. Simulation du mouvement humain en vue d'applications ergonomiques - Vers une approche de simulation basée sur données et assistée par connaissances

    OpenAIRE

    WANG, X

    2003-01-01

    Le mannequin numérique, comme outil de conception, a pour objectif de permettre aux ingénieurs de prendre en compte des facteurs humains dans la conception de produits ou de postes de travail. Il doit être capable de représenter le futur opérateur ou l'utilisateur du produit, de simuler son activité, d'évaluer ses interactions avec son environnement et d'en déduire des informations sur les astreintes subies. Si les avancées technologiques, notamment dans le domaine informatique, permettent un...

  9. Kalevipoeg tänapäeval - ühe tulevase Euroopa kultuuri document humain : psühholoogilis-antropoloogilisi aspekte / Peter Petersen ; tõlkinud Krista Räni

    Index Scriptorium Estoniae

    Petersen, Peter, 1933-

    2003-01-01

    Lisa 1. William Butler Yeats. Ta igatseb endale taevakangaid / tõlkinud Märt Väljataga, lk. 2587 ; Lisa 2. Novalis. Neue Fragmente. Nr. 393 (Novalis. Werke und Briefe. Stuttgart ; Hamburg : Deutscher Bücherbund, 1962), lk. 2587-2588 ; Lisa 3. Tabel väärtuste kohta, mida Kalevipoja-eeposes esile tuuakse, lk. 2588. Bibl. lk. 2589-2590. Tõlgitud käsikirjast: "Kalevipoeg heute - document humain einer künftigen Kultur Europas: psychologisch-anthropologische Aspekte"

  10. New strategic directions for Caribbean CSM project.

    Science.gov (United States)

    1986-01-01

    Recent changes in the strategy of the Caribbean Contraceptive Social Marketing Project emphasize the condom, under the brand name, Panther. Since 1984, CCSMP began marketing their Perle rand of oral contraceptive, since dropped, in Barbados, St. Vincent and St. Lucia. Now wider commercial connections are envisioned, with support by CCSMP to promote generic brands. The Panther condom campaign will include an array of mass media, point-of-purchase and sporting event advertising. Pharmacies report that Panther is selling as well as the leading commercial brand. CCSMP is looking to introduce an ultra-thin condom and a vaginal foaming tablet. Market research, involving physicians and users as well as retail audits, indicates that although population in numbers alone is not a serious problem in the Caribbean, early pregnancy is a concern in the area.

  11. CSM in Latin America: new developments.

    Science.gov (United States)

    1986-01-01

    SOMARC is currently providing support to contraceptive social marketing efforts in Bolivia, Brazil, and Paraguay. The distinctly different family planning climates in these 3 countries have provided SOMARC with an opportunity to practice programmatic flexibility in project strategy and design. In Bolivia, the SOMARC strategy for implementing contraceptive social marketing is primarily a private sector venture in which donated products will be imported by local distributors and sold through the traditional channels. Distribution services through a network of local private family planning groups will provide SOMARC with direct access to Bolivian trade unions and work organizations. These family planning groups will in turn be strengthened by their association with the social marketing program as a potential source of revenue. In Brazil, where many low-priced contraceptives are already on the market, SOMARC's role will be in the areas of communication and promotion to increase contraceptive prevalence. The first task will be to identify target areas where there is a combination of low prevalence and an existing market infrastructure. A Brazil Contraceptive Social Marketing Program Advisory Council has been formed to provide a consolidated approach to family planning activities. Efforts toward developing a contraceptive social marketing program in Paraguay remain at an exploratory level. The introduction of social marketing in Paraguay is complicated by the existence of a pervasive contraband system. Although consumer awareness of contraception is high, the contraceptive prevalence rate is low. Efforts in all 3 countries reflect SOMAR's strategy of broadening the scope of project alternatives to meet the special needs of each nation.

  12. FPA withdraws from CSM project in Guatemala.

    Science.gov (United States)

    1984-01-01

    Guatemala's family planning association, the Asociacion Pro-Bienestar de la Familia (APROFAM) recently cut its ties with the nation's contraceptive social marketing program. The announced reasons for the disassociation was APROFAM's concerns about the legality of selling donated commodities. APROFAM helped create the program served as a member of the marketing program's board of directors, and was expected to function as the channel for the commidities donated by the US Agency for International Development (USAID). The marketing program will now be managed by the newly created Importadora de Farmaceuticos (IPROFA), a for-profit organization. This alters the legal status of the marketing program, and as a result, the program will be required to pay duties on USAID donated contraceptives. USAID cannot legally pay duties on its own contributions. Instead, the duies will be paid by IPROFA out of the revenues generated by the project. IPROFA will finance the 1st consignment of products with a bank loan, and the loan and duties on subsequent shipments will be paid out of the program's revenues. This strategy is not expected to pose legal problems for USAID, since the agency has no control over how programs use the revenues generated by selling the agency's commodities. As a result of the changed status, the marketing program must acquire it own storage and packaging facilities. According to Manuel DeLucca, the program's resident advisor, these problems will not delay the launch of the program's products scheduled for early 1985. The program plans to sell an oral contraceptive, a vaginal spermicidal tablet, and a condom. Orginal plans called for selling the low dose OC, Norminest; however, Norminest may not be approved for distribution in Guatemala, and USAID may replace Norminest with another product. As a result, the program may market Noriday, a normal dose pill instead of Norminest. Guatemalan registration of the spermicidal tablet the program is planning to sell is pending. The program is engendering considerable interest because of its unique legal status as a commercial enterprise and its freedom from bureaucractic constraints.

  13. Adaptation dynamique de mouvements humains

    OpenAIRE

    Hoyet , Ludovic

    2010-01-01

    For years, understanding and simulating human motion has become an important issue for various fields, such as computer animation, robotics, biomechanics, etc. In computer animation, the goal is to use this knowledge to create virtual humans as realistic as possible. With the amount of work already done, it is now possible for virtual humans to handle various tasks as realistically as a real human would do. One important key point in the realism of virtual motions is to verify dynamic laws. E...

  14. Relation entre le capital humain des maraîchers urbains et leurs comportements de prévention des risques sanitaires sur les sites de culture à Abidjan (Côte d'Ivoire)

    OpenAIRE

    Adiko, Francis A.; Matthys, Barbara; Cissé, Guéladio; Bonfoh, Bassirou; Tanner, Marcel; Utzinger, Jürg

    2010-01-01

    Le capital humain des maraîchers urbains d’Abidjan influence leur prévention des risques sanitaires liés à l’utilisation abusive des pesticides et des eaux usées, et à l’intensité du travail de maraîchage en milieu urbain. Mais, les effets positifs de la scolarisation et de l’expérience professionnelle sur la santé sont assujettis par les exigences et les contraintes de l’activité agricole, et particulièrement du maraîchage urbain, de sorte qu’ils ne sont perçus chez les maraîchers à conditio...

  15. ETUDE DE L'EFFET DE QUELQUES FACTEURS SUR LA CYTOTOXICITE INDUITE PAR L'AMPHOTERICINE B ASSOCIEE AUX LIPOPROTEINES DU SERUM SANGUIN CHEZ DES CELLULES DE GLOBULES ROUGES HUMAINES

    OpenAIRE

    BOUCHERIT, ATMANI Zahia

    2014-01-01

    toxiques. Dans le cadre de l'élaboration d'une stratégie de développement de cette molécule visant à augmenter l'index thérapeutique tout en réduisant la toxicité, nous avons étudié l'effet de quelques facteurs sur la cytotoxicité induite par l'amphotéricine B associée à des lipoprotéines du sérum sanguin chez le globule rouge humain (modèle universel de cellules animales supérieures). Dans notre travail nous avons abordé d'une part, les effets des caractéristiques des lipoprot...

  16. Etude physico-chimique et bactériologique de l'eau de la source « Sidi Bouyashak» destinée à la consommation humaine de la population de Tlemcen.

    OpenAIRE

    HAMEL, Latifa Amel

    2015-01-01

    Le présent travail consiste à effectuer des analyses physico-chimiques et bactériologiques de l'eau de la source de sidi Bouyashak dans le but d'apprécier sa potabilité selon la réglementation algérienne en vigueur, étant donné qu'une partie de la population de Tlemcen la consomme et la considère comme eau « potable » et « minérale ». Les résultats des analyses physico-chimiques montrent que cette eau est apte à la consommation humaine. Cette eau est bicarbonatée calcique se...

  17. Développement humain, développement durable et « pays en développement » : comment articuler et mesurer les différentes dimensions ?

    Directory of Open Access Journals (Sweden)

    Bruno Boidin

    2004-02-01

    Full Text Available Cet article cherche à préciser la place qu’occupent les différentes dimensions du développement durable au sein de l’analyse économique du développement, et en particulier les dimensions humaine et sociale. Ceci nous amène à considérer les relations complexes entre les différents actifs (santé, éducation, capital social…, marquées par des effets d’irréversibilité qui peuvent remettre en cause la durabilité. Se pose alors la question de la mesure du développement durable prenant en compte ces articulations entre les dimensions. Une grille d’évaluation des mesures synthétiques du développement durable est proposée et appliquée à une sélection d’indicateurs.This article seeks to specify the place of various dimensions of sustainable development within development economics, in particular human and social dimensions. This leads us to consider the complex relations between the various assets (health, education, social capital…, characterized by irreversibility effects which can jeopardize sustainability. It is therefore necessary to find a measure of sustainable development, taking into account these interactions between dimensions. We propose criteria to evaluate synthetic measurements of sustainable development, and apply them to selected indicators.

  18. Le rôle médiateur de la satisfaction au travail dans le lien entre l’intensité de la gestion des ressources humaines et le roulement du personnel

    Directory of Open Access Journals (Sweden)

    Emmanuel Nwahanye

    2016-09-01

    Full Text Available Ce travail évalue empiriquement le rôle médiateur de la satisfaction au travail dans le lien entre l’intensité de la gestion des ressources humaines (GRH et le roulement du personnel mis en évidence par de nombreux modèles de départ d’employés. Il est conduit sur un échantillon de 73 institutions financières en activité au Cameroun et fait appel à la méthode causale d’analyse des effets médiateurs adaptée du modèle de Baron & Kenny (1986. Les résultats assortis des régressions montrent, d’une part, que la satisfaction est un médiateur partiel dans le lien entre l’intensité de la GRH et le taux de roulement volontaire. D’autre part, elle est un médiateur parfait dans le lien entre l’intensité de la GRH et la propension à quitter. Il recommande aux dirigeants d’accorder une attention particulière à la satisfaction au travail en matière de rétention du personnel.

  19. Determination of iron absorption and excretion by whole-body counting; Determination de l'absorption et de l'excretion du fer par la methode de comptage global humain

    Energy Technology Data Exchange (ETDEWEB)

    Hollard, D.; Benabid, Y.; Berard, M.; Bonnin, J.; Darnault, J.; Millet, M. [Commissariat a l' Energie Atomique, Grenoble (France). Centre d' Etudes Nucleaires

    1969-07-01

    Using a whole-body counter, the authors have studied {sup 59}Fe absorption and loss in 8 normal subjects and in 30 iron deficient patients. Results showed that whole-body counting provided an excellent and simple method for iron retention measurements, obviating many inaccuracies of previous technic. Normal absorption of radio iron with this procedure has ranged from 9 per cent to 20 per cent of the administered tracer in normal subjects, with a mean of 15 per cent. A significant increase in {sup 59}Fe absorption was noted in 21 iron-deficient patients in whom the retention ranged from 40 to 100 per cent. However, 3 iron-deficient patients were found to have low absorption, and their severe iron deficiency could be correlated with this defect in absorption. This method permits also the determination of the rate of iron excretion during the following months and therefore the study of the mechanism of some pathological loss. (authors) [French] L'utilisation de la methode de comptage humain global a permis aux auteurs d'etudier l'absorption et l'excretion du fer-59 chez 8 sujets temoins et 30 sujets hyposideremiques. Les resultats montrent que cette technique simple et directe offre de nombreux avantages sur les methodes employees jusqu'a maintenant pour cette determination. La valeur normale de l'absorption du fer chez les temoins est d'environ 15 pour cent de la dose ingeree. Ce chiffre est tres fortement augmente chez 21 sujets hyposideremiques, pouvant atteindre 100 pour cent de la dose ingeree. Par contre, pour 3 malades, cette absorption est si faible qu'elle suggere une carence par defaut d'absorption. Cette methode permet egalement de suivre l'excretion du fer au cours des mois qui suivent l'examen et de determiner le mecanisme de fuites anormales. (auteurs)

  20. Human Factors Analysis of Aircrew Operational Tasks in a Fixed-Wing Search and Rescue Aircraft Cargo Compartment (Analyse des facteurs humains lies aux taches operationnelles qui sont executees par les membres d’equipage dans la soute des avions de recherche et de sauvetage)

    Science.gov (United States)

    2011-05-01

    SAR. On a tenu compte de données anthropométriques pertinentes, des tendances de la croissance séculaire, de l’équipement de protection individuelle...Defence, 2011 © Sa Majesté la Reine (en droit du Canada), telle que représentée par le ministre de la Défense nationale, 2011 DRDC Toronto TM...CISHO), à la demande du Directeur, Besoins aérospatiaux (DBA), a effectué une analyse des facteurs humains liés aux tâches opérationnelles qui sont

  1. Séroprévalence du virus de l'herpès humain-8 chez des patients VIH positif à l'hôpital général de Yaoundé – Cameroun

    Science.gov (United States)

    Jacky, Njiki Bikoï; Paul, Ndom; Lilian, Mupang; Sylvie, Agokeng Demanou

    2015-01-01

    L'épidémiologie de l'infection par le virus herpès humain de type 8 (HHV8) associée à celle à VIH, reste encore méconnue au Cameroun, bien que le pays soit considéré comme une zone endémique pour ces deux virus. L'objectif de ce travail était de ressortir le profil de la séroprévalence du HHV8 au sein de notre population d'étude. 57 personnes ont été recrutées à l'Hôpital Général de Yaoundé et suivies sur une durée 12 mois. Des anticorps IgG anti-HHV8 ont été déterminés par ELISA. Des paramètres autres, tels que l'âge, le sexe, le stade des maladies (SK et VIH/SIDA), le protocole ARV, ainsi que les taux de CD4 ont été utilisés pour déterminer les variables associées à la séropositivité au HHV8. Cette association a été évaluée par le test khi carré. La séroprévalence du HHV8 était de 90% dans notre population en début d'étude et de 74% douze mois plus tard, une séroprévalence qui restait élevée quelque soit le profil clinique, la tranche d'âge, le sexe ou le taux de CD4+ de l'individu. Aucune variable de l'étude n'était significativement associée à la séropositivité du HHV8. Le virus HHV8 semblait circuler au sein de notre population d'étude. Cependant l'on constate, douze mois plus tard, l'absence de manifestations cliniques du SK chez les patients VIH+ positifs, malgré des titres très élevés en IgG anti-HHV8. PMID:26090027

  2. Impact of the economic crisis on human mobility in Japan : a preliminary note L’impact de la crise économique sur la mobilité humaine au Japon : note préliminaire

    Directory of Open Access Journals (Sweden)

    Yoshitaka Ishikawa

    2012-12-01

    Full Text Available The central aim of this paper is to explore the impact of the global economic crisis on different categories of human mobility, including migration and tourism, in Japan. The major findings can be summarized as follows. First, since the fall of 2008 the crisis has had a far-reaching influence on Japan, for both the ethnic majority and minorities. Second, the intensity of the negative impact has varied by metropolitan areas and nationalities. Japanese nationals in the Tokyo metropolitan area and migrant workers (particularly Brazilians in the Nagoya metropolitan area and central Japan manufacturing prefectures are the most affected population groups. Finally, support programs by the Japanese government were problematic, and, in particular, the program that provided incentives for migrant workers to voluntarily return to their home countries was introduced too late. However, it is too early to clearly elucidate the full impact of the crisis, since the latest available data confirm that the current situation remains in a state of crisis.L’article vise à explorer l’impact de la crise économique mondiale sur différentes catégories de mobilité humaine au Japon, y compris les migrations et le tourisme. Les résultats principaux de l’étude peuvent se résumer comme suit. En premier lieu, depuis l’automne 2008, la crise a eu une influence non négligeable sur le pays, à la fois pour la majorité et pour les minorités ethniques. Ensuite, l’intensité de l’impact négatif a varié selon les zones métropolitaines et les nationalités. Les nationaux de la zone métropolitaine de Tokyo, ainsi que les travailleurs migrants (surtout des Brésiliens de la zone de Nagoya et des préfectures manufacturières du centre sont les groupes les plus touchés. Enfin, les programmes d’aide mis en place par le gouvernement japonais se sont révélés problématiques, en particulier celui qui offrait des incitations au retour volontaire vers les pays

  3. Efficacité de la prévention de la transmission mère-enfant du Virus de l'Immunodéficience Humaine par le protocole 2010 de l'Organisation Mondiale de la Santé au Centre Médical Saint Camille de Ouagadougou (Burkina Faso)

    Science.gov (United States)

    OuédraogoYugbaré, Solange Odile; Zagré, Nikaise; Koueta, Fla; Dao, Lassina; Kam, Ludovic; Ouattara, Diarra Yé; Simporé, Jacques

    2015-01-01

    L’épidémie du Virus de l'Immunodéficience Humaine en milieu pédiatrique est surtout le résultat de la transmission mère-enfant. Notre étude a pour objectif de décrire l'efficacité de la prévention de la transmission mère-enfant du Virus de l'Immunodéficience Humaine par le protocole OMS 2010 (Option A et trithérapie) au centre médical saint Camille de Ouagadougou. Nous avons mené une étude d'une cohorte d'enfants suivis dans le cadre de la prévention de la transmission mère-enfant du Virus de l'Immunodéficience Humaine au centre médical saint Camille de Ouagadougou sur une période de 2 ans allant du 1er Janvier 2012 au 31 Décembre 2013. Nous avons obtenu l'accord de 4900 femmes enceintes pour le dépistage de l'infection du Virus de l'Immunodéficience Humaine et 238 gestantes ont été diagnostiquées séropositives soit 4,86% de séroprévalence. Les femmes étaient surtout infectées par le Virus de l'Immunodéficience Humaine avec de type I (95,38%)). La majorité était sous trithérapie (74,3%) et (25,7%) sous prophylaxie (option A). Les nouveau-nés (92,5%) ont reçu un traitement antirétroviral à base de névirapine dans les 72 heures après la naissance. L'allaitement sécurisé a été appliquée dans 78% des cas. Le taux global de transmission mère-enfant du VIH était de 3,6% avec 3% de transmission chez les enfants nés de mères sous trithérapie antirétrovirale et 6,3% dans les cas de prophylaxie antirétrovirale. Le facteur de risque de transmission a été le long délai du début d'administration des antirétroviraux chez le nouveau-né. La mortalité infantile à un an était de 3,5%. Cette étude a révélé l'efficacité de l'Option A et conforté celle de la trithérapie, le passage à l'Option B+ serait donc plus bénéfique. PMID:26966499

  4. Mesenchymal stem cells, a hope for the treatment of radiotherapy complications; Les cellules souches mesenchymateuses, un espoir pour le traitement des complications des radiotherapies

    Energy Technology Data Exchange (ETDEWEB)

    Gourmelon, P. [Institut de Radioprotection et de Surete Nucleaire, Dir. de la Radioprotection de l' Homme, 92 - Fontenay-aux-Roses (France); Semont, A.; Benderitter, M. [Institut de Radioprotection et de Surete Nucleaire. Laboratoire de Radiopathologie et Therapies Experimentales, 92 - Fontenay-aux-Roses (France)

    2010-10-15

    This article reports experimental researches performed by IRSN researchers in the field of cell therapy, notably for the treatment of severe accidental radiological burns. It shows than mesenchymal stem cells have been very efficient for the treatment of radio-induced of muscular cutaneous lesions, notably by reducing the pain where conventional analgesic treatments fail. A positive effect has been also obtained by using these stem cells for the treatment of severe intestinal lesions on mice locally irradiated with high doses. The tumorigenic risk associated with the use of these mesenchymal stem cells is also discussed

  5. Apports nutritionnels, dépense et bilan énergétiques chez l’homme et les primates non-humains : aspects méthodologiques Nutritional intakes, energy expenditure and energy balance in human and non-human primates: methodological aspects

    Directory of Open Access Journals (Sweden)

    Laurent Tarnaud

    2011-02-01

    Full Text Available Cet article est une revue des méthodes de terrain et des techniques de laboratoire, traditionnelles et récentes, qui permettent d’évaluer les apports alimentaires et nutritionnels, les profils d’activité, la dépense énergétique et les réserves énergétiques corporelles des primates humains et non-humains. Cette revue a pour objectif de faire le point sur l’avancement des techniques utilisées pour estimer les paramètres énergétiques en anthropobiologie. Les primates non-humains et l’homme partagent un certain nombre de traits psycho-physiologiques issus des processus d’adaptation biologique à l’environnement et/ou liés à l’inertie phylogénétique. Identifier les mécanismes qui président à la dynamique énergétique chez les primates non-humains permet ainsi de situer certaines des bases biologiques partagées avec l’homme dans le contexte de l’évolution. Cette revue s'attache donc à présenter les méthodes en dégageant, lorsqu’ils existent, les points de recoupement des différentes approches méthodologiques appliquées à l’homme et aux primates non-humains. Par ailleurs, des comparaisons inter-populationnelles au sein de l’espèce humaine ou chez des primates non-humains permettent de préciser les relations entre les variables écologiques et les adaptations énergétiques. Dans cet article le lecteur trouvera différentes méthodes, présentées dans différents chapitres, selon qu'il s'intéresse à décrire et quantifier les apports alimentaires, nutritionnels et énergétiques des individus dans des conditions environnementales spécifiques, mesurer les dépenses énergétiques associées aux activités ou déterminer le statut nutritionnel et la composition corporelle des individus ou encore préciser le rôle des composés secondaires sur la sélection des items alimentaires et les propriétés pharmacologiques des plantes consommées. À l’origine descriptives, les méthodes actuelles

  6. Corruption, croissance et capital humain : quels rapports ?

    African Journals Online (AJOL)

    15 oct. 2013 ... rentes qui peuvent prendre des formes telles que la corruption ou les marchés parallèles (Krueger 1974). Ceci est important dans la mesure où la recherche de rentes, surtout dans le secteur public, par la bureaucratie empêche beaucoup plus les activités génératrices d'innovations que dans le secteur.

  7. Directeur, Ressources Humaines | CRDI - Centre de recherches ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Le Centre compte au total cinq régimes salariaux, six régimes de retraite (deux pour les ERO et quatre pour les ERP), sept régimes d'avantages sociaux et plusieurs indemnités différentes pour le personnel affecté à l'étranger. Il existe également dans les bureaux régionaux une myriade de coutumes locales qu'il faut ...

  8. Scanning Apollo Flight Films and Reconstructing CSM Trajectories

    Science.gov (United States)

    Speyerer, E.; Robinson, M. S.; Grunsfeld, J. M.; Locke, S. D.; White, M.

    2006-12-01

    Over thirty years ago, the astronauts of the Apollo program made the journey from the Earth to the Moon and back. To record their historic voyages and collect scientific observations many thousands of photographs were acquired with handheld and automated cameras. After returning to Earth, these films were developed and stored at the film archive at Johnson Space Center (JSC), where they still reside. Due to the historical significance of the original flight films typically only duplicate (2nd or 3rd generation) film products are studied and used to make prints. To allow full access to the original flight films for both researchers and the general public, JSC and Arizona State University are scanning and creating an online digital archive. A Leica photogrammetric scanner is being used to insure geometric and radiometric fidelity. Scanning resolution will preserve the grain of the film. Color frames are being scanned and archived as 48 bit pixels to insure capture of the full dynamic range of the film (16 bit for BW). The raw scans will consist of 70 Terabytes of data (10,000 BW Hasselblad, 10,000 color Hasselblad, 10,000 Metric frames, 4500 Pan frames, 620 35mm frames counts; are estimates). All the scanned films will be made available for download through a searchable database. Special tools are being developed to locate images based on various search parameters. To geolocate metric and panoramic frames acquired during Apollos 15\\-17, prototype SPICE kernels are being generated from existing photographic support data by entering state vectors and timestamps from multiple points throughout each orbit into the NAIF toolkit to create a type 9 Spacecraft and Planet Ephemeris Kernel (SPK), a nadir pointing C\\- matrix Kernel (CK), and a Spacecraft Clock Kernel (SCLK). These SPICE kernels, in addition to the Instrument Kernel (IK) and Frames Kernel (FK) that also under development, will be archived along with the scanned images. From the generated kernels, several IDL programs have been designed to display orbital tracks, produce footprint plots, and create image projections. Using the output from these SPICE based programs enables accurate geolocating of SIM bay photography as well as providing potential data from lunar gravitational studies.

  9. La correction et la révision de l’écrit en français langue seconde: médiation humaine, médiation informatique Correcting and editing texts written by FSL students: human mediation vs. computer-assisted mediation

    Directory of Open Access Journals (Sweden)

    Chantal Dion

    2003-06-01

    Full Text Available L’apprentissage de la correction / révision de l’écrit par les apprenants de français langue seconde peut-elle tirer profit des correcteurs orthographiques et grammaticaux des traitements de texte ou des correcticiels spécialisés ? La nature de la médiation informatique permet-elle aux apprenants de corriger de façon efficace leurs textes et comment se compare-t-elle avec la correction humaine ? Qu’est-ce qui différencie ces deux médiations ? Des textes rédigés par des anglophones ont été soumis aux deux types de corrections, humaine et informatique, soit deux enseignantes ayant vingt ans d’expérience et la correction informatique effectuée par le correcteur orthographique et grammatical de Word et les deux correcticiels canadiens, Le correcteur 101 et Antidote. Les résultats montrent que la nature de ces médiations n’est pas comparable et que la médiation informatique, pour être efficace, nécessite la participation active, intelligente et instruite de l’utilisateur et que les correcticiels ne peuvent pas corriger efficacement des textes d’étudiants de niveau intermédiaire.Can spellcheckers or grammar correctors, be they part of a word processor or stand-alone programs, help FSL students become more adept at correcting or editing the written texts they produce? Does computer-assisted mediation enable learners to correct their work efficiently and how does it compare with human mediation? What differentiates them? Texts written by anglophone students were corrected using both methods, i.e., on the one hand, by two teachers with 20 years experience and, on the other hand, using the specialized tools available with MSWord as well as two Canadian text correction programs, Le Correcteur 101 and Antidote. It turns out that the two methods are of very different natures ; computer-based correction can only give some positive results if the users have received appropriate training enabling them to actively and

  10. High-sensitivity gamma spectroscopy for extended sources. Application to activity measurements on the human body, on glass, and on soil; Spectrographie gamma a grande sensibilite pour sources etendues. Application a la mesure de l'activite du corps humain, du verre et du sol

    Energy Technology Data Exchange (ETDEWEB)

    Jouve, B

    1962-07-01

    The measurement and location by gamma spectroscopy of human body internal contaminations at maximum permissible levels, and, in certain cases, at lower activities such as that due to {sup 40}K was investigated. The characteristics of the high-sensitivity apparatus used are given, and several assemblies using large-volume NaI(Tl) scintillators are described. The relatively light shielding required for natural radioactivity permitted construction of mobile assembly. Conditions of use are described, and the results are given. All gamma emitting elements were measured in 15 min at levels lower than the tolerance dose. Gamma spectroscopy was also used to determine fission products in the earth and to study radioactive elements in the presence of other emitters. (author) [French] La spectrographie gamma du corps humain permet la mesure et la localisation des contaminations internes au niveau des doses de tolerance et, dans certains cas, celle d'activites plus faibles comme la radioactivite naturelle due principalement au potassium 40. Les caracteristiques des appareils a grande sensibilite permettant ces mesures sont exposees et on decrit plusieurs realisations originales utilisant un scintillateur NaI(Tl) de grand volume. L'epaisseur du blindage a ete limitee a 5 cm de plomb, ainsi, pour une protection suffisante contre les rayonnements ambiants, les appareils sont relativement legers et l'une des realisations a pu etre installee dans un laboratoire mobile. Les conditions d'utilisation (mouvement propre, etalonnage) et les resultats obtenus sont donnes; tous les radioelements emetteurs gamma sont mesurables en 15 minutes a un niveau inferieur a la dose de tolerance. On presente enfin des applications a la spectrographie gamma d'echantillons volumineux (poudres ou liquides) et de tres faible activite: elles interessent des domaines tres varies comme, par exemple, la geophysique (etude des retombees radioactives) ou l'industrie chimique

  11. Comment mesurer la relation humain-technologies-organisation ? How to measure the human-technology-organization relationship? Presentation of a symbiosis-based questionnaire for evaluating the human-technology-organization relationship Cómo medir la relación humano-tecnologías-organización ? Elaboración de un cuestionario de medición de la relación humano-tecnología-organización basado en el modelo de la simbiosis

    Directory of Open Access Journals (Sweden)

    Éric Brangier

    2007-10-01

    Full Text Available Cet article vise à restituer une recherche relative à la mise au point d’une échelle de mesure de la relation entre l’humain, la technologie et l’organisation. Tout d’abord, les auteurs débattent des différents modèles théoriques de l’acceptation des technologies (technology acceptance model, théorie de la satisfaction de l’utilisateur, la théorie de la nonconformité aux attentes, puis proposent de considérer que la relation entre l’humain, la technologie et l’organisation peut s’appréhender selon une approche symbiotique qui considère qu’humains et technologies sont reliés par des rapports de forte dépendance, voire de fusion réciproque ou de couplage mutuel. La présentation d’un modèle de la symbiose humain-technologie-organisation donne ensuite lieu à l’élaboration d’un questionnaire administré à un échantillon de 172 personnes. Enfin, les analyses soulignent que l’approche symbiotique fournit des niveaux d’explicativité très intéressants, notamment en soulignant l’importance du couplage entre l’humain et la machine, et en révélant ainsi que les liens qui tissent la relation entre l’humain, l’organisation et la machine peuvent être dits mutuellement dépendants. Cet article propose donc une alternative aux modèles qui insistent sur les conditions d’acceptation des technologies par l’humain en montrant qu’aujourd’hui les technologies contemporaines sont en passe de devenir des symbiotes qui, d’un point de vue métaphorique, se couplent avec les individus.This article aims to reconstruct research relating to the development of a measurement scale for the man-technology-organization relationship. The authors first discuss various theoretical models for technology acceptance: the technology acceptance model, user’s satisfaction theory, expectancy disconfirmation theory, and then suggest that the man-technology-organization relationship can be studied through a

  12. Interaction affective et expressive. Compagnon artificiel-humain

    OpenAIRE

    Riviere , Jérémy

    2012-01-01

    The aim of this thesis is to make an Embodied Conversational Agent (ECA) sincere in order to, on one hand, improve its believability from the human's point of view, and on the other hand make it acceptable in an affective relationship between an artificial companion and a human. The first part of this work consists in creating a Multimodal Conversation Language (MCL) for an ECA, made up of Multimodal Conversation Acts (MCA) such as promise, apologise or demand. These MCA allow the agent to ap...

  13. Logiques paysannes d'utilisation des excreta humains hygienises ...

    African Journals Online (AJOL)

    The data used in this article are from our doctoral thesis. Simultaneously, have been mobilized the quantitative and qualitative approaches supported by the comparative method. Practice of defecation, ecological sanitation device in households and the use of HHE as fertilizer by peasants have fostered the development of ...

  14. Distribution des Glossines vecteurs de la Trypanosomose humaine ...

    African Journals Online (AJOL)

    Conclusion and Application:All elements of the complex pathogenic necessary for the transmission of human African trypanosomes are present in the park. These results, although preliminary invite to develop strategies of struggle and control parasitosis vectors. Keywords: Vavoua trap, Doussala, Trypanosoma, Glossina, ...

  15. Génétique humaine de la tuberculose

    OpenAIRE

    El Baghdadi, J.; Grant, A.V.; Sabri, A.; El Azbaoui, S.; Zaidi, H.; Cobat, A.; Schurr, E.; Boisson-Dupuis, S.; Casanova, J.L.; Abel, L.

    2013-01-01

    La tuberculose, causée par Mycobacterium tuberculosis, demeure un problème majeur de santé publique avec plus de 8,7 millions de nouveaux cas et 1,4 millions de décès par an. Après exposition, la plupart des individus, mais pas la totalité, deviennent infectés par le bacille. Parmi les sujets infectés, seule une minorité (environ 10%) développera une tuberculose clinique, qui est typiquement soit une tuberculose primaire, extra-pulmonaire, chez l’enfant, soit une tuberculose de réactivation, ...

  16. Corruption, croissance et capital humain : quels rapports ? | Seka ...

    African Journals Online (AJOL)

    En effet, des étudiants talentueux qui au départ voudraient faire de longues études les jugent précipitamment trop longues, quand ils comparent le niveau de vie de ceux qui en ont déjà fait et ceux qui n'en ont pas fait mais riches de par la corruption. La méthodologie pour analyser ce phénomène est de deux ordres : à la ...

  17. Mieux nourrir les animaux pour une meilleure alimentation humaine ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    8 nov. 2013 ... Des chercheurs travaillant dans les districts de Morogoro et de Dodoma, en Tanzanie, ont fait une importante découverte : en enrichissant le foin avec des fanes de manioc et des feuilles de patate douce, ils ont fourni aux chèvres laitières un aliment peu coûteux, à teneur élevée en protéines, qui les a ...

  18. 5 les indicateurs de developpement humain au niveau infranational

    African Journals Online (AJOL)

    Ces indicateurs permettent de classer les pays et de mesurer l'évolution de leurs performances annuelle- ment. La question à laquelle nous nous attellerons dans ce papier est d'aborder les aspects méthodologiques que soulève le calcul de ces indicateurs à un niveau infranational. Pourquoi calculer l'IDH à un niveau ...

  19. Autonomisation des femmes au moyen de lieux de travail humains ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    En Asie, les ateliers de confection constituent un secteur d'emplois dominant, néanmoins les conditions dans ces lieux de travail sont parmi les plus rudes dans la région. Dans beaucoup d'ateliers de confection en Asie, des améliorations aux modes de gestion sont mises à l'essai dans le but de rehausser les conditions de ...

  20. Conseil de recherches en sciences humaines du Canada | CRDI ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Carrières · Communiquez avec nous · Plan du site. Abonnez-vous à notre bulletin pour recevoir les nouvelles du CRDI chaque mois. Abonnez-vous · Droits d'auteur · Éthique de la recherche · Politique de libre accès · Politique de confidentialité · Transparence · Utilisation du site Web. Suivez-nous; Facebook · Twitter ...

  1. NOUVELLES FORMES DE LA TRAITE DES ETRES HUMAIN

    OpenAIRE

    Dragos CHILEA; Andreea Georgiana ENACHE

    2011-01-01

    New forms of human trafficking are: I. Trafficking and exploitation of slaves. Trafficking human beings is one method of obtaining slaves. Victims are typically recruited through deceit or trickery (such as a false job offer, false migration offer, or false marriage offer), sale by family members, recruitment by former slaves, or outright abduction. II. Traffic flows of workers in Asia, Africa, Eastern Europe and former Soviet Union, Turkey. In the case of trafficking of workers there is the ...

  2. Sciences sociales, sciences humaines et sciences de l'homme ...

    African Journals Online (AJOL)

    D'où la question que nous nous posons: une telle définition est-elle suffisante pour une appréhension effective du statut de la science dans toutes ses dimensions? La réponse à une telle interrogation ne peut être que négative, dans la mesure ou en réalité, il ne peut y avoir de science que de la nature ni de la vie.

  3. Radiations, human cancerization and radioresistance. Rayonnements, cancerisation humaine et radioresistance

    Energy Technology Data Exchange (ETDEWEB)

    Vuillaume, M. (Ecole Normale Superieure, 75 - Paris (FR))

    1991-06-01

    Active oxygen species have been implicated in inflammatory diseases, cellular transformation and carcinogenesis. Experiments studying their direct (for instance, by ionizing radiation) or indirect influence (for instance, by the decrease(s) in activity of cellular defence enzymes), in vivo, and/or, in cell cultures (fibroblasts, keratinocytes, hepatocytes,...) have been positive. To the contrary, reactions or products, which decrease level(s) of free radicals/H{sub 2}O{sub 2} (i) directly, (ii) indirectly by an increase of SOD, catalase, and peroxydase activites suppress the above-described phenomena. This is the case for the domain number 2 (that contains copper, MW 53KDa) of the Scorpion's blood pigment (hemocyanin), which possesses SOD-, catalase-, and peroxydase-like properties, resistant to, at least, 4000 Gy, and thus may explain the especially high radioresistance of scorpions. Enzymatic decrease(s) and the domain number 2 of hemocyanin are under current investigation in several laboratories.

  4. The SMP mobilizes a bright idea: a CSM cinema on wheels.

    Science.gov (United States)

    1985-01-01

    The Bangladesh Family Planning Social Marketing Project (SMP) provides 1 of the best examples of the use of the mass media to promote social marketing. Using a fleet of 7 vans and 1 motor launch, the SMP brings films about family planning to more than a million rural couples a month living in isolated villages. Each film unit has two 16 mm projectors, a generator, a screen and speaker system and is operated by a projectionist and an assistant. 1 mobile unit gives about 25 shows a month at a cost of $75US per show, or less than 2 cents per person. The message reels and advertising spots were produced in Bangladesh, and the musical numbers are taken from local feature films. Every 3-4 months, the vans switch message and musical films, but all units keep separate copies of the advertising spots for Raja and Panther condoms and Maya and Ovacon pills. The motivational films were developed through extensive research, and they address basic social issues. During the show, various promotional items are sold, including calendars with family planning messages, plastic bags, key rings, and contraceptives. According to Robert Ciszewski, executive director of Population Services International, these mobile films are making a profound social change in Bangladesh.

  5. Determination of keystone species in CSM food web: A topological analysis of network structure

    OpenAIRE

    LiQin Jiang; WenJun Zhang

    2015-01-01

    The importance of a species is correlated with its topological properties in a food web. Studies of keystone species provide the valuable theory and evidence for conservation ecology, biodiversity, habitat management, as well as the dynamics and stability of the ecosystem. Comparing with biological experiments, network methods based on topological structure possess particular advantage in the identification of keystone species. In present study, we quantified the relative importance of specie...

  6. Low Loss Tapered Fiber Waveguide Modulator for Crew Cognitive State Monitoring (CSM)

    Data.gov (United States)

    National Aeronautics and Space Administration — Many crew-related errors in aviation and astronautics are caused by hazardous cognitive states including overstress, disengagement, high fatigue and ineffective crew...

  7. Factor structure of the Communicator Styles Measure (CSM) when used with undergraduate health science students.

    Science.gov (United States)

    Brown, Ted; Boyle, Malcolm; Williams, Brett; Molloy, Andrew; McKenna, Lisa; Palermo, Claire; Molloy, Liz

    2013-06-01

    It is important for educators to consider the communication skills of students enrolled in health science programmes. To date, research into this area is limited, and having measures that are valid and reliable would assist educators and researchers to complete high-quality investigations. The purpose of this study was to investigate the factor structure of Communicator Styles Measure. Data from the Communicator Styles Measure completed by 860 undergraduate health science students enrolled in eight different courses at an Australian university (response rate of 59%) were analysed using principal component analysis with varimax rotation and a cluster analysis using elementary linkage analysis. The Communicator Styles Measure is a self-report scale consisting of 40 items designed to assess ten communication styles and one's perception of his/her ability to communicate. Communicator Styles Measure items loaded onto five new viable factors labelled personable, energetic, confident, open and confronting. Six items of the original 40 from the Communicator Styles Measure did not load onto any factor and were therefore considered redundant. The original factor structure proposed by the Communicator Styles Measure's author was not supported, which calls into question its construct validity. However, the five new factors identified in this study may be useful for researchers and educators when assessing the communication skills of students and practitioners. Further investigation into the construct validity and reliability of the five new Communicator Styles Measure factors is recommended. © 2012 Nordic College of Caring Science.

  8. Criteria for feasibility, health and welfare assessment of requirement to use second and subsequent generations of non-human primates or animals from self-sustaining colonies in research Critères d’évaluation de la faisabilité, de l’incidence sanitaire et des répercussions sur le bien-être animal, relatifs à l'obligation future d'utiliser des primates non humains issus uniquement des animaux de deuxième génération et plus ou des animaux provenant de colonies d'élevage auto-entretenues pour la recherche expérimentale

    Directory of Open Access Journals (Sweden)

    David Smith

    2011-10-01

    Full Text Available The European Directive 2010/63/EU on the protection of animals used for scientific purposes requires that a feasibility study must be conducted by the European Commission to determine if all sourcing of non-human primates from parents bred in captivity (F2 or from self-sustaining colonies can be achieved. This study should also include an assessment of animal health and welfare. Prior to the initiation of the European Commission’s study, it was considered by EFPIA and FELASA that the criteria to be used in the feasibility, health and welfare assessment should be established by experts to help expedite such a study. This paper identifies those criteria which may be useful in making policy decisions on the confirmation or reconsideration of the timetable for implementation of the F2 requirement. A key requirement before a number of criteria can be assessed is the generation of base-line data relating to the supply and future demand of non-human primates and the health and welfare status of current breeding colonies supplying the European market. Three groups of criteria have been indentified, namely feasibility, science and research and welfare. Within each group, a number of parameters are defined and their rationale for inclusion, together with suggested information points, is discussed.La directive européenne 2010/63/EU sur la protection des animaux utilisés à des fins scientifiques exige qu'une étude de faisabilité soit conduite par la Commission européenne afin de déterminer si l’approvisionnement en primates non-humains à partir de géniteurs élevés en captivité (F2 ou de colonies d'élevage autosuffisantes, peut être possible. Cette étude devra également inclure une évaluation de la santé des animaux et de leur bien-être. Avant le début de cette étude par la Commission européenne, l'EFPIA et FELASA ont estimé que les critères à utiliser pour les évaluations de la faisabilité, de la santé des animaux et du bien

  9. THE LINDA CRANE MEMORIAL LECTURE: Striving for Excellence: Thursday February 18, 2010: APTA's CSM San Diego, CA.

    Science.gov (United States)

    Hayes, Sherrill H

    2010-06-01

    Historically, invited lecturers have often challenged us to define excel lence in physical therapy practice, or in our academic programs. While some have addressed different char acteristics of excellence, our profession has not really come together to address 2 very important questions: what does "quality" mean in physical therapist education? And how do we measure it? Using 3 elements of Friendship, Leadership, and Mentoring, and Defining Excellence and juxtaposing these with Linda Crane and her life, a vision of excellence in physical therapy educational programs was explored in this invited lecture. The text of that lecture ensues.

  10. Coupled CFD/CSM vibration design methodology for Generation IV long-life fuel and component design

    International Nuclear Information System (INIS)

    Weber, D.P; Chen, S.S.; Wang, C.Y.; Wei, T.Y.C.; Jansson, S.

    2000-01-01

    Fluid-structure interaction is a cause of failures experienced in fuel rods and is of particular importance for all reactor components in Generation IV reactors which unanimously adopt a pool configuration. A Nuclear Energy Research Initiative (NERI) project proposal has been submitted to United States Department of Energy (USDOE) to develop an advanced design methodology to model fluid-structure interaction, predict its consequences, and guide the design of reactor components. The proposed design methodology is an integrated experimental/theoretical/numerical technique. Preliminary studies have been performed utilizing the CFD code STAR-CD coupled to a first-order structural mechanics model to explore the issues of coupled dynamic fluid/structure interactions - flow field, fluid forces, and instability of tubes - in the cross flow regime. The coupled tool has been used to predict the characteristics of complex dynamic fluid/structure interactions. It includes flow field in the wake of a tube or tube array, motion-dependent fluid forces for a tube, and fluid elastic instability of tube arrays. Specifically, the following calculated quantities have been compared with published experimental data, (a) Flow Field: flow velocity, fluid pressure, and fluid forces (steady and fluctuating components) of steady flow across a circular cylinder at subcritical and critical regions. (b) Fluidelastic Forces: a tube is excited at a given frequency and amplitude. The resulting flow field and fluid forces acting on the tube are calculated. (c) Fluidelastic Instability of a Tube Row: coupled vibration of a tube row is analyzed as a function of flow velocity. Those predicted quantities which have been compared, agree well with experimental data. (author)

  11. Coupled deformation and fluid-flow behavior of a natural fracture in the CSM in situ test block

    International Nuclear Information System (INIS)

    Gertsch, L.S.

    1989-01-01

    The primary goal was the evaluation of an in situ block test as a data source for modeling the coupled flow and mechanical behavior of natural rock fractures. The experiments were conducted with the Colorado School of Mines in situ test block, an 8 m 3 (280 ft 3 ) gneiss cube which has been the focus of several previous studies. A single continuous fracture within the block was surrounded with instruments to measure stresses, deformations, and gas conductivity. The setup was subjected to combinations of normal and shear stress by pressurizing the block sides differentially with hydraulic flatjacks. The induced fracture deformation, as measured by two separate sensor systems, did not correlate closely with the fracture conductivity changes or with each other. The test fracture is more complicated physically than two parallel rock faces. Many joints which were not detected by mapping intersect the test fracture and strongly influence its behavior. These invisible joints create sub-blocks which react complexly to changes in applied load. The flow tests reflected the aggregate sub-block dislocations in the flow path. The deformation readings, however, were the movements of discrete points sparsely located among the sub-blocks. High-confidence extrapolation of block test results to large volumes, such as required for nuclear waste repository design, is not feasible currently. Present instrumentation does not sample rock mass behavior in situ at the proper scales. More basically, however, a fundamental gap exists between the nature of jointed rock and our conception of it. Therefore, the near-field rock mass must be discounted as an easily controllable barrier to groundwater flow, until radically different approaches to rock mass testing and modeling are developed

  12. A reconstituted light-harvesting complex from the green sulfur bacterium Chlorobium tepidum containing CsmA and bacteriochlorophyll a

    DEFF Research Database (Denmark)

    Pedersen, Marie Ø; Pham, Lan; Steensgaard, Dorte B

    2008-01-01

    chlorosomes were lyophilized and extracted with chloroform/methanol (1:1, v/v). The extract was further purified using gel filtration and reverse-phase HPLC and the purity of the preparation confirmed by SDS-PAGE. Mass spectrometric analysis showed an m/z of 6154.8, in agreement with the calculated mass...

  13. Institutionnalisation de l'approche Ecosystème et santé humaine en ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Ivoire et dans l'École nationale polytechnique de l'Université de Yaoundé au Cameroun. La coordination sera assurée par la Faculté des Sciences de la santé de l'Université d'Abomey Calavi. Le projet aura un volet formation en salle de classe ...

  14. Contribution à la simulation du mouvement humain en vue d'application en ergonomie

    OpenAIRE

    WANG, X

    2008-01-01

    Ce mémoire constitue une synthèse des travaux de recherche effectués par l' auteur tout d' abord au Laboratoire Ergonomie Santé Confort (LESCO), et puis au Laboratoire de Biomécanique et Mécanique de Chocs (LBMC) de l' Institut National de Recherche sur les Transports et leur Sécurité (INRETS) durant la période janvier 1992 - octobre 2007. La principale source d' inspiration de ces travaux réside dans le domaine spécifique de la simulation ergonomique. Ils portent essentiellement sur l' analy...

  15. Impact de l'exploitation miniere sur la sante humaine : cas de la ...

    African Journals Online (AJOL)

    The liquid and solid wastes as well as the dust from the treatment plant of the phosphorites of Hahotoé-Kpogamé (Southern Togo) pose serious problems of environmental pollution that are source of some diseases like dental fluorosis related to the high content of fluorine in those phosphorites. The analysis of this element ...

  16. Le facteur humain et la sûreté de fonctionnement dans le ...

    African Journals Online (AJOL)

    Elle avait pour objectif la recherche d'un meilleur confort, d'une garantie de continuité de service et de maintien, à moindre coût de la .... à la définition et à la coordination interdisciplinaire, transdisciplinaire et multisectorielle des ... également un outil d'aide à la décision par les choix qu'elle met en évidence ou en exergue.

  17. Human Dimensions in Embedded Virtual Simulation (Les dimensions humaines dans la simulation virtuelle integree)

    Science.gov (United States)

    2009-10-01

    des besoins ; • Gestion de la formation ; • Technologie des interfaces ; et • Apprentissage. Les...FCS et F-35, tous deux ayant expressément nécessité l’inclusion d’une formation intégrée dans leurs projets de conception globale. • La formation des ...pour la recherche et la technologie (RTO) de l’Organisation du Traité de l’Atlantique Nord (OTAN) a organisé et animé un atelier consacré aux

  18. Changements climatiques et santé humaine à Accra, Ghana | IDRC ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    existence et le bien-être de la population ghanéenne. La détérioration du milieu rural contribue sensiblement au flux de migrants qui arrivent chaque jour dans les villes. Ces nouveaux arrivants regroupés dans des bidonvilles dépourvus ...

  19. Capital humain, croissance, équité et réformes structurales dans le ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Groupe d'analyses et politiques économiques de Tunisie (GAPET). La récente transformation politique qui s'est opérée en Tunisie a fourni l'occasion de débattre de grandes questions en matière d'économie et de développement. Voir davantageGroupe d'analyses et politiques économiques de Tunisie (GAPET).

  20. Les flux migratoires et la traite d’êtres humains / Migration and trade in human being

    Directory of Open Access Journals (Sweden)

    Farsédakis Jacques

    2010-03-01

    Full Text Available The article analyses the relationship between the migration and the trade in human beings – it is a global phenomenon which affects both industrial and developing countries – involving people in the process of the soliticing of clients to the places of exploitation ( roadways, homes of prostitution, bar, night clubs, etc.,.Then, the author examines the international, European and national juridical instruments of the repression of the trafficking.Finally, an action-research methodology is proposed in order to prevent the trade in human beings.

  1. Données préliminaires sur le paludisme humain en zones rurale et ...

    African Journals Online (AJOL)

    Objectif : Cette étude évalue les connaissances et les pratiques des populations sur le traitement et la prévention du paludisme et détermine la transmission du paludisme en zones rurale et sémi-urbaine du département du Nkam. Méthodologie et résultats : Un questionnaire a été administré aux populations de Bodiman et ...

  2. Science, technologie, nature et humain ont rendez-vous au jardin

    Directory of Open Access Journals (Sweden)

    Dargent Olivier

    2015-01-01

    Full Text Available Un jardin expérimental est un espace riche en activités pédagogiques pour les élèves. Il recueille, à priori, naturellement, l’adhésion de chacun, élèves, équipe éducative et parents. Il est enfin une occasion d’avoir une approche différente de celle de la classe, les élèves étant confrontés au vivant dans son environnement. Lors de ces activités proposées dans ce contexte, leur rapport au vivant est directement confronté à la réalité. Quels sont les enjeux didactiques d’une pédagogie axée autour d’activités au jardin expérimental ? A partir de deux activités ; un « totem à insectes » et un « nichoir connecté ». La confrontation du vivant et de leur représentation est analysée.

  3. Changements dans l'utilisation des terres et la santé humaine dans ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Le nouveau site Web facilitera l'enregistrement des événements démographiques afin d'améliorer l'accès aux services pour tous. Le nouveau site Web et la nouvelle bibliothèque de ressources aideront à améliorer les systèmes d'information et d'enregistrement des faits d'état civil dans les pays en développement.

  4. Human Factors in the 21st Century(Les facteurs humains au 21th siecle)

    Science.gov (United States)

    2002-05-01

    Applications" document #8), le Prof. CINQUIN a montré comment, dans le cas de l’hospitalisation à domicile et de la surveillance médicale de personnes âgées, il...well-defined tasks, performed automatically with little human intervention or awareness will reside in all levels of modern systems. Tasks that...activities with habitual , well-practiced sequences, a high-workload, error-prone activity (Loukopoulos, Dismukes, & Barshi, in press). This issue will

  5. Aide au développement et santé comme droit humain

    OpenAIRE

    Boidin, Bruno

    2007-01-01

    As health is more and more recognized as a « human right », we can wonder if this tendency leads to an important increase in foreign aid for health. We try to show that aid has been considered for a few years as a big stake for international security. This approach focused on security issues is a very narrow use of the concept of global public goods. As a consequence, infectious disease is the priority of health assistance and other sub-sectors generally considered pro-poor are loosing chare ...

  6. La mondialisation au banc des accusés: La condition humaine et la ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    IIII ) ( Ghazali, 1978 ) et, plus tard, Ibn Taymiyyah ( 1263-1328 ) ( Ibn Taymiyyah, 1966 ) à élaborer des théories pour ce que Iqbal a nommé la « reconstruction de la ...... Lisensky, R.P., Pfnister, A. et Sweet, S.D., 1985, The new liberal learning: technology and the liberal arts, Washington ( États-Unis ), Council of Independent ...

  7. Protection des vies humaines et des moyens de subsistance dans la ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    , mais l'on craint que ces phénomènes deviennent de plus en plus destructeurs au fur et à mesure que l'atmosphère se réchauffera et que le niveau des océans montera sous l'effet des changements climatiques. Lorsque le ...

  8. Lutte intégrée contre les maladies humaines et animales pour les ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    La recherche portera sur deux zones agroécologiques du corridor d'élevage du bétail en Tanzanie, soit les districts de Ngorongoro et ceux de Kibaha et de Kilosa, et sera menée par le Southern African Centre for Infectious Disease Surveillance (SACIDS), un consortium d'établissements scientifiques de l'Afrique australe.

  9. Protection des vies humaines et des moyens de subsistance dans la ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Le cyclone Phailin, qui a frappé l'Inde en 2013, a occasionné d'immenses pertes : en deux jours seulement, 12 millions d'habitants des États côtiers de l'Odisha et de l'Andhra Pradesh ont perdu leur maison et leurs moyens de subsistance. Des chercheurs subventionnés par le CRDI oeuvrent à la protection de la région et ...

  10. Les oméga 3 : de l’alimentation animale à la nutrition humaine

    Directory of Open Access Journals (Sweden)

    Combe Nicole

    2004-01-01

    Full Text Available La dernière édition des Apports nutritionnels conseillés (ANC- éd. 2001 souligne la nécessité d’accroître la consommation d’acide alpha-linolénique (ALA. Celle-ci devrait au minimum doubler et représenter 0,8 % (par rapport à l’énergie totale contre 0,34 % actuellement. Or, l’étude Aquitaine [1] a montré que les lipides d’origine animale contribuaient à près de 75 % de l’apport alimentaire en ALA. Ainsi, parmi les stratégies envisageables pour accroître notre consommation d’ALA, sans changer fondamentalement les habitudes alimentaires des Français, on note un intérêt croissant pour augmenter la teneur en oméga 3 des produits animaux via l’alimentation de ces derniers. Quelques exemples de modification de la composition en acides gras des produits animaux sont exposés. Chez les espèces monogastriques (volaille, porc, le profil des lipides de carcasse est un bon reflet des lipides alimentaires. Ainsi, chez le porc, le niveau d’oméga 3 peut être augmenté d’un facteur 2 à 4, lorsque les animaux reçoivent dans leur alimentation de l’huile de colza, des graines de lin ou de la farine de poissons. En revanche, chez les animaux ruminants, le transfert des acides gras polyinsaturés alimentaires vers les tissus est faible en raison de l’hydrogénation qu’ils subissent dans le rumen. Certaines stratégies qui consistent à protéger ces acides gras de la biohydrogénation permettent néanmoins d’accroître le taux d’ALA dans les tissus et le lait. Ainsi, il apparaît possible d’augmenter la consommation d’oméga 3 de la population, via la consommation de produits issus d’animaux nourris avec des sources d’oméga 3. Cependant, au niveau de la production, ces changements doivent être maîtrisés \\; ils ne peuvent se faire sans un contrôle des qualités d’une part organoleptiques, en raison du degré élevé d’oxydabilité de ces acides gras, d’autre part de texture, en raison de leur caractère « fluide ».

  11. Virtual Institute on Human Behavior Representation (Institut virtuel de representation du comportement humain)

    Science.gov (United States)

    2010-06-01

    should exhibit five critical properties: 1) It should be difficult to change the overall functionality of the software via small, local changes to...2007 Kjeller SLOVAQUIE ESPAGNE Akadémia ozbrojených síl gen. SDG TECEN / DGAM PAYS-BAS M.R. Štefánika, Distribučné a C/ Arturo Soria 289 Royal...Mladoboleslavská 944 Royal Netherlands Military 1000 Ljubljana PO Box 18 Academy Library 197 21 Praha 9 P.O. Box 90.002 SPAIN 4800 PA Breda SDG TECEN / DGAM

  12. Human Systems Integration for Network Centric Warfare (Integration des systemes humains dans les operations reseaux centrees)

    Science.gov (United States)

    2010-02-01

    and perception in the local population in an area of operation in order to see whether opinions are changing to the better or worse for own forces...Requirements (e.g. training needs); • Local effects (e.g. opportunities for social learning). (in order) HV-B3 & F1 - HV-B1 & 5 HV-H HV-B2, F1 UK...ozbrojených síl SDG TECEN / DGAM M.R. Štefánika, Distribučné a C/ Arturo Soria 289 PAYS-BAS informačné stredisko RTO Madrid 28033 Royal

  13. Ressources humaines en matière de santé dans la Chine rurale ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Six world-class research teams to investigate overcoming therapeutic resistance in high fatality cancers. The world-class research teams will direct their focus towards new frontiers in cancer research. View moreSix world-class research teams to investigate overcoming therapeutic resistance in high fatality cancers ...

  14. Changements dans l'utilisation des terres et la santé humaine dans ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Dans l'est de l'Himalaya, l'utilisation des terres change en raison de la croissance démographique, du développement socioéconomique, de l'urbanisation et de ... China, Far East Asia, Nepal, Central Asia, South Asia ... Six world-class research teams to investigate overcoming therapeutic resistance in high fatality cancers.

  15. Collaboration dans les établissements humains spontanés : s ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    5 mars 2018 ... Au Cap, une longue histoire d'apartheid et d'inégalité dans le développement a conduit les formations urbaines de ménages pauvres à se transformer en bidonvilles dans les quartiers défavorisés de la périphérie de la ville. Plus de 8 000 ménages, soit 38 000 habitants, sont touchés par les inondations, ...

  16. Ontologie des écosystèmes, ou des milieux humains ?

    Directory of Open Access Journals (Sweden)

    Augustin Berque

    2010-06-01

    Full Text Available Voilà donc enfin traduit en français cet auteur pourtant célébré en France depuis plus de trente ans comme le père de l’ écologie profonde. Traduit à partir de l’américain, dommage ; mais Ecology, community and lifestyle (Cambridge University Press, 1989 était en quelque sorte la version finale d’un ouvrage initialement paru en 1976 en norvégien, réédité plusieurs fois, puis revu et réécrit en collaboration par Næss lui-même pour l’édition américaine. On y ...

  17. Séroprévalence du virus de l'immunodéficience humaine, des virus ...

    African Journals Online (AJOL)

    Objectifs: Les agents pathogènes transmissibles par transfusion sanguine constituent un problème de santé publique en Afrique subsaharienne. Le but de ... Un choix plus judicieux des ces tests rapides et le recrutement de donneurs de sang bénévoles non rémunérés et leur fidélisation pourraient améliorer la sécurité ...

  18. Séroprévalence du virus de l'immunodéficience humaine, des virus ...

    African Journals Online (AJOL)

    SARAH

    28 févr. 2017 ... Objectifs : Les agents pathogènes transmissibles par transfusion sanguine constituent un problème de santé publique en Afrique subsaharienne. Le but de ... recrutement de donneurs de sang bénévoles non rémunérés et leur fidélisation pourraient améliorer la sécurité transfusionnelle à Koula-Moutou au ...

  19. Pour une herméneutique de l’humaine nature

    OpenAIRE

    Tverdota, Gábor

    2017-01-01

    Nous aussi, nous avons peur que le ciel nous tombe sur la tête. Introduction Curieuse autobiographie que le Croire et le Craindre de Fernand Deligny ! Publiée en 1978, cette œuvre d’une richesse exceptionnelle défie à plus d’un titre les règles de l’art. Au niveau de la forme tout d’abord, car issue non pas d’un monologue intérieur avec un interlocuteur imaginaire, mais d’entretiens et d’une correspondance suivis avec Isaac Joseph, collaborateur pendant plusieurs années de Fernand Deligny. Au...

  20. Fertilisation du maïs (Zea mays L.) à base d'urines humaines ...

    African Journals Online (AJOL)

    maturité, les traitements à l'urine pour 90, 120 et 150 kg N/ha respectivement indiquent une production de biomasse sèche de 12 ... Mots clés : Toilette écologique, urine hygiénisée, fertilisation, biomasse sèche, rendement grain, maïs. Fertilization of the corn ...... and spring barley in organic farming. Skara series B Crops ...

  1. Approche systémique du processus de gestion des ressources humaines

    Directory of Open Access Journals (Sweden)

    Cesar Nieto Licht

    2013-08-01

    Full Text Available Rev.esc.adm.neg Mediante la comprensión de la teoría sistémica, su evolución y sus aplicaciones se plantearán los retos generales y específicos que afrontan actualmente los profesionales de Gestión Humana para diseñar y desarrollar sus procesos de manera sistémica, generando valor para la organización y aportando significativamente al desarrollo de la empresa y de los seres humanos que la conforman. Por lo tanto, este artículo presentará una exploración por las herramientas de la era de la máquina, su impacto en el proceso de pensamiento de los administradores, el significado de la era sistémica y sus aplicaciones e incidencias en el diseño de los procesos. Finalmente, se presentarán los retos específicos que los profesionales de Gestión Humana deben afrontar para intervenir sus procesos bajo un enfoque sistémico.

  2. Obésité humaine et système nerveux sympathique

    Directory of Open Access Journals (Sweden)

    Lafontan Max

    2003-03-01

    Full Text Available The sympathetic nervous system (SNS is an important element of the autonomic nervous system which has an essential role in the maintenance of body homeostasis. SNS activation involves norepinephrine release by noradrenergic fibres and epinephrine secretion by adrenal medulla. SNS controls a number of physiological events including metabolic processes, cardiac and vascular activities, gastrointestinal functions and endocrine secretions. The SNS has a major role in the control of adipose tissue function through a direct effect on adipocytes and adipose tissue vessels, and by an indirect effect on pancreatic hormones secretion. Various alterations of SNS effects on metabolism have been implicated in the development and the maintenance of obesity. This review provides an overview of physiological aspects of the SNS involvement in normal and obese subjects. Physiological and pathological changes in SNS activity are summarized. Modifications occurring in adipose tissue function and fat cell responsiveness to norepinephrine and epinephrine are also considered.

  3. Impact de la fragmentation et de la pression humaine sur la relique ...

    African Journals Online (AJOL)

    Les résultats indiquent également que la relique est devenue un refuge pour les fourmis et que la plupart des espèces y ayant trouvé refuge, s'installent dans la litière. Les résultats de cette étude semblent précieux en ce sens qu'ils mettent en exergue l'importance de la relique pour la conservation de la biodiversité au ...

  4. Partenaire d'affaires en ressources humaines (h/f) | CRDI - Centre ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Plus précisément, le partenaire d'affaires en RH, avec le soutien du coordonnateur des RH et du Centre d'expertise en RH, assure la prestation de solutions stratégiques et opérationnelles dans les domaines suivants : la planification de la relève, l'acquisition de talents, la gestion du rendement et des relations avec les ...

  5. Dieu, tu n'es jamais aussi beau que sur une face humaine

    Directory of Open Access Journals (Sweden)

    Mireille Brémond

    2008-07-01

    Full Text Available Autour de deux figures mythiques incarnant la beauté : Apollon et Narcisse, plusieurs thèmes récurrents dans l’œuvre de Yourcenar s’enchevêtrent. Celui de l’image de soi, étrange, étrangère, voire impossible, que nous renvoient toutes espèces de miroirs, symboles de la relation difficile de soi à soi et aux autres ; celui de la beauté et de l’art, de l’objet d’amour considéré comme œuvre d’art ; celui du statut de l’être aimé, appréhendé à la fois comme œuvre d’art et être divin. Tous ces thèmes s’articulent pour aboutir à l’idée de l’immortalisation par l’art et de la divinisation par l’amour.

  6. KIR haplotypes defined by segregation analysis in 59 Centre d'Etude Polymorphisme Humain (CEPH) families.

    Science.gov (United States)

    Martin, M P; Single, R M; Wilson, M J; Trowsdale, J; Carrington, M

    2008-12-01

    The killer cell immunoglobulin-like receptor (KIR) gene cluster exhibits extensive allelic and haplotypic diversity. Variation at the locus is associated with an increasing number of human diseases, reminiscent of the HLA loci. Characterization of diversity at the KIR locus has progressed over the past several years, particularly since the sequence of entire KIR haplotypes have become available. To determine the extent of KIR haplotypic variability among individuals of northern European descent, we genotyped 59 CEPH families for presence/absence of all KIR genes and performed limited allelic subtyping at several KIR loci. A total of 20 unique haplotypes differing in gene content were identified, the most common of which was the previously defined A haplotype (f = 0.52). Several unusual haplotypes that probably arose as a consequence of unequal crossing over events were also identified. Linkage disequilibrium (LD) analysis indicated strong negative and positive LD between several pairs of genes, values that may be useful in determining haplotypic structure when family data are not available. These data provide a resource to aid in the interpretation of disease association data involving individuals of European descent.

  7. KIR haplotypes defined by segregation analysis in 59 Centre d’Etude Polymorphisme Humain (CEPH) families

    Science.gov (United States)

    Martin, M. P.; Single, R. M.; Wilson, M. J.; Trowsdale, J.

    2012-01-01

    The killer cell immunoglobulin-like receptor (KIR) gene cluster exhibits extensive allelic and haplotypic diversity. Variation at the locus is associated with an increasing number of human diseases, reminiscent of the HLA loci. Characterization of diversity at the KIR locus has progressed over the past several years, particularly since the sequence of entire KIR haplotypes have become available. To determine the extent of KIR haplotypic variability among individuals of northern European descent, we genotyped 59 CEPH families for presence/absence of all KIR genes and performed limited allelic subtyping at several KIR loci. A total of 20 unique haplotypes differing in gene content were identified, the most common of which was the previously defined A haplotype (f=0.52). Several unusual haplotypes that probably arose as a consequence of unequal crossing over events were also identified. Linkage disequilibrium (LD) analysis indicated strong negative and positive LD between several pairs of genes, values that may be useful in determining haplotypic structure when family data are not available. These data provide a resource to aid in the interpretation of disease association data involving individuals of European descent. PMID:18972110

  8. Renforcement de la capacité des ressources humaines dans le ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    -Quelles sont les compétences et les capacités nécessaires pour gérer efficacement le cycle de vie du secteur extractif (exploration, exploitation, gestion, fermeture ... Women in the developing world continue to face obstacles that limit their ability to establish careers and become leaders in the fields of science, technology, ...

  9. L'ordinateur a visage humain (The Computer in Human Guise).

    Science.gov (United States)

    Otman, Gabriel

    1986-01-01

    Discusses the tendency of humans to describe parts and functions of a computer with terminology that refers to human characteristics; for example, parts of the body (electronic brain), intellectual activities (optical memory), and physical activities (command). Computers are also described through metaphors, connotations, allusions, and analogies…

  10. Human Behaviour Representation in Constructive Modelling (Representation du comportement humain dans des modelisations creatives)

    Science.gov (United States)

    2009-09-01

    fashion, etc. A related aspect of a goal-directed task representation (such as Hierarchical Task Analysis, HTA : Annett, 2003; Annett & Duncan, 1967) is...The pandemonium model employs daemons that shriek for attention (a metaphorical prioritisation scheme) although it isn’t necessarily a winner take all...Such phenomena might be better captured with a mixture of HTA and TNO’s pandemonium model, or some other task prioritization scheme, to reflect

  11. Human Behavior Representation in Constructive Simulation (La representation du comportement humain dans la simulation constructive)

    Science.gov (United States)

    2009-09-01

    Attention 4-4 4.3 Models of Perception 4-5 4.3.1 Stimulus Properties 4-5 4.3.2 Physiological Properties 4-6 4.3.3 Psychological Properties 4-7...HPM Human Performance Model/Modeling HQ HeadQuarters HTA Hierarchical Tasks Analysis HUM HUMan Resources and Performance (TTCP) IA Intelligent...Program PAC Personality-based Architecture for Cognition PAM Preparatory Attentional Memory PFC Problem Focused Coping PM Perceptual-Motor

  12. La mondialisation au banc des accusés : La condition humaine et la ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Brillant, profond et tout à fait opportun pour quiconque veut saisir le sens et les implications du phénomène actuel de la mondialisation » — William F. Ryan, S.J. (auteur de Culture, Spirituality, and Economic Development)

  13. Influence de la fertilisation à base des déchets humains recyclés ...

    African Journals Online (AJOL)

    Objectives: The use of municipal solid waste in urban agriculture is a common practice. Recycled human waste made with little or no mineral fertilizers and their effects on crops and soil has however been poorly understood. This work was initiated to evaluate the effects of the combined inputs of recycled human waste and ...

  14. Apprentissage automatique de représentations profondes pour l’analyse du mouvement humain

    OpenAIRE

    Neverova, Natalia

    2016-01-01

    The research goal of this work is to develop learning methods advancing automatic analysis and interpreting of human motion from different perspectives and based on various sources of information, such as images, video, depth, mocap data, audio and inertial sensors. For this purpose, we propose a several deep neural models and associated training algorithms for supervised classification and semi-supervised feature learning, as well as modelling of temporal dependencies, and show their efficie...

  15. Microbiote intestinal et lipides : impact sur la santé humaine

    Directory of Open Access Journals (Sweden)

    Gérard Philippe

    2012-07-01

    Full Text Available The human intestine harbours a complex and diverse bacterial community called the gut microbiota. This microbiota, stable during the lifetime, is specific of each individual despite the existence of a phylogenetic core shared by the majority of adults. The influence of the gut microbiota on host’s physiology has been largely studied using germfree animals and recently it has been proposed that the gut microbiota affects nutrient acquisition, energy regulation and fat storage. Indeed, germfree animals are resistant to diet induced obesity and display low levels of blood and liver lipids. In humans, several grams of lipids reach the colon each day. These lipids have an impact on the gut microbiota composition characterized by an increase of the Firmicutes/ Bacteroides ratio. Concurrently, the gut microbiota is able to convert lipids, including fatty acids or cholesterol, leading to the production of metabolites with potential health effects.

  16. TIC pour un accès équitable aux ressources humaines en sante en ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Bamako, 2000) plusieurs initiatives d'utilisation des TIC ont vu le jour au Mali tel que le projet de télémédecine du Réseau informatique malien d'information et de communication médicale (REIMICOM) et le projet de téléradiologie IKON.

  17. Human Consequences of Agile Aircraft (Facteurs humains lies au pilotage des avions de combat tres manoeuvrants)

    Science.gov (United States)

    2001-05-01

    Ecologia . - 1995. No 5. - P. 2-7. 20. Palets B.L., Tikhonov M.A., Popov A.A., Arkhangelsky D.Yu., Palets L.D., Bondarenko R.A. Theoretical Analysis of... Ecologia . - 1995. - No 3. - P. 30-34. 46. Chernyakov I.N., Shishov A.A. Maintenance of Vitality and Performance in Pilots by Means of Oxygen Complex in...Emergency Depressurization of the Cabin // Meditsina Truda i Promyshlennaya Ecologia . - 1995. - No 3. - P. 30- 34. 47. Chernyakov I.N., Shishov A.A

  18. Intérêt nutritionnel de l'oeuf en alimentation humaine

    OpenAIRE

    Nau, Francoise; Nys, Yves; Yamakawa, Y.; Rehault-Godbert, Sophie

    2010-01-01

    L’œuf est une source très digestible de protéines et de lipides qui contient par ailleurs une part importante des vitamines et minéraux nécessaires à l’Homme. La composition en acides aminés, équilibrée par rapport aux besoins de l’Homme, fait de l’œuf l’une des meilleures sources protéiques et les lipides de l’œuf fournissent des quantités importantes d’acides gras insaturés et de phospholipides. Les constituants majeurs de l’œuf sont relativement stables ; ils dépendent essentiellement de l...

  19. Ionizing radiation, human carcinogenesis and radioresistance; Rayonnements, cancerisation humaine et radioresistance

    Energy Technology Data Exchange (ETDEWEB)

    Vuillaume, M.; Queinnec, E. [Ecole Normale Superieure, Paris (France)

    1992-07-01

    H{sub 2}O{sub 2} and free radicals are correlated with inflammatory diseases, cellular transformation and carcinogenesis. Experiments studying their direct or indirect influence in vivo, and/or, in cell cultures were still positive. In the contrary, reactions or products, which decrease level(s) of free radicals/H{sub 2}O{sub 2} (i) directly, (ii) indirectly by an increase of SOD, catalase and peroxydase activities zeroed the above described phenomena. It is the case of the domain number 2 (that contains copper) of the Scorpion's blood pigment (hemocyanin), (i) which possesses SOD-, catalase-and peroxyde-like properties, resistant, at least, at 4000Gy, furthermore explaining the especially high radioresistance of scorpions. (author)

  20. Impact of the human activities on the climate; Impact des activites humaines sur le climat

    Energy Technology Data Exchange (ETDEWEB)

    Deque, M

    2007-07-01

    In the framework of the A2 scenario of the GIEC, the possible impacts on the french climate, of the human activities are examined. It seems that the human activities imposed and will be able to impose a faster change of the climate than the natural changes. For the hundred coming years the main characteristics could be: an increase of the temperature, an increase of the rains in winter and a decrease in summer, a decrease of the water in soils expected in freezing areas and an increase of the drought periods. (A.L.B.)

  1. Données préliminaires sur le paludisme humain en zones rurale et ...

    African Journals Online (AJOL)

    SARAH

    31 juil. 2017 ... RESUME. Objectif : Cette étude évalue les connaissances et les pratiques des populations sur le traitement et la prévention du paludisme et détermine la transmission du paludisme en zones rurale et sémi-urbaine du département du Nkam. Méthodologie et résultats : Un questionnaire a été administré aux ...

  2. Institutionnalisation de l'approche Ecosystème et santé humaine en ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Ouest et du Centre. Depuis une dizaine d'années, un groupe d'enseignants et de ... Financement de la recherche en Afrique : cas du Centre Suisse de Recherche Scientifique en Côte d'Ivoire. Téléchargez le PDF. Études. Point de la deuxième ...

  3. A New Harness For Use with Exercise Countermeasures-Validation of Improved Comfort and Loading with the Center for Space Medicine (CSM) Harness

    Data.gov (United States)

    National Aeronautics and Space Administration — The on-orbit treadmill harness Station Development Test Objective (SDTO) evaluation ran from Increment 21 through 25 aboard the International Space Station...

  4. Improved read disturb and write error rates in voltage-control spintronics memory (VoCSM) by controlling energy barrier height

    Science.gov (United States)

    Inokuchi, T.; Yoda, H.; Kato, Y.; Shimizu, M.; Shirotori, S.; Shimomura, N.; Koi, K.; Kamiguchi, Y.; Sugiyama, H.; Oikawa, S.; Ikegami, K.; Ishikawa, M.; Altansargai, B.; Tiwari, A.; Ohsawa, Y.; Saito, Y.; Kurobe, A.

    2017-06-01

    A hybrid writing scheme that combines the spin Hall effect and voltage-controlled magnetic-anisotropy effect is investigated in Ta/CoFeB/MgO/CoFeB/Ru/CoFe/IrMn junctions. The write current and control voltage are applied to Ta and CoFeB/MgO/CoFeB junctions, respectively. The critical current density required for switching the magnetization in CoFeB was modulated 3.6-fold by changing the control voltage from -1.0 V to +1.0 V. This modulation of the write current density is explained by the change in the surface anisotropy of the free layer from 1.7 mJ/m2 to 1.6 mJ/m2, which is caused by the electric field applied to the junction. The read disturb rate and write error rate, which are important performance parameters for memory applications, are drastically improved, and no error was detected in 5 × 108 cycles by controlling read and write sequences.

  5. mxCSM: A 100-slit, 6-wavelength wide-field coronal spectropolarimeter for the study of the dynamics and the magnetic fields of the solar corona

    Directory of Open Access Journals (Sweden)

    Haosheng eLin

    2016-03-01

    Full Text Available remendous progress has been made in the field of observational coronal magnetometry in the first decade of the 21st century. With the successful construction of the Coronal Multichannel Magnetometer (CoMP instrument, observations of the linear polarization of the coronal emission lines (CELs, which carry information about the azimuthal direction of the coronal magnetic fields, are now routinely available. However, reliable and regular measurements of the circular polarization signals of the CELs remain illusive. The CEL circular polarization signals allow us to infer the magnetic field strength in the corona, and is critically important {bf of} our understanding of the solar corona. Current telescopes and instrument can only measure the coronal magnetic field strength over a small field of view. Furthermore, the observations require very long integration time that preclude the study of dynamic events even when only a small field of view is required. This paper describes a new instrument concept that employees large-scale multiplexing technology to enhance the efficiency of current coronal spectropolarimeter by more than two orders of magnitude. This will allow for the instrument to increase of the integration time at each spatial location by the same factor, while also achieving a large field of view coverage. We will present the conceptual design of a 100-slit coronal spectropolarimeter that can observe six coronal emission lines simultaneously. Instruments based on this concept will allow us to study the evolution of the coronal magnetic field even with coronagraphs with modest aperture.

  6. Human Development report 2007/2008 - Fighting climate change: human solidarity in a divided world; Rapport mondial sur le developpement humain 2007 / 2008 - La lutte contre le changement climatique: un imperatif de solidarite humaine dans un monde divise

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    2007-07-01

    Climate change is the defining human development challenge of the 21. Century. Failure to respond to that challenge will stall and then reverse international efforts to reduce poverty. The poorest countries and most vulnerable citizens will suffer the earliest and most damaging setbacks, even though they have contributed least to the problem. Looking to the future, no country - however wealthy or powerful - will be immune to the impact of global warming. The Human Development Report 2007/2008 shows that climate change is not just a future scenario. Increased exposure to droughts, floods and storms is already destroying opportunity and reinforcing inequality. Meanwhile, there is now overwhelming scientific evidence that the world is moving towards the point at which irreversible ecological catastrophe becomes unavoidable. Business-as-usual climate change points in a clear direction: unprecedented reversal in human development in our lifetime, and acute risks for our children and their grandchildren. There is a window of opportunity for avoiding the most damaging climate change impacts, but that window is closing: the world has less than a decade to change course. Actions taken - or not taken - in the years ahead will have a profound bearing on the future course of human development. The world lacks neither the financial resources nor the technological capabilities to act. What is missing is a sense of urgency, human solidarity and collective interest. As the Human Development Report 2007/2008 argues, climate change poses challenges at many levels. In a divided but ecologically interdependent world, it challenges all people to reflect upon how we manage the environment of the one thing that we share in common: planet Earth. It challenges us to reflect on social justice and human rights across countries and generations. It challenges political leaders and people in rich nations to acknowledge their historic responsibility for the problem, and to initiate deep and early cuts in greenhouse gas emissions. Above all, it challenges the entire human community to undertake prompt and strong collective action based on shared values and a shared vision.

  7. Simulation de mouvement humain sur postes de travail pour le diagnostic et l'aide à la conception

    OpenAIRE

    Hue , Valentin

    2008-01-01

    The works presented in this memory concern the automatic generation of postures and human movements on industrial workstation. The aim is to animate in a realistic way a numerical mannequin in order to simulate an operator in the execution of his task. This animation must make it possible to contribute to the analysis of the biomechanical factors which can engender musculo-skeletal disorders. At rst, choices of modelling are proposed according to this speci c context. The model selected is ba...

  8. Réseau sur le développement humain et la capacité - phase III ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Cette approche déplace les frontières de l'économique en proposant que de nombreux jugements de valeur en économique tiennent compte des pratiques de démocratie participative et qu'en matière de développement, les citoyens soient tout autant des agents que des participants. Deux premières phases du projet de ...

  9. INCOMMANDS TDP: Human Factors Design and Evaluation Guide (PDT INCOMMANDS: Guide de Conception et d’Evaluation des Facteurs Humains)

    Science.gov (United States)

    2009-12-01

    Support, ou Système novateur d’aide à la décision pour la gestion du combat naval) vise à étudier, à démontrer et à évaluer de nouveaux concepts d’aide...guideront et façonneront l’élaboration des concepts d’IOM et d’aide à la décision arrêtés dans le cadre du projet INCOMMANDS de sorte qu’ils...commandement élaborés par l’équipe du projet . Ce document vise à étayer et à orienter la conception et l’élaboration du système de soutien électronique

  10. Les Comités mixtes de sécurité humaine (CMSH) au Burundi : un ...

    African Journals Online (AJOL)

    La fin de plus de 10 ans de guerre civile a donc abouti à la mise en place d'une police nationale inclusive, intégrée et unie, .... En effet, au cours de la guerre civile, le gouvernement avait érigé une structure ..... Enfin, dans « guharanira amajambere », il y a l'idée de combat, de dépenser la dernière énergie pour le progrès.

  11. Utilisation de modèles inspirés de l'humain pour guider la locomotion des robots

    OpenAIRE

    Vassallo , Christian

    2016-01-01

    This thesis has been done within the framework of the European Project Koroibot which aims at developing advanced algorithms to improve the humanoid robots locomotion. It is organized in three parts. With the aim of steering robots in a safe and efficient manner among humans it is required to understand the rules, principles and strategies of human during locomotion and transfer them to robots. The goal of this thesis is to investigate and identify the human locomotion strategies and create a...

  12. UTILISATION DES MODÈLES INSPIRÉS DE L'HUMAIN POUR LE GUIDAGE DE LA LOCOMOTION DE ROBOTS

    OpenAIRE

    Vassallo, Christian

    2016-01-01

    This thesis has been done within the framework of the European Project Koroibot which aims at developing advanced algorithms to improve the humanoid robots locomotion. It is organized in three parts. With the aim of steering robots in a safe and efficient manner among humans it is required to understand the rules, principles and strategies of human during locomotion and transfer them to robots. The goal of this thesis is to investigate and identify the human locomotion strategies and create a...

  13. The Human Effects of Non-Lethal Technologies (Impacts humain des technologies non letales) (CD-ROM)

    National Research Council Canada - National Science Library

    2006-01-01

    .... In response to NATO RTO tasking, based on the recommendations of the 2000 Defence Capabilities Initiative, to support preparations for a NATO NLW capability, the Human Factors and Medicine Panel (HFM...

  14. Les répercussions de la santé animale sur la santé humaine | CRDI ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    9 déc. 2010 ... À l'inverse, si la grippe aviaire frappait demain et éliminait toutes les volailles, cela aurait de profondes conséquences car la volaille et le poisson sont des sources essentielles de protéines animales. Retombées économiques. Les enjeux économiques sont aussi au premier plan. Le Dr Stephen fait ...

  15. Télétravail : Les enjeux de la déspatialisation pour le management humain

    OpenAIRE

    Taskin, Laurent

    2006-01-01

    En rompant avec une certaine unité de temps, de lieu et d’action, le télétravail bouleverse l’organisation du travail et l’exercice traditionnel des pratiques de management. La déspatialisation, qui renvoie à la distance physique et psychosociologique induite par la pratique du télétravail, constitue l’enjeu central de cette re-régulation nécessaire qui altère fondamentalement la structure du travail et de la supervision. Au cœur de celle-ci, la question du contrôle semble être la dimension l...

  16. Education, capital humain et dynamique économique : analyse à partir du secteur industriel sénégalais

    OpenAIRE

    Dia, Abdoul Alpha

    2005-01-01

    05090; The objective of this work is to analyze the relations between education, human capital and the industrial performances in Senegal. The approached questions are different and varied, and more particularly, they relate to the investment of industrial concerns in the human resources (levels of qualification of the workforce, training policies), at the various levels of efficiency (internal and external) of the educational system, in the adequacy training / employment, etc. The impact of ...

  17. Télétravail : Les enjeux de la déspatialisation pour le management humain

    Directory of Open Access Journals (Sweden)

    Laurent Taskin

    2006-07-01

    Full Text Available En rompant avec une certaine unité de temps, de lieu et d’action, le télétravail bouleverse l’organisation du travail et l’exercice traditionnel des pratiques de management. La déspatialisation, qui renvoie à la distance physique et psychosociologique induite par la pratique du télétravail, constitue l’enjeu central de cette re-régulation nécessaire qui altère fondamentalement la structure du travail et de la supervision. Au cœur de celle-ci, la question du contrôle semble être la dimension la plus critique pour le management. Cette contribution montre comment le contrôle et l’autonomie, qui sont des forces complémentaires en tension au sein des organisations, sont appelés à être reconfigurés dans le cadre du télétravail ; et comment cette nécessaire re-régulation affecte directement la relation managériale, la socialisation organisationnelle et la gestion des carrières.Telework transforms the traditional office space, its management and routines, by exploding the spatio-temporal framework of work. Despatialization, which refers to the geographical and psycho sociological distance consecutive to telework practice, constitutes the major stake of the necessary re-regulation of work in terms of supervision and structure. In tfis context, the control issue represents the most critical dimension for management. This contribution shows how control and autonomy, which are complementary but tightened forces operating inside organizations, have to be re-cast when developing telework; and how this re-regulation affects directly the managerial relationship, organizational socialization, and career management.

  18. Productivité du travail, capital humain et écart technologique dans les industries manufacturières marocaines

    OpenAIRE

    bouoiyour, jamal

    2006-01-01

    We estimated the interaction between economic openness, foreign presence and productivity of work in the case of Moroccan manufacturing industries. Econometric estimates in panel data show that skilled labor, export capacity and the foreign presence exert a positive and significant impact on the apparent labor productivity of Moroccan firms. However, the relationship between foreign presence and productivity depends on the absorptive capacity of Moroccan firms and the technology gap betwe...

  19. Caractérisation Structurale des Kinase Humaines par le Criblage de Bibliothèque des Constructions

    OpenAIRE

    Yumerefendi, Hayretin

    2009-01-01

    Structural characterization of proteins is often hindered by insufficient amounts of soluble protein. A common approach is to isolate its separate domains, classically done by time-consuming iterations of design, generation and testing of constructs. An alternative approach is to generate a random library of all possible constructs by enzymatic DNA truncation and test them in one experiment for expression and solubility. In this work, the novel, directed evolution-type method Expression of So...

  20. Portable energy: autonomy and integration in the human environment; Energie portable: autonomie et integration dans l'environnement humain

    Energy Technology Data Exchange (ETDEWEB)

    Multon, F.; Delamarche, P. [Rennes-2 Universite, Lab. de Physiologie et de Biomecanique de l& #x27; Exercice Mulsculaire, UMR. APS, 35 (France); Lucchese, P. [CEA Fontenay-aux-Roses, Dir. de la Recherche Technologique, Hydrogene et Pile a Combustible, 92 (France)] [and others

    2002-07-01

    This colloquium was motivated by the possibility to recover in our environment the energy produced by our movements, but also the heat emitted and the radiations received by the human body in order to supply the energy needs of portable electronic devices (telephones, micro-computers, watches, prostheses etc..). It tries to answer the different problems raised by the implementation of portable energy sources: the energy resources in the human environment, the physical and technological processes of energy production and storage, the electronic energy conversion and remote transmission means, the intelligent energy management, and the existing and potential applications of these processes. This document brings together 16 communications presented by searchers from various domains (biology, medicine, electrochemistry, computer science, mechanics, thermodynamics, electronics etc..) on the following topics: energy in the human body, possibilities of miniaturization of fuel cells, thermo-mechanical micro-generators, thermoelectric generation, solar cells and autonomy, micro-chargeable batteries, double-layer super-capacitors (principles and electrical behaviour), renewable energies in watches, electro-mechanical devices for the exploitation of human movements energy, trans-dermal power supply, new mechanical-aided systems for blood circulation, problems and their solutions related to portable telephones, low voltage and high efficiency power electronic systems for portable applications, remote energy transmission, intelligent energy management (equipments and softwares), electromagnetic environments and health. (J.S.)

  1. Le souci du public et des ressources humaines. Les producteurs de la relation au public dans le secteur culturel

    OpenAIRE

    Kletz, Frédéric; Lenay, Olivier

    2012-01-01

    A l’instar de nombreux champs de l’action publique, le secteur culturel est aujourd’hui soumis à l’impératif de mieux répondre aux attentes du public, voire d’en susciter de nouvelles. Face à l’ampleur de l’injonction, les pratiques d’innovations locales ne suffisent plus et il importe de concevoir une véritable politique des publics. Nous allons voir que cette tâche semble aujourd’hui facilitée par une nouvelle dynamique de GRH qui, grâce à un référentiel des emplois et des compétences, pour...

  2. Diversité floristique et infiltration humaine de la forêt classée de la ...

    African Journals Online (AJOL)

    Les familles les plus abondantes sont Fabaceae, les Rubiaceae, les Euphorbiaceae, les Moraceae, les Malvaceae, les Meliaceae, les Moraceae, les Annonaceae, les Sapindaceae et les Poaceae. Parmi ces espèces, 79 % sont des phanérophytes et 3 % des hémicryptophytes. Conclusion: Malheureusement, cette forêt est ...

  3. Enquête entomologique dans le foyer historique de trypanosomose humaine africaine de Bendjé (Gabon

    Directory of Open Access Journals (Sweden)

    Kohagne Tongué L.

    2011-11-01

    Full Text Available La situation de la maladie du sommeil est très peu connue au Gabon. De nombreux foyers historiques n’ont pas été prospectés depuis plus de 15 ans. Le foyer historique de Bendjé fournit régulièrement quelques cas, dépistés passivement, qui concernent le plus souvent des pêcheurs dont il est a priori difficile de déterminer le lieu probable de contamination du fait de leur grande mobilité au cours de leurs activités. La présence des hommes infectés dans ce foyer historique pourrait favoriser son réveil s’il existe un contact étroit entre les différents éléments potentiellement présents du cycle épidémiologique (homme, vecteur, trypanosome. Afin de vérifier l’existence éventuelle d’un risque trypanosomien dans ce foyer, nous y avons mené une enquête entomologique. Des pièges ont été posés dans des biotopes fréquentés par l’homme et laissés en place pendant quatre jours. Trois espèces de glossines (Glossina palpalis palpalis, G. pallicera newsteadi et G. caliginea ont été capturées et deux espèces de trypanosomes (Trypanosoma vivax et T. brucei s.l. identifiées par PCR. Ces résultats suggèrent l’existence d’un cycle de transmission animal. Le contact entre les hommes et les glossines est particulièrement étroit dans tous les types de site prospectés, à l’exception de la mangrove.

  4. Chaire en écosanté sur la santé des humains et des animaux dans ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Canada-Latin America and Caribbean Zika Virus Research Program. A new funding opportunity on Zika virus is responding to the virus outbreak and the health threat it represents for the affected populations in the hardest hit countries in Latin America and the... View moreCanada-Latin America and Caribbean Zika Virus ...

  5. Bourses Écosystèmes et santé humaine pour les cycles supérieurs ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Le montant de chaque bourse sera de 15 000 CAD pour la recherche sur le terrain et jusqu'à 4 000 CAD pour participer à une conférence afin de diffuser les résultats des recherches ou pour retourner sur le terrain afin de présenter ses constatations aux parties prenantes locales. En outre, les boursiers participeront à une ...

  6. Utilisation des déchets humains recyclés pour l'augmentation de la ...

    African Journals Online (AJOL)

    (30 et 50 t.ha-1) ont créé de meilleures conditions de croissance et de nutrition pour les cultures, augmentant ainsi le rendement du maïs par rapport aux fertilisants inorganiques. Le rapport valeur sur cout (RVC) diminue cependant avec la dose appliquée et les doses de 1, 10, 20 et 30 t.ha-1 ont donné de RVC supérieurs ...

  7. Spécialiste de la paie et des systèmes des ressources humaines (h/f ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Résumé des fonctions Le spécialiste de la paie et des systèmes RH, est chargé de la paie et veille à l'intégrité et à l'exactitude des systèmes de paie ainsi qu'à la conformité aux divers organismes de réglementation. Le titulaire coordonne la mise en œuvre et le fonctionnement du Système intégré de gestion des ...

  8. Intégration et exploitation des arrières effets des fèces humaines ...

    African Journals Online (AJOL)

    English Title: Integration and exploitation of back effects of the human faeces to improve chemical fertility of soil and production of maize (Zea mays L.) in Lubumbashi (D.R. Congo). English Abstract. Objective: This study was carried out during two agricultural surveys to evaluate the direct effects and back effects of human ...

  9. GENOMIQUE ET NUTRITION HUMAINE Biodisponibilité des acides gras et apports nutritionnels conseillés

    Directory of Open Access Journals (Sweden)

    Combe Nicole

    2002-03-01

    Full Text Available Les recommandations en terme d’apports en lipides évoluent en même temps que la connaissance de leurs effets sur la santé. La troisième édition des apports nutritionnels conseillés (ANC, pour la population française, a été publiée en 2001. L’examen de l’état des lieux, au travers de diverses données récentes d’enquêtes alimentaires, permet de souligner les écarts importants par rapport aux ANC. Il y a lieu de diminuer la consommation d’acides gras saturés [de 18 à 8% de l’apport énergétique total quotidien (AETQ] et d’augmenter celle des acides gras monoinsaturés (de 15 à 20%. Il ressort également que l’apport en 18:3 n-3 est insuffisant (0,3% au lieu de 0,8% AETQ recommandé. Les stratégies à envisager pour optimiser l’apport en acides gras polyinsaturés doivent prendre en compte un certain nombre de critères, dont celui de leur biodisponibilité. Il est rappelé que la biodisponibilité d’un acide gras ne dépend pas uniquement de sa teneur au sein des triglycérides ingérés mais également de sa répartition entre les positions interne (sn2 et externes (sn1 + sn3 du squelette glycérol. À partir de corps gras « structurés » ou « inter-estérifiés », des études ont montré que l’athérogénicité de l’acide palmitique est plus importante lorsqu’il est situé en position sn2 des triglycérides alimentaires. C’est en effet cette position qui, d’une part, lui assure le coefficient d’absorption intestinale maximum et, d’autre part lui permet de se maintenir à cette même position dans les lipides plasmatiques, ce qui contribuerait à augmenter son pouvoir athérogène. S’agissant des acides gras insaturés, la biodisponibilité de l’acide linoléique comme précurseur d’acides gras essentiels serait corrélée à ses proportions en sn2 dans les triglycérides; celle des acides gras polyinsaturés à longue chaîne est fonction de leur digestibilité qui est médiocre lorsqu’ils sont situés en positions sn1 et sn3, comparativement à la position sn2. Dans le cas de l’acide alpha-linolénique, dont le métabolisme oxydatif in vivo est très rapide, c’est son maintien en position interne des triglycérides plasmatiques qui pourrait lui assurer la protection contre une dégradation oxydative précoce, préjudiciable à sa fonction de précurseur d’acides gras essentiels. Sur cette base sont évoquées les capacités de l’huile de colza supérieures à celles de l’huile de soja, avec le maintien sur la position sn2 des triglycérides lymphatiques de proportions plus élevées en acide alpha-linolénique.

  10. La catastrophe nucléaire de Tchernobyl entre erreurs humaines et défauts techniques

    CERN Document Server

    Perrineau, Aude

    2015-01-01

    Découvrez enfin tout ce qu'il faut savoir sur la catastrophe nucléaire de Tchernobyl en moins d'une heure ! Le 26 avril 1986 à 1 h 23, une catastrophe d'un nouveau genre ébranle le monde : un réacteur de la centrale nucléaire de Tchernobyl explose. Alors que les autorités soviétiques camouflent l'accident, puis en minimisent l'importance, un nuage radioactif se forme et se propage sur toute l'Europe…Ce livre vous permettra d'en savoir plus sur : Le contexte de l'époque Les acteurs majeurs qui ont participé à l'événement La catastrophe nucléaire de Tchernobyl Les répercussions du drameLe mot

  11. Impact du régime alimentaire sur la dynamique structurale et fonctionnelle du microbiote intestinal humain

    OpenAIRE

    Tap, Julien

    2009-01-01

    Nutritionnistes et gastroentérologues s'accordent pour admettre que le microbiote intestinal conditionne de nombreuses fonctions de l'hôte et joue un rôle important dans le bien-être digestif. Comprendre comment notre régime alimentaire modifie la structure et les fonctions du microbiote intestinal est essentiel afin de connaître en retour son impact sur notre santé.Le consortium d'espèces du microbiote intestinal de l'Homme adulte apparaît spécifique de l'individu. Ceci constitue un paradoxe...

  12. Effet de différentes doses de bouse de vache, d'urine humaine et de ...

    African Journals Online (AJOL)

    Méthodologie et résultats: Des plants d'ananas de trois mois de la variété "pain de sucre " ont été soumis, tous les trois mois jusqu'à la maturité physiologique, ... Toutefois, une étude approfondie de l'effet de ces fertilisants organiques sur la qualité nutritionnelle de l'ananas et de la rentabilité économique de l'utilisation de ...

  13. Pourquoi entrer a l'Universite? L'Exemple d'une universite de lettres et sciences humaines

    Science.gov (United States)

    Canals, Valérie; Diebolt, Claude

    2001-11-01

    The large number of secondary school graduates entering higher education is transforming the nature of universities, particularly in literature and the humanities, by changing the relative numbers of students enrolled in different academic years. At the same time this influx is accompanied by a significant failure rate in the first academic year, calling into question the efficacy of the university system. A national issue with local repercussions, the struggle against failure in the first year is leading to much heart-searching among the universities, whose staff are trying hard to understand why certain students abandon their studies. The enquiry described in this article reveals the co-existence of two student populations: those who enter university as an active choice and those who do so by default. In the case of the first group, entry to university represents an investment for the future which must be carefully managed. In the second case it is a matter of going into higher education as a faute de mieux solution in an economic context in which work is scarce.

  14. The precaution principle in the human affairs management; Le principe de precaution dans la conduite des affaires humaines

    Energy Technology Data Exchange (ETDEWEB)

    Godard, O. [Centre National de la Recherche Scientifique (CNRS), 75 - Paris (France); Bourdeaux, I. [Centre de recherche sur le politique, l`administration et le territoire (CERAT), Unite de recherche associee au CNRS 978, Institut d`etudes politiques de Grenoble, 38 (France); Dab, W. [Ecole nationale de la sante publique (ENSP) (France)]|[Electricite de France (EDF), 75 - Paris (France); Ewald, F. [Centre National de la Recherche Scientifique (CNRS), 75 - Paris (France)]|[FFSA, Federation francaise des societes d`assurances (France); Fabiani, J.L. [Ecole des hautes etudes en sciences sociales (EHESS) (France); Gilbert, C. [Centre National de la Recherche Scientifique (CNRS), 75 - Paris (France); Hermitte, M.A. [Centre National de la Recherche Scientifique (CNRS), 75 - Paris (France)]|[Paris-1 Univ., 75 (France); Hourcade, J.Ch. [Centre National de la Recherche Scientifique (CNRS), 75 - Paris (France); Huber, G. [Association Descartes (France); Laverie, M. [Institut National de l`Environnement Industriel et des Risques (INERIS) (France); Martin, G.J. [Nice Univ., 06 (France); Megie, G. [Paris-6 Universite Pierre et Marie Curie, 75 (France)]|[Institut Pierre-Simon Laplace, 75 - Paris (France); Pelegrin, J. [Academie des Sciences (France); Reveret, J.P. [Montreal Univ., PQ (Canada); Weber, J. [CIRAD, Centre de cooperation internationale en recherche agronomique pour le developpement (France); Wynne, B. [Lancaster Univ. (United Kingdom)

    1997-12-31

    The precaution principle is applied in the example of The nuclear facilities in the United Kingdom, Windscale reactor and the Sellafield reprocessing plant. In the first case, an interpretation mistake in the behaviour of sediments in Irish Sea leads to a pollution by plutonium 239, and finally the admissible contamination of sediments became a possible ingestion of plutonium in atmosphere because of transport of this radioisotope from the sediments to the surface waters and then to atmosphere with this possibility of ingestion by man and ingestion is a more severe pollution than contamination. The second example is the difference of behaviour of Cesium 137 in front of acid soils or clayey soils, difference that the researchers did not see in United Kingdom around Sellafield plant but the Chernobyl accident brought to the fore this difference of behaviour. These examples proved if it was needed that scientific knowledge is uncomplete and consequently the precaution principle is highly required. Furthermore, the cases of the blood transfusion and the Aids virus, the impact on health of power lines and the ozone layer are also reviewed to enlight this precaution principle. (N.C.)

  15. Operator Functional State Assessment (L’evaluation de l’aptitude operationnelle de l’operateur humain)

    Science.gov (United States)

    2004-02-01

    organise workshops, symposia, field trials, lecture series and training courses. An important function of these Technical Teams is to ensure the...the Baroreflex Loop 4-8 Figure 10 Circadian Rhythm of Core Temperature 4-17 Figure 11 Temperature Distribution of the Human Body in Cold (A; 20°C...electronics and computer technology can address these problems to some extent. Given the high workload of many operators, any additional training effort, or

  16. Une architecture de sélection de l'action pour des humains virtuels autonomes dans des mondes persistants

    OpenAIRE

    De Sevin , Etienne

    2006-01-01

    Nowadays, virtual humans such as non-player characters in computer games need to have a strong autonomy in order to live their own life in persistent virtual worlds. When designing autonomous virtual humans, the action selection problem needs to be considered, as it is responsible for decision making at each moment in time. Indeed action selection architectures for autonomous virtual humans need to be reactive, proactive, motivational, and emotional to obtain a high degree of autonomy and ind...

  17. Rites et Condition Humaine : Leçon sur les leçons des pères

    African Journals Online (AJOL)

    uns des secrets qui le rendent, encore une fois, plus que jamais forts. Question de méthode. Nous précisons, enfin, que ce travail est rendu possible grâce à la lecture d'ouvrages portant sur les thèmes du rite, de l'initiation, du corps et de la mort.

  18. Molecular contacts for chlorosome envelope proteins revealed by cross-linking studies with chlorosomes from Chlorobium tepidum

    DEFF Research Database (Denmark)

    Li, Hui; Frigaard, Niels-Ulrik; Bryant, Donald A

    2006-01-01

    in appropriate mutants. Confirming the location of CsmA in the paracrystalline baseplate, cross-linking showed that CsmA forms dimers, trimers, and homomultimers as large as dodecamers and that CsmA directly interacts with the Fenna-Matthews-Olson protein. Cross-linking further suggests that the precursor form...... of CsmA is inserted near the edges of the baseplate, where CsmA and pre-CsmA interact with CsmB and CsmF. Several chlorosome proteins, including CsmA, CsmC, CsmD, CsmH, CsmI, CsmJ, and CsmX, were shown to exist as homomultimers in the chlorosome envelope. On the basis of the structural information...

  19. Une tumeur exceptionnelle du doigt: la tumeur fibreuse solitaire

    Directory of Open Access Journals (Sweden)

    Taoufiq Harmouch

    2011-12-01

    Full Text Available La tumeur Fibreuse solitaire (TFS est une proliferation fusocellulaire rare, souvent de localisation intrathoracique. Nous rapportons le cas d�une localisation exceptionnelle au niveau du 3eme doigt de la main droite. En l�absence de marqueur specifique l�interpretation de l�immunomarquage depend du contexte histomorphologique. La similitude avec les differents neoplasmes a cellules fusiformes des tissus mous rend le diagnostic de ces tumeurs mesenchymateuses difficile et tardif. Dans 20a 30 % des cas le comportement de la TFS est celui d�une tumeur maligne localement agressive et recidivante, avec des metastases rares et tardives. Ce comportement impose une surveillance prolongee apres exerese chirurgicale.

  20. Les impacts humains des changements organisationnels autour des TIC Human impacts of organizational changes based on ITC Impactos humanos de los cambios organizacionales en torno a los TIC

    Directory of Open Access Journals (Sweden)

    Robert Picard

    2007-10-01

    Full Text Available La taille des systèmes mis en place dans les grandes organisations, leur caractère exogène par rapport aux pratiques de l’entreprise (progiciels de gestion intégrés, posent des défis relativement nouveaux, difficiles à relever pour les acteurs. En effet, les métiers des informaticiens comme ceux des utilisateurs en sont le plus souvent profondément affectés.Les informaticiens doivent réviser leur mode d’action, révision qui s’accompagne d’une moindre autonomie, d’exigences de coopération plus élevées, et d’une multidisciplinarité à laquelle ils n’ont pas nécessairement été préparés.Les professionnels utilisateurs peuvent perdre des repères professionnels historiques, changement accompagné d’une révision des pratiques, de la modification des structures et de l’environnement de travail. Ils doivent parfois acquérir de nouvelles qualifications, de façon coûteuse, et certains peuvent perdre leur travail.Ces problématiques seront illustrées par deux situations concrètes très récentes, observées dans un grand groupe de service, pour chacune des populations.Many organizational changes are related to (or initiated by the introduction of information and communication technology (ICT tools.The size of the systems implemented in large organizations, their external nature vis-à-vis the company’s practices (Enterprise Resource Planning are rather new challenges, which are difficult for the actors to tackle. In fact, the jobs of data processing people as well as of professional users are often the most affected.Data processing people must revise their way of doing things, a change that is accompanied by a loss of autonomy and greater demands for cooperation and multidisciplinarity that they are not necessarily prepared for.Professional users may lose some historical guidelines, a change that is accompanied by a review of their practices, organizational changes, and changes in the work environment. They must sometimes develop new capacities, which may be costly for them, and some may even lose their jobs.These questions will be illustrated in two actual recent situations observed in a major service provider, for each of the populations.Numerosos cambios organizacionales están asociados a (o provocados por la introducción de herramientas tecnológicas de información o de comunicación (TIC.El tamaño de los sistemas implantados en las grandes organizaciones y su carácter exógeno con relación a las prácticas de la empresa (programas de gestión integrada, plantean desafíos relativamente nuevos, difíciles de asumir para los actores. Efectivamente, tanto el oficio de los especialistas en informática, como el de los profesionales usuarios, se ven muy frecuentemente afectados.Los especialistas en informática deben revisar su manera de hacer, revisión que se acompaña de una menor autonomía, exigencias de cooperación más elevadas y de un trabajo multidisciplinario para el cual no fueron necesariamente preparados. Los profesionales usuarios pueden perder puntos históricos de referencia profesional, cambio acompañado de una revisión de las prácticas, de la modificación de las estructuras y del medio ambiente del trabajo. A veces, deben adquirir nuevas calificaciones, a un costo alto y algunos pueden perder su trabajo.Estas problemáticas serán ilustradas a través de dos situaciones concretas muy recientes, observadas en un gran grupo proveedor de servicios, para ambos grupos de empleados.

  1. Caractérisation et simulation des mouvements d'atteinte par un opérateur humain en position assise en vue d'applications ergonomiques

    OpenAIRE

    CHEVALOT, N

    2006-01-01

    La simulation de mouvements d'atteinte effectués par un opérateur assis est particulièrement utile pour les constructeurs d'automobiles. Elle permet d'améliorer l'ergonomie de l'habitacle et des commandes, le plus en amont possible dans la conception. Elle consiste à simuler un mouvement et à prédire son inconfort. Cependant, ce type de simulation se heurte à des problèmes pratiques et théoriques. Pour la partie pratique, une méthode de simulation générique et stable pour tout type de mouveme...

  2. Caractérisation et simulation des mouvements d'atteinte par un opérateur humain en position assise en vue d'applications ergonomiques

    OpenAIRE

    Chevalot , Nicolas

    2006-01-01

    Simulation of seated reaching movements is useful for designing the interior of a car. It allows assessing reachability of control commands and their discomfort in an early phase of design, through virtual simulation. However, this kind of simulation encounters theoretical and pratical problems. Practically, the whole simulation process should be designed for all kind of reach tasks, arising the problems of robustness and genericity. Theoretically, it is important to understand how the moveme...

  3. Évaluation sur simulateur de conduite du comportement humain en situation de pré-crash : application à l'amélioration des airbags

    OpenAIRE

    Robache , Frédéric

    2017-01-01

    Automakers are lawfully required to achieve a minimum level of security which is checked during standardized crash tests. This results in a limited number of scenarios, which do not take individual specificities into account. This dissertation evaluates real human behaviour during the pre-crash phase, by means of a driving simulator. The experiment, integrating an unavoidable accident, studied the behaviour of 76 drivers, of which 40 drivers on a dynamic simulator. Concerning this group, 43 a...

  4. Contribution à l'analyse et à l'interprétation du mouvement humain: application à la reconnaissance de postures

    OpenAIRE

    Girondel, Vincent

    2006-01-01

    This Ph.D. thesis research work is dedicated to the analysis and the interpretation of human motion with an application to posture recognition. Human motion analysis and interpretation in computer vision have numerous applications domains such as videosurveillance, mixed-reality applications and advanced man-machine interfaces. We propose here a real-time system that allows human motion analysis and interpretation.Human motion analysis includes several processing steps of image processing suc...

  5. Représentation du corps humain et cultures en milieu Bantu : l'enseignement de l'anatomie au Gabon

    OpenAIRE

    Djembi, Yves Roger

    2015-01-01

    The teaching of anatomy in Gabon is based on a Western cultural model. The issue is the approach and cultural perceptions of the human body differ from one continent to another. The major issue from our perspective is: how to reconcile the Western approach to the human body and the perception of the body in the Bantu culture? The goal of this work is to contribute developing the teaching of anatomy in Libreville by seeking to better integrate it in the Gabonese culture.; L’enseignement de l’a...

  6. Femme et education: Une equation determinante pour le developpement humain en Afrique (Women and Education: A Determining Equation for Human Development in Africa).

    Science.gov (United States)

    Hane Ba, Fama

    1993-01-01

    Identifies the common characteristics of population education in African countries, including a focus on safeguarding cultural traditions. Suggests that improving the condition of women should be at the heart of population education because of their role in promoting family health and environmental protection and in the education of their…

  7. Earth in the balance. Ecology and the human spirit; Urgence Planete Terre. L'esprit humain face a la crise ecologique

    Energy Technology Data Exchange (ETDEWEB)

    Al Gore

    2007-07-01

    This book is the translation of the original American edition 'earth in the balance'. When Earth in the Balance first came out, it caused quite a stir and for good reason. It convincingly makes the case that a crisis of epidemic proportions is nearly upon us and that if the world does not get its act together soon and agree to some kind of 'Global Marshall Plan' to protect the environment, we're all up a polluted creek without a paddle. Myriad plagues are upon us, but the worst include the loss of biodiversity, the depletion of the ozone layer, the slash-and-burn destruction of rain forests, and the onset of global warming. None of this is new, of course, nor was it new in 1992. But most environmentalists will still get a giddy feeling reading such a call to action as written by a prominent politician. The book is arranged into three sections: the first describes the plagues; the second looks at how we got ourselves into this mess; and the final chapters present ways out. Gore gets his points across in a serviceable way, though he could have benefited from a firmer editor's hand; at times the analogies are arcane and the pacing is odd kind of like a Gore speech that climaxes at weird points and then sinks just as the audience is about to clap. Still, at the end you understand what's been said. Gore believes that if we apply some American ingenuity, the twin engines of democracy and capitalism can be rigged to help us stabilize world population growth, spread social justice, boost education levels, create environmentally appropriate technologies, and negotiate international agreements to bring us back from the brink. For example, a worldwide shift to clean, renewable energy sources would create huge economic opportunities for companies large and small to design, build, and maintain solar panels, wind turbines, fuel cells, and other eco friendly innovations.

  8. Dispositifs de gestion et risques psychosociaux. Une étude qualitative des risques humains et de leur gestion dans les organisations.

    OpenAIRE

    Beau, Pauline

    2017-01-01

    Since the late 2000s, psychosocial risks (job strain, anxiety, burn out…) are a debating point. The literature explains it by the dissemination of a results-oriented culture which demands more and more to people and controls their performance by using management tools. Furthermore, to prevent psychosocial risks organizations also use management tools. That's why we focus our attention on the use of management tools in organizations to study the complex links between management control and psy...

  9. The 'humane performance' project for the French nuclear power plants; Le projet performance humaine au sein du parc nucleaire francais

    Energy Technology Data Exchange (ETDEWEB)

    Theurier, J.P. [Electricite de France (EDF/DPN/UNIE), 93 - Saint-Denis (France)

    2010-05-15

    In 2006 EDF launched a project called 'human performance' whose aim was to make work practices of 37.000 nuclear workers evolve towards more efficiency and more rigor. In fact the aim is to break the professional routines that are often sources of mistakes and make workers more able to summon up all their capabilities during an intervention. The most innovative step in this project is the implementation of the 'reliability path'. This path is in fact a mental preparation before the intervention and an acute awareness of what is being done during the intervention. A debriefing phase follows the intervention in which the worker reviews the intervention and suggests the points to improve. (A.C.)

  10. Une nouvelle approche de l'autisme: des désordres de la communication neuronale aux désordres de la communication humaine

    OpenAIRE

    Gepner, Bruno

    2008-01-01

    International audience; In this paper we draw the first lines of a novel gene-to-behaviour approach to Autism Spectrum Disorders (ASD). This approach is presented from behaviours and upstream to genes. We first present again our threefold -clinical, experimental and theoretical- approach to autism, the so-called E-Motion mis-sight and other temporospatial processing disorders. According to our view, subjects with ASD present from the beginning of their life different degrees of disability in ...

  11. What is Essential for Virtual Reality Systems to Meet Human Performance Goals? (les Caracteristiques essentielles des systemes VR pour atteindre les objectifs militaires en matiere de performances humaines)

    Science.gov (United States)

    2001-03-01

    du contrôle des performances . En outre, de grandes possibilités ont déjà été identifiées dans les domaines de la planification et la ...recherches doivent être entreprises sur la facilité d’utilisation de ces technologies afin de permettre aux militaires de les acheter en connaissance...SEINE CEDEX, FRANCE RTO MEETING PROCEEDINGS 58 What Is Essential for Virtual Reality Systems to Meet Military Human Performance Goals? (les

  12. La caravane des animaux. Circulation des « orangs-outans » et des savoirs, reconfigurations des frontières de l’humain

    OpenAIRE

    Sebastiani, Silvia

    2018-01-01

    L’article interroge la présence des animaux exotiques dans la Grande-Bretagne des Lumières, et en particulier des « orangs-outans ». Il retrace la mobilité de ces bêtes, met en lumière les réseaux au long cours de leur circulation, dessine les multiples espaces de sociabilité de leur mise en observation et le foisonnement des registres de discours dont ils font l’objet. Mis au cœur des travaux d’anatomie comparée dès la fin du xviie siècle, les orangs-outans deviennent l’une des grandes attra...

  13. Dimensions humaine et sociale du développement durable : une problématique séparée du volet environnemental ?

    Directory of Open Access Journals (Sweden)

    Sandrine Rousseau

    2004-11-01

    Full Text Available La mise en place au niveau international d’un développement durable devrait aboutir à une forme de rapprochement des modes de gestion de l’environnement et du travail des différents pays. L’article propose ici de faire un état des lieux des conséquences des modes d’organisation mis en place. Il croise en effet deux indicateurs : taux de pauvreté (et travail décent et empreinte écologique pour comprendre quel est le chemin à parcourir vers le développement durable pour les pays de l’OCDE. Se dégagent ainsi différents scénarios : des pays cumulant un fort taux de pauvreté avec une empreinte écologique importante vers des pays plus respectueux des deux ressources. L’article tente de comprendre quels sont les éléments à l’origine de ces différentes situations.The implementation of sustainable development policies on a global scale should icrease the coherence of the management of environmental and labour resources in the various countries. This paper aims at explaining the consequences of the different forms of management and organisation implemented recently. It compares two indicators, poverty rates (and decent labour and the ecological footprint, in order to suggest policies that should be led in OECD countries to achieve sustainable development. Several scenarios are identified, from the countries that show a high poverty rate and a strong environmental print to other countries that are more concerned by both environmental and labour resources. This paper attempts to present the features that can explain the variety of configurations.

  14. Les mécanismes de cicatrisation des plaies retardés dans les divers modèles de maladies humaines

    OpenAIRE

    Nguyen , Van Tuan

    2015-01-01

    Impaired wound healing is a major unsolved clinical problem in aging, diabetes, sickle cell disease (SCD), glucocorticoid (GC) therapy or Cushing syndrome.First, we investigated the mechanisms underlying SCD ulcers, using SAD transgenic mouse model with mutated human beta globin. Old SAD mice displayed delayed healing correlated with the severity of anemia and hemolysis, as in human SCD, related to impaired cutaneous angiogenesis and poor endothelial progenitor cell (EPC) mobilization from th...

  15. Arthur Maurice Hocart, Au commencement était le rite. De l’origine des sociétés humaines

    Directory of Open Access Journals (Sweden)

    Jean-Pierre Baud

    2009-04-01

    Full Text Available Il s’agit d’une œuvre qui était déjà en 1954 l’édition tardive d’une œuvre d’un auteur mort en 1939 et dont on a attendu la traduction française pendant un demi-siècle, laquelle semble annoncer une sortie de purgatoire qu’un Van Gennep attend encore (un haut lieu de l’anthropologie juridique ne possédait aucune de ses œuvres en l’an 2000. Au temps où elle était encore une science jeune, l’anthropologie s’était très vite dotée d’un académisme permettant d’accréditer les spécialistes sérieux e...

  16. Scientific days on electromagnetic fields: from dosimetry to human health - Conference proceedings; Journees scientifiques - Champs electromagnetiques: de la dosimetrie a la sante humaine - Recueil des resumes et presentations

    Energy Technology Data Exchange (ETDEWEB)

    Wiart, J.; Ghanmi, A.; Picon, O.; Conil, E.; Varsier, N.; Hadjem, A.; Sudret, B.; Magne, I.; Souques, M.; Gaudaire, F.; De Seze, R.; Jawad, O.; Lautru, D.; Dricot, J.M.; Horlin, F.; De Doncker, P.; Drissaoui, A.; Musy, F.; Nicolas, L.; Perrussel, R.; Scorretti, R.; Voyer, D.; Jala, M.; Moulines, E.; Levy-Leduc, C.; Mahfouz, Z.; Gati, A.; Fouad Hanna, V.; Leveque, P.; Arnaud-Cormos, D.; Zhadobov, M.; Jarrige, P.; Gaborit, G.; Kohler, S.; Ticaud, N.; Duvillaret, L.; Guelilia, Z.; Loison, R.; Gillard, R.; Laisne, A.; Favet, D.; Benadhira, R.; Mir, L.; Nadi, M.; Kourtiche, D.; Gazeau, F.; Wilhelm, C.; Delemotte, L.; Breton, M.; Tarek, M.; Marc-Vergnes, J.P.; Yardin, C.; Perrin, A.; Le Drean, Y.; Sauleau, R.; Lambrozo, J.; Selmaoui, B.; Ghosn, R.; Thuroczy, G.; Villegier, A.S.; Loos, N.; Brenet-Dufour, V.; Liabeuf, S.; Bach, V.; Moretti, D.; Lewis, N.; Garenne, A.; Poulletier De Gannes, F.; Haro, E.; Lagroye, I.; Bornat, Y.; Boutaib, Y.; Saighi, S.; Renaud, S.; Veyre, B.; Schuz, J.; Deltour, I.; Van Deventer, E.; Vecchia, P.; Merckel, O.; Bellaouel, A.; Demaret, P.; Donati, P.; Jovanovic, D.; Chauvin, S.; Desreumaux, J.P.; Fouquet, L.; Picard, D.; Massardier-Pilonchery, A.; Hours, M.; Bergeret, A.; Person, C.; Toutain, Y.; Butet, R.; Berrahma, K.; Balderelli, I.; Stelmaszyk, V.; Cretallaz, C.; Lamproglou, I.; Amourette, C.; Diserbo, M.; Fauquette, W.; Martigne, P.; Collin, A.; Lagroye, I.; Ait Aissa, S.; Hurtier, A.; Taxile, M.; Le Montagner, L.; Athane, A.; Duleu, S.; Percherancier, Y.; Geffard, M.; Ruffie, G.; Billaudel, B.; Veyret, B.; Pelletier, A.; Delanaud, S.; Libert, J.P.; Schunck, T.; Bieth, F.; Soubere Mahamoud, Y.; Le Quement, C.; Ferrand, G.; Le Guevel, R.; Carton, P.H.; Luong, M.; Tanvir, S.; Selmaoui, B.; Silva Pires-Antonietti, V.; Sonnet, P.; Pulvin, S.; Kuster, O.; Tetelin, C.

    2012-04-15

    This document brings together the available presentations (articles and slides) given at the URSI scientific days on electromagnetic fields: dosimetry, peoples' exposure, biological and health risks, risk management, and medical uses. 48 presentations are compiled in this document and deal with: 1 - Stochastic dosimetry: variability challenge; 2 - How to estimate the exposure to 50/60 Hz magnetic field in an epidemiological study?; 3 - Joint analysis of population exposure and radio coverage of GSM and UMTS mobile phone networks; 4 - Study of the specific energy absorption rate (SAR) sensitiveness to phone positions near the head for 2 GSM mobile phones; 5 - Statistical Study of SAR under Wireless Channel - Exposure in Indoor Environment; 6 - Uncertainty propagation in numerical dosimetry: how to reduce calculation costs?; 7 - Use of a simplified pregnant woman model for foetus exposure analysis; 8 - SAR estimation using multi-exposure with a mobile phone; 9 - State-of-the-art in experimental dosimetry (RF and pulses); 10 - Mm-waves dosimetry: issues, stakes and actual solutions; 11 - Use of DG-FDTD for a dosimetry calculation in a strongly multi-scale problem: determination of the eye-SAR near a HF/VHF vehicle-borne source; 12 - Dosimetric measurements with a fiber-type electro-optical sensor; 13 - Partial experimental evaluation of basic restrictions in the HF/VHF range; 14 - Repetitive trans-cranial magnetic stimulation Stimulation (rTMS) in psychiatry: present day situation and perspectives; 15 - Medical applications of electric fields; 16 - Measurements for life: new perspectives? 17 - Nano-particles and magnetic stimuli for medical imaging and therapy; 18 - Molecular Insights into electroporation and siRNA electro-transfer through model cell membranes; 19 - State of knowledge on electromagnetic fields hypersensitivity (HS-CEM); 20 - Experimentation methodology: from results to interpretation; 22 - Mm waves - update on biological effects at 40-60 GHz; 23 - Electromagnetic interferences and cardiac implants; 24 - RF effects on central nervous system: sleep, cognition, Electro-encephalography, vascularisation; 25 - Specific effects of an exposure to mobile phone RF waves on the autonomous nervous control of the cutaneous vasomotor tone; 26 - The ERNAM project: exposure of neuronal networks to the GSM-1800 signal; 27 - Mobile phones, power lines and cancer: the epidemiological evidence leading to classification as possible carcinogens; 28 - EMF Risk Assessment and Management: A WHO Perspective; 29 - Evolution of ICNIRP guidelines; 30 - Assessment of RF-linked risks at the Anses: from dialogue management recommendations; 31 - Characterization of mobile phone-absorbing medium interactions for non-invasive dosimetry; 32 - Status of electromagnetic radiation exposures and evaluation of prevention means; 33 - General public exposure to RF in France; 34 - Power emitted by a mobile phone in voice communication: from 2G to 3G VoIP; 35 - Digital dosimetry in HF/VHF range; 36 - Professional exposure of mobile phone maintenance technicians; 37 - Robot-less multi-sensors dosimetry for real time SAR measurement; 38 - High performance SAR meter for the characterization of 3G mobile phones exposure; 39 - RF dosemeters and user's body diffraction; 40 - RF waves and health: summary of 2007-2011 scientific publications; 41 - Behaviour of adult male wistar rats during high power pulsed electromagnetic waves (3 GHz); 42 - Wi-Fi effects: results of IMS Lab studies; 43 - Effects on the energy fluxes of young rats homeostasis during a chronic exposure to RF fields; 44 - Biological effects of very-high power and ultra-large range radiations: ISL's research programme; 45 - Study of cell-scale biological effects of pulsed RF fields used in high-resolution NMR-imaging; 46 - Effects of cell phone radiofrequency exposure on the human cytochrome P450 reductase; 47 - CEA's 'electromagnetic safety' working group; 48 - In situ evaluation of electromagnetic fields from UHF RFID readers

  17. Abondance et distribution des grands singes et des activités humaines dans le Parc National de Campo Ma'an, Sud Cameroun

    Directory of Open Access Journals (Sweden)

    Tchamba, MN.

    2015-01-01

    Full Text Available Abundance and Distribution of Great Apes and Human Activities in the Campo Ma'an National Park, South Cameroon. The Campo Ma'an National Park (CMNP located in South Cameroon, has a rich biodiversity and is part of the priority areas of the Central Africa Network of Protected Areas. In order to improve the knowledge on great apes in this park, an inventory was conducted between October and November 2011 using the linear transect technique. In total, 103 transects, 2.5 km each, were established and surveyed. The results of the study confirm the presence of the two species of great apes in the CMNP, chimpanzees (Pan troglodytes troglodytes and gorillas (Gorilla gorilla gorilla. The inventory suggested that chimpanzees had a nest density of 0.158 nest∙km-2, allowing an estimated density of 0.555 indiv.km-2, for a total population estimated at 1466 animals weaned throughout the Park. Chimpanzees were mainly located in the northern part of the Park, near the hilly area of Niété. Gorillas had an estimated average encounter rate of 1.080 sign per km. They also appeared to be more concentrated around the area of Niété. Poaching was the preferred type of human activity in the Park and was located in the northern part of the Park. It is strongly recommended to implement the results of this study by performing regular surveys, about every 3 months, in order to monitor the demography of the great apes populations in the Park.

  18. Rôles des NADPH oxydases lors de pathologies humaines à l'aide de modèles murins transgéniques

    OpenAIRE

    Deffert, Christine; Lardy, Bernard; Morel, Francoise

    2009-01-01

    Reactive oxygen species (ROS) are molecules derived from oxygen. They are generated by professional NADPH oxidases (NOX). The NOX family are proteins that transfer electrons across biological membranes. In general, the electron acceptor is oxygen and the product of the electron transfer reaction is superoxide. Seven NOXs protein has been described and all of them generate or ROS. Despite their similar structure and enzymatic function, NOX family enzymes differ in their mechanism of activation...

  19. Le changement climatique d'origine humaine. Rappel de quelques résultats générauxAnthropogenic climate change: general results

    Science.gov (United States)

    Petit, Michel

    1999-02-01

    The IPCC (International Panel on Climate Change) reports have highlighted major results, which constitute a relevant framework for the specific papers in this issue. Both facts established with large confidence level and models results are presented.

  20. Quel rôle joue les autres? : Une analyse empirique de l'interaction entre capital social et capital humain en Inde

    OpenAIRE

    Gille, Véronique

    2013-01-01

    There is nothing controversial in saying that hum an capital matters a great deal for economic development. Research during the past 50 years has confirmed this belief, and governments, international organizations and NGOs have worked hard to improve human capital indicators. But the majority of policy makers and researchers have considered and studied human capital as an issue only concerning individuals. However, human capital also has a social component which has not yet been well understo...

  1. Accumuler le capital humain tout au long de la vie: Quels facteurs prédictifs de la participation à la formation permanente?

    Science.gov (United States)

    Boudard, Emmanuel; Morlaix, Sophie

    2003-09-01

    This article addresses the main predictors of adult education, using statistical methods different from those generally used by social science researchers. Its aim is twofold. First, it seeks to explain in a simple and comprehensible manner the methodological value of these methods (in relation to the use of structural models); secondly, it demonstrates the concrete usefulness of these methods on the basis of a recent piece of research on the data from the International Adult Literacy Survey (IALS).

  2. Introduction. Lorsque la recherche en sciences humaines et sociales se penche sur les données numériques

    OpenAIRE

    Mabi, Clément; Plantin, Jean-Christophe

    2017-01-01

    On assiste actuellement à la production et à la diffusion d’un nombre toujours plus important de données numériques dans l’espace scientifique, professionnel et public. Celles-ci proviennent de diverses sources : des administrations qui mettent en ligne leurs données de fonctionnement dans le cadre de démarches open data, des entreprises qui ouvrent certaines de leurs données non stratégiques, du monde scientifique qui a recours à des données de plus en plus hétérogènes et de grande taille, o...

  3. Génétique épidémiologique et moléculaire de l’obésité humaine

    Directory of Open Access Journals (Sweden)

    Iron Albert

    2000-01-01

    Full Text Available L’obésité est une pathologie majeure pour plusieurs raisons qu’il est difficile de hiérarchiser. D’abord parce qu’elle est commune, concernant aujourd’hui près d’un individu sur trois dans les pays industrialisés. Ensuite, parce qu’elle est grave en raison des complications nombreuses et sévères, parmi lesquelles on peut citer des cardiopathies, le diabète, l’HTA, des cancers, etc. Enfin, parce que répondant à la définition de maladie multifactorielle résultant de l’interaction entre des facteurs héréditaires et des facteurs environnementaux, sa connaissance a beaucoup progressé ces dernières années, notamment grâce à l’apport de la génétique moléculaire. À l’échelon individuel et d’une manière simple, on peut définir l’obésité comme résultant d’un excès de tissu adipeux qui va se traduire par un poids élevé par rapport à ce qu’on peut considérer comme étant un poids idéal donné par la formule de Lorentz : Poids idéal (kg = Taille (cm – 100 – [Taille (cm – 150]/4 (homme ou 2,5 (femme Sous l’angle épidémiologique, c’est-à-dire à l’échelle des populations, l’obésité sera définie à partir de critères de nature anthropologique utilisés aussi en clinique pour typer le patient obèse. On peut prendre en compte le rapport du tour de hanche sur le tour de taille (qui permet de définir une obésité de type androïde ou gynoïde selon que ce rapport est supérieur ou inférieur à 0,85 ou la mesure de l’adiposité évaluée par l’appréciation des plis cutanés (en particulier le pli tricipital ou surtout l’indice de corpulence qui est le critère majeur des épidémiologistes pour l’étude de l’obésité chez l’adulte. Cet indice est la référence pour la définition de l’obésité chez l’adulte ; il est aussi appelé indice de masse corporelle (IMC ou indice de Quetelet ; il exprime le rapport du poids (en kg au carré de la taille (en m. Il a été choisi par l’OMS en 1998 pour établir la classification de l’obésité adulte [1]. Entre 18,5 et 25, le poids du sujet est normal, souhaitable avec un risque standard. Au-delà de 25, on définit d’abord une zone de surpoids puis trois degrés de sévérité et de complications croissantes.

  4. L’éducation, facteur de l’utilisation effi cace des ressources humaines. Le développement durable dans des conditions de crise

    Directory of Open Access Journals (Sweden)

    Mariana BALAN

    2011-04-01

    Full Text Available La Roumanie est aujourd’hui un pays confronté à des risques majeurs parce que les systèmes d’éducation et de recherche ne répondent pas aux exigences minimales d’une société européenne et de l’économie dans laquelle la connaissance est le plus précieux produits et la plus importante source de développement économique, social et personnel. Les dernières évaluations internationales montrent que les étudiants roumains sont au bas du tableau en termes de connaissances. Ces montrent que la Roumanie est en chute libre, pour la première fois les scores enregistrés ont été faible même au niveau de l’école primaire. Cet article présente une analyse statistique des indicateurs clés sur l’accès et la participation à l’éducation et la formation, les indicateurs de la qualité et l’efficacité de l’éducation et la formation, les indicateurs des résultats du système d’éducation, les indicateurs de résultats sur l’éducation et de formation et de main-d’ouvre de qualité travailler comme indicateurs de la participation et l’investissement dans la FPC/ apprentissage à vie. Pour évaluer la contribution quantitative des changements au systèmes d’éducation en Roumanie et pour expliquer l’évolution de l’éducation pendant la crise, a été utilisée un modèle de choix d’éducation et les résultats de ces simulations sont présenté aussi.

  5. Uninhabited Military Vehicles (UMVs): Human Factors Issues in Augmenting the Force (Vehicules Militaires sans Pilote (UMV): Questions Relatives aux Facteurs Humains lies a l’augmentation des Forces)

    Science.gov (United States)

    2007-07-01

    DE Soesterberg The Netherlands Email: aernout.oudenhuijzen@tno.nl Dr. Raja Parasuraman George Mason University Department of Psychology 4400...les UMV sur le champ de bataille incertain, ambigu et non linéaire du futur, y compris la manière dont le droit international traitera la guerre...space, on land, in the air and at sea.” President George W Bush, address to the Citadel, December 2001. Unmanned Military Vehicles (UMVs) are

  6. Haïti : les pouvoirs de l'art dans Le Sang et la Mer de Gary Victor et La Belle Amour humaine de Lyonel Trouillot

    Directory of Open Access Journals (Sweden)

    Odile Gannier

    2012-11-01

    Full Text Available Dans cet article, l'auteure pose une question en écho aux événements de janvier 2010 : "comment écrire encore après les catastrophes ?". Elle en prend pour témoins les œuvres de Gary Victor et de Lyonel Trouillot (respectivement parues en 2010 et 2011 qui, pour l'une, raconte l'histoire d'une orpheline, Hérodiane, au parcours difficile, et rapporte, pour l'autre, l'enquête d'Anaïse, une étrangère, sur les traces de sa famille haïtienne. Odile Gannier analyse la construction de l'intrigue et des personnages, mais aussi les tonalités et les genres représentés dans les deux œuvres, ainsi que leurs multiples similitudes avec d'autres formes de production artistique (la peinture en particulier.

  7. Organisational and human factors in risk management: common beliefs, deceived ideas; Les Facteurs Organisationnels et Humains de la gestion des risques: idees recues, idees decues

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    2011-09-22

    The author propose critical discussions of common beliefs about the ineluctability of human error, individual ability, the validity of written procedures, good organisation, the culture of safety, the contribution of quality approaches to safety, the continuous improvement of safety, the good usage of the return on experience, the rigour and objectivity of the FOH (organisational and human factor) approach, and appealing to experts in FOHs

  8. Caractérisation géométrique et mécanique multi-échelle de la dentine humaine

    OpenAIRE

    Wang, Wenlong

    2016-01-01

    Human dentin is one of the main components of human tooth. It shows a hierarchicalstructure from a multi-scale point of view. Generally speaking, dentin can be seen as a hard biomaterial consisting in 3 phases: the porous phase made of tubules, the inclusion phase made of peritubular dentin and the matrix phase made of intertubular dentin. These hierarchical structures strongly determine its mechanical properties. The knowledge of its structure, its mechanical property and its deformation beh...

  9. Caractérisation des propriétés mécaniques de la peau humaine in vivo via l'IRM

    OpenAIRE

    Tran, H.V.

    2007-01-01

    The human skin is a complex biological material. It consists of three layers of different thicknesses: epidermis, dermis and hypodermis. This structural complexity gives the skin of the mechanical properties of complex hyperelastic, nonlinear, viscoelastic and submitted to the pre-tension. An indentation composed of 6 loading levels and running in the MRI environment has been developed. Indentation tests were performed on the dorsal part of the left forearm of 9 subjects of ages ranging from ...

  10. The exposures to natural radioactivity as a result of human activities; Les expositions a la radioactivite naturelle du fait des activites humaines

    Energy Technology Data Exchange (ETDEWEB)

    Rannou, A.; Dupuis, M.; Bottollier-Depois, J.F.; Leprieur, F.; Pasquier, J.L.; Doremus, P.; Pierre, J.P. [Institut de Radioprotection et de Surete Nucleaire, 92 - Clamart (France); Bernhard, S. [ALGADE, 87 6 Bessines sur Gartempe (France); Delporte, V. [Drection Generale de la Surete Nucleaire et de la Radioprotection, 75 - Paris (France); Servent, J.P. [Institut National de Recherche et de Securite, 75 - Paris (France); Marchand, D. [DRASS Bretagne (France); Dupuis, M.; Bottollier-Depois, J.F.; Leprieur, F.; Pasquier, J.L.; Doremus, P.; Pierre, J.P. [Institut de Radioprotection et de Surete Nucleaire, 92 - Clamart (France); Surbeck, H. [Neuchatel Univ. (Switzerland); Degrange, J.P. [Centre d' Etude sur l' Evaluation de la Protection dans le Domaine Nucleaire, 92 - Fontenay aux Roses (France)

    2005-07-01

    The new regulation in matter of radiation protection, coming from the transposition of the European directive 96/29/EURATOM modifies the code of the public health and the labour code. The exposures to natural radioactivity by the very fact of human activities are the object of specific dispositions. These new dispositions apply to professional areas that were, until now, little concerned by the regulation relative to ionizing radiations. The S.F.R.P., in relationship with the Minister in charge of labour, and the A.F.T.I.M. (French organisation of safety technicians and engineers and labour physicians) organizes two days of information and exchange on the subject. This meeting concerns industry and research departments but also inspectors and labour physicians and other actors having a look on the risk management in societies. After some reminder on radioactivity and its effects, the regulation and the global risk management on working place, several actual examples are presented, covering the different known situations of exposure to the natural radioactivity ( radon, cosmic rays, use of radioactive material in an industrial process, production of radioactive waste). The days finish by a round table conference on the stakes and practical entailment of the new regulation. (N.C.)

  11. Traitement de l'hétérogénéité sémantique dans les interactions humain-agent et agent-agent

    OpenAIRE

    Mazuel , Laurent

    2008-01-01

    The main purpose of this thesis is the management of semantic heterogeneity in human-agent and agent-agent interaction. We especially focus on the situation where a software agent, supplied with a knowledge representation model, has to understand requests coming from different interlocutors; either it is a human user or another software agent.Most work in this domain either focus on human-agent interaction or agent-agent interaction. On the contrary, we suggest that it is possible to use a co...

  12. Effects of extremely low frequency electromagnetic fields on human beings; Effets sur les etres humains des champs electromagnetiques a tres basse frequence

    Energy Technology Data Exchange (ETDEWEB)

    Lilien, J.L.; Dular, P.; Sabariego, R.; Beauvois, V.; Barbier, P.P.; Lorphevre, R. [Universite de Liege, Departement d' Electricite, Electronique et Informatique, Institut Montefiore, Liege (Belgium)

    2010-05-15

    Since the early seventies, potential health risks from ELF (Extremely Low frequency electromagnetic Fields) exposure (50 Hz) have been extensively treated in the literature (more than 1000 references registered by WHO (World Health Organisation), 2007). After 30 years of worldwide research, the major epidemiological output is the possible modest increased risk (by a factor 2) of childhood leukaemia in case of a long exposure to an ambient magnetic flux density (B-field) higher than 0.4 muT. However, this fact has not been confirmed by in vivo and in vitro studies. Moreover it has not been validated by any adverse health biological mechanisms neither for adults nor for children. International recommendations (ICNIRP, International Commission on Non-Ionising Radiation Protection) are currently, for general public, not to exceed a B-field of 100 muT (50 Hz) and an E-field of 5 kV/m (50 Hz). Herein, a rough overview of typical values of ELF fields will be presented followed by a brief literature survey on childhood leukaemia and ELF The potential carcinogenic effect of ELF would be linked to electrical disturbances in cell behaviour. The major concern linking child-hood leukaemia and ELF is thus to determine the response of bone marrow cells under ELF fields. With that purpose, transmembrane potential will be targeted and linked to the E-field at that level. This paper is three-folded: (1) the electric interactions between ambient ELF fields and the body are studied both qualitatively and quantitatively. Different sources of internal E-field are analysed and classified according to their potential risk; (2) the hypothesis of contact current is detailed; (3) key actions to undertake are highlighted. Based on the current state of the art and some authors' own developments, this paper proposes simple low cost enhancements of private electrical installations in order to annihilate the major source of potential effects of ELF. (authors)

  13. Relation entre la faune de quelques rivières du nord-ouest de l'Angleterre et les activités humaines

    Directory of Open Access Journals (Sweden)

    MACAN T. T.

    1976-01-01

    Full Text Available MINSHALL et KUEHNE ont signalé que, dans la « Région des lacs » en Angleterre, alors que la faune typique d'un ruisseau à fond pierreux peut monter jusqu'aux sources dans les montagnes, il y a des zones où la faune est pauvre, hormis les Plécoptères. Dans ces dernières eaux, le pH et le taux en calcium sont faibles, comme l'ont montré SUTCLIFFE et CARRICK qui pensent qu'il s'agit d'une pollution atmosphérique. De telles communautés habitent les affluents de la Rivière Lune. La rivière elle-même traverse une gorge où, grâce aux éboulis, le fond est stable. La faune actuelle est riche en espèces et en individus, surtout en larves de Tricoptères avec filet. C'est presque la seule région où les mollusques ne risquent pas d'être écrasés par les pierres roulantes. En aval, dans une longue plaine alluviale, le substrat est instable et, en conséquence, les espèces sont peu nombreuses bien que les individus de quelques-unes soient abondants. Une augmentation de l'enrichissement actuel provenant des villes et des prairies cultivées pourrait provoquer une croissance excessive des algues filamenteuses. Celles-ci font disparaître la vraie faune lithicole et disparaissent elles-mêmes en temps de crue, en emportant vers l'aval les animaux qu'elles hébergent. Au-delà de la plaine, la rivière traverse une région à pierre meulière, sur un lit plat et lisse. Entre deux barrages, ce lit est couvert de mousses habitées par 4 espèces d'éphémères qui ne se trouvent ailleurs, que dans de petites baies où le courant est faible. On a remarqué dans une rivière voisine la disparition de telles espèces après l'amélioration du lit par les ingénieurs.

  14. Étude structurale de l'assemblage du complexe télomérique humain TRF2/RAP1

    OpenAIRE

    Gaullier , Guillaume

    2015-01-01

    Telomeres are the ends of eukaryotic linear chromosomes. They are made oftandem repeats of a short guanine-rich motif and bound by specific proteins.In vertebrates, these proteins form a complex called shelterin, theintegrity of which is critical to ensure proper replication of chromosomeends and to protect them against illicit targeting by DNA double-strandbreak repair pathways. Telomere dysfunctions lead to genome instability,which can ultimately cause senescence or cancer. Telomeres are a ...

  15. Huit idées reçues sur le(s) modèle(s) de l’erreur humaine de James Reason

    OpenAIRE

    Larouzée, Justin; Guarnieri, Franck

    2014-01-01

    International audience; This paper directed to engineers, researchers and PhD students concerned one way or another by the issues of industrial safety and needing to use the theories or work of the English psychologist James Reason, theorist and practitioner of the global concept of human error. This paper, which requires additional reading of James Reason’s essential works, intends to provide evidence to exceed eight preconceived ideas about thework of the latter, mainly directed to the etio...

  16. Surveillance épidémiologique de la rage humaine dans un contexte d’endémie de rage canine en Cote d’Ivoire

    OpenAIRE

    Tiembré, I.; Dagnan, S; Douba, A; Adjogoua, E V; Bourhy, Hervé; Dacheux, L; Kouassi, L; Dosso, M; Odehouri-Koudou, P; Tiembré, P

    2010-01-01

    International audience; The objective of this study was to analyze the epidemiologic monitoring of human rabies in the rabies medical center of Abidjan.; A cross-sectional study was undertaken based on files of patients having consulted in the rabies center after exposure and suspicion of human rabies between January 2001 and June 2009.; Twenty-six cases of human rabies were reported in 10,706,136 inhabitants (annual incidence of 0.028 cases per 100,000). The number of detected cases increase...

  17. Cartographie des connaissances et gestion des ressources humaines: exemple de l'ambiguïté cognitive des Systèmes de Gestion des Connaissances

    OpenAIRE

    Dudezert, Aurélie

    2007-01-01

    National audience; This paper deals with Knowledge Maps usage in Human Resource Management context. It studies how those specific Knowledge Management Systems are used to take decisions on Knowledge Allocation. With a discourse analysis of ten Top-Managers in HR Departments of French companies this paper discusses the cognitive ambiguity of Knowledge Management Systems and how their usage could create illusions on Knowledge Allocation.; En étudiant l'usage d'un type de Système de Gestion des ...

  18. Vectorisation de molécules biologiques par la protéine ZEBRA du Virus Epstein-Barr : applications en thérapie humaine

    OpenAIRE

    Marchione, Roberta

    2014-01-01

    In recent years, the understanding of disease molecular mechanisms has led to the identification of genes and proteins that are altered in disease state and many therapeutic targets have been found located within cells. The protective and hydrophobic nature of plasma membrane prevents therapeutic drugs from entering cells. Cell-penetrating peptides (CPPs) or protein transduction domains (PTDs) have emerged as a group of non-invasive delivery vectors for various hydrophilic macromolecules, and...

  19. Comparison of Anterior and Posterior Surgery for Degenerative Cervical Myelopathy: An MRI-Based Propensity-Score-Matched Analysis Using Data from the Prospective Multicenter AOSpine CSM North America and International Studies.

    Science.gov (United States)

    Kato, So; Nouri, Aria; Wu, Dongjin; Nori, Satoshi; Tetreault, Lindsay; Fehlings, Michael G

    2017-06-21

    Surgeons often choose between 2 different approaches (anterior and posterior) for surgical treatment of degenerative cervical myelopathy on the basis of imaging features of spinal cord compression, the number of levels affected, and the spinal alignment. However, there is a lack of consensus on which approach is preferable. The objective of the present study was to use magnetic resonance imaging (MRI)-based propensity-score-matched analysis to compare postoperative outcomes between the anterior and posterior surgical approaches for degenerative cervical myelopathy. A total of 757 patients were enrolled in 2 prospective multicenter AOSpine studies, which involved 26 international sites. Preoperative MRIs were reviewed to characterize the causes of the cord compression, including single-level disc disease, multilevel disc disease, ossification of the posterior longitudinal ligament, enlargement of the ligamentum flavum, vertebral subluxation/spondylolisthesis, congenital fusion, number of compressed levels, or kyphosis. The propensity to choose anterior decompression was calculated using demographic data, preoperative MRI findings, and the modified Japanese Orthopaedic Association (mJOA) scores in a logistic regression model. We then performed 1-to-1 matching of patients who had received anterior decompression with those who had the same propensity score but had received posterior decompression to compare 2-year postoperative outcomes and 30-day perioperative complication rates between the 2 groups after adjustment for background characteristics. A total of 435 cases were included in the propensity score calculation, and 1-to-1 matching resulted in 80 pairs of anterior and posterior surgical cases; 99% of these matched patients had multilevel compression. The anterior and posterior groups did not differ significantly in terms of the postoperative mJOA score (15.1 versus 15.3, p = 0.53), Neck Disability Index (20.5 versus 24.1, p = 0.44), or Short Form-36 (SF-36) Physical Component Summary (PCS) score (41.9 versus 40.9, p = 0.30). The overall rates of perioperative complications were similar between the 2 groups (16% versus 11%, p = 0.48); however, dysphagia/dysphonia was reported only in the anterior group whereas surgical site infection and C5 radiculopathy were reported only in the posterior group. Anterior and posterior decompression for degenerative cervical myelopathy resulted in similar postoperative outcomes and rates of complications. Therapeutic Level III. See Instructions for Authors for a complete description of levels of evidence.

  20. Spectroscopic properties of a reconstituted light-harvesting complex from the green sulfur bacterium Chlorobium tepidum containing CsmA and bacteriochlorophyll a

    DEFF Research Database (Denmark)

    Pedersen, Marie Østergaard; Pham, Lan; Steensgaard, Dorte Bjerre

    2008-01-01

    chlorosomes were lyophilized and extracted with chloroform/methanol (1:1, v/v). The . Isolated chlorosomes were lyophilized and extracted with chloroform/methanol (1:1, v/v). The extract was further purified using gel filtration and reverse-phase HPLC and the purity of the preparation confirmed by SDS...

  1. Evaluation of genetically-improved (glandless) and genetically-modified low-gossypol cottonseed meal as alternative protein sources in the diet of juvenile southern flounder Paralichthys lethostigma reared in a recirculating

    Science.gov (United States)

    Cottonseed meal (CSM) proteins from genetically-improved (glandless) seed (GI-CSM, 52.1% crude protein, CP), genetically-modified low-gossypol seed (GMO-CSM, 56.0% CP) and from an untreated regular (glanded) seed (R-CSM 49.9% CP) were evaluated to replace fish meal (FM) protein (59.5% CP) in juvenil...

  2. Dicty_cDB: CHG688 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available *dvxxnhecrfndqghqccvkvhhdrcslrcphaheckvdxngkeccvrshrppp pevcslrcppkheckfddhgkkccv...gheckvdqhgkeccvvahrpppkcslrcppkhecrinhfgeeccvksrn dcltcedxncerkglhcamktvpidkencwkk Homology vs CSM-cDNA Scor

  3. “Rien de ce qui est humain est étranger”: a etnografia de Michel Leiris a partir da revista francesa documents (1929-1930 = Rien de ce qui est humain est étranger: Michel Leiris’s ethnography through french magazine documents (1929-1930

    Directory of Open Access Journals (Sweden)

    Theophilo, Gabriela

    2014-01-01

    Full Text Available Entre os anos de 1929 e de 1930 o escritor e etnólogo francês Michel Leiris (1901-1990 colaborou para revista de etnografia Documents. Nas páginas do periódico foram veiculados alguns dos principais debates das artes e da etnologia francesa no período. Tratava-se de um momento conturbado no continente europeu e de muitos questionamentos no que dizia respeito às concepções oitocentistas de “civilização”. Pode-se dizer que a revista funcionou como um “laboratório” no qual o escritor Georges Bataille (diretor do periódico e Michel Leiris puderam propor e testar novas formas de se pensar a sociedade ocidental e suas relações com outras sociedades. As contribuições deste para a revista foram profundamente marcadas por suas leituras acerca do gnosticismo, do neoplatonismo e do hermetismo – que ele mesmo costumava denominar apenas como “ocultismo” ou “misticismo”. Este artigo visa, portanto, empreender uma leitura pormenorizada de artigos escritos por Leiris em Documents, procurando investigar de que modos os debates ali travados contribuíram para suas reflexões posteriores no âmbito da disciplina etnográfica e no da chamada “escrita de si”

  4. Quantum mechanics as a natural generalization of classical statistical mechanics

    International Nuclear Information System (INIS)

    Xu Laizi; Qian Shangwu

    1994-01-01

    By comparison between equations of motion of geometrical optics (GO) and that of classical statistical mechanics (CSM), it is found that there should be an analogy between GO and CSM instead of GO and classical mechanics (CM). Furthermore, by comparison between the classical limit (CL) of quantum mechanics (QM) and CSM, the authors find that CL of QM is CSM not CM, hence they demonstrated that QM is a natural generalization of CSM instead of CM

  5. The Development of a Modelling Solution to Address Manpower and Personnel Issues Using the IPME

    Science.gov (United States)

    2010-11-01

    sur les groupes professionnels militaires dans un environnement de modélisation du rendement humain permet de créer des modèles de rendement humain...militaires dans un environnement de modélisation du rendement humain permet de créer des modèles de rendement humain qui sont adaptés aux caractéristiques

  6. Nine mutants of Chlorobium tepidum each unable to synthesize a different chlorosome protein still assemble functional chlorosomes

    DEFF Research Database (Denmark)

    Frigaard, Niels-Ulrik; Li, Hui; Milks, Kirstin J

    2004-01-01

    H, CsmI, CsmJ, and CsmX) but contain relatively little total protein compared to other photosynthetic antenna complexes. Except for CsmA, which has been suggested to bind BChl a, the functions of the chlorosome proteins are not known. Nine mutants in which a single csm gene was inactivated were created......Chlorosomes of the green sulfur bacterium Chlorobium tepidum comprise mostly bacteriochlorophyll c (BChl c), small amounts of BChl a, carotenoids, and quinones surrounded by a lipid-protein envelope. These structures contain 10 different protein species (CsmA, CsmB, CsmC, CsmD, CsmE, CsmF, Csm......, and the BChl c absorbance maximum was blue-shifted about 8 nm, indicating that the structure of the BChl c aggregates in these chlorosomes is altered. The results of the present study establish that, except with CsmA, when the known chlorosome proteins are eliminated individually, none of them are essential...

  7. SN 2010jl: Optical to Hard X-ray Observations Reveal an Explosion Embedded In a Ten Solar Mass Cocoon

    DEFF Research Database (Denmark)

    Ofek, Eran O.; Zoglauer, Andreas; Boggs, Steven E.

    2014-01-01

    Some supernovae (SNe) may be powered by the interaction of the SN ejecta with a large amount of circumstellar matter (CSM). However, quantitative estimates of the CSM mass around such SNe are missing when the CSM material is optically thick. Specifically, current estimators are sensitive to uncer......Some supernovae (SNe) may be powered by the interaction of the SN ejecta with a large amount of circumstellar matter (CSM). However, quantitative estimates of the CSM mass around such SNe are missing when the CSM material is optically thick. Specifically, current estimators are sensitive...... to uncertainties regarding the CSM density profile and the ejecta velocity. Here we outline a method to measure the mass of the optically thick CSM around such SNe. We present new visible-light and X-ray observations of SN 2010jl (PTF 10aaxf), including the first detection of an SN in the hard X-ray band using Nu...

  8. Dicty_cDB: SHG252 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available xls*iixt*r*nqxky*s*tigc*klgnxmx ilrvnhywvxnqxgkrlanvftxinvisafrnqprlkrtkssfatxssdsnarxhrnlkv qv Translated A... ilrvnhywvxnqxgkrlanvftxinvisafrnqprlkrtkssfatxssdsnarxhrnlkv qv Homology vs CSM-

  9. Dicty_cDB: AFM535 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FIPKNAQILINYQALGMNEEYYENPEQFDPSRFLKVESNVAFLPFSIGIRSCVGQSFAQ DEHIXLYFKXCF*iltlxhqltvksidxtexygltlktkxrf Trans...YYENPEQFDPSRFLKVESNVAFLPFSIGIRSCVGQSFAQ DEHIXLYFKXCF*iltlxhqltvksidxtexygltlktkxrf Homology vs CSM-cDNA Scor

  10. Dicty_cDB: SSM193 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available M408 (SSM408Q) /CSM/SS/SSM4-A/SSM408Q.Seq.d/ 932 0.0 SSM376 (SSM376Q) /CSM/SS/SSM3-D/SSM376Q.Seq.d/ 932 0.0 SSM294 (SSM29...4Q) /CSM/SS/SSM2-D/SSM294Q.Seq.d/ 932 0.0 SSM193 (SSM193Q) /CSM/SS/S

  11. Dicty_cDB: SSH709 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available (SSM408Q) /CSM/SS/SSM4-A/SSM408Q.Seq.d/ 551 e-156 SSM376 (SSM376Q) /CSM/SS/SSM3-D/SSM376Q.Seq.d/ 551 e-156 SSM294 (SSM29...4Q) /CSM/SS/SSM2-D/SSM294Q.Seq.d/ 551 e-156 SSM193 (SSM193Q) /CSM/SS

  12. Dicty_cDB: SSG852 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available M408Q.Seq.d/ 1017 0.0 SSM294 (SSM294Q) /CSM/SS/SSM2-D/SSM294Q.Seq.d/ 1017 0.0 SSL192 (SSL192Q) /CSM/SS/SSL1-...CSM-cDNA Score E Sequences producing significant alignments: (bits) Value SSM408 (SSM408Q) /CSM/SS/SSM4-A/SS

  13. Dicty_cDB: SSE546 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available (SSM408Q) /CSM/SS/SSM4-A/SSM408Q.Seq.d/ 957 0.0 SSM376 (SSM376Q) /CSM/SS/SSM3-D/SSM376Q.Seq.d/ 957 0.0 SSM294 (SSM29...4Q) /CSM/SS/SSM2-D/SSM294Q.Seq.d/ 957 0.0 SSL192 (SSL192Q) /CSM/SS/SSL1-D

  14. Dicty_cDB: SSK189 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available (SSM408Q) /CSM/SS/SSM4-A/SSM408Q.Seq.d/ 932 0.0 SSM376 (SSM376Q) /CSM/SS/SSM3-D/SSM376Q.Seq.d/ 932 0.0 SSM294 (SSM29...4Q) /CSM/SS/SSM2-D/SSM294Q.Seq.d/ 932 0.0 SSL192 (SSL192Q) /CSM/SS/SSL1-D

  15. Dicty_cDB: SSD340 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Q) /CSM/VS/VSC8-B/VSC830Q.Seq.d/ 482 e-135 SSM714 (SSM714Q) /CSM/SS/SSM7-A/SSM714Q.Seq.d/ 482 e-135 SSM290 (SSM29...0Q) /CSM/SS/SSM2-D/SSM290Q.Seq.d/ 482 e-135 SSK841 (SSK841Q) /CSM/SS/SSK8-B/

  16. Étude par spectroscopie RMN du carbone 13 de la toxicité métabolique du cadmium dans les tubules rénaux proximaux murins et humains

    OpenAIRE

    Faiz, Hassan

    2011-01-01

    As part of the assessment of metabolism nephrotoxicity of cadmium, we have studied the effect of cadmium chloride (CdCl2) on gluconeogenesis in isolated mouse and human renal proximal tubules. The dose-response experiments in vitro have shown that CdCl2 inhibits the use of lactate and glucose production in a dose-dependent fashion. Besides, the CdCl2 induced a significant decrease in cellular concentrations of ATP and the main compounds containing thiol groups such as coenzyme A and reduced g...

  17. Développement d'un modèle ostéoarticulaire du genou humain pour une analyse dynamique du contact en grands déplacements

    OpenAIRE

    Bideau , Nicolas; Dao , T.T.; Rassineux , Alain; Ho Ba Tho , Marie-Christine

    2011-01-01

    National audience; Le principal objectif de ce travail est le développement d'un modèle tridimensionnel de l'articulation du genou en grands déplacements. A partir des données d'imagerie médicale (IRM), un modèle géométrique 3D a été développé. Ce modèle est résolu par la méthode des éléments finis. La simulation proposée permet de comprendre le comportement dynamique des différentes structures articulaires lors d'un mouvement de grande amplitude.

  18. Chromosomes and irradiation: in vitro study of the action of X-rays on human lymphocytes; Chromosomes et radiations: etude in vitro de l'action des rayons X sur les lymphocytes humains

    Energy Technology Data Exchange (ETDEWEB)

    Mouriquand, C.; Patet, J.; Gilly, C.; Wolff, C

    1966-07-01

    Radioinduced chromosomal aberrations were studied in vitro on leukocytes of human peripheral blood after x irradiation at 25, 50, 100, 200, and 300 R. The numeric and structural anomalies were examined on 600 karyotypes. The relationship between these disorders and the dose delivered to the blood are discussed. An explanation on their mechanism of formation is tentatively given. (authors) [French] L'etude in vitro des anomalies chromosomiques radioinduites a ete pratiquee sur des leucocytes de sang peripherique preleve chez 4 sujets et irradie aux doses de 25, 50, 100, 200, 300 R. Les aberrations numeriques et structurales ont ete examinees sur 600 caryotypes. Les rapports entre ces anomalies et les doses appliquees sont etudies. Une hypothese sur leur mecanisme de formation est avancee. (auteurs)

  19. Le facteur humain dans la mise en oeuvre de la sécurité et de la sûreté maritimes : analyse de l'inscription de la Tunisie dans l'ordonnancement juridique international

    OpenAIRE

    Ismaili, Syrine

    2012-01-01

    The frequency of maritime accidents and the extent of the damage some of them cause, can cast doubt on the effectiveness of maritime safety and security measures. At the same time, the ever increasing rôle played by man in such occurrences has been steadily recognized. Sailors' living and working conditions on board, crew size and working hours are just a few ofthe significant factors wich have contributed to human error. As a result, such factors, should not be excluded from the global organ...

  20. Différenciation génétique des populations humaines pour les gènes de la réponse aux médicaments

    OpenAIRE

    Patillon, Blandine

    2014-01-01

    Response to drug treatment can be highly variable between individuals, both in terms of therapeutic effect (efficacy) and of adverse reactions (toxicity).Genetic factors affecting drug pharmacodynamics and pharmacokinetics play a major role in this inter-individual variability. Some of these factors are heterogeneously distributed among human populations. Local adaptation of populations to their environment partly explained those differences. Indeed,during human evolution, populations had to ...

  1. Human and technical factors in the doses reduction and optimization at Cogema/Marcoule; Facteurs techniques et humains dans la reduction et l'optimisation des doses a Cogema/Marcoule

    Energy Technology Data Exchange (ETDEWEB)

    Bourgogne, J.L. [Cogema, 30 - Marcoule (France)

    1998-07-01

    In the case of Cogema/Marcoule, the constant decrease of radiation doses is attributed to three factors: technical with a surveillance system and doses optimization, relational with the promotion of confidence in teams of radiation protection services as an acceptation factor of radiation protection techniques and psychological with an evolution of minds towards the ALARA approach. (N.C.)

  2. Listériose Humaine : Expériences Cliniques Avec Cette Zoonose Chez 12 Patients en Estrie, Québec Sur une Période de 19 ans (1976 à 1995

    Directory of Open Access Journals (Sweden)

    Pierre-Jean Maziade

    1997-01-01

    Full Text Available Une étude rétrospective a été faite dans le but de réviser l’épidémiologie, les facteurs de risque, les manifestations cliniques et l’évolution des cas d’infection à Listeria monocytogenes en Estrie, Québec de 1976–1995. Les patients ont été repérés à partir des cultures positives et du diagnostic donné par le Service des maladies infectieuses du Centre hospitalier universitaire de Sherbrooke, Sherbrooke, Québec. Un total de 12 patients ont fait partie de l’étude. La septicémie non reliée à la grossesse (4/12 et la méningite (6/12 ont été les deux présentations cliniques majeures. Il y avait 1 cas de listériose de grossesse et 1 cas de granulomatosis infanti septica. Dix patients avaient au moins une condition prédisposante. Un seul décès a été attribué à l’infection à L monocytogenes. Des séquelles neurologiques ont été observées chez la moitié des patients avec méningite tandis qu’aucune séquelle a été notée chez ceux avec septicémie. En conclusion, la listériose est une maladie de patients âgés et immunocompromis. La présentation clinique et l’évolution ne sont pas différentes de ce qui a déjà été rapporté dans d’autres régions industrialisées.

  3. Caractérisation et rôles du récepteur apparenté aux récepteurs des oestrogènes-γ (ERRγ) dans le placenta humain normal et pathologique

    OpenAIRE

    Poidatz, Dorothée

    2015-01-01

    Human placenta is a vital organ for pregnancy support and fetal development. The chorionic villi is the structural and functional unit of the placenta and is mainly constituted by trophoblastic cells. The trophoblast differentiate in villous endocrine and extra-villous invasive trophoblast. Placental development and its numerous functions require the availability of high energy. Placental energetic metabolism control is partially mediated by the regulation of mitochondrial activity.Mitochondr...

  4. Etude de nouveaux biomarqueurs de toxicité induite par des micropolluants (benzo(a)pyrène et phtalate de bis(2-ethylhexyle)) sur des modèles de placenta humain

    OpenAIRE

    Wakx, Anaïs

    2014-01-01

    Prenatal exposure to pollutants is commonly evaluated using placenta as a barrier between mother and fetus. Here, we consider placenta as a target organ for toxic agents. To achieve this, we selected a trophoblastic cell model, which is adapted to toxicological studies. In clinical studies, pregnancy pathologies are associated to changes in human placental lactogen (hPL) and human chorionic gonadotropin (hCG) secretions. Our in vitro work links exposure to micropollutants (mono(2-ethylhexyl)p...

  5. OPTICS (Operational Threat Integrated Corrective Spectacles) Production and Initial Human Factors Testing (Lunettes Optics (Lunettes Correctrices Integrees a L’equipment de protection Contre les Menaces Operationnelles) - Production et Essais Initiaux Relatifs Aux Facteurs Humains)

    Science.gov (United States)

    2006-06-01

    lentilles correctrices rapportées qui soient compatibles avec les lunettes de protection balistique et qui permettent l’utilisation à l’intérieur du...dispositif; le concept 0 a pris pour point de départ des lentilles rapportées de prescription commerciales courantes de type sportif, le concept 1 s’est...pouvant utiliser des lentilles de prescription intégrées à des lunettes de protection balistique et à un respirateur C4 a été bien reçu. Les participants

  6. L’Argentina dall’impunità alla verità, giustizia e memorializzazione delle violazioni dei diritti umani / Argentine from the impunity to the truth, justice and memorialisation of humain rights violations

    Directory of Open Access Journals (Sweden)

    Gennaro Carotenuto

    2015-01-01

    The presidency of Néstor Kirchner (2003-2007 in Argentina marks a before and an after in the history of transitional justice in the world. He arrived in the Casa Rosada after the financial default of 2001. Kirchner builds its legitimacy on the basis of latinoamericanism, the criticism of the neoliberal model and the defense of human rights. After the initial rush of Raúl Alfonsín, who processed the heads of the dictatorship after the defeat of the Falklands/Malvinas war, impunity in Argentina characterized the following twenty years. Within a few weeks impunity laws were erased. This, not only opens the doors to justice for the 30,000 disappeared people of the last dictatorship (1976-1983, but marks a real change of hegemony in which human rights become state policy and a sort of a new civil religion of the Argentine state.

  7. Sujet, être, être-là : Heidegger, ou l’être humain entre pensée juive et philosophie grecque Subject, Being, Being-there: Heidegger or the Human Being between Jewish Thinking and Greek Philosophy

    Directory of Open Access Journals (Sweden)

    Josef Schovanec

    2011-10-01

    Full Text Available In the sixties and seventies, theoretical discussions in European social sciences focused on the nature of the human being. Proponents of the rational subject, characterizing. Enlightenment-prone Western classical philosophy, went against the advocates of the much older and less-known anti-subjective tradition. Our study aims at giving an archaeological insight into this second paradigm, going back first to Heidegger, the master thinker of contemporary European social sciences, then to the religious – mainly Jewish – roots of his thought. It views human being not as an achieved and autonomous entity, but as an emanation of the Being. Men have to follow the path it sets and its voice, free themselves from material assets which are mere impediments, and eventually enter into a superior dimension of thinking. Beyond our limited case-study, the whole question of the persistence of another main - albeit forgotten - way of thinking in the very heart of modernity is being raised anew.

  8. État des connaissances et incertitudes sur le changement climatique induit par les activités humainesScientific basis and uncertainties of human induced climate change

    Science.gov (United States)

    Duplessy, Jean-Claude

    2001-12-01

    During the 20th century, the mean temperature of the air at the ground level has increased by 0.6±0.2 °C and the warmest air temperatures occurred after 1980. These were significantly warmer than those of the last millennium. Simultaneously, rain and drought, cold and heat wave frequencies have changed, mountain glaciers retreated and the sea-level increased by ˜10 cm. This warming was at least in part induced by human activities and will continue during the next decades. Its amplitude will depend on the rate of greenhouse gas and sulphate aerosols emissions, i.e. on energetic scenarios. Pending scientific uncertainties include cloud variations and interactions between the physical parts of the climate system and the biogeochemical cycles and the biosphere.

  9. Development of emergency response training program based on human factors; Developpement d'un programme de formation pour la reaction aux situations d'urgences base sur les facteurs humains

    Energy Technology Data Exchange (ETDEWEB)

    Nakata, Y. [Osaka Gas Co., Ltd. (Japan)

    2000-07-01

    A training program has been developed at Osaka Gas Co., Ltd. to improve personal response to emergency situations by enabling plant shift chiefs to understand the unique human behavioral patterns that appear during emergencies. The program provides comprehensive and systematic training consisting of lectures and seminars based on a Human Factor Handbook, simulation training, and feedback training. The program can also be applied to all areas of the process industry. (author)

  10. Inflammatory cytokine regulation by LPS and lymphoid cells in human gamma-irradiated monocytes/macrophages; Regulation des cytokines de l`inflammation en presence de LPS ou de lymphocytes dans les monocytes/macrophages humains irradies

    Energy Technology Data Exchange (ETDEWEB)

    Pons, I.; Gras, G.; Dormont, D. [Centre de Recherches du Service de Sante des Armees, La Tronche, 38 - Grenoble (France)]|[Centre de Recherches du Service de Sante des Armees - Centre d`Etudes Nucleaires de Fontenay-aux-Roses, 92 (France)]|[Paris-5 Univ., 75 (France)

    1997-12-31

    We have investigated the inflammatory cytokine regulation after ionizing radiation of monocytes/macrophages. We have not evidenced any significant induction of tumour necrosis factor-{alpha}(TNF{alpha}) after irradiation alone. For one donor only out of eight, interleukin-1{beta}(IL-l{beta}) gene expression was affected by {gamma}-irradiation, with a 2-3-fold increase in level, while for two other donors, interleukin-6 (IL-6) mRNA expression was 5-14 fold increased. For one of the eight donors tested, monocytes/macrophages responded to 10 Gy {gamma}-rays by releasing inflammatory cytokines. In the presence of LPS, a significant increase of IL-1{beta} mRNA expression was detected in 10 Gy {gamma}-irradiated cells treated with 1 {mu}g/ml LPS. In most cases, combination of LPS treatment and 10 Gy irradiation down-regulated cytokine secretion except for a TNF{alpha} induction at 6 h post-irradiation. In the presence of lymphoid cells, IL-6 mRNA level was increased in irradiated cells at 24 h. Increases of IL-1{beta} and IL-6 releases were detected at 24 h post-irradiation too. (authors)

  11. L’Homme, un itinéraire vietnamien. Humanisme et sujet humain au xxe siècle Man, a Vietnamese Itinerary. Humanism and the Human Subject in the 20th Century

    Directory of Open Access Journals (Sweden)

    Daniel Hémery

    2009-10-01

    Full Text Available Cette étude interroge la confrontation qui s’est instaurée au Vietnam depuis le milieu du xixe siècle – et sans doute bien avant – entre la conception de l’homme-individu importée par les Occidentaux en Asie orientale et les philosophies du sujet qui s’y étaient développées depuis l’antiquité chinoise. Cette confrontation a-t-elle abouti dans la culture vietnamienne à une réévaluation socialement acceptée du statut du sujet et sur une nouvelle figure de l’humanisme ? Quel bilan provisoire dresser ?This paper examines the mid 19th century encounter in Vietnamese culture of the concept of the individual imported by Westerners to Far East Asia with the philosophical tradition of the human subject that has developed in China since the classic period. Did this conflictual encounter result in a new, socially acceptable evaluation of the human statute and in a renewed Vietnamese humanism? This article concludes with a provisional assessment of a cultural confrontation.

  12. Consequences of gamma-irradiation on inflammatory cytokine regulation in human monocytes/macrophages; Consequences de l`irradiation gamma sur la regulation des cytokines de l`inflammation dans les monocytes/macrophages humains

    Energy Technology Data Exchange (ETDEWEB)

    Pons, I.; Gras, G.; Dormont, D.

    1995-12-31

    Inflammation is a frequent radiation-induced damage, especially after therapeutic irradiation. In this study, we have investigated, the inflammatory cytokine regulation after ionizing irradiation of monocytes/macrophages from four donors. Semi-quantitative RT-PCR revealed, after in vitro 24 h-differentiated monocytes irradiation between 5 to 40 Gy, no induction of interleukin-I{beta} (IL I{beta}), interleukin-6 (IL-6) and tumor necrosis factor-{alpha} (TNF-{alpha} mRNA) expression. Moreover, protein quantitation shows no significant increase of post-irradiation secretion. (author). 6 refs.

  13. Modèles animaux et pathologies humaines : caractérisation de 3 lignées murines ENU présentant des anomalies du système vestibulaire ou locomoteur

    OpenAIRE

    El Hakam , Carole

    2016-01-01

    The random chemical mutagenesis with the Ethyl-Nitroso-Urea (ENU), whose power has been widely demonstrated during these last decades in the murine models creation, is a remarkable and essential tool in functional genomics. This approach is indeed a significant contribution to the understanding of the genes’ function and regulation; it also establishes an accelerator to identify the key elements in a signaling pathway. This systematic approach, based on the simultaneous screening of a large n...

  14. Reconstruction 3D du bassin humain à partir d'images médicales multimodales incomplètes. Application à l'assistance de la chirurgie de la prothèse totale de la hanche (PTH).

    OpenAIRE

    Amavizca Ruiz, Ligia Miriam

    2005-01-01

    This research topic is related to the previous Sharp team project. It will be ended at the end of 2005 (with the Miriam Amavizca's ph-D). This year, a paper related to our previous work on the dynamic and interactive simulation applied to an echographic medical procedure, has been published in a medical journal.We have worked in computer aided surgery for the Total Hip Prosthesis (THP) in collaboration with Aesculap-BBraun. The aim of the project is to obtain a CT/MRI-free 3D volume generatio...

  15. Use of recombinant human thyrotropin (rh TSH) as a method of preparation for radioiodine therapy in thyroid disorders; Utilisation de la thyreostimuline humaine recombinante dans la preparation au traitement par iode-131 des pathologies thyroidiennes

    Energy Technology Data Exchange (ETDEWEB)

    Taieb, D.; Guillet, B.A.; Tessonnier, L.; Mundler, O. [Centre Hospitalo-Universitaire de la Timone, Service Central de Biophysique et de Medecine Nucleaire, 13 - Marseille (France)

    2008-02-15

    The introduction of recombinant human TSH (rh TSH) as a method of preparation for radioiodine therapy of follicular-derived thyroid tumors (benign and malignant) is a significant medical advance. Rh TSH has been approved for use in remnants ablation after total thyroidectomy for carcinoma. There are other potential uses for rh TSH that have not yet been licensed. The use of rh TSH allows to reduce administrated doses in goiters through an increase of iodine uptake and a more homogeneous distribution of radioiodine in the gland. Rh TSH also improves thyroid cancer patients quality of life by avoiding hypothyroidism. (authors)

  16. Analyse des génomes à la recherche de répétitions en tandem polymorphes : outils d?épidémiologie bactérienne et locus hypermutables humains

    OpenAIRE

    Denoeud , France

    2003-01-01

    thèse soutenue par la DGA; Tandem repeats are consecutive occurrences of a DNA unit. Such structures are found in all organisms, prokaryotes as well as eukaryotes. Although their biological function is not fully understood, they have diverse practical applications. In bacteria, polymorphic tandem repeats (with varying copy numbers), are powerful tools for strain identification in bacterial epidemiology. In humans, some tandem repeats mutate at a very high rate: hypermutable minisatellites are...

  17. Light ions radiobiological effects on human tumoral cells: measurements modelling and application to hadron-therapy; Mesures et modelisation des effets radiobiologiques des ions legers sur des cellules tumorales humaines: application a l'hadrontherapie

    Energy Technology Data Exchange (ETDEWEB)

    Jalade, P

    2005-11-15

    In classical radiotherapy, the characteristics of photons interactions undergo limits for the treatment of radioresistant and not well located tumours. Pioneering treatments of patients at the Lawrence Laboratory at Berkeley has demonstrated two advantages of hadrons beams: the Relative Biologic Effect (the RBE) and the ballistic of the beams. Since 1994, the clinical centre at Chiba, has demonstrated successfully the applicability of the method. A physics group, managed by G. Kraft, at Darmstadt in Germany, has underlined the advantages of carbon beams. An European pool, called ENGIGHT (European Network for LIGHt ion Therapy) has been created in which the French ETOILE project appeared. The purpose of the thesis concerns measurements and models of 'in vitro' human cells survival. In the first part, the nowadays situation in particles interactions, tracks and cells structures and radiobiology is presented here. The second is devoted to the models based on the beam tracks and localization of the physical dose. Discussion of sensitivity to various parameters of the model has been realized with the help of numerical simulations. Finally the predictions of the improved model has been compared to experimental irradiations of human cells with argon and carbon beams of the GANIL machine. Conclusion of such study shows the performance and limits of a local model for predicting the radiobiological efficiency of light ions in hadron-therapy. (author)

  18. Les caractéristiques du bassin des australopithèques (A. robustus, A. africanus et A. afarensis) sont-elles liées à une bipédie de type humain?

    OpenAIRE

    Berge, Christine; Ponge, Jean-François

    1983-01-01

    International audience; Deux bassins (STS 14, AL 288) et cinq os coxaux d'Australopithèques (SK 50, SK 3155. MLD 7), ainsi qu'un os coxal de Homo erectus (OH 28) ont été étudiés biométriquement à l'aide d'un programme d'analyse des correspondances, en comparaison avec la totalité des Simiens catarrhiniens (367 individus adultes appartenant à 19 genres). 16 mesures ont été prises sur le bassin, dont 11 sur l'os coxal seul. Les Australopithèques forment un groupe de Bipèdes avec le genre Homo (...

  19. Silver Games : étude des facteurs humains dans le développement de jeux vidéos adaptés aux personnes âgées

    OpenAIRE

    Legouverneur, Gregory

    2014-01-01

    For many years, research in the field of aging has focused on understanding this complex phenomenon and identifying solutions to medical, economic, psychological or sociological issues linked to it. In this context, the aim of this thesis was to identify factors that facilitate the use of video games as a medium for cognitive stimulation in older adults. To answer this question, two studies were carried out: the first one focused on exploring the gameplay of the Nintendo Wii, and the second o...

  20. Study of the cell cycle control for human malignant mesothelioma lines. Interferon and radiations effect; Etude de la regulation du cycle cellulaire de lignees de mesotheliome malin humain. Effet de l'interferon et des radiations

    Energy Technology Data Exchange (ETDEWEB)

    Vivo, C

    1999-07-01

    In order to better understand the inhibition mechanisms of the IFN-R-HU on tumoral development, the IFN-R-U effect on MM lines has been studied. Three groups of lines has been distinguished: eight sensitive lines, two intermediate and three resistant. The sensitive lines showed a triple locking of the cell cycle: in phases S, G1 and G2. The study of the cell cycle control points function, realized by the MM lines radiation exposure showed the points function on G1/S and-or on G2/M and the dependence or non dependence of the cycle stop of the protein P53 and P21 W at F1/CIP1. (A.L.B.)

  1. The effect of carotid sinus massage is independent of posture in patients with heart disease

    DEFF Research Database (Denmark)

    Mickley, H; Hansen, K N; Oxhøj, H

    1989-01-01

    The influence of posture on the effect of carotid sinus massage (CSM) in patients with heart disease has not been systematically evaluated. In the present study CSM was performed in 80 patients (mean age 55 +/- 10 (SD) years) suffering from various cardiovascular diseases. Each subject had....... These results imply that posture does not influence the effect of CSM in patients suffering from heart disease....

  2. The effect of carotid sinus massage is independent of posture in patients with heart disease

    DEFF Research Database (Denmark)

    Mickley, H; Hansen, K N; Oxhøj, H

    1989-01-01

    The influence of posture on the effect of carotid sinus massage (CSM) in patients with heart disease has not been systematically evaluated. In the present study CSM was performed in 80 patients (mean age 55 +/- 10 (SD) years) suffering from various cardiovascular diseases. Each subject had...... unilateral right- and left-sided CSM performed in the supine and in the sitting position, while heart rate and systolic blood pressure were monitored. No statistically significant differences in the CSM-induced response in systolic blood pressure or heart rate were found between the two postures....... These results imply that posture does not influence the effect of CSM in patients suffering from heart disease....

  3. Replacing soybean meal for cottonseed meal on performance of lactating dairy cows.

    Science.gov (United States)

    Imaizumi, Hugo; De Souza, Jonas; Batistel, Fernanda; Santos, Flávio Augusto Portela

    2016-01-01

    Cottonseed meal (CSM) is an alternative source of protein, and previous studies have been shown that it can replace soybean meal (SBM) without decrease animal performance. However, Brazilian CSM has a different chemical composition compared with the usual CSM reported in the literature. The objective of this experiment was to evaluate the effects of replacing SBM for Brazilian CSM on performance and energy balance of mid-lactating dairy cows. Forty-two Holstein cows were used in a replicate 3 × 3 Latin square design. Increasing contents of CSM (0, 15, and 30% of dry matter (DM)) were fed in diets to replace SBM. Milk yield and feed efficiency were linearly reduced with the replacement of CSM for SBM (P = 0.001). Milk fat content tended to increase quadratically (P = 0.07) with CSM addition. Replacing SBM for CSM affected milk protein content quadratically (P = 0.05). Milk urea nitrogen and plasma urea nitrogen (PUN) tended to respond quadratically (P = 0.06 and 0.10) when CSM replaced SBM to the diets. Variation in body weight (BW) also responded quadratically as CSM replaced SBM (P = 0.05). Altogether, the findings suggest better performance when cows receive SBM diet compared with the Brazilian CSM diet.

  4. A safety study of thallium-containing ceramic superconductor material in rats.

    Science.gov (United States)

    Mulkey, J P; Oehme, F W

    1998-02-01

    Thallium is a highly toxic cumulative poison in humans and animals. The use of the metal as a component in ceramic superconductor material (CSM) raised concern about the health risk of CSM to children accidentally swallowing some of the CSM or to occupationally-exposed workers in the electronics industry. This study examined the biological availability of CSM by quantifying the thallium content in organs, blood and fecal matter of Sprague-Dawley rats after a single acute oral exposure to CSM and compares these values to similar thallium measurements from identical exposure to thallium sulfate. The CSM-exposed group had significantly less thallium than the thallium sulfate-exposed group in all tissues/fluids analyzed. This suggested that CSM poses a lower health risk to exposed persons than thallium sulfate.

  5. 22 Sanou_F 03.pmd

    African Journals Online (AJOL)

    hond

    au niveau du corps humain, il peut s'agir d'un faux visage, de l'aspect réel d'un visage humain ; au niveau des arts plastiques, le masque peut être la reproduction d'un visage humain ou animal ; le masque peut aussi être un simple objet à l'image des masques à gaz, d'une élévation de terre, d'un abri en acier, etc. Il existe ...

  6. Fate and ultra-structural features of chicken skin mucosa around juvenile polyps.

    Science.gov (United States)

    El-Hodhod, M A; Soliman, A A; Hamdy, A M; Abdel-Rahim, A A; Abdel-Hamid, F K

    2011-03-01

    Chicken skin mucosa (CSM) is a common finding around juvenile polyps in children. Its ultrastructural features and fate after polypectomy are not yet clear. The aim was to study ultra-structural features and outcome of this CSM compared to that of the polyps and distant endoscopically normal mucosa. From 240 children with juvenile polyps, 45 needed a second colonoscopy. Thirty six patients showing CSM represented the cohort of this study. One polyp only was studied in each patient. The histologic features of the CSM were compared to normal and polyp mucosa. The fate of CSM was evaluated in the second colonoscopy. The mean numbers of intraepithelial lymphocytes, as well as lamina propria inflammatory cellular infiltrates were significantly higher in polyp mucosa than in CSM. Goblet cells were significantly higher in CSM compared to normal mucosa with marked depletion in the polyp mucosa. The muscularis mucosae thickness was significantly higher in CSM compared to polyps (ppolyp showed the most intense mucosal inflammatory reaction. CSM with the unique thickening of muscularis mucosae especially around larger polyps almost disappeared after polypectomy. So these results suggest that CSM is a benign compensatory reaction induced by the mechanical effect of the polyp.

  7. X-RAY EMISSION FROM STRONGLY ASYMMETRIC CIRCUMSTELLAR MATERIAL IN THE REMNANT OF KEPLER'S SUPERNOVA

    Energy Technology Data Exchange (ETDEWEB)

    Burkey, Mary T.; Reynolds, Stephen P.; Borkowski, Kazimierz J.; Blondin, John M., E-mail: reynolds@ncsu.edu [Department of Physics, North Carolina State University, Raleigh NC 27695-8202 (United States)

    2013-02-10

    Kepler's supernova remnant resulted from a thermonuclear explosion, but is interacting with circumstellar material (CSM) lost from the progenitor system. We describe a statistical technique for isolating X-ray emission due to CSM from that due to shocked ejecta. Shocked CSM coincides well in position with 24 {mu}m emission seen by Spitzer. We find most CSM to be distributed along the bright north rim, but substantial concentrations are also found projected against the center of the remnant, roughly along a diameter with position angle {approx}100 Degree-Sign . We interpret this as evidence for a disk distribution of CSM before the supernova, with the line of sight to the observer roughly in the disk plane. We present two-dimensional hydrodynamic simulations of this scenario in qualitative agreement with the observed CSM morphology. Our observations require Kepler to have originated in a close binary system with an asymptotic giant branch star companion.

  8. What Is Commercial Social Marketing?

    DEFF Research Database (Denmark)

    Anker, Thomas Boysen; Stead, Martine

    of CSM. In relation to the benchmark criteria, the second section focuses on 3 key ethical challenges in CSM. a) We describe the problem of paternalism and suggest that CSM can deal with it by anchoring social campaigns in the target groups’ world-view. b) We address the problem of power imbalances......The aim of this paper is to introduce the concept of commercial social marketing (CSM) and discuss some major ethical aspects of CSM. In the first section, we introduce 6 social marketing benchmark criteria. Against this background, we demonstrate Dove’s ‘Campaign for Real Beauty’ to be an instance...... and argue why it is more severe in non-profit social marketing. c) We argue that CSM could create a new and unethical kind of social competition due to its inherent motivation to gain ownership of the social cause it addresses....

  9. Dicty_cDB: SSF750 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available S/VSD3-D/VSD385Q.Seq.d/ 722 0.0 VSA477 (VSA477Q) /CSM/VS/VSA4-D/VSA477Q.Seq.d/ 722 0.0 SSM291 (SSM29...1Q) /CSM/SS/SSM2-D/SSM291Q.Seq.d/ 722 0.0 SSL667 (SSL667Q) /CSM/SS/SSL6-C/SSL667Q.Seq.d/

  10. Dicty_cDB: SSB618 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available /VS/VSC8-B/VSC830Q.Seq.d/ 468 e-131 SSM714 (SSM714Q) /CSM/SS/SSM7-A/SSM714Q.Seq.d/ 468 e-131 SSM290 (SSM29...0Q) /CSM/SS/SSM2-D/SSM290Q.Seq.d/ 468 e-131 SSL572 (SSL572Q) /CSM/SS/SSL5-C/SSL572Q

  11. Dicty_cDB: SSJ884 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Score E Sequences producing significant alignments: (bits) Value SSM408 (SSM408Q) /CSM/SS/SSM4-A/SSM408Q.Seq.d/ 1072 0.0 SSM29...4 (SSM294Q) /CSM/SS/SSM2-D/SSM294Q.Seq.d/ 1072 0.0 SSL192 (SSL192Q) /CSM/SS/SSL1-D/SSL192

  12. Dicty_cDB: SSE384 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available M408 (SSM408Q) /CSM/SS/SSM4-A/SSM408Q.Seq.d/ 317 6e-86 SSM376 (SSM376Q) /CSM/SS/SSM3-D/SSM376Q.Seq.d/ 317 6e-86 SSM294 (SSM29...4Q) /CSM/SS/SSM2-D/SSM294Q.Seq.d/ 317 6e-86 SSM193 (SSM193Q) /CS

  13. Dicty_cDB: VHJ842 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 845 (VSD845Q) /CSM/VS/VSD8-B/VSD845Q.Seq.d/ 46 0.001 VSD104 (VSD104Q) /CSM/VS/VSD1-A/VSD104Q.Seq.d/ 46 0.001 SSM293 (SSM29...3Q) /CSM/SS/SSM2-D/SSM293Q.Seq.d/ 46 0.001 own update 2004.12.24 Homology vs DNA Score E Seque

  14. Dicty_cDB: SSJ239 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 79Q.Seq.d/ 944 0.0 SSM408 (SSM408Q) /CSM/SS/SSM4-A/SSM408Q.Seq.d/ 936 0.0 SSM294 (SSM29...4Q) /CSM/SS/SSM2-D/SSM294Q.Seq.d/ 936 0.0 SSL192 (SSL192Q) /CSM/SS/SSL1-D/SSL192Q.Seq.d/ 936 0.0 SSL18

  15. Dicty_cDB: SSC582 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SM-cDNA Score E Sequences producing significant alignments: (bits) Value SSC582 (SSC582Q) /CSM/SS/SSC5-D/SSC582Q.Seq.d/ 1061 0.0 SSM2...90 (SSM290Q) /CSM/SS/SSM2-D/SSM290Q.Seq.d/ 1053 0.0 SSK841 (SSK841Q) /CSM/SS/SSK8-B

  16. Dicty_cDB: SSM376 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available M376Q.Seq.d/ 1043 0.0 SSM294 (SSM294Q) /CSM/SS/SSM2-D/SSM294Q.Seq.d/ 1043 0.0 SSL...Q.Seq.d/ 1043 0.0 SSM408 (SSM408Q) /CSM/SS/SSM4-A/SSM408Q.Seq.d/ 1043 0.0 SSM376 (SSM376Q) /CSM/SS/SSM3-D/SS

  17. Dicty_cDB: SSC489 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SSK107 (SSK107Q) /CSM/SS/SSK1-A/SSK107Q.Seq.d/ 325 3e-88 SSM714 (SSM714Q) /CSM/SS/SSM7-A/SSM714Q.Seq.d/ 230 1e-59 SSM290 (SSM29...0Q) /CSM/SS/SSM2-D/SSM290Q.Seq.d/ 230 1e-59 SSK556 (SSK556Q) /

  18. Dicty_cDB: SSE630 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available A/SSM408Q.Seq.d/ 910 0.0 SSM376 (SSM376Q) /CSM/SS/SSM3-D/SSM376Q.Seq.d/ 910 0.0 SSM294 (SSM29...4Q) /CSM/SS/SSM2-D/SSM294Q.Seq.d/ 910 0.0 SSL192 (SSL192Q) /CSM/SS/SSL1-D/SSL192Q.Seq.d/ 910 0.0

  19. Dicty_cDB: SSC461 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Sequences producing significant alignments: (bits) Value SSM408 (SSM408Q) /CSM/SS/SSM4-A/SSM408Q.Seq.d/ 1082 0.0 SSM294 (SSM29...4Q) /CSM/SS/SSM2-D/SSM294Q.Seq.d/ 1082 0.0 SSK729 (SSK729Q) /CSM/SS/SSK7-B/SSK729Q.Seq.d/

  20. Near infrared reflectance spectroscopy for the determination of free gossypol in cottonseed meal

    OpenAIRE

    Lordelo, M.M.; Shaaban, S.A.; Dale, N.M.; Calhoun, M.C.; Vendrel, P.F.; Davis, A.J.

    2008-01-01

    Gossypol is a toxic polyphenolic compound produced by the pigment glands of the cotton plant. The free gossypol content of cottonseed meal (CSM) is commonly determined by the American Oil Chemists’ Society (AOCS) wet chemistry method. The AOCS method, however, laboratory-intensive, time-consuming, and therefore, not practical for quick field analyses. To determine if the free gossypol content of CSM could be predicted by near infrared reflectance spectroscopy (NIRS), CSM sample...

  1. Adapting the Army’s Training and Leader Development Programs for Future Challenges

    Science.gov (United States)

    2013-01-01

    Headquarters TRADOC, CSM Dean Keveles at the Fires Center of Excellence, CSM Raymond Chandler and SMA Richard Rosen at the Ser- geants Major Academy, 1SG...of Staff of the Army CSM Command Sergeant Major CTC Combat Training Center DA Department of the Army DAMO-FM Army G-3/5/7 Force Management...Coordination Council Workshop TCM TRADOC Capability Managers TD Training Development TD2 Training Doctrine and Development TDY temporary duty TESS Tactical

  2. Dicty_cDB: CHP286 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available EEDGDS NTTKKDGGDDDNNDDINKPTREIFIEAHKSLSNSDKEERLLLLESWKEFEQTFGNQETLN QVLKKIXTKSYQKKK*w*wwy*rifrlyxspeeekstqtxlklxrsxxkawxeiktatx...lyxspeeekstqtxlklxrsxxkawxeiktatxn yktqqntkttt Homology vs CSM-cDNA Score E Seque

  3. Dicty_cDB: VFC405 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available vvvkrptapvrrsnplknlramiklnp aavstrrtqvkslkskgikvskknqlraklvaatxnq*x Translated Amino Acid sequence (All Fram...trrtqvkslkskgikvskknqlraklvaatxnq*x Homology vs CSM-cDNA Score E Sequences producing significant alignments:

  4. Proteomic comparison by iTRAQ combined with mass spectrometry of egg white proteins in laying hens (Gallus gallus) fed with soybean meal and cottonseed meal

    Science.gov (United States)

    He, Tao; Zhang, Haijun; Wang, Jing; Wu, Shugeng; Yue, Hongyuan; Qi, Guanghai

    2017-01-01

    Cottonseed meal (CSM) is commonly used in hens’ diets to replace soybean meal (SBM). However, the molecular consequences of this substitution remains unclear. To investigate the impact of this substitution at the molecular level, iTRAQ combined with biochemical analysis was performed in Hy-Line W-36 hens supplemented with a mixed diet of CSM and SBM. Egg weight, albumen height, and Haugh unit were significantly reduced in the CSM100 group (100% crude protein of SBM replaced by CSM) compared with the SBM group (Phen diet. PMID:28813468

  5. Exploring the physics of unstable nuclei

    International Nuclear Information System (INIS)

    Volya, Alexander

    2015-01-01

    In this presentation the Continuum Shell Model (CSM) approach is advertised as a powerful theoretical tool for studying physics of unstable nuclei. The approach is illustrated using 17 O as an example, which is followed by a brief presentation of the general CSM formalism. The successes of the CSM are highlighted and references are provided throughout the text. As an example, the CSM is applied perturbatively to 20 O allowing one to explore the effects of continuum on positions of weakly bound states and low-lying resonances, as well as to discern some effects of threshold discontinuity. (author)

  6. Dicty_cDB: SFK717 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available nqiapllnvldqyvnhiid*t*pil vvvvvnhvqvshvlfksnivkmvkfqlvvvhvhlnqlknqivqkfhvqrf*niakegel...snwllsmytstn*ktrlfkssmskdfkilprkvnfq lvvvhvhlnqlknqivqefhvqrf*ntvkegelptglxsmytstn*ktrl--- Homology vs CSM-c

  7. Dicty_cDB: VSB406 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available GTVRKAIARVLTVFNQTQKNHLR XVYSKKSSSKIPTDLRYKKTRAIRRRLTNKQSKVVTLRVSKTATNFPQRVFAVKA*ici* milknkiy Translated Ami...RRLTNKQSKVVTLRVSKTATNFPQRVFAVKA*ici* milknkiy Homology vs CSM-cDNA Score E Sequences producing significant a

  8. Dicty_cDB: VFD272 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available NIDGLKNVQTICYNNMSQCYLKEKKVPMLW*lqkkh*nyhqmilkhsl eklklyl*wrnmmklskiskks Translate...IAK YNKALRYLDCCSNIDGLKNVQTICYNNMSQCYLKEKKVPMLW*lqkkh*nyhqmilkhsl eklklyl*wrnmmklskiskks Homology vs CSM-cDNA

  9. Dicty_cDB: VHI505 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available LYAAELTASPTLLEPIYLVEITAPENAIGG IYSVLNRRXGICYW*rtsyrfpiixcqssfxsirixrfx Translated Amino Acid sequence (All F...RRXGICYW*rtsyrfpiixcqssfxsirixrfx Homology vs CSM-cDNA Score E Sequences producing significant alignments: (

  10. Dicty_cDB: AFN285 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FAXTARXVGDGIXIPAXEGYELXKXGAEXTWVXKY*rlslixixkaxqxmaeqxxx xrfmqxxsxxxrlqxnxxrxxpir...XTWVXKY*rlslixixkaxqxmaeqxxx xrfmqxxsxxxrlqxnxxrxxpirt Homology vs CSM-cDNA Score E Sequences producing sign

  11. Dicty_cDB: Contig-U14032-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available IIIIIITIIIXXIXIXKXXXXXYXY Frame B: xxxxxxkxxxxxkxkkx*kkx*k*x********q***xx*xxkkxxxxxxii Frame C: xxxxxxxxkxxxx...kkxnkkxnknxnnnnnnnnnnnnxnxxnxkkxxxxxxls own update ---------- Homology vs CSM-c

  12. Dicty_cDB: SSE465 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available WGIKGYILMSKDRKNNCGIASVSSYPLA*iygskmnrrmfgsi **pemffy*knknknnnf*ly Translated Amin...YWIVKNSWGTSWGIKGYILMSKDRKNNCGIASVSSYPLA*iygskmnrrmfgsi **pemffy*knknknnnf*ly Homology vs CSM-cDNA Score E Se

  13. Dicty_cDB: SSD327 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available EGPVLNRKQTIVIHKNEDN KVESSDDSSDSVRPKANNYWIVKNSWGTSWGIKGYILMSKDRKNXCGIASVSSYPLA*iy gskmnrrmfgsi**pemf...DRKNXCGIASVSSYPLA*iy gskmnrrmfgsi**pemffy*knknknnnf*l* Homology vs CSM-cDNA Score E Sequences producing sign

  14. Dicty_cDB: SLA477 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available QGKDDEGPVLNRKQTIVIHKNED NKVESSDDSSDSVRPKANNYWIVKNSWGTSWGIKGYILMSKDRKNNCGIASVSSYPLA*i ygskmnrrmfgsi**pemf...IKGYILMSKDRKNNCGIASVSSYPLA*i ygskmnrrmfgsi**pemffy*knknknnnf*ly Homology vs CSM-cDNA Score E Sequences produ

  15. Dicty_cDB: SSD746 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available WIVKNSWGTSWGIKGYILMSKDRKNNCGIASVSSYPLA*iygskmnrrmf gsi**pemffy*knknknnnf*l Transl...ESSDDSS DSVRPKANNYWIVKNSWGTSWGIKGYILMSKDRKNNCGIASVSSYPLA*iygskmnrrmf gsi**pemffy*knknknnnf*l Homology vs CSM

  16. Dicty_cDB: SLH872 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available DEGPVLNRKQTIVIHKNEDNKV ESSDDSSDSVRPKANNYWIVKNSWGTSWGIKGYILMSKDRKNNCGIASVSSYPLA*iygs kmnrrmfgsi**pemf...LMSKDRKNNCGIASVSSYPLA*iygs kmnrrmfgsi**pemffy*knknknnnf*lykik Homology vs CSM-cDNA Score E Sequences produci

  17. Dicty_cDB: SSE188 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Acid sequence ---KKNFKIFFLKSILNXNNNGFFFFIKKRKKKXKKKKKEKKNLKKKKKIEKKKLKM*w* nqsrmeiqkkifinchy...EKKNLKKKKKIEKKKLKM*w* nqsrmeiqkkifinchynqcidivpsvcmllgpvcslvtli*iyivifikkkkrkkkt Homology vs CSM-cDNA Score

  18. Dicty_cDB: SSI471 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available o Acid sequence ---KKNIKIFFLKSILNINNNVFFFFIKKRKKKRKKKKKEKKNLKKKKKIEKKKLKM*w* nqsrmeiqkkifinchy...KKKEKKNLKKKKKIEKKKLKM*w* nqsrmeiqkkifinchynqcidivpsvcmllgpvcslvtli*iyivifikkkkkkkknk Homology vs CSM-cDNA Sc

  19. Dicty_cDB: SSM491 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available cid sequence ---KKKKKRKKKNIKIFFLKSILNINNNVFFFFIKKRKKKRKKKKKEKKNLKKKKKIEKK KLKM*w*nqsrmeiqkkifinchy...KKKKKEKKNLKKKKKIEKK KLKM*w*nqsrmeiqkkifinchynqcidivpsvcmllgpvcslvtli*iyivifikk Homology vs CSM-cDNA Score E

  20. Dicty_cDB: VHQ281 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available QVEDFFKQNPVAIADRSIK QDLEQIRNNTKWFNSFNKDLLNWIKK*ii*fnkdl*iwifiknkiylifiifllsfinnk infqin Translated Amino Aci...FFKQNPVAIADRSIK QDLEQIRNNTKWFNSFNKDLLNWIKK*ii*fnkdl*iwifiknkiylifiifllsfinnk infqin Homology vs CSM-cDNA Sco

  1. Dicty_cDB: CHL532 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available QLQQVEDFFKQNPVAIADRSIKQDLEQIRNNTKWFNSFNKDLLNWIKK*ii*fnkdl* iwifiknkiylifiifllsfinnkinfk Translated Amino Aci...EDFFKQNPVAIADRSIKQDLEQIRNNTKWFNSFNKDLLNWIKK*ii*fnkdl* iwifiknkiylifiifllsfinnkinfk Homology vs CSM-cDNA Scor

  2. Dicty_cDB: CFD455 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available NLNNINNGGGKRY DPMSLSNLTNDDEPNPQPTFVTRPQQQPQQQQPQQQQQPQQQQQPQQQQQQPQQQQQQQQ QQQQQQQQQQQQQ--- ---KKKKLIXSSNKSN...mmmnqihnqll*qdpnnnlnnnnlnnnnnlnnnnnlnnnnnnlnnnnnnnn nnnnnnnnnnnnn--- ---kkkkinxiik*ikf*skknkmxlfssxssmstsmsg...ttsttttttstttttttt ttttttttttttt--- ---KKKKLIXSSNKSNFKVKKIKXHSFHQXHLCQPQCLDQNQVLHHLVVEQVW Homology vs CSM-cD

  3. Dicty_cDB: CHH719 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available *VVLVLLYHXLIIQ IWGYTLADPICSLLISILIFLSVLPLIANTAKTLLQCTPEPIXSSXYQINQFIXSIDGVH NIISY...VLLYHXLIIQ IWGYTLADPICSLLISILIFLSVLPLIANTAKTLLQCTPEPIXSSXYQINQFIXSIDGVH NIISYHFWS...ncfxqfxfgy*kn*kinfkifkqrs*ys*vyyriht fti****sttr*rctinxssyp**yss*sffiiiiiisssss*lik*kkvixkvn Homology vs CSM

  4. Dicty_cDB: VHD234 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available IFHDISSYAQSHYRPAALSLS HPLLPMFTTTQQSSNDWNSQYQGVYSPLTSASPLPNGLKIQTLQWLDNQDNTILLRIENI YQIDGQDSQDPQTITLDLSTIFSTITITSATEMNLTGVQKLSNXSS...lsfqqlqsllqlk*i*lvfknyqixqvxxmpkllxvkxmx hxsss Frame B: ---sryxnakennqlssimefxrgstnqw*lctcecyclhsrs*siitihhc...DLSTIFSTITITSATEMNLTGVQKLSNXSSXXNAKTVXGKXYVS XIII Homology vs CSM-cDNA Score E Se

  5. Dicty_cDB: VSE557 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available DLTSSGSRVVVIMEH TTKHGKPKILKNCTLPLTGKSCVNRIITELAVFDVVNGKLELIEVVDGQTVDDIKSKTEA EFTVSKNLKPLQQVEI*nnnnnnnknini...QTVDDIKSKTEA EFTVSKNLKPLQQVEI*nnnnnnnkninis*n Homology vs CSM-cDNA Score E Sequences producing significant a

  6. Dicty_cDB: CFE626 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available hlfxlx*xiixfvlrxlxskif kkkaxnnqxeknxxqqqslflixsffixkrlkrtnk*xnxlf*kaixxlycxllxvssxa xrvxkxskxkxkxtrstttxdxnx...hixka*knx*inxlxilkshxxxll*xixcfvxsx xrxkxxqxeaxxnqidxnxrpqxspfxxf Homology vs CSM-cDNA Score E Sequences pro

  7. Dicty_cDB: CHN682 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available mx*fnwlckhssqc*** *smyrrclyqxnrcysypsqcr**qqmyn*cmyqrrwcnsypsqy***qclyn*cmykrk wcnsysxqy***qclypltpvhhqlafshtpincddxn...xctvxscskfnrvvatppiqwl miiihgtvdscxktnxxvlhtppxwxxdxn--- Homology vs CSM-cDNA Score E Sequences pro

  8. Dicty_cDB: VHF231 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available GSPLLSVKAHLPVLESFGFTADLRSHTAGQAFPQCVFDXWAS IGVVNKDKKAXEVALATRKRKGLAPEIPDLDKFHEKL*ti*val*vfkdxn...GQAFPQCVFDXWAS IGVVNKDKKAXEVALATRKRKGLAPEIPDLDKFHEKL*ti*val*vfkdxnqi*knfkk Homology vs CSM-cDNA Score E Sequ

  9. Dicty_cDB: SSG806 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 16 (SSG616Q) /CSM/SS/SSG6-A/SSG616Q.Seq.d/ 1179 0.0 SSF627 (SSF627Q) /CSM/SS/SSF6-B/SSF627Q.Seq.d/ 1179 0.0 SSM290 (SSM29...0Q) /CSM/SS/SSM2-D/SSM290Q.Seq.d/ 1174 0.0 SSH888 (SSH888Q) /CSM/SS/SSH8-D/SSH888Q.Seq.d/ 1170

  10. Dicty_cDB: SSH501 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 67 (VHP367Q) /CSM/VH/VHP3-C/VHP367Q.Seq.d/ 468 e-131 SSM528 (SSM528Q) /CSM/SS/SSM5-B/SSM528Q.Seq.d/ 468 e-131 SSM293 (SSM29...3Q) /CSM/SS/SSM2-D/SSM293Q.Seq.d/ 468 e-131 SSL530 (SSL530Q) /CSM/SS/SSL5-B/SSL530Q.Seq.d/ 46

  11. Dicty_cDB: SSK107 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available C830Q) /CSM/VS/VSC8-B/VSC830Q.Seq.d/ 601 e-171 SSM714 (SSM714Q) /CSM/SS/SSM7-A/SSM714Q.Seq.d/ 601 e-171 SSM290 (SSM29...0Q) /CSM/SS/SSM2-D/SSM290Q.Seq.d/ 601 e-171 SSK841 (SSK841Q) /CSM/SS/SSK8-B/SSK841Q.Seq.d/ 601 e-17

  12. Dicty_cDB: SSI610 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available s: (bits) Value SSM417 (SSM417Q) /CSM/SS/SSM4-A/SSM417Q.Seq.d/ 1055 0.0 SSM408 (SSM408Q) /CSM/SS/SSM4-A/SSM408Q.Seq.d/ 1055 0.0 SSM29...4 (SSM294Q) /CSM/SS/SSM2-D/SSM294Q.Seq.d/ 1055 0.0 SSL192 (SSL192Q) /CSM/SS/SSL1-D/

  13. Dicty_cDB: SSL375 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ) /CSM/SS/SSC1-D/SSC196Q.Seq.d/ 410 e-114 SSC192 (SSC192Q) /CSM/SS/SSC1-D/SSC192Q.Seq.d/ 410 e-114 SSM295 (SSM29...5Q) /CSM/SS/SSM2-D/SSM295Q.Seq.d/ 398 e-110 SSE301 (SSE301Q) /CSM/SS/SSE3-A/SSE301Q.Seq.d/ 398 e-110 SSA

  14. Strong late-time circumstellar interaction in the peculiar supernova iPTF14hls

    Science.gov (United States)

    Andrews, Jennifer E.; Smith, Nathan

    2018-03-01

    We present a moderate-resolution spectrum of the peculiar Type II supernova iPTF14hls taken on day 1153 after discovery. This spectrum reveals the clear signature of shock interaction with dense circumstellar material (CSM). We suggest that this CSM interaction may be an important clue for understanding the extremely unusual photometric and spectroscopic evolution seen over the first 600 days of iPTF14hls. The late-time spectrum shows a double-peaked intermediate-width Hα line indicative of expansion speeds around 1000 km s-1, with the double-peaked shape hinting at a disc-like geometry in the CSM. If the CSM was highly asymmetric, perhaps in a disc or torus that was ejected from the star 3-6 years prior to explosion, then the CSM interaction could have been overrun and hidden below the SN ejecta photosphere from a wide range of viewing angles. In that case, CSM interaction luminosity would have been thermalized well below the photosphere, potentially sustaining the high luminosity without exhibiting the traditional observational signatures of strong CSM interaction (narrow Hα emission and X-rays). Variations in density structure of the CSM could account for the multiple rebrightenings of the lightcurve. We propose that a canonical 1× 1051 erg explosion energy with enveloped CSM interaction as seen in some recent SNe, rather than an entirely new explosion mechanism, may be adequate to explain the peculiar evolution of iPTF14hls.

  15. Dicty_cDB: VFA373 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available qlfqeilkkmfnmplkvsngwvy*vlmkkl*irilqsivfalyskr nsltklvnvm*lslnitlssntlivqkkkfhhsfvmvfqmvvlqlhsllvfqlvsqlnss lmvklqlevllvq*llilftnfrei...kixkyxxxklnkk*kikkklifkkn Homology vs CSM-cDNA Score E S

  16. Femmes et enseignement supérieur en Afrique | CRDI - Centre de ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    2 sept. 2013 ... The authors in Femmes et enseignement supérieur en Afrique - Reconceptualisation des capacités humaines fondées sur le genre et renforcement des droits humains à la connaissance explore the issues surrounding the basic fundamental right of women to higher education. Women's access to higher ...

  17. Gestionnaire, Relations de travail et relations avec les employés (h/f ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Assurer l'établissement de rapports organisationnels fiables sur le rendement de la gestion des ressources humaines par rapport au Plan de mise en oeuvre des ressources humaines, au Rapport annuel du CRDI, aux tableaux de bord organisationnels et autres obligations de production de rapports en coordonnant la ...

  18. Research article

    African Journals Online (AJOL)

    Raul

    2009-08-28

    Aug 28, 2009 ... 1Programme sous régional de lutte contre la trypanosomiase humaine africaine, Organisation de Coordination pour la lutte contre les Endémies en. Afrique Centrale (OCEAC). 2Programme national de lutte contre la trypanosomiase humaine africaine de la République Démocratique du Congo. 3Direction ...

  19. L'education et la problematique de l'insertion socioprofessionnelles ...

    African Journals Online (AJOL)

    accumulation du capital humain qui permet au travailleur d'accroitre sa productivité. La théorie du capital humain nous enseigne que l'éducation est un investissement et que les individus les plus formés ont une productivité supérieure sur le marché du ...

  20. Socioeconomic Renovation in Viet Nam : The Origin, Evolution, and ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Les directeurs. Peter Boothroyd est directeur du Centre des établissements humains à l'Université de la Colombie-Britannique, à Vancouver, au Canada. Pham Xuan Nam est professeur au Centre national des sciences sociales et humaines à Hanoi, au Vietnam. Il est aussi rédacteur en chef de la Vietnam Social Science ...

  1. Modeling Type II-P/II-L Supernovae Interacting with Recent Episodic Mass Ejections from Their Presupernova Stars with MESA and SNEC

    Science.gov (United States)

    Das, Sanskriti; Ray, Alak

    2017-12-01

    We show how dense, compact, discrete shells of circumstellar gas immediately outside of red supergiants affect the optical light curves of Type II-P/II-L supernovae (SNe), using the example of SN 2013ej. Earlier efforts in the literature had used an artificial circumstellar medium (CSM) stitched to the surface of an evolved star that had not gone through a phase of late-stage heavy mass loss, which, in essence, is the original source of the CSM. In contrast, we allow enhanced mass-loss rate from the modeled star during the 16O and 28Si burning stages and construct the CSM from the resulting mass-loss history in a self-consistent way. Once such evolved pre-SN stars are exploded, we find that the models with early interaction between the shock and the dense CSM reproduce light curves far better than those without that mass loss and, hence, having no nearby dense CSM. The required explosion energy for the progenitors with a dense CSM is reduced by almost a factor of two compared to those without the CSM. Our model, with a more realistic CSM profile and presupernova and explosion parameters, fits observed data much better throughout the rise, plateau, and radioactive tail phases as compared to previous studies. This points to an intermediate class of supernovae between Type II-P/II-L and Type II-n SNe with the characteristics of simultaneous UV and optical peak, slow decline after peak, and a longer plateau.

  2. Colonic chicken-skin mucosa in children with polyps is not a preneoplastic lesion.

    Science.gov (United States)

    Nowicki, Michael J; Bishop, Phyllis R; Subramony, Charu; Wyatt-Ashmead, Josephine; May, Warren; Crawford, Maxine

    2005-11-01

    Colonic polyps are common both in adults and children; however, the malignant potential varies according to the type of polyp. Most childhood polyps are solitary juvenile polyps, which have negligible malignant potential. Chicken-skin mucosa (CSM) is an endoscopic finding initially described associated with adenomatous polyps and adenocarcinoma, suggesting a preneoplastic lesion. Subsequently, CSM was described in association with juvenile polyps, suggesting that this mucosal finding is not a precursor to dysplasia. To determine whether CSM represents a preneoplastic lesion, we studied endoscopic colonic mucosal biopsies for markers of cell replication (Ki-67) and malignant transformation (p53) in mucosal biopsies of CSM, normal colonic tissue, tubular adenomas, and adenocarcinomas. Samples were subjected to immunostaining for the presence of Ki-67 and p53. The degree of Ki-67-positive staining cells was similar for CSM and normal colonic tissue, whereas there was significantly increased staining for both tubular adenomas and adenocarcinomas. There was no evidence of p53 staining in CSM and normal colonic mucosa, whereas there was varying degrees of staining in tubular adenomas and adenocarcinomas. The association of CSM with benign juvenile polyps and the absence of histologic markers for increased replication and malignant transformation support the notion that this endoscopic finding is not preneoplastic. Rather, CSM arises in proximity to polyps of all histologic types because of local mucosal damage.

  3. Altering the expression of two chitin synthase genes differentially affects the growth and morphology of Aspergillus oryzae

    DEFF Research Database (Denmark)

    Müller, Christian; Hjort, C.M.; Hansen, K.

    2002-01-01

    obtained for csmA indicated that it had high similarity to class V chitin synthases. chsB and csmA disruption strains and a strain in which chsB transcription was controlled were constructed using the nitrite reductase (niiA) promoter. The strains were examined during hyphal growth by Northern analysis...

  4. Seasonal changes in suspended sediment load in the Gauthami-Godavari Estuary

    Digital Repository Service at National Institute of Oceanography (India)

    Reddy, N.P.C.; Rao, B.P.; Rao, K.M.; Rao, V.S

    estuarine mouths. During pre-monsoon and northeast monsoon seasons, the CSM is mainly controlled by the tidal currents (10 cm/s to 150 cm/s) as the fresh water discharge during this period is minimum. Higher CSM (270 mg/l) at Vrudha estuarine mouth compared...

  5. Quality of eggs produced by laying chickens fed lowgossypol ...

    African Journals Online (AJOL)

    Results indicated an increase in egg production with increasing levels of CSM in the diet up to 10 per cent level of inclusion. The addition of CSM to the diets had no significant effects on egg weight, Haugh unit values (HUV), yolk index, and yolk colour scores. However, egg yolk colour tended to improve with increasing ...

  6. A Global Perspective on the Outcomes of Surgical Decompression in Patients With Cervical Spondylotic Myelopathy: Results From the Prospective Multicenter AOSpine International Study on 479 Patients

    NARCIS (Netherlands)

    Fehlings, M.G.; Ibrahim, A.; Tetreault, L.; Albanese, V.; Alvarado, M.; Arnold, P.; Barbagallo, G.; Bartels, R.H.M.A.; Bolger, C.; Defino, H.; Kale, S.; Massicotte, E.; Moraes, O.; Scerrati, M.; Tan, G.; Tanaka, M.; Toyone, T.; Yukawa, Y.; Zhou, Q.; Zileli, M.; Kopjar, B.

    2015-01-01

    STUDY DESIGN: Prospective, multicenter international cohort. OBJECTIVE: To evaluate outcomes of surgical decompression for cervical spondylotic myelopathy (CSM) at a global level. SUMMARY OF BACKGROUND DATA: CSM is a degenerative spine disease and the most common cause of spinal cord dysfunction

  7. Gait impairment in cervical spondylotic myelopathy: comparison with age- and gender-matched healthy controls.

    LENUS (Irish Health Repository)

    Malone, Ailish

    2012-12-01

    Gait impairment is a primary symptom of cervical spondylotic myelopathy (CSM); however, little is known about specific kinetic and kinematic gait parameters. The objectives of the study were: (1) to compare gait patterns of people with untreated CSM to those of age- and gender-matched healthy controls; (2) to examine the effect of gait speed on kinematic and kinetic parameters.

  8. Reliability of three-dimensional gait analysis in cervical spondylotic myelopathy.

    LENUS (Irish Health Repository)

    McDermott, Ailish

    2010-10-01

    Gait impairment is one of the primary symptoms of cervical spondylotic myelopathy (CSM). Detailed assessment is possible using three-dimensional gait analysis (3DGA), however the reliability of 3DGA for this population has not been established. The aim of this study was to evaluate the test-retest reliability of temporal-spatial, kinematic and kinetic parameters in a CSM population.

  9. Strategic Sustainability Management for Enhancing Corporate Value: in the context of Korean Business Circles

    NARCIS (Netherlands)

    Y-G. Ahn

    2007-01-01

    textabstractIn line with the growing importance of Corporate Sustainability Management (CSM) in business circles, the linkages between CSM, corporate values and performance is becoming increasingly higher on the agenda both for internal corporate management purposes and for external relations for

  10. Adverse events after cervical spinal manipulative therapy: consensus based classification and definitions

    NARCIS (Netherlands)

    Dr. C.P. van der Schans; M. Schmitt; dr. S.E. Lakke; H.A. Kranenburg

    2015-01-01

    Cervical spinal manipulations (CSM) are frequently employed techniques to alleviate neck pain and headache. Minor and major complications following CSM have been described, though clear consensus on definition and the classification of the complications had not yet been achieved. As a result,

  11. Parallel Worlds: Agile and Waterfall Differences and Similarities

    Science.gov (United States)

    2013-10-01

    gress; • Milestone A precedes a program moving into Technology Devel- opment ( TD ) • Milestone B precedes a program moving into the Engineering...5. FUNDING NUMBERS FA8721-05-C-0003 6. AUTHOR(S) M. Steven Palmquist, PE, PMP, Mary Ann Lapham, PMP, CSM , Suzanne Miller CSM , Timothy Chick, Ipek

  12. Comparison of angle, shape, and position of articular processes in Dobermans and Great Danes with and without cervical spondylomyelopathy.

    Science.gov (United States)

    Bonelli, Marília de Albuquerque; da Costa, Ronaldo Casimiro; Martin-Vaquero, Paula; Lima, Carolina Gonçalves Dias

    2017-03-24

    Cervical spondylomyelopathy (CSM), also known as wobbler syndrome, affects mainly large and giant-breed dogs, causing compression of the cervical spinal cord and/or nerve roots. Structural and dynamic components seem to play a role in the development of CSM; however, pathogenesis is not yet fully understood. Physiologic and pathologic movements of the cervical spine depend on the morphology and morphometry of articular processes, as well as on intervertebral discs and vertebral column ligaments. Moreover, the characteristics of the articular processes affect motion and stability of the vertebral column. The goal of this study was to investigate the angle, shape, and position of the articular surfaces within the articular processes and compare them between Doberman Pinschers and Great Danes with and without cervical spondylomyelopathy. Magnetic resonance images were obtained for 60 dogs: 15 clinically normal Dobermans (Dob-N), 15 CSM-affected Dobermans (Dob-CSM), 15 clinically normal Great Danes (GD-N), and 15 CSM-affected Great Danes (GD-CSM). Angle, shape, and position (lateral distance) of the articular surfaces from the articular processes were analyzed from C 2-3 to C 7 -T 1 . Results indicate that the mean angle was different between Dob-CSM and GD-CSM at C 4-5 , C 5-6 , and C 6-7 , and between GD-N and GD-CSM at C 6-7 . There were differences between Dob-N and GD-N, and between Dob-CSM and GD-CSM for the lateral distance at most locations, except C 2-3 . Compared with Great Danes, Dobermans generally had a greater proportion of concave caudal surfaces at C 4-5 , C 5-6 , and C 6-7 . Concave articular surfaces have been associated with greater axial rotation. This may explain the high proportion of disc-associated CSM in Dobermans compared to Great Danes. The differences between breeds suggest they may have different motion patterns in the caudal cervical vertebral column. Considering that no differences in angle, shape, or position of the articular surfaces

  13. Synthèse et évaluations pharmacologiques de nouveaux inhibiteurs β-lactamiques de la Fatty Acid Amide Hydrolase humaine (hFAAH) mise en évidence d’un mécanisme d’inhibition réversible et compétitif

    OpenAIRE

    Feledziak, Marion

    2012-01-01

    Research on cannabis effects has evolved in a medicinal context towards the discovery and the understanding of the endocannabinoid system. Most of the effects, beneficial or psychotropic, produced by the cannabis consumption have been ascribed to the activation of two receptors, called cannabinoid receptors CB1 and CB2, by a liposoluble molecule the tetrahydrocannabinol (THC). Displaying the existence of these two receptors has accelerated the research about an eventual endogenous cannabinoid...

  14. Human Factors Issues for Controlling Uninhabited Aerial Vehicles: Preliminary Findings in Support of the Canadian Forces Joint Unmanned Aerial Vehicle Surveillance Target Acquisition System Project (Incidence des Facteurs Humains sur le Pilotage des Vehicules Aeriens Telepilotes: Constatations Preliminaires a L’Appui du Projet de Systeme Interarmees D’Acquisition D’Objectif au Moyen de Vehicules Aeriens Telepilotes de Surveillance des Forces Canadiennes)

    Science.gov (United States)

    2010-11-01

    2010 © Sa Majesté la Reine (en droit du Canada), telle que représentée par le ministre de la Défense nationale, 2010 DRDC Toronto TR 2009-043...horaire de quarts de travail a été instauré afin qu’un opérateur soit en fonction en tout temps au poste de contrôle au sol. La fatigue qu’engendre ce...aérienne et soutien technique a chargé Recherche et développement pour la Défense Canada (RDDC) – Toronto de présenter un sommaire préliminaire au sujet de

  15. Colloque S&T Symposium 2009: Understanding the Human Dimension in 21st Century Conflict/Warfare: Taking Care of the Front Line (comprendre la dimension humaine dans les conflits/la conduite de la guerre au xxle siecle: veiller a la ligne de front)

    Science.gov (United States)

    2009-06-01

    de soigner » découle d’un impératif : en raison de l’ensemble des obligations réciproques autour desquelles s’articule le contrat social...soigner ». Ce changement découle d’un impératif : en raison de l’ensemble des obligations réciproques autour desquelles s’articule le contrat social...fondamentaux se pointent à l’horizon. La modification de l’environnement mondial, de pair avec le changement de la nature des conflits et de la

  16. Adaptive response to ionizing radiation in normal human skin fibroblasts. Enhancement of DNA repair rate and modulation of gene expression. Reponse adaptative au rayonnement ionisant des fibroblastes de peau humaine. Augmentation de la vitesse de reparation de l'ADN et variation de l'expression des genes

    Energy Technology Data Exchange (ETDEWEB)

    Toledo, S.M. de; Mitchel, R.E.J. (Atomic Energy of Canada Ltd., Chalk River, ON (Canada). Chalk River Nuclear Labs.); Azzam, E. (Atomic Energy of Canada Ltd., Chalk River, ON (Canada). Chalk River Nuclear Labs. Ottawa Univ., ON (Canada). Dept. of Biology); Raaphorst, G.P. (Ottawa Univ., ON (Canada). Dept. of Biology)

    Low doses and dose rates of ionizing radiation enhance the rate of DNA repair in human fibroblasts and protect the cells against radiation-induced micronucleus formation. Chronic exposures reduce the mRNA levels of the genes topoisomerase II and FACC-1 (Fanconi's anemia, group C). (authors). 11 refs., 1 tab., 2 figs.

  17. Ex vivo exposure to gaseous pollutants of air passages and human and animal pulmonary vessels: effect on the reactivity and cell signalling; Exposition ex vivo aux polluants gazeux des voies aeriennes et de vaisseaux pulmonaires humains et animaux: effet sur la reactivite et la signalisation cellulaire

    Energy Technology Data Exchange (ETDEWEB)

    Hyvelin, J.M.

    2000-07-01

    The objectives of this work have been to characterize effects of exposure to several pollutants on the reactivity of air passages, to study the action mechanisms of pollutants on the smooth muscle cell of air passages, to characterize the calcic signalling of the human bronchi smooth muscle in order to identify the pollutants cell targets, to look for others pollutants cell targets. This work contributes to a better knowledge of air pollution effects, by underlining the additive character of pollutants. It allows a better knowledge of cell mechanisms implied in the pollutants effects. Then, it notices the existence of other cell types, the pulmonary arterial myocyte, sensitive to pollutants exposure and that can be implied in the respiratory health degradation. (N.C.)

  18. Caractérisation numérique et expérimentale du champ magnétique B.F. généré par des systèmes électrotechniques en vue de la modélisation des courants induits dans le corps humain

    OpenAIRE

    Scorretti , Riccardo

    2003-01-01

    In the daily life, we are exposed to electromagnetic fields. One of the sources of these fields is the natural environment, but they are also dues to the increasing number of electrical appliances. Thus one is more and more concerned with the issue of the effects of this exposure on human health. The low frequency magnetic fields generate induced currents into the human body. These currents may produce some minor, reversible effects (phosphenes) for J=100mA/m2. On the other hand, the long-ter...

  19. Étudier les réseaux comme phénomènes hétérogènes : quelle place pour la « nouvelle science des réseaux » en sciences humaines et sociales ?

    OpenAIRE

    Rieder, Bernhard

    2009-01-01

    Texte présenté dans le cadre des Journées d'étude "Dynamiques de réseaux : information, complexité et non-linéarité" à Bordeaux, les 6-7 décembre 2007; Dans ce texte, nous nous proposons d'examiner ce qu'une (nouvelle) branche des mathématiques appliquées, appelée par certains la « nouvelle science des réseaux » (NSR), peut apporter aux SHS et plus particulièrement aux sciences de l'information et de la communication (SIC).

  20. In vitro cytotoxic effects of PM{sub 2.5} from the city of Abidjan (Ivory Coast) on human A549 lung cells; Effets cytotoxiques in vitro des PM{sub 2,} {sub 5} de la ville d'Abidjan (Cote-d'Ivoire) sur des cellules pulmonaires humaines

    Energy Technology Data Exchange (ETDEWEB)

    Kouassi, Kouakou-Serge [Universite Lille Nord de France, Lille (France); Unite de Chimie Environnementale et Interactions sur le Vivant, EA 4492 MREI, Universite du Littoral Cote d' Opale, Dunkerque (France); Universite Cocody-Abidjan et Institut Pasteur, Abidjan (Cote d' Ivoire); Billet, Sylvain; Garcon, Guillaume; Verdin, Anthony; Courcot, Dominique; Shirali, Pirouz [Universite Lille Nord de France, Lille (France); Unite de Chimie Environnementale et Interactions sur le Vivant, EA 4492 MREI, Universite du Littoral Cote d' Opale, Dunkerque (France); Diouf, Amadou [Laboratoire de Toxicologie, Faculte de Medecine Pharmacologie Odontologie, Universite Cheikh Anta Diop, Dakar (Senegal); Cazier, Fabrice [Universite Lille Nord de France, Lille (France); Centre Commun de Mesures, MREI 1, Universite du Littoral Cote d' Opale, Dunkerque (France); Djaman, Joseph [Universite Cocody-Abidjan et Institut Pasteur, Abidjan (Cote d' Ivoire)

    2012-01-15

    Epidemiological studies associate air pollution, especially particulate, increased morbidity and mortality from respiratory and cardiovascular origin . Africa, which has an urbanization rate among the highest in the world, is particularly exposed. The 'Initiative on the air quality in Sub-Saharan Africa' showed the importance of atmospheric concentrations of certain pollutants such as nitrogen oxides, sulfur dioxide and particulate matter (PM{sub 10}). Like the great capitals of Africa, Abidjan, economic capital and most industrialized city of Ivory Coast is facing an air pollution from industrial-urban and health consequences for its population of nearly 6 million inhabitants. To better understand the mechanisms of action resulting from pulmonary exposure to particulate atmospheric aerosols, we proposed: (i) to collect atmospheric particles (PM{sub 2.5}) using high volume cascade impaction in the District of Abidjan in three influences (rural, urban or industrial), (ii) to determine their main physicochemical, (iii) assess their cytotoxicity and their role in the induction of oxidative damage in a model of human lung cells (A549) in culture. The chemical composition of the atmospheric particles revealed their heterogeneity, and many inorganic (e.g. Al, Ca, Fe, Mn, Zn, Ni, Cr, Cu, Pb, Mg) and organic compounds (e.g. paraffins) were quantified at the three sites. Their effect concentrations (EC) to 10 and 50% on the A549 were as follows: influence rural: EC{sub 10} = 5.91 {mu}g/cm{sup 2} and EC{sub 50} 29.55 {mu}g/cm{sup 2}, urban influence: EC{sub 10} = 5 .45 {mu}g/cm{sup 2} and EC{sub 50} = 27.23 {mu}g/cm{sup 2}, and industrial influence: EC{sub 10} = 6.86 {mu}g/cm{sup 2} and EC{sub 50} = 34.29 {mu}g/cm{sup 2}. Exposure of A549 cells to Abidjan city's PM samples for 24, 48 or 72 hours to their EC{sub 10} or EC{sub 50} induced oxidative damage, as demonstrated by the formation of malon-dialdehyde, changes in enzyme activity of superoxide dismutase and alteration of glutathione status. (authors)

  1. Regulation of heating and air-conditioning systems based on human thermal sensation: impact on the energy consumption in buildings; Regulation des systemes de chauffage et de climatisation basee sur la sensation thermique humaine: impact sur la consommation d'energie dans les batiments

    Energy Technology Data Exchange (ETDEWEB)

    Endravadan, M.

    2006-02-15

    This study is based on the adaptive approach. The thermal comfort of an individual depends on indoor conditions that can be controlled. However, changes in activity or clothing adjustments are difficult to control and measure in the field experiments. Behavioural actions undertaken by the occupant to overcome the discomfort could be varying and may have diverse consequences. Sometimes these actions are beneficial to the occupant, although often they lead to disastrous amounts of energy consumption. Hence, it becomes crucial to consider the human behaviour and the thermal inertia of the building. The creation of numerical models is useful to study the coupling between these two components and to evaluate the effects of the behaviour on comfort and the energy. The simulations were conducted using TRNSYS software. A model such as 'Global Behavioural Regulator' (GBR) was created to evaluate the effects of clothing or thermostat adjustments made by the occupant depending on his thermal sensation (PMV). The energy costs of several types of regulators have been compared in various seasons for example, winter and summer using a light and heavy weight building. The heating of a whole-building may not be necessary in temperate climates or during mid-season. However, comfortable working conditions could be assured for the occupants with the use of an individual heating system such as a 'Local Heating System' (LHS). In such a context, it becomes interesting to evaluate the occupant's behaviour in regards to local heating and its effects on comfort and energy consumption. The LHS consists of three radiant panels; therefore, it is important to evaluate the local heat exchanges with precision. Experiments conducted with the manikin were used to validate the infra-red model; whereas experiments with real subjects were studied to understand the occupant behaviour on the LHS as a function of their local thermal sensations. These analyses led to the creation of a 'Local Behavioural Regulator' (LBR). The results show that such a system is advantageous in certain situations and does lead to comfort conditions with reduced energy costs. (author)

  2. Partnering for Learnware: Critical Success Factors in the Use of Learnware by Human Resources Sector Councils and Industry Associations in Canada = Partenariats pour les technologies d'apprentissage: Facteurs critiques de succes dans l'utilisation des technologies d'apprentissage par les conseils sectoriels des ressources humaines et les associations industrielles au Canada.

    Science.gov (United States)

    Stahmer, Anna; Green, Lyndsay

    The use of learnware by human resources sector councils and industry associations in Canada was examined to identify critical success factors in the use of technology-based training. Eight case studies--four involving sector councils and four involving industry associations that either have national mandates or distribute their products across…

  3. Proposition d’un modèle d’organisation pour une gestion intégrée de la sécurité sanitaire des aliments, dans ses trois dimensions : technique, humaine et organisationnelle, à l’échelle libanaise

    Directory of Open Access Journals (Sweden)

    Fadi Nicolas

    2017-06-01

    Full Text Available Nicolas, F. Chevrier, C. Rizk, T. Assaf, C. and Yaghy, J. 2017. Proposal of an organizational model for an integrated management of food safety, in its three dimensions: technical, human and organizational, on Lebanese scale. Lebanese Science Journal, 18(1: 1-25. A critical analysis of the Lebanese food industry in its main sectors, namely milk and its derivatives, red meat and white meat, was made from facility inspections, investigations and management manufacturing procedures and/or processing, as well as microbiological and chemical analysis of different samples. It showed the inadequacy or the failure of the measures adopted, either at the organoleptic quality of food produced or the safety of consumer foods. Hence the need for the establishment of a new management system, supported by appropriate governance and meet international requirements, resulting in an ongoing, controlled and acceptable risk, and the restoration and strengthening of trust in the Lebanese health system. However, health problems often exceeding their initial importance and direct effect of triggering factor - minimal disruption transforming rapidly into a major crisis - any food system finds himself constantly undermined with permanent instability. This instability is characteristic of complex phenomena, and therefore, it returns us to the theory that the system is considered as a network of interdependent actors working to the satisfaction of the consumer in a given geographical area. Such a system must necessarily be global; it must incorporate all stakeholders in the food chain and be able to self-adjust to permanent and continuous way. From these considerations, we propose to the Lebanese authorities, in addition to the new food safety legislation food, adopted in January 2015, a specific model based on the principle of systemic triangulation (governance, risk analysis, regulatory and legislation and operating as a global system of governance and management of health food. The role of the authorities return to set standards of this system and the regulatory framework of the structure and behavior. The risk analysis tool, based on international standards, guarantor of international recognition of the proposed model should then be able to arrange its components continuously, in three dimensions, technical, human and organizational, and for that the entire system does not depart from the main objective, the protection of public health.

  4. Metabolic activation of volatile organic compounds and polycyclic aromatic hydrocarbons coated onto airborne PM{sub 2.5} in isolated human alveolar macrophages; Etude de l'activation metabolique des composes organiques volatils et des hydrocarbures aromatiques polycycliques d'un aerosol anthropogenique par des macrophages alveolaires humains en culture primaire

    Energy Technology Data Exchange (ETDEWEB)

    Saint-Georges, F.; Mulliez, P. [Hopital Saint Philibert - GHICL-FLM, Service de Pneumologie, 59 - Lomme (France); Saint-Georges, F.; Abbas, I.; Garcon, G.; Billet, S.; Verdin, A.; Shirali, P. [LCE-EA2598, Lab. de Recherche en toxicologie Industrielle et Environnementale - ULCO-MREI, 59 - Dunkerque (France); Gosset, P. [Hopital Saint Vincent, Laboratoire d' Anatomie et de Cytologie Pathologiques - GHICL-FLM, 59 - Lille (France); Courcot, D. [LCE-EA2598, Lab. de Catalyse et Environnement - ULCO-MREI, 59 - Dunkerque (France)

    2009-01-15

    To contribute to improve the knowledge of the underlying mechanisms of action involved in air pollution Particulate Matter (PM)-induced cytotoxicity, we were interested in the metabolic activation of Volatile Organic Compounds (VOC) and/or Polycyclic Aromatic Hydrocarbons (PAH)-coated onto Dunkerque City's PM{sub 2.5} in human Alveolar Macrophages (AM) isolated from Bronchoalveolar Lavage Fluid (BALF). This in vitro cell lung model is very close to the normal in vivo situation, notably in the characteristics that AM display in terms of gene expression of phase I and phase II-metabolizing enzymes. The bronchoscopic examinations and BAL procedures were carried out without any complications. The exposure of AM, during 24, 48 or 72 h, to increasing concentrations of the collected aerosol induced significant variations of the activities of the extracellular lactate dehydrogenase and the mitochondrial dehydrogenase. The lethal concentrations at 10% and 50% were 14.93 and 74.63 {mu}g/mL for AM, respectively, and indicated the relatively higher sensibility of such target lung cells. VOC and/or PAH-coated at low levels onto the surface of the particulate fraction significantly induced gene expression of cytochrome P450 (GYP) 1A1, CYP2E1, NADPH Quinone oxido-reductase (NQO)-1) and Glutathione S-Transferase (GST)P1 and M3, versus controls, suggesting thereby the formation of biologically reactive metabolites. Moreover, these results suggested the role of physical vector of carbonaceous core of PM, which can, therefore, increase both the penetration and the retention of attached-VOC into the cells, thereby enabling them to exert a more durable induction. Hence, we concluded that the metabolic activation of the very low doses of VOC and/or PAH-coated onto Dunkerque City's PM{sub 2.5} is one of the underlying mechanisms of action closely involved in its cytotoxicity in isolated human AM in culture. (author)

  5. Bulky PAH-DNA induced by exposure of a co-culture model of human alveolar macrophages and embryonic epithelial cells to atmospheric particulate pollution; Adduits encombrants a l'ADN dans des cocultures de cellules pulmonaires humaines exposees a une pollution atmospherique particulaire

    Energy Technology Data Exchange (ETDEWEB)

    Abbas, Imane; Garcon, Guillaume; Billet, Sylvain; Shirali, Pirouz [Universite Lille Nord de France - Lille (France); Unite de Chimie Environnementale et Interactions sur le Vivant, MREI, Universite du Littoral Cote d' Opale, Dunkerque (France); Andre, Veronique; Le Goff, Jeremie; Sichel, Francois [GRECAN, Universite de Caen Basse-Normandie et centre Francois Baclesse, Caen (France); Roy Saint-Georges, Francoise; Mulliez, Philippe [Service de Pneumologie, Hopital Saint-Philibert, GHICL, Lille (France)

    2012-01-15

    Because of their deep penetration in human lungs, fine airborne particulate matter were described as mainly responsible for the deleterious effects of exposure to air pollution on health. Organic constituents are adsorbed on particles surface and, after inhalation, some (polycyclic aromatic hydrocarbons, PAHs) can be activated into reactive metabolites and can bind to DNA. The formation of bulky DNA adducts has been researched after exposure of mono-and co-cultures of alveolar macrophages (AM) and human embryonic human lung epithelial (L132), to fine air pollution particulate matter Air samples have been collected with cascade impactor and characterized: size distribution (92.15% < 2.5{mu}.m), specific surface area (1 m{sup 2}/g), inorganic (Fe, AI, Ca, Na, K, Mg, Pb, etc.) and organic compounds (PAHs, etc.). {sup 32}P post-labeling method was applied to detect bulky DNA adducts in AM and L132, in mono-and co-cultures, 72 h after their exposure to atmospheric particles at their Lethals and Effects concentrations or (LC or CE) to 50% (i.e. MA: EC{sub 50} = 74.63 {mu}g/mL and L132: LC-5-0 = 75.36 {mu}g/mL). Exposure to desorbed particles (MA: C1= 61.11 {mu}g/mL and L132 : C2 = 61.71 {mu}g/mL) and B[a]P (1 {mu}M) were included. Bulky PAH-DNA adducts were detected in AM in mono-culture after exposure to total particles (Pt), to B[a]P and desorbed particles (Pd). Whatever the exposure, no DNA adduct was detected in L132 in mono-culture. These results are coherent with the enzymatic activities of cytochrome P450 l Al in AM and L132. Exposure of co-culture to Pt, or Pd induced bulky adducts to DNA in AM but not in L132. Exposure to B[a]P alone has altered the DNA of AM and L132, in co-culture. Exposure to Pt is closer to the environmental conditions, but conferred an exposure to amounts of genotoxic agents compared to studies using organic extracts. The formation of bulky DNA adducts was nevertheless observed in AM exposed to Pt, in mono- or co-culture, indicating that they were competent in terms of metabolic activation of PAHs. The DNA damage in the L132 in co-culture following exposure to B[a]P have suggested that some PAH metabolites generated by the MA could be have a genotoxic action on L132. (authors)

  6. CHRYSAOR : un Système Tutoriel Intelligent pour les Environnements Virtuels d'Apprentissage Humain. Application à la formation au matériel de laboratoire en hémostase : application à la formation au matériel de laboratoire en hémostase

    OpenAIRE

    Le Corre, Frédéric

    2013-01-01

    This research focuses on the virtual environments for training in biomedical diagnostic devices. The simulation of the real situation only is not enough, we needs to incorporate a pedagogical scenario to build the learning. The scenario applies to all learners, so it is important to integrate individualization. For this we propose to couple the virtual environment with an Intelligent Tutoring System (ITS). Our study begins with an identification of existing systems that seem best suited, on w...

  7. Danièle Linhart, La Comédie humaine du travail. De la déshumanisation taylorienne à la sur-humanisation managériale, Toulouse, Éditions Érès, 2015, 158 p.

    OpenAIRE

    Higelé, Jean-Pascal

    2015-01-01

    L’ouvrage de Danièle Linhart présente de manière simple et bien écrite la thèse aujourd’hui bien identifiée et documentée, en particulier par les travaux de l’auteure elle-même, selon laquelle l’idéologie fordo-taylorienne et l’idéologie du management moderne, loin de s’opposer, ont pour projet commun de déposséder les travailleurs de leur professionnalité afin de les conformer aux objectifs déterminés par les directions des organisations. Mais taylorisme et management procèdent de deux maniè...

  8. Immunoscintigraphy with the human monoclonal antibody 88 BV 59 in case of negative TDM and suspicion of recurrence of colorectal cancer; Immunoscintigraphie avec l`anticorps monoclonal humain 88 BV 59 en cas de TDM negative et suspicion de recidive de cancer colorectal

    Energy Technology Data Exchange (ETDEWEB)

    Chetanneau, A.; Douillard, J.Y.; Barbet, E. [CRLC, Nantes (France); Herpst, J.; Wynant, G.; Hanna, M.G. [PERIMMUNE, Rockville (United States); Chatal, J.F. [CRLC, Nantes (France)

    1997-12-31

    Twelve patients (6 F, 6 M) of average age 60 years (between 41 and 75 years) presented a suspicion of recurrence of colorectal cancer having in all cases an elevation of the rate of serumal ACE to which in two patients other diseases were also present. For all the patients the tomodensitometry (TDM) was negative at the abdomen and pelvis level in the two weeks preceding the pre-operation immunoscintigraphy (IS). The tumoral targeting was realised with 10 mg of complete human monoclonal antibodies (Mab) 88 BV 59 labelled with 1110 to 1330 MBq of {sup 99m}Tc. The planar images and SPECT were carried out at 14 to 20 hours after the IV injection of radiolabelled Mab and in a case a late IS was carried out also at the fortieth hour. For a patient a second IS in the same conditions was realised 9 months later. Serumal sampling before injecting the 88 BV 59 antibody, then, 1 and 3 months later, were realised for possible surveillance of human anti-antibody antibody apparition (HAAA). The final diagnosis has been proved histologically in 8 patients within 4 weeks following the IS. A patient positive in IS rejected the surgery but 11 months later was positive in echo-endoscopy. The other 3 patients non operated being IS negative have developed hepatic or pulmonary metastases during one year of medical surveillance. The global results of IS were: 6 true-positive, 1 true-negative, 4 false negative (in 3 cases for hepatic metastases and in one case for pulmonary metastases) and a false positive (with scintigraphic suspicion of peritoneal carcinoma being not confirmed at laparotomy). No patient developed HAAA. Totally, the IS with human Mab 88 BV 59 has consequently confirmed its profit for the localization of colo-rectal cancer recurrence associated with a confirmed ACE elevation with negative TDM

  9. Théorie et pratique des modèles d’erreur humaine dans la sécurité des barrages hydroélectriques : le cas des études de dangers de barrages d’EDF

    OpenAIRE

    Larouzée, Justin

    2015-01-01

    This thesis presents two different works: (1) an in-depth study of James Reason's work (Swiss cheese model) and (2) the engineering activity of a model (ECHO) of organizational and human factors in operation of EDF's dams. These works are articulated regarding the role, value and place of human error models in industrial safety management.A literature review shows that dams' safety is mainly based on technical issues. The considerations relating to human factors, although pervasively present ...

  10. Molecular and structural characterisation of the human sodium/iodide symporter (h N.I.S.) C-terminus and the implication of this domain in the transporter regulation; Caracterisation moleculaire et structurale de l'extremite C-Terminale du co-transporteur sodium/iode humain (h N.I.S.): Implication de ce domaine dans la regulation du transporteur

    Energy Technology Data Exchange (ETDEWEB)

    Huc, S

    2007-12-15

    The human natrium iodide symporter (h N.I.S.) is an intrinsic membrane protein expressed in thyroid cells where it allows iodide uptake and accumulation. It is composed of thirteen transmembrane helices and its ninety- three amino acids long cytosolic C-terminus presents many potential post-translational regulatory sites. A first part of the PhD work has been dedicated to the expression in a bacterial system and to the purification of the cytosolic C-terminal fragment. Biochemical and structural characterisation have revealed that this C-terminus is very flexible but prone to dimerization. The fragment has also been used as a bait to test the interactions with PDZ domain proteins spotted on a membrane. Several proteins interacting with the (natrium/iodide symporter) N.I.S. C-terminus have thus been identified and the study of their implication in the protein regulation has been initiated. A second part of the work has underlined the existence of a N.I.S. fragment co-purified with the entire protein. This fragment has been found in cells in culture stably expressing N.I.S. and also in human thyroid extracts and in rodent thyroid cells. We observed that this fragment is spontaneously associated with the entire protein. It is composed of the last 131 amino acid of the protein and so comprises the last transmembrane domain and the C-terminal extremity. The expression of a truncated form of h N.I.S., lacking the last 131 amino acids, shows that this protein is not correctly addressed to the cell membrane and cells expressing this mutated symporter cannot accumulate iodide. However, our results show that the co-expression of the two N.I.S. parts, the truncated form lacking the last 131 amino acid, and the complementary C-terminal fragment, leads to cells presenting 10 % of the activity of cells expressing the whole N.I.S.. (author)

  11. Investigation of double strand breaks induced by alpha particle irradiation using C.N.B.G. microbeam in human keratinocytes; Mise en evidence de cassures double brin de l'ADN induites par irradiation de keratinocytes humains en microfaisceau alpha

    Energy Technology Data Exchange (ETDEWEB)

    Pouthier, Th

    2006-12-15

    To understand the mechanisms of interaction of ionizing radiation with living tissues exposed to low and protracted doses remains a major issue for risk evaluation. The response cannot be found in epidemiological studies because the only available data concern accidental exposures to high doses of radiation. The natural exposure represents the main source of exposure in the daily life, just before the medical sources (radiology, radiotherapy). In addition, this kind of exposure is very difficult to reproduce in vitro by irradiating cell lines. The method per preference is based on random irradiation of cell populations. The mean number of particles having traversed cells is then calculated on the basis of Poisson statistics. In addition to inevitable multiple impacts, the numerous potential intracellular targets (nuclei, cytoplasm), the indirect effects induced by the impact of particles on neighbouring cells or simply the extracellular targets, constitute phenomena that make more complex the interpretation of experimental data. A charged particle microbeam was developed at C.E.N.B.G. to perform the targeted irradiation of individual cells with a targeting precision of a few microns. It is possible to deliver a counted number of alpha particles down to the ultimate dose of one alpha per cell, to target predetermined cells and then to observe the response of the neighbouring cells. This facility has been validated during this work on human keratinocyte cells expressing a recombinant nuclear fluorescent protein (histone H2B-GFP). The combination of ion micro-beams with confocal microscopy and numeric quantitative analysis allowed the measurement of DNA double strand breaks via the phosphorylation of the histone H2A.X in individual cells. The mechanisms of DNA reparation and apoptosis induction were also in the scope of those studies. The experimental results obtained during this thesis validate the methodology we have developed by demonstrating the targeting reproducibility and the dose control. A dose-effect relationship has been also investigated as a function of time. (author)

  12. DIANE, a simulation code for the interaction of neutrons with living tissues. Application to low doses of fast neutrons on human tumoral cells; DIANE, un code de simulation de l'interaction des neutrons avec la matiere vivante. Applications aux faibles doses de neutrons rapides sur des cellules tumorales humaines

    Energy Technology Data Exchange (ETDEWEB)

    Nenot, M.L

    2003-07-15

    Our work deals with the irradiation of cells and living tissues by 14 MeV neutrons at very low doses (a few 10{sup -2} Gy). Such experiments require an accurate knowledge of the values of neutron dose rates and fluences at the level of cell cultures. We have performed measurements of fluence rates through an activation method applied to gold and copper foils. The fluence rate is deduced from the gamma rays emitted by the irradiated foils. Neutron doses and dose rates have been measured through varied methods: PIN diodes, ionization tissue equivalent chambers, and Geiger-Mueller counters. We have designed the DIANE code to simulate the impact of energetic neutrons on cells. This code can be used with isolated cells or macroscopic tissues, it takes into account the roles of the ionisation electrons produced by recoil nuclei entering the cell. This point is all the more important since recent works have highlighted the impact of very low energy electrons on DNA. (A.C.)

  13. Rôle du stress du réticulum endoplasmique et de l’autophagie dans la régulation des réponses immune et angiogénique activées par des stress ischémiques et inflammatoires dans l’épithélium rénal humain

    OpenAIRE

    Fougeray, Sophie

    2012-01-01

    Under pathological conditions, kidney is subjected to multiple toxic, ischemic and immunological failures that promote the occurrence of chronic kidney disease and the development of acute kidney injury. In response to stress, renal parenchymal cells activate biological adaptive processes permitting the maintenance of cell viability and renal homeostasis. These adaptive responses can also activate innate immunity and induce tissue remodeling (fibrogenesis and angiogenesis). However, accurate ...

  14. Obésité et grossesse : étude de l'influence d'un marqueur de l'obésité sur les mécanismes cellulaires et tissulaires de l'accouchement dans un modèle d'explants myométriaux humains

    OpenAIRE

    Wendremaire, Maeva

    2012-01-01

    Maternal obesity is associated with a wide spectrum of delivery disorders, such as delayed or post-term delivery, that might be explained partly by the increase in plasma leptin levels in obese women, as leptin inhibits in vitro myometrial contractility. Delivery involves uterine apoptosis and remodelling of the extracellular matrix, via the activation of matrix metalloproteinases (MMP). This study was aimed to assess the role of leptin on human myometrium, by studying the interaction of lept...

  15. Abnormal cardiovascular responses to carotid sinus massage also occur in vasovagal syncope - implications for diagnosis and treatment.

    Science.gov (United States)

    Humm, A M; Mathias, C J

    2010-08-01

    Carotid sinus massage (CSM) is commonly used to identify carotid sinus hypersensitivity (CSH) as a possible cause for syncope, especially in older patients. However, CSM itself could provoke classical vasovagal syncope (VVS) in pre disposed subjects. Retrospective analysis of CSM, cardiovascular autonomic function tests (including tilt table testing) and medical history in 388 patients with recurrent syncope to identify and characterize patients in whom an abnormal response to CSM was more likely to reflect VVS than CSH. CSM was abnormal in 79 patients. In 53 patients (77.2 +/- 8.7 years), CSH was the likely cause of syncope. VVS was the more likely diagnosis in 26 younger patients (59.7 +/- 12.6 years) with longstanding syncope from youth, in whom fear or pain was as a trigger; 7/26 suffered from intense chronic or intermittent neck pain and one exacerbation of syncopal attacks followed a physical and emotional trauma to the neck. In VVS, 4/26 had spontaneous VVS during head-up tilt, another six after venepuncture (performed in 17/26). In 6/26, the abnormal response to CSM was delayed, occurring 62.8 +/- 28.4 s after completion of CSM. The response to CSM was predominantly of the mixed type (20/26) and abnormal on both sides in 14/26. An abnormal response to CSM may not indicate syncope caused by CSH and needs to be considered in the light of the patient's age, duration of syncopal episodes and detailed history of provocative stimuli. Differentiating CSH from VVS with an abnormal response to CSM has various implications from advice on driving to treatment strategies.

  16. AGAINST THE WIND: RADIO LIGHT CURVES OF TYPE IA SUPERNOVAE INTERACTING WITH LOW-DENSITY CIRCUMSTELLAR SHELLS

    International Nuclear Information System (INIS)

    Harris, Chelsea E.; Nugent, Peter E.; Kasen, Daniel N.

    2016-01-01

    For decades a wide variety of observations spanning the radio through optical and on to the X-ray have attempted to uncover signs of type Ia supernovae (SNe Ia) interacting with a circumstellar medium (CSM). The goal of these studies is to constrain the nature of the hypothesized SN Ia mass-donor companion. A continuous CSM is typically assumed when interpreting observations of interaction. However, while such models have been successfully applied to core-collapse SNe, the assumption of continuity may not be accurate for SNe Ia, because shells of CSM could be formed by pre-supernova eruptions (novae). In this work, we model the interaction of SNe with a spherical, low-density, finite-extent CSM and create a suite of synthetic radio synchrotron light curves. We find that CSM shells produce sharply peaked light curves. We also identify a fiducial set of models that obey a common evolution and can be used to generate radio light curves for an interaction with an arbitrary shell. The relations obeyed by the fiducial models can be used to deduce CSM properties from radio observations; we demonstrate this by applying them to the nondetections of SN 2011fe and SN 2014J. Finally, we explore a multiple shell CSM configuration and describe its more complicated dynamics and the resultant radio light curves.

  17. AGAINST THE WIND: RADIO LIGHT CURVES OF TYPE IA SUPERNOVAE INTERACTING WITH LOW-DENSITY CIRCUMSTELLAR SHELLS

    Energy Technology Data Exchange (ETDEWEB)

    Harris, Chelsea E.; Nugent, Peter E.; Kasen, Daniel N., E-mail: chelseaharris@berkeley.edu [Astronomy Department, University of California Berkeley, Berkeley, CA (United States)

    2016-06-01

    For decades a wide variety of observations spanning the radio through optical and on to the X-ray have attempted to uncover signs of type Ia supernovae (SNe Ia) interacting with a circumstellar medium (CSM). The goal of these studies is to constrain the nature of the hypothesized SN Ia mass-donor companion. A continuous CSM is typically assumed when interpreting observations of interaction. However, while such models have been successfully applied to core-collapse SNe, the assumption of continuity may not be accurate for SNe Ia, because shells of CSM could be formed by pre-supernova eruptions (novae). In this work, we model the interaction of SNe with a spherical, low-density, finite-extent CSM and create a suite of synthetic radio synchrotron light curves. We find that CSM shells produce sharply peaked light curves. We also identify a fiducial set of models that obey a common evolution and can be used to generate radio light curves for an interaction with an arbitrary shell. The relations obeyed by the fiducial models can be used to deduce CSM properties from radio observations; we demonstrate this by applying them to the nondetections of SN 2011fe and SN 2014J. Finally, we explore a multiple shell CSM configuration and describe its more complicated dynamics and the resultant radio light curves.

  18. Data-driven risk identification in phase III clinical trials using central statistical monitoring.

    Science.gov (United States)

    Timmermans, Catherine; Venet, David; Burzykowski, Tomasz

    2016-02-01

    Our interest lies in quality control for clinical trials, in the context of risk-based monitoring (RBM). We specifically study the use of central statistical monitoring (CSM) to support RBM. Under an RBM paradigm, we claim that CSM has a key role to play in identifying the "risks to the most critical data elements and processes" that will drive targeted oversight. In order to support this claim, we first see how to characterize the risks that may affect clinical trials. We then discuss how CSM can be understood as a tool for providing a set of data-driven key risk indicators (KRIs), which help to organize adaptive targeted monitoring. Several case studies are provided where issues in a clinical trial have been identified thanks to targeted investigation after the identification of a risk using CSM. Using CSM to build data-driven KRIs helps to identify different kinds of issues in clinical trials. This ability is directly linked with the exhaustiveness of the CSM approach and its flexibility in the definition of the risks that are searched for when identifying the KRIs. In practice, a CSM assessment of the clinical database seems essential to ensure data quality. The atypical data patterns found in some centers and variables are seen as KRIs under a RBM approach. Targeted monitoring or data management queries can be used to confirm whether the KRIs point to an actual issue or not.

  19. Land Operations in the Year 2020 (LO2020) (Operations terrestres a l’horizon 2020 (LO2020)).

    Science.gov (United States)

    1999-03-01

    guerre de l’information, les dispositifs electroniques, la biotechnologie , les technologies des structures et materiaux, les facteurs humains et...electriques militaires de grande puissance, la biotechnologie , les systemes microelectriques-mecaniques (MEMS) et les materiaux energetiques novateurs

  20. Author Details

    African Journals Online (AJOL)

    appareil urinaire au CHU Sylvanus Olympio : Bilan, analyse des potentialities biomedicales et ressources humaines au Togo Abstract. ISSN: 2413-354X. AJOL African Journals Online. HOW TO USE AJOL... for Researchers · for Librarians ...

  1. Libros

    Directory of Open Access Journals (Sweden)

    Facultad de Medicina Revista

    1952-09-01

    Full Text Available Precis de Parasitologie Humaine / Sindromes Pathologiques du Nourrisson et. de L'enfant / Practique Neurnlogique / Precis D'Anatomie / Traite de Medecine / Traite de Therapeutique Chirurgicale

  2. Browse Title Index

    African Journals Online (AJOL)

    Vol 23, No 1 (2004), MANIFESTATIONS NEURO-OPHTHALMOLOGIQUES DE LA TRYPANOSOMIASE HUMAINE AFRICAINE NEURO-OPHTHALMOLOGIC MANIFESTATIONS OF HUMAN AFRICAN TRYPANOSOMIASIS (English), Abstract. Jean-Claude Mwanza, Léon Kazumba, Gordon Terence Plant, Thorkild Tylleskär.

  3. Browse Title Index

    African Journals Online (AJOL)

    administration publique Beninoise : une contribution theorique de l'analyse strategique, Abstract .... Vol 17, No 3 (2015), Developpement du systeme de gestion des ressources humaines dans le District Sanitaire des Lacs de 2000 a 2011, Abstract.

  4. Managementul resurselor umane în administrația publică

    Directory of Open Access Journals (Sweden)

    Mirela MINICĂ

    2004-10-01

    Full Text Available La gestion des ressources humaines est un element essentiel de la dynamisation de la fonction publique. L’article fait un courte presentation sur les politiques de GRH et sur les fonctiones dans l’administration publique.

  5. Transportation of Aspergillus nidulans Class III and V Chitin Synthases to the Hyphal Tips Depends on Conventional Kinesin.

    Directory of Open Access Journals (Sweden)

    Norio Takeshita

    Full Text Available Cell wall formation and maintenance are crucial for hyphal morphogenesis. In many filamentous fungi, chitin is one of the main structural components of the cell wall. Aspergillus nidulans ChsB, a chitin synthase, and CsmA, a chitin synthase with a myosin motor-like domain (MMD at its N-terminus, both localize predominantly at the hyphal tip regions and at forming septa. ChsB and CsmA play crucial roles in polarized hyphal growth in A. nidulans. In this study, we investigated the mechanism by which CsmA and ChsB accumulate at the hyphal tip in living hyphae. Deletion of kinA, a gene encoding conventional kinesin (kinesin-1, impaired the localization of GFP-CsmA and GFP-ChsB at the hyphal tips. The transport frequency of GFP-CsmA and GFP-ChsB in both anterograde and retrograde direction appeared lower in the kinA-deletion strain compared to wild type, although the velocities of the movements were comparable. Co-localization of GFP-ChsB and GFP-CsmA with mRFP1-KinArigor, a KinA mutant that binds to microtubules but does not move along them, was observed in the posterior of the hyphal tip regions. KinA co-immunoprecipitated with ChsB and CsmA. Co-localization and association of CsmA with KinA did not depend on the MMD. These findings indicate that ChsB and CsmA are transported along microtubules to the subapical region by KinA.

  6. Human Leukocyte Antigen Mismatch and Steroid Maintenance in Kidney Transplantation.

    Science.gov (United States)

    Chopra, B; Sureshkumar, K K

    2015-12-01

    This study aimed to analyze the impact of chronic steroid maintenance (CSM) vs early steroid withdrawal (ESW) in kidney transplant recipients (KTRs) stratified by the level of human leukocyte antigen (HLA) mismatch. Adult KTRs between 2001 and 2011 who received antibody induction followed by calcineurin inhibitor (CNI)/mycophenolate mofetil (MMF) maintenance with or without steroid were identified from the Organ Procurement and Transplantation Network/United Network for Organ Sharing (OPTN/UNOS) database. Using multivariate analysis, graft and patient outcomes were compared for CSM vs ESW in KTRs stratified by HLA mismatch levels separately for depleting and nondepleting antibody-induced patients. Among 43,096 study patients, 26,582 received depleting induction (zero HLA mismatch = 5324 [CSM = 3416; ESW = 1908]; 5-6 HLA mismatch = 21,258 [CSM = 13,739; ESW = 7519]) and 16,514 patients received nondepleting induction (zero HLA mismatch = 4109 [CSM = 3453; ESW = 656]; 5-6 HLA mismatch = 12,405 [CSM = 10,890; ESW = 1515]). Adjusted graft failure risks for CSM vs ESW groups for zero HLA mismatch patients were as follows: HR 1.13, P = .07 (depleting induction); HR 1.30, P = .01 (nondepleting induction). Graft outcomes were similar for CSM vs ESW in 5-6 HLA mismatch groups for both induction types. Adjusted patient death risks were significantly higher for CSM vs ESW with depleting (HR 1.3, P = .003) and nondepleting (HR 1.45, P = .006) induction in zero HLA mismatch patients and only with depleting induction in 5-6 HLA mismatch groups (HR 1.16, P mismatch in KTRs selected for antibody induction and CNI/MMF maintenance. Copyright © 2015 Elsevier Inc. All rights reserved.

  7. RNA and DNA Targeting by a Reconstituted Thermus thermophilus Type III-A CRISPR-Cas System.

    Directory of Open Access Journals (Sweden)

    Tina Y Liu

    Full Text Available CRISPR-Cas (clustered regularly interspaced short palindromic repeats-CRISPR-associated systems are RNA-guided adaptive immunity pathways used by bacteria and archaea to defend against phages and plasmids. Type III-A systems use a multisubunit interference complex called Csm, containing Cas proteins and a CRISPR RNA (crRNA to target cognate nucleic acids. The Csm complex is intriguing in that it mediates RNA-guided targeting of both RNA and transcriptionally active DNA, but the mechanism is not well understood. Here, we overexpressed the five components of the Thermus thermophilus (T. thermophilus Type III-A Csm complex (TthCsm with a defined crRNA sequence, and purified intact TthCsm complexes from E. coli cells. The complexes were thermophilic, targeting complementary ssRNA more efficiently at 65°C than at 37°C. Sequence-independent, endonucleolytic cleavage of single-stranded DNA (ssDNA by TthCsm was triggered by recognition of a complementary ssRNA, and required a lack of complementarity between the first 8 nucleotides (5' tag of the crRNA and the 3' flanking region of the ssRNA. Mutation of the histidine-aspartate (HD nuclease domain of the TthCsm subunit, Cas10/Csm1, abolished DNA cleavage. Activation of DNA cleavage was dependent on RNA binding but not cleavage. This leads to a model in which binding of an ssRNA target to the Csm complex would stimulate cleavage of exposed ssDNA in the cell, such as could occur when the RNA polymerase unwinds double-stranded DNA (dsDNA during transcription. Our findings establish an amenable, thermostable system for more in-depth investigation of the targeting mechanism using structural biology methods, such as cryo-electron microscopy and x-ray crystallography.

  8. RNA and DNA Targeting by a Reconstituted Thermus thermophilus Type III-A CRISPR-Cas System.

    Science.gov (United States)

    Liu, Tina Y; Iavarone, Anthony T; Doudna, Jennifer A

    2017-01-01

    CRISPR-Cas (clustered regularly interspaced short palindromic repeats-CRISPR-associated) systems are RNA-guided adaptive immunity pathways used by bacteria and archaea to defend against phages and plasmids. Type III-A systems use a multisubunit interference complex called Csm, containing Cas proteins and a CRISPR RNA (crRNA) to target cognate nucleic acids. The Csm complex is intriguing in that it mediates RNA-guided targeting of both RNA and transcriptionally active DNA, but the mechanism is not well understood. Here, we overexpressed the five components of the Thermus thermophilus (T. thermophilus) Type III-A Csm complex (TthCsm) with a defined crRNA sequence, and purified intact TthCsm complexes from E. coli cells. The complexes were thermophilic, targeting complementary ssRNA more efficiently at 65°C than at 37°C. Sequence-independent, endonucleolytic cleavage of single-stranded DNA (ssDNA) by TthCsm was triggered by recognition of a complementary ssRNA, and required a lack of complementarity between the first 8 nucleotides (5' tag) of the crRNA and the 3' flanking region of the ssRNA. Mutation of the histidine-aspartate (HD) nuclease domain of the TthCsm subunit, Cas10/Csm1, abolished DNA cleavage. Activation of DNA cleavage was dependent on RNA binding but not cleavage. This leads to a model in which binding of an ssRNA target to the Csm complex would stimulate cleavage of exposed ssDNA in the cell, such as could occur when the RNA polymerase unwinds double-stranded DNA (dsDNA) during transcription. Our findings establish an amenable, thermostable system for more in-depth investigation of the targeting mechanism using structural biology methods, such as cryo-electron microscopy and x-ray crystallography.

  9. The Significance of the Trömner Sign in Cervical Spondylotic Myelopathy Patient.

    Science.gov (United States)

    Chaiyamongkol, Weera; Laohawiriyakamol, Teeranan; Tangtrakulwanich, Boonsin; Tanutit, Pramot; Bintachitt, Piyawat; Siribumrungwong, Koopong

    2017-11-01

    This study is a diagnostic analysis. To investigate the diagnostic accuracy of Trömner sign in cervical spondylotic myelopathy (CSM), and how its presence correlates with the severity of myelopathy. A clinical presentation of myelopathy corresponding with image findings is a current standard to diagnose CSM. Trömner sign is an alternative of well-known Hoffmann sign to detect CSM. Little is known about its diagnostic accuracy and how its presence correlates with the severity of CSM. Consecutive patients with clinical diagnosis of CSM and other cervical spondylosis-related problems were enrolled in either CSM group, cervical spondylotic radiculopathy group, or axial pain group. Normal volunteers and patients without spine-related issues were used as a control. All participants were examined for the presence of myelopathic signs. Magnetic resonance imaging studies of all participants were reviewed by a radiologist. There were 85 participants included in the study. Diagnostic sensitivity was 76%, 94%, 76%, and 36% for Hoffmann sign, Trömner sign, inverted radial reflex, and Babinski sign, respectively. Trömner sign had relatively high sensitivity (95%) despite of mild degree of myelopathy. Negative predictive value was 60%, 85%, 59%, and 38% for Hoffmann sign, Trömner sign, inverted radial reflex, and Babinski sign, respectively. There were 63%-71% of patients in either axial pain group or cervical spondylotic radiculopathy group had positive Trömner sign. Most of CSM patients with cord signal changed had positive myelopathic sign. Regarding CSM patient without cord signal change, most of tests were negative except Trömner sign. High sensitivity (94%) and relatively high negative predictive value (85%) for Trömner sign indicate the usefulness of Trömner sign in ruling out CSM. High incidence of positive Trömner sign in presymptomatic cervical cord compression patients suggests Trömner sign could have a useful role in early detection of presymptomatic

  10. Promotion de l'excellence en recherche sur la santé de la faune et la ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    En revanche, la cohabitation faune-humains s'accompagne de problèmes sérieux, notamment la transmission, par les animaux sauvages, de maladies infectieuses aux animaux d'élevage et aux êtres humains (par exemple la fièvre aphteuse, la fièvre par morsure de rat et la rage), qui font du Sri Lanka une zone très ...

  11. Index of International Publications in Aerospace Medicine

    Science.gov (United States)

    2014-05-01

    Document is available to the public through the Internet: www.faa.gov/go/oamtechreports 19. Security Classif. (of this report) 20. Security Classif...Modelling. Neuilly-sur-Seine, France: AGARD, 1998. Amalberti R. Facteurs Humains . Rungis, France: Institut Aéronautique Jean Mermoz, 1996. Anca JM...Spain, IBERIA, 1985. Emeyriat B. Facteurs Humains en Sécurité Aéroemme. Mont-Royal, Québec: Modulo, 1997. Endsley MR, Garland DJ. Situation

  12. Scoping Study on DRDC Toronto Future Research Regarding Naval Mine Countermeasures

    Science.gov (United States)

    2012-06-01

    particulier dans deux domaines : la coordination des facteurs humains pour la reconnaissance automatique de cibles et de véhicules sous-marins autonomes...considérations relatives aux facteurs humains par rapport à divers sujets pertinents. DRDC Toronto TR 2011-178 vii Table of contents Abstract...offensive mining threat to Canada is low, the emerging global security trends illustrate the potential for irregular attacks on Canada from terrorists

  13. Activités de renforcement des capacités de recherche sur les ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Les auteurs du Rapport arabe sur le développement humain 2005 mettent en évidence un phénomène qu'ils qualifient de détestable, à savoir l'abondance de capital humain féminin qualifié dans la région du Moyen-Orient et de ... Gender and work in MENA : research capacity building activities; mid-term evaluation.

  14. Agent chargé des politiques et de la planification stratégique des ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Appui à des comités internes de la GRH. Le Comité de gestion de ressources humaines (CGRH) est composé de gestionnaires et d'employés du CRDI dont le rôle est de fournir à la présidente des conseils stratégiques sur la gestion des ressources humaines au Centre et de superviser l'administration d'importantes ...

  15. Une approche écosanté pour le contrôle de la fièvre de la vallée du ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    17 août 2016 ... International Centre for Insect Physiology and Ecology. Échantillonnage de vecteur pendant l'étude. La fièvre de la vallée du Rift est une maladie grave qui se transmet par la piqûre d'un moustique qui infecte l'être humain, le bétail et les animaux sauvages. De plus, les êtres humains peuvent contracter la ...

  16. Résultats de recherche | Page 137 | CRDI - Centre de recherches ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Les auteurs du Rapport arabe sur le développement humain 2005 mettent en évidence un phénomène qu'ils qualifient de détestable, à savoir l'abondance de capital humain féminin qualifié dans la région du Moyen-Orient et de l'Afrique du Nord (région. Projet ...

  17. Prostate Cancer Risk in Relation to IGF-1 and its Genetic Determinants: A Case Control Study Within the Cancer Prostate Sweden Project (CAPS)

    Science.gov (United States)

    2007-05-01

    www.interscience. wiley.com). Abbreviations: CAPS, Cancer Prostate in Sweden; CEPH, Centre d’Etude du Polymorphisme Humain ; htSNPs, haplotype tagging...downloading genotype data for 30 Caucasian Centre d’Etude du Polymorphisme Humain (CEPH) trios from the HapMap Phase 1 data base,15 covering the IGF1...chromosome 5p12, a region highlighted by several independent prostate cancer family–based linkage analysis studies (16-20). Capitalizing on the

  18. More Freedom, Less Terror? Liberalization and Political Violence in the Arab World

    Science.gov (United States)

    2008-01-01

    unable to capitalize on the state’s indiscriminate repression, were not able to build a strong base of support within Egyptian society; their focus on...erosion of the new king’s political capital occurred with the pas- sage of anti-assembly and antiterrorism laws. By 2006, particularly after the...Marocaine des Droits Humains and more elitist Organisa- tion Marocaine des Droits de l’Homme. See Organisation Marrocaine des Droits Humains (2008

  19. Résultats de recherche | Page 53 | CRDI - Centre de recherches ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Corruption, opportunités économiques et concurrence. Published date. 1 janvier 2012. Études ... Mouvements sociaux dans le contexte de conflits armés : causes et effets de la défense des droits humains (1980-2012). La place de plus en plus prépondérante qui occupe la défense des droits humains dans les ...

  20. AS_659_A4 OK

    African Journals Online (AJOL)

    AKA BOKO

    utilisation en tant que phytosanitaire naturel sans effet secondaire sur la santé humaine et sur ... métabolites à tous les échelons édaphiques) que pour la santé humaine (possibilité de résidus dans les eaux ... naturelles et fournisseur d'huiles essentielles et végétales conventionnelles et certifiés BIO 171, Rue de.

  1. Agent de ressourcement (h/f) | CRDI - Centre de recherches pour le ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Tenir à jour les données consignées dans les modules du système de gestion des ressources humaines (SGRH), le système suivi aux fins de la classification et le contenu des pages Web de la Division des ressources humaines ayant trait à la dotation, à l'apprentissage, à la classification, aux langues officielles et à ...

  2. Gender Issues in Human trafficking in Edo State, Nigeria

    African Journals Online (AJOL)

    DENCES élevées de la traite des êtres humains dans la région. Mots clés: Trafic d 'êtres humains, État d 'Edo, polygynie, sexualité feminine, système héréditaire. Introduction. Human trafficking can best be described as a global problem and a modern form of slavery. Women and children are the key target groups because ...

  3. Nephrolepis biserrata, une Ptéridophyte utilisée comme plante ...

    African Journals Online (AJOL)

    SARAH

    30 sept. 2014 ... Extraction des épines de palmiers du corps humain : Dans la réalisation des activités humaines. (entretien des plantations de palmiers à huile, chasse, etc.), les accidents liés aux piquants des feuilles de palmiers sont courants. Pour extraire les restes d'organes de cette plante du corps après ces.

  4. Dicty_cDB: CHB488 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CH (Link to library) CHB488 (Link to dictyBase) - - - Contig-U14971-1 CHB488P (Link to Original site) CHB...488F 125 CHB488Z 717 CHB488P 822 - - Show CHB488 Library CH (Link to library) Clone ID CHB... URL http://dictycdb.biol.tsukuba.ac.jp/CSM/CH/CHB4-D/CHB488Q.Seq.d/ Representative seq. ID CHB...488P (Link to Original site) Representative DNA sequence >CHB488 (CHB488Q) /CSM/CH/CHB4-D/CHB4...iqipxatqlrxv* Homology vs CSM-cDNA Score E Sequences producing significant alignments: (bits) Value CHB

  5. Dicty_cDB: SHB752 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SH (Link to library) SHB752 (Link to dictyBase) - - - Contig-U16471-1 - (Link to Original site) - - SHB...752Z 722 - - - - Show SHB752 Library SH (Link to library) Clone ID SHB752 (Link to dicty...iol.tsukuba.ac.jp/CSM/SH/SHB7-C/SHB752Q.Seq.d/ Representative seq. ID - (Link to ...Original site) Representative DNA sequence >SHB752 (SHB752Q) /CSM/SH/SHB7-C/SHB752Q.Seq.d/ XXXXXXXXXXGCAGTTC...XLLEQETKIK Homology vs CSM-cDNA Score E Sequences producing significant alignments: (bits) Value SHB

  6. Dicty_cDB: VHB718 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHB718 (Link to dictyBase) - - - Contig-U15950-1 - (Link to Original site) - - VHB...718Z 219 - - - - Show VHB718 Library VH (Link to library) Clone ID VHB718 (Link to dicty...iol.tsukuba.ac.jp/CSM/VH/VHB7-A/VHB718Q.Seq.d/ Representative seq. ID - (Link to ...Original site) Representative DNA sequence >VHB718 (VHB718Q) /CSM/VH/VHB7-A/VHB718Q.Seq.d/ XXXXXXXXXXTAGGCTT...GINXGGLPSMTIDXFNNLVEKE NKKXMIIXKTV Homology vs CSM-cDNA Score E Sequences producing significant alignments: (bits) Value VHB718 (VHB

  7. Dicty_cDB: AHB367 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available AH (Link to library) AHB367 (Link to dictyBase) - - - Contig-U16439-1 - (Link to Original site) - - AHB...367Z 597 - - - - Show AHB367 Library AH (Link to library) Clone ID AHB367 (Link to dicty...iol.tsukuba.ac.jp/CSM/AH/AHB3-C/AHB367Q.Seq.d/ Representative seq. ID - (Link to ...Original site) Representative DNA sequence >AHB367 (AHB367Q) /CSM/AH/AHB3-C/AHB367Q.Seq.d/ XXXXXXXXXXAACGTGC...llp*llvsfvsn*lklfkiklw rnirapl*i*vshslvs Homology vs CSM-cDNA Score E Sequences producing significant alignments: (bits) Value AHB

  8. Dicty_cDB: SHB826 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SH (Link to library) SHB826 (Link to dictyBase) - - - Contig-U16330-1 SHB826P (Link to Original site) SHB...826F 610 SHB826Z 493 SHB826P 1083 - - Show SHB826 Library SH (Link to library) Clone ID SHB...e URL http://dictycdb.biol.tsukuba.ac.jp/CSM/SH/SHB8-B/SHB826Q.Seq.d/ Representative seq. ID SHB...826P (Link to Original site) Representative DNA sequence >SHB826 (SHB826Q) /CSM/SH/SHB8-B/SHB...LPELTNXEGSFCKDSCDXQAWSXATILAXPYXLSINKN*ifif Homology vs CSM-cDNA Score E Sequences producing significant ali

  9. Cellules stromales mésenchymateuses et transplantation d'organes

    OpenAIRE

    DETRY, Olivier; JOURET, François; VANDERMEULEN, Morgan; ERPICUM, Pauline; Delens, Loïc; GREGOIRE, Céline; BRIQUET, Alexandra; WEEKERS, Laurent; BAUDOUX, Etienne; LECHANTEUR, Chantal; BEGUIN, Yves

    2014-01-01

    Les cellules stromales mésenchymateuses (CSM) sont des cellules multipotentes et capables d’autorenouvellement. Les CSM semblent intéressantes pour leurs propriétés immunomodulatrices, dans la prévention ou le traitement du traumatisme ischémique, ainsi que dans la potentielle reconstitution ou amélioration d’organes. Depuis quelques années, le rôle potentiel des CSM en transplantation d’organes est évalué par des études in vitro et dans des modèles animaux. Leurs caractéristiques font des CS...

  10. Dicty_cDB: VSH854 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 67Q.Seq.d/ 519 e-146 SSM528 (SSM528Q) /CSM/SS/SSM5-B/SSM528Q.Seq.d/ 519 e-146 SSM293 (SSM29...3Q) /CSM/SS/SSM2-D/SSM293Q.Seq.d/ 519 e-146 SSL530 (SSL530Q) /CSM/SS/SSL5-B/SSL530Q.Seq.d/ 519 e-1... AU038826 ) Dictyostelium discoideum slug cDNA, clone SSL530. 504 e-145 2 ( AU039028 ) Dictyostelium discoideum slug cDNA, clone SSM2

  11. Dicty_cDB: SFA635 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available .43 VFG840 (VFG840Q) /CSM/VF/VFG8-B/VFG840Q.Seq.d/ 34 0.43 VFA553 (VFA553Q) /CSM/VF/VFA5-C/VFA553Q.Seq.d/ 34 0.43 SSM295 (SSM29...5Q) /CSM/SS/SSM2-D/SSM295Q.Seq.d/ 34 0.43 own update 2004.12.25 Homology vs DNA Score E S

  12. Dicty_cDB: VSH874 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SM/SS/SSM8-B/SSM828Q.Seq.d/ 176 9e-44 SSM528 (SSM528Q) /CSM/SS/SSM5-B/SSM528Q.Seq.d/ 176 9e-44 SSM29...3 (SSM293Q) /CSM/SS/SSM2-D/SSM293Q.Seq.d/ 176 9e-44 SSK684 (SSK684Q) /CSM/SS/SSK6-D/SSK68...telium discoideum slug cDNA, clone SSM293. 155 9e-43 2 ( AU038255 ) Dictyostelium discoideum slug cDNA, clon

  13. Dicty_cDB: SLE611 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available equences producing significant alignments: (bits) Value SSM408 (SSM408Q) /CSM/SS/SSM4-A/SSM408Q.Seq.d/ 1009 0.0 SSM294 (SSM29...4Q) /CSM/SS/SSM2-D/SSM294Q.Seq.d/ 1009 0.0 SSL192 (SSL192Q) /CSM/SS/SSL1-D/SSL192Q.Seq.d/ 1...one SSM408. 957 0.0 1 ( AU039029 ) Dictyostelium discoideum slug cDNA, clone SSM29

  14. Military Intelligence Professional Bulletin (MIPB). Volume 37, Number 2, April-June 2011

    Science.gov (United States)

    2011-04-01

    Ibrahimov, PhD Professional Reader Contact and Submission Information Inside Back Cover: 2011 CSM Doug Russell Award Departments 2 Military Intelligence...issue that characterized the rotation. Mr. Tomes has been a CoIST instructor for NSTID/ TD at Ft. Huachuca for the past 2 years. and the JRTC CoIST Site...520.538.0956 DSN 879.0956. The 11th annual CSM Doug Russell Award ceremony was held on 8 March 2011 during the Military Intelligence (MI) CSM /SGM

  15. Innovations in Site Characterization Case Study: The Role of a Conceptual Site Model for Expedited Site Characterization Using the Triad Approach at the Poudre River Site, Fort Collins, Colorado

    Science.gov (United States)

    This case study examines how systematic planning, an evolving conceptual site model (CSM), dynamic work strategies, and real time measurement technologies can be used to unravel complex contaminant distribution patterns...

  16. Dicty_cDB: SSD104 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available v i*sncfrs*pcrikiftnvl*iwheyitnslfstdiq*ncic*ctwgsdtsd Homology vs CSM-cDNA Score E Sequences producing sign...kkklmcftnkgwitiifwtsicfscseli*titcwtkwhtqgte*rls aswrs*ttifitrvchnrttwtf**wq*itftnwiw*mnesi*ycnfsttectltd*ti

  17. Dicty_cDB: CHB832 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CH (Link to library) CHB832 (Link to dictyBase) - - - Contig-U16535-1 CHB832P (Link to Original site) CHB...832F 533 CHB832Z 762 CHB832P 1275 - - Show CHB832 Library CH (Link to library) Clone ID CHB...e URL http://dictycdb.biol.tsukuba.ac.jp/CSM/CH/CHB8-B/CHB832Q.Seq.d/ Representative seq. ID CHB...832P (Link to Original site) Representative DNA sequence >CHB832 (CHB832Q) /CSM/CH/CHB8-B/CHB...strgtsiqqesl Homology vs CSM-cDNA Score E Sequences producing significant alignments: (bits) Value CHB832 (CHB832Q) /CSM/CH/CHB

  18. Dicty_cDB: VHB117 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHB117 (Link to dictyBase) - - - Contig-U16528-1 VHB117P (Link to Original site) VHB...117F 592 VHB117Z 283 VHB117P 855 - - Show VHB117 Library VH (Link to library) Clone ID VHB... URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHB1-A/VHB117Q.Seq.d/ Representative seq. ID VHB...117P (Link to Original site) Representative DNA sequence >VHB117 (VHB117Q) /CSM/VH/VHB1-A/VHB1...LHLVLRLRGGGGKX Homology vs CSM-cDNA Score E Sequences producing significant alignments: (bits) Value VHB117 (VHB117Q) /CSM/VH/VHB

  19. Dicty_cDB: VHB751 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHB751 (Link to dictyBase) - - - Contig-U16283-1 VHB751P (Link to Original site) VHB...751F 554 VHB751Z 583 VHB751P 1117 - - Show VHB751 Library VH (Link to library) Clone ID VHB...e URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHB7-C/VHB751Q.Seq.d/ Representative seq. ID VHB...751P (Link to Original site) Representative DNA sequence >VHB751 (VHB751Q) /CSM/VH/VHB7-C/VHB...lignments: (bits) Value VHB751 (VHB751Q) /CSM/VH/VHB7-C/VHB751Q.Seq.d/ 2079 0.0 VHN470 (VHN470Q) /CSM/VH/VHN

  20. Dicty_cDB: VHB353 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHB353 (Link to dictyBase) - - - Contig-U12097-1 VHB353P (Link to Original site) VHB...353F 573 VHB353Z 640 VHB353P 1193 - - Show VHB353 Library VH (Link to library) Clone ID VHB...e URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHB3-C/VHB353Q.Seq.d/ Representative seq. ID VHB...353P (Link to Original site) Representative DNA sequence >VHB353 (VHB353Q) /CSM/VH/VHB3-C/VHB...ttrkn*ki Homology vs CSM-cDNA Score E Sequences producing significant alignments: (bits) Value VHB353 (VHB353Q) /CSM/VH/VHB3-C/VHB

  1. Dicty_cDB: SHB840 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SH (Link to library) SHB840 (Link to dictyBase) - - - Contig-U16471-1 - (Link to Original site) - - SHB...840Z 575 - - - - Show SHB840 Library SH (Link to library) Clone ID SHB840 (Link to dicty...iol.tsukuba.ac.jp/CSM/SH/SHB8-B/SHB840Q.Seq.d/ Representative seq. ID - (Link to ...Original site) Representative DNA sequence >SHB840 (SHB840Q) /CSM/SH/SHB8-B/SHB840Q.Seq.d/ XXXXXXXXXXTGAACAA...s CSM-cDNA Score E Sequences producing significant alignments: (bits) Value SHB840 (SHB840Q) /CSM/SH/SHB8-B/SHB

  2. Dicty_cDB: VHB236 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHB236 (Link to dictyBase) - - - Contig-U12076-1 VHB236P (Link to Original site) VHB...236F 655 VHB236Z 805 VHB236P 1440 - - Show VHB236 Library VH (Link to library) Clone ID VHB...e URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHB2-B/VHB236Q.Seq.d/ Representative seq. ID VHB...236P (Link to Original site) Representative DNA sequence >VHB236 (VHB236Q) /CSM/VH/VHB2-B/VHB...Homology vs CSM-cDNA Score E Sequences producing significant alignments: (bits) Value VHB236 (VHB236Q) /CSM/VH/VHB2-B/VHB

  3. Dicty_cDB: SHB156 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SH (Link to library) SHB156 (Link to dictyBase) - - - Contig-U11241-1 SHB156P (Link to Original site) SHB...156F 168 SHB156Z 381 SHB156P 529 - - Show SHB156 Library SH (Link to library) Clone ID SHB... URL http://dictycdb.biol.tsukuba.ac.jp/CSM/SH/SHB1-C/SHB156Q.Seq.d/ Representative seq. ID SHB...156P (Link to Original site) Representative DNA sequence >SHB156 (SHB156Q) /CSM/SH/SHB1-C/SHB1...ant alignments: (bits) Value SHB156 (SHB156Q) /CSM/SH/SHB1-C/SHB156Q.Seq.d/ 406 e-112 AHC605 (AHC605Q) /CSM/

  4. Dicty_cDB: CHB732 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CH (Link to library) CHB732 (Link to dictyBase) - - - Contig-U16535-1 CHB732P (Link to Original site) CHB...732F 516 CHB732Z 751 CHB732P 1247 - - Show CHB732 Library CH (Link to library) Clone ID CHB...e URL http://dictycdb.biol.tsukuba.ac.jp/CSM/CH/CHB7-B/CHB732Q.Seq.d/ Representative seq. ID CHB...732P (Link to Original site) Representative DNA sequence >CHB732 (CHB732Q) /CSM/CH/CHB7-B/CHB...ficant alignments: (bits) Value CHB732 (CHB732Q) /CSM/CH/CHB7-B/CHB732Q.Seq.d/ 1780 0.0 CHB832 (CHB832Q) /CSM/CH/CHB8-B/CHB

  5. Dicty_cDB: VHB772 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHB772 (Link to dictyBase) - - - Contig-U15043-1 VHB772P (Link to Original site) VHB...772F 580 VHB772Z 774 VHB772P 1334 - - Show VHB772 Library VH (Link to library) Clone ID VHB...e URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHB7-C/VHB772Q.Seq.d/ Representative seq. ID VHB...772P (Link to Original site) Representative DNA sequence >VHB772 (VHB772Q) /CSM/VH/VHB7-C/VHB...alignments: (bits) Value VHB772 (VHB772Q) /CSM/VH/VHB7-C/VHB772Q.Seq.d/ 1675 0.0 VFD268 (VFD268Q) /CSM/VF/VF

  6. Dicty_cDB: SSJ426 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available XX***** ****kiinsrninsyqffqnmrifffk*inplfl*i Translated Amino Acid sequence (All Frames) Frame A: ---l*hlfsk...MTKKLYIQDLRKKSFLIPKKNTNKKSCKTXX***** ****kiinsrninsyqffqnmrifffk*inplfl*i Homology vs CSM-cDNA Score E Seque

  7. Is Decompressive Surgery for Cervical Spondylotic Myelopathy Effective in Patients Suffering from Concomitant Multiple Sclerosis or Parkinson’s Disease?

    Directory of Open Access Journals (Sweden)

    Taylor E. Purvis

    2017-04-01

    Full Text Available A subset of patients with a demyelinating disease suffer from concurrent cervical spondylotic myelopathy, both of which evince similar symptomatology. Differentiating the cause of these symptoms is challenging, and little research has been done on patients with coexisting diseases. This review explores the current literature on the appropriate surgical management of patients with concurrent multiple sclerosis (MS and cervical spondylotic myelopathy (CSM, and those with both Parkinson’s disease (PD and CSM. MS and CSM patients may benefit from surgery to reduce pain and radiculopathy. Surgical management in PD and CSM patients has shown minimal quality-of-life improvement. Future studies are needed to better characterize demyelinating disease patients with concurrent disease and to determine ideal medical or surgical treatment.

  8. Porous carbon with small mesoporesas an ultra-high capacity adsorption medium

    Science.gov (United States)

    Gao, Biaofeng; Zhou, Haitao; Chen, De; Yang, Jianhong

    2017-10-01

    Resins (732-type), abundant and inexpensive resources were used to prepare porous carbon with small mesopores (CSM) by carbonization and post-chemical-activation with potassium hydroxide (KOH). The N2 adsorption measurements revealed that CSM had high surface areas (1776.5 m2 g-1), large pore volumes (1.10 cm3 g-1), and nearly optimal narrow small mesopore sizes ranging from 2 to 7 nm. CSM was used as adsorbent to investigate the adsorption behavior for Rhodamine B (RhB). Due to the optimal pore size distributions (PSD), intensive-stacking interaction, S-doped, and electrostatic attraction, the CSM exhibited an ultra-high-capacity of 1590 mg g-1 for RhB in aqueous solutions.

  9. Dicty_cDB: VFF224 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VF (Link to library) VFF224 (Link to dictyBase) - - - Contig-U15434-1 VFF224P (Link to Original site) VFF22...4F 649 VFF224Z 711 VFF224P 1360 - - Show VFF224 Library VF (Link to library) Clone ID VFF22...e URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VF/VFF2-A/VFF224Q.Seq.d/ Representative seq. ID VFF22...4P (Link to Original site) Representative DNA sequence >VFF224 (VFF224Q) /CSM/VF/VFF2-A/VFF22...logy vs CSM-cDNA Score E Sequences producing significant alignments: (bits) Value VFF224 (VFF224Q) /CSM/VF/VFF2-A/VFF22

  10. Dicty_cDB: SSF228 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SS (Link to library) SSF228 (Link to dictyBase) - - - Contig-U14470-1 SSF228Z (Link... to Original site) - - SSF228Z 479 - - - - Show SSF228 Library SS (Link to library) Clone ID SSF228 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/SS/SSF2-B/SSF228Q.Seq.d/ Representative seq. ID SSF22...8Z (Link to Original site) Representative DNA sequence >SSF228 (SSF228Q) /CSM/SS/SSF2-B/SSF228Q.Seq.d/ XXXXX...SSI693Q) /CSM/SS/SSI6-D/SSI693Q.Seq.d/ 862 0.0 SSG623 (SSG623Q) /CSM/SS/SSG6-A/SSG623Q.Seq.d/ 862 0.0 SSF228 (SSF22

  11. Dicty_cDB: SLF225 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SL (Link to library) SLF225 (Link to dictyBase) - - - Contig-U16171-1 SLF225P (Link to Original site) SLF22...5F 132 SLF225Z 444 SLF225P 576 - - Show SLF225 Library SL (Link to library) Clone ID SLF22... URL http://dictycdb.biol.tsukuba.ac.jp/CSM/SL/SLF2-B/SLF225Q.Seq.d/ Representative seq. ID SLF22...5P (Link to Original site) Representative DNA sequence >SLF225 (SLF225Q) /CSM/SL/SLF2-B/SLF22...icant alignments: (bits) Value VFA868 (VFA868Q) /CSM/VF/VFA8-C/VFA868Q.Seq.d/ 618 e-176 SLF225 (SLF225Q) /CSM/SL/SLF2-B/SLF22

  12. Soome maiustustetootja Leaf saab peatselt uue omaniku / Tõnis Arnover

    Index Scriptorium Estoniae

    Arnover, Tõnis, 1952-

    2004-01-01

    Hollandi kontsern CSM otsustas loobuda maiustusetootmisest, sh. Soome magusatootjast Leaf ning keskenduda pagaritööstustoorme, biokemikaalide ning suhkrutoodete valmistamisele. Diagramm: CSMi kasumlikkus vähenes. Vt. samas: Eestis menukad kurgupastillid

  13. Integrated Microchannel Reformer/Hydrogen Purifier for Fuel Cell Power Systems, Phase II

    Data.gov (United States)

    National Aeronautics and Space Administration — Makel Engineering, Inc. (MEI) supported by Lockheed Martin and the Colorado School of Mines (CSM) propose to develop an integrated hydrogen generator and purifier...

  14. Dicty_cDB: CHI526 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available YVPXIESCXNNHYNXQLSXSIN*iny*xki kkiilitiii**ln*fansn Translated Amino Acid sequenc...ALDGTHMNPSYVPXIESCXNNHYNXQLSXSIN*iny*xki kkiilitiii**ln*fansn Homology vs CSM-cDNA Score E Sequences produci

  15. Dicty_cDB: Contig-U14477-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available vmvvvivfylqviynlriivilmvqlivivf*mglvmvtviiivivii i*rinnnnsnnnnnsnnnkikmif*yqiinrlnnyf*shyqkfiiiqrldfwdyqrler* *hhlyqrlvnqvvivq*fhwisl...amvlaimxxx own update 2004. 6.10 Homology vs CSM-cDNA Query= Contig-U14477-1 (Conti

  16. Dicty_cDB: SFI877 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ighclpnixkminhxxliwxxyhhqlxxkxkvhqvxrfiqtlxt Frame C: *wk*vyfik*DLHXTXYIHILIFSNEN...rir**ffikeis*im*f*rixnyx y*ikglyiwrixxs*ldivypiyxr**iixi*fgxxttinxxkrxrfiksxxlfkh*xr Homology vs CSM-cDNA Sc

  17. Curing characteristics and dynamic mechanical behaviour of reinforced acrylonitrile-butadiene/chlorosulfonated polyethylene rubber blends

    Czech Academy of Sciences Publication Activity Database

    Markovic, G.; Marinovic-Cincovic, M.; Valentová, H.; Ilavský, Michal; Radovanovic, B.; Budinski-Simendic, J.

    2005-01-01

    Roč. 494, - (2005), s. 475-480 ISSN 0255-5476 Institutional research plan: CEZ:AV0Z40500505 Keywords : adhesion strength * crosslinking * CSM Subject RIV: CD - Macromolecular Chemistry Impact factor: 0.399, year: 2005

  18. A Window of Opportunity for Aceh, Indonesia Post-Tsunami: Historic Continuity, Current Points of Interest, and a Pattern. Output of the Cultural Simulation Model

    National Research Council Canada - National Science Library

    2006-01-01

    ...) for the Situation in Aceh, Indonesia. The CSM uses news filtering, a knowledge acquisition and contextual memory method, which we refer to as a Cultural Construct, as well as interaction by modelers, subject matter experts (SMEs...

  19. Dicty_cDB: FC-BR23 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-BR23 (Link to dictyBase) - - - Contig-U15008-1 FC-BR23Z (Li...nk to Original site) - - FC-BR23Z 641 - - - - Show FC-BR23 Library FC (Link to library) Clone ID FC-BR23 (Li.../dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-BR/FC-BR23Q.Seq.d/ Representative seq. ID FC-BR2...3Z (Link to Original site) Representative DNA sequence >FC-BR23 (FC-BR23Q) /CSM/FC/FC-BR/FC-BR23Q.Seq....9 0.0 SLA211 (SLA211Q) /CSM/SL/SLA2-A/SLA211Q.Seq.d/ 1029 0.0 FC-BR23 (FC-BR23Q) /CSM/FC/FC-BR/FC-BR2

  20. Dicty_cDB: FC-AP22 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AP22 (Link to dictyBase) - G24045 DDB0232387 Contig-U15141-1 FC-AP...22F (Link to Original site) FC-AP22F 317 - - - - - - Show FC-AP22 Library FC (Link to library) Clone ID FC-AP...1-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AP/FC-AP22Q.Se...q.d/ Representative seq. ID FC-AP22F (Link to Original site) Representative DNA sequence >FC-AP22 (FC-AP22Q) /CSM/FC/FC-AP/FC-AP...KKKKKKK Homology vs CSM-cDNA Score E Sequences producing significant alignments: (bits) Value FC-AP22 (FC-AP22Q) /CSM/FC/FC-AP/FC-AP