WorldWideScience

Sample records for mesenchymateuses humaines csm

  1. Study of human mesenchymal stem cells plasticity into radiation injured tissues in a N.O.D./S.C.I.D. mouse model: therapeutic approach of the multiple organ dysfunction; Etude de la capacite plastique des Cellules Souches Mesenchymateuses humaines (CSM) apres irradiation du tissu receveur: approche therapeutique de l'atteinte multiorgane radio-induite

    Energy Technology Data Exchange (ETDEWEB)

    Francois, S

    2006-01-15

    The therapeutic potential of bone marrow-derived human mesenchymal stem cells (h.M.S.C.) has recently been brought into the spotlight of many fields of research. One possible application of the approach is the repair of injured tissues arising from side effects of radiation treatments and accidents. The first challenge in cell therapy is to assess the quality of the cell and the ability to retain their differentiation potential during the expansion process. Efficient delivery to the sites of intended action is also necessary. We addressed both questions using h.M.S.C. cultured and then infused to Non Obese Diabetes/Severe Combined Immunodeficiency (N.O.D./S.C.I.D.) mice submitted to total body irradiation. Further, we tested the impact of additional local irradiation superimposed to total body irradiation (T.B.I.), as a model of accidental irradiation. Our results showed that the h.M.S.C. used for transplant have been expanded without significant loss in their differentiation capacities. After transplantation into adult unconditioned mice, h.M.S.C. not only migrate in bone marrow but also into other tissues. Total body irradiation increased h.M.S.C. implantation in bone marrow and muscle and further led to engraftment in brain, heart, and liver. Local irradiation, in addition to T.B.I., increased both specific homing of injected cells to the injured tissues and to other tissues outside the local irradiation field. M.S.C. may participate to restoration of intestinal homeostasis 3 days post abdominal irradiation. This study suggests that using the potential of h.M.S.C. to home to various organs in response to tissue injuries could be a promising strategy to repair the radiation induced damages. (author)

  2. Study of human mesenchymal stem cells plasticity into radiation injured tissues in a N.O.D./S.C.I.D. mouse model: therapeutic approach of the multiple organ dysfunction; Etude de la capacite plastique des Cellules Souches Mesenchymateuses humaines (CSM) apres irradiation du tissu receveur: approche therapeutique de l'atteinte multiorgane radio-induite

    Energy Technology Data Exchange (ETDEWEB)

    Francois, S

    2006-01-15

    The therapeutic potential of bone marrow-derived human mesenchymal stem cells (h.M.S.C.) has recently been brought into the spotlight of many fields of research. One possible application of the approach is the repair of injured tissues arising from side effects of radiation treatments and accidents. The first challenge in cell therapy is to assess the quality of the cell and the ability to retain their differentiation potential during the expansion process. Efficient delivery to the sites of intended action is also necessary. We addressed both questions using h.M.S.C. cultured and then infused to Non Obese Diabetes/Severe Combined Immunodeficiency (N.O.D./S.C.I.D.) mice submitted to total body irradiation. Further, we tested the impact of additional local irradiation superimposed to total body irradiation (T.B.I.), as a model of accidental irradiation. Our results showed that the h.M.S.C. used for transplant have been expanded without significant loss in their differentiation capacities. After transplantation into adult unconditioned mice, h.M.S.C. not only migrate in bone marrow but also into other tissues. Total body irradiation increased h.M.S.C. implantation in bone marrow and muscle and further led to engraftment in brain, heart, and liver. Local irradiation, in addition to T.B.I., increased both specific homing of injected cells to the injured tissues and to other tissues outside the local irradiation field. M.S.C. may participate to restoration of intestinal homeostasis 3 days post abdominal irradiation. This study suggests that using the potential of h.M.S.C. to home to various organs in response to tissue injuries could be a promising strategy to repair the radiation induced damages. (author)

  3. Humain behavior

    CERN Multimedia

    James,M

    1979-01-01

    Le Dr.Muriel James est ingénieur, conseiller/consultant dans plusieurs commissions (p.ex.justice criminelle au Japon) et universités et est l'auteur de nombreux livres (11) traduits dans plusieurs langues. Le plus connu de ses ouvrages est "Born to win". Dans son exposé elle se réfère à son livre "O.K.Boss" et parle d'un modèle spécifique du comportement humain et de ses qualités essentielles qui est la base de son travail.

  4. Cervical Spondylotic Myelopathy (CSM)

    Science.gov (United States)

    ... of CSM occur over time. They can include: neck pain or stiffness arm pain numbness in your hands ... Health, Men, Seniors, WomenTags: adult, elderly, Neck Disorders, neck pain, Neck Swelling, older adults, Rheumatologic, senior September 1, ...

  5. CSM: Profamilia's approach in Colombia.

    Science.gov (United States)

    Samuel, S

    1982-03-01

    Colombia's PROFAMILIA has successfully operated a contraceptive social marketing (CSM) program since 1973. Beginning with 1 salesperson distributing primarily to Cajas de Subsideio, the CSM program is now distributed through 70-80% of the 6000 registered pharmacies in the country, as well as pharmacy counters of several supermakets in urban areas. During 1981, PROFAMILIA's 5 salespersons accountd for commerical sales of oral contraceptives (OCs) to 225,000 couples and sales of barrier methods to another 75,000. Program sales of contraceptives and other products generated approximately US $1.7 million in revenue for the same year. PROFAMILIA's marketing approach is unique in its product and promotinal characteristics. Supplies are obtained directly from local and foreign manufacturers and are resold without any repackaging. While it is generally believed that CSM programs expand the market for contraceptives, data analysis and analysis of PROFAMILIA's distribution system suggests that the PROFAMILIA CSM program has simply absorbed some of the previously existing commerical market. Total commerical market sales of oral contraceptives (OCs) have grown at an annual rate of 3-4% since 1975. During the same period, direct sales of Schering, Wyeth, and other competitors have declined. PROFAMILIA's community-based program operates mainly among urban and semi-rural lower income populations. It sells products through established retail outlets rather than through institutional or non-retail outlets. PROFAMILIA's community-based program in all respects but its use of a staff of 112 salaried "instructoras" is as much a marketing program as PROFAMILIA's sales through pharmacies. Taken together, the 2 program expanded the commerical makert by about 1/2 since 1975. The contraceptive social marketing or pharmacy sales program appears to excel at generation of revenue and delivery of products to higher income clients. The community-based program excels at delivery of information

  6. Chamber service module (CSM1) for MDT

    CERN Document Server

    Binchi, P

    2002-01-01

    CSM-1 is the second and latest version of the high speed electronic unit whose primary task is to multiplex serial data from up to 18 ASD /TDC cards located at the ends of the Monitored Drift Tubes. Each CSM will capture data from all 24 channel TDC (AMT-2 units) of a given chamber and transfer it along a single optic fiber to the MROD, the event builder and readout driver. The core of the board is a Xilinx VirtexII FPGA which will use JTAG protocol (IEEE Std. 1149.1) for logic configuration parameter loading.

  7. Crystal structure of the Csm3-Csm4 subcomplex in the type III-A CRISPR-Cas interference complex.

    Science.gov (United States)

    Numata, Tomoyuki; Inanaga, Hideko; Sato, Chikara; Osawa, Takuo

    2015-01-30

    Clustered, regularly interspaced, short palindromic repeat (CRISPR) loci play a pivotal role in the prokaryotic host defense system against invading genetic materials. The CRISPR loci are transcribed to produce CRISPR RNAs (crRNAs), which form interference complexes with CRISPR-associated (Cas) proteins to target the invading nucleic acid for degradation. The interference complex of the type III-A CRISPR-Cas system is composed of five Cas proteins (Csm1-Csm5) and a crRNA, and targets invading DNA. Here, we show that the Csm1, Csm3, and Csm4 proteins from Methanocaldococcus jannaschii form a stable subcomplex. We also report the crystal structure of the M. jannaschii Csm3-Csm4 subcomplex at 3.1Å resolution. The complex structure revealed the presence of a basic concave surface around their interface, suggesting the RNA and/or DNA binding ability of the complex. A gel retardation analysis showed that the Csm3-Csm4 complex binds single-stranded RNA in a non-sequence-specific manner. Csm4 structurally resembles Cmr3, a component of the type III-B CRISPR-Cas interference complex. Based on bioinformatics, we constructed a model structure of the Csm1-Csm4-Csm3 ternary complex, which provides insights into its role in the Csm interference complex. Copyright © 2014 Elsevier Ltd. All rights reserved.

  8. CSM research: Methods and application studies

    Science.gov (United States)

    Knight, Norman F., Jr.

    1989-01-01

    Computational mechanics is that discipline of applied science and engineering devoted to the study of physical phenomena by means of computational methods based on mathematical modeling and simulation, utilizing digital computers. The discipline combines theoretical and applied mechanics, approximation theory, numerical analysis, and computer science. Computational mechanics has had a major impact on engineering analysis and design. When applied to structural mechanics, the discipline is referred to herein as computational structural mechanics. Complex structures being considered by NASA for the 1990's include composite primary aircraft structures and the space station. These structures will be much more difficult to analyze than today's structures and necessitate a major upgrade in computerized structural analysis technology. NASA has initiated a research activity in structural analysis called Computational Structural Mechanics (CSM). The broad objective of the CSM activity is to develop advanced structural analysis technology that will exploit modern and emerging computers, such as those with vector and/or parallel processing capabilities. Here, the current research directions for the Methods and Application Studies Team of the Langley CSM activity are described.

  9. Pakistan/USAID to start CSM project.

    Science.gov (United States)

    1984-01-01

    Pakistan, with the assistance of funds for the US Agency for International Development (USAID), is about to start its novel approach to contraceptive social marketing (CSM). This new effort suggests a marked policy shift on the part of the Pakistan government toward intensifying its family planning activities. The program will be government-operated and supported by AID over the next 5 years with $20 million, more than double the cost of similar CSM projects elswhere. Distribution of a condom on a pilot project basis is expected to begin by December 1984. Sales of a low-dose oral contraceptive (OC) could begin in test market areas by mid-1985, with national launching of both products tentatively scheduled for January 1986. The Pakistan/USAID agreement represents the 1st time since the formation of India's Nirodh project in the late 1960s that a CSM program is being established without the involvement of either an international social marketing contractor or a country's family planning association. The Pakistan CSM program will be managed by a policy board composed of representatives from the government's Ministries of Planning, Health and Education; a resident advisor from USAID; and a local company responsible for product marketing and distribution. The approach has received a skeptical response among international social marketing experts about the program's chances for success. Their doubts extend to 2 other aspects of the proposed design: an official of the Ministry of Planning's Population and Welfare Division expects the CSM program to generate sufficient revenues to cover all operating costs following the 5-year subsidy period, while also providing attractive profit margins for the marketing/distribution company; and the government prohibits mass media advertising of contraceptives. According to AID, the issue of mass media contraceptive advertising has not yet been resolved, and a national survey will be conducted to determine what communication needs are

  10. Thermostability and surface morphology of nano- and micro-filled NBR/CSM and CR/CSM rubber blends

    Directory of Open Access Journals (Sweden)

    M. MARINOVIC-CINCOVIC

    2004-02-01

    Full Text Available Acrylonitrile-butadiene rubber (NBR, polychloroprene rubber (CR, chlorosulphonated polyethylene rubber (CSM and their blends were cross-linked with sulphur, ethylene-thiourea, magnesium oxide or their combination. The effect of nano- and micro- particle sized of 35 pphr SiO2 on the thermostability and surface morphology of all the crosslinked systems was investigated. Identification of the structure of nano- and micro- particle sized SiO2 filled NBR/CSM and CR/CSM crosslinked systems was carried out by Fourier transform infrared spectroscopy (FTIR with an attenuated total reflectance (ATR extension. The thermal stability of the nano- and micro- particle sized SiO2 filled NBR/CSM and CR/CSM crosslinked systems were carried out by thermogravimetric analysis (TGA. The glass transition temperature (Tg of the samples was determined by differential scanning calorimetry (DSC. The morphology of the fracture surface of the crosslinked systems was carried out by scanning electron microscope (SEM. The results show when filled with nano-particle sized of SiO2 NBR/CSM and CR/CSM polymer matrix have a strong peak from SiO–C at 1079 cm-1. This suggests the an interaction between the SiO2, which should lead to an increased thermal stability, higher values of Tg, better dispersion the nano-SiO2 and more polish, without cracks than micro-filled NBR/CSM and CR/CSM crosslinked systems.

  11. Egypt site of first CSM marketing audit.

    Science.gov (United States)

    1982-01-01

    The 1st application of the marketing audit concept to a CSM project was implemented in Egypt's Family of the Future (FOF) contraceptive social marketing program in 1982. The audit defined the basic mission of the FOF as one of assisting the government in achieving its long range family planning goals. The stated FOF objectives are as follows: to create an awareness or an increase in demand for family planning services, particularly among the lower socioeconomic strata in urban Egypt; to establish and maintain a reliable supply mechanism to make FOF products more readily acceptable and available from pharmacies; and to consolidate the CSM operations and services first in the greater Cairo area and then expand to other urban areas in Egypt. The core strategy of the FOF incorporates several elements, including intensive media based advertising and personal promotion to promote the concept of family planning and to educate the general public about contraceptive alternatives. FOF product prices are considerably lower than commercial prices. Dr. Alan R. Andreasen, who conducted the audit on behalf of the FOF technical assistance contractor, noted that the FOF is growing rapidly and stated that the audit recommendations were intended to help FOF management. Dr. Andreasen conducted interviews with all the senior personnel at FOF and met with various specialized staff members such as the Public Relations Manager. Dr. Andreasen noted that at the time of the audit the FOF could claim major accomplishments in creating an awareness of the need for family planning and in product sales. From the time products were launched in 1979 through 1981 condom sales increased 260%. Foaming tablet sales increased more than 320% and IUD sales increased nearly 330%. The introduction of the Copper 7 IUD accounted for 35% of the growth of IUD sales in 1981. Couple years of protection (CYP) provided by all products increased from 45,533 in 1979 to 190,831 in 1981, an increase over 300%. The

  12. Nigerian CSM project ready to roll.

    Science.gov (United States)

    1985-01-01

    Nigeria's contraceptive social marketing (CSM) project is ready to be launched. Population Services Intenational (PSI) had completed the groundwork for the project, funded primarily by a $200,000 grant from the nonpofit D.K. Tyagi Fund. The Population Crisis Committee also provided support for the new project. At presstime, PSI was negotiating for continued project funding from the US Agency for International Development (USAID) and The Futures Group. PSI already has identified suitable products, researched brand names, arranged for distribution, appointed an advertising agency, designed packaging, written a marketing plan, and taken steps to create a local, nonprofit marketing organization to manage the project. PSI has named Tim Barton as the resident manager. He will take up his post once the issue of future funding is resolved. Contraceptives now available are distributed through the private sector and by the Planned Parenthood Federation of Nigeria, the Local International Planned Parenthood Federation affiliate. Nigeria's annual rate of population growth is about 3% and the country is urbanizing rapidly. A 1983 fertility report revealed that only 14% of Nigerian women had ever used any type of contraception; 6% of married women were using a contraceptive method at the time of the survey.

  13. A Sandbox Environment for the CSM Standard and SPICE

    Science.gov (United States)

    Hare, T. M.; Laura, J. R.

    2018-04-01

    We present ongoing work USGS is undertaking to provide a programming environment for the Camera Sensor Model (CSM) standard and associated SPICE information. This allows for instrument testing and experimentation outside a given production area.

  14. Des relations plus humaines ?

    OpenAIRE

    Ricciardi, Ferruccio

    2013-01-01

    À partir d’une approche sociohistorique, cet article s’intéresse aux effets de la croissance économique sur l’identité des cadres, en l’occurrence les groupements de cadres et patrons italiens qui, au lendemain de la Seconde Guerre mondiale, essaient de conjuguer les principes du catholicisme social dont ils se réclament dans l’arène publique avec les logiques issues du productivisme managérial américain qui s’impose en Europe occidentale. Le prisme des méthodes de « relations humaines » pour...

  15. Verification and Evaluation of Aquatic Contaminant Simulation Module (CSM)

    Science.gov (United States)

    2016-08-01

    underlying sediment layer. Likewise, it was written as a dynamic link library (DLL) and compiled as CSM.dll. The CSM is independent of the dimensionality...column CT Total concentration in water µg L-1 Cion Ionic concentration in water µg L-1 Cd Concentration of dissolved phase in water µg L-1 Cdoc...CT2 Total concentration in sediment µg L-1 Cion2 Ionic concentration in water µg L-1 Cd2 Concentration of dissolved phase in pore water µg L-1

  16. Geological and structural setting of the CSM/OCRD test site: CSM experimental mine, Idaho Springs, Colorado

    International Nuclear Information System (INIS)

    Hutchinson, R.M.

    1983-09-01

    This report is the second in a series describing research conducted by the Colorado School of Mines (CSM) for the Office of Crystalline Repository Development (OCRD) to determine the extent of blast damage in rock surrounding an underground opening. A special room, called the CSM/OCRD room, was excavated for the purpose of assessing blast damage in the rock around the room. Even though this mine is not proposed as a nuclear waste repository site, the instrumentation and methods of blast damage assessment developed in this project are applicable to proposed repository sites. In order to understand which instruments and techniques are most applicable and what types of fractures existed before blasting, a thorough description of the rock mass surrounding the room is necessary. This report describes the geologic history of the area surrounding the Colorado School of Mines' Experimental Mine. The purpose of the historical description is to explain the probable origin of faults, fractures, and joints that affect rock mass permeability around the excavation site. This report will also provide probable cause of original rock mass stress in existence prior to excavating the experimental room. Furthermore, it provides a basis for detailed mapping of the CSM/OCRD experimental room wall rock. 19 references, 19 figures

  17. Des relations plus humaines ?

    Directory of Open Access Journals (Sweden)

    Ferruccio Ricciardi

    2012-05-01

    Full Text Available À partir d’une approche sociohistorique, cet article s’intéresse aux effets de la croissance économique sur l’identité des cadres, en l’occurrence les groupements de cadres et patrons italiens qui, au lendemain de la Seconde Guerre mondiale, essaient de conjuguer les principes du catholicisme social dont ils se réclament dans l’arène publique avec les logiques issues du productivisme managérial américain qui s’impose en Europe occidentale. Le prisme des méthodes de « relations humaines » pour la gestion des salariés est ici utilisé pour rendre compte des modes de construction d’une identité professionnelle prise entre l’« esprit du religieux » et l’« esprit du capitalisme ». La déclinaison des « relations humaines » en fonction du projet de justice sociale préconisé par la doctrine sociale de l’Église en ressort amendée, car elles sont perçues moins comme un levier pour l’intégration des salariés que comme un instrument au service du contrôle politique de ceux-ci.Are the relations more human? Catholic executives and the employers facing the managerial productivism (Italy, ‘50s-‘60sThis article deals with the effects of economic growth on the identity of managers and the employers, especially the Italian ones who, after the World War II, try to combine their catholic principles with the issues of the managerial productivism spreading in the Western Europe. Adopting a socio-historical framework, the article analyses the implementation of the human relations techniques for the management of personnel in order to grasp a split professional identity between the ‘spirit of religious’ and the ‘spirit of capitalism’. The declination of the human relations theories according to the principles of social justice advocated by the social doctrine of the Church has been amended, because of the perception of the human relations as a means for political control of workers rather than an

  18. Analyse, Modélisation et Simulation du Mouvement Humain

    OpenAIRE

    Multon , Franck

    2006-01-01

    Comprendre le mouvement humain mobilise des chercheurs de nombreuses disciplines scientifiques : physiologie, biomécanique, neurosciences comportementales, anatomie fonctionnelle, les sciences du sport... Mes travaux s'inscrivent donc dans une démarche pluridisciplinaire d'analyse/synthèse du mouvement humain. Pour mener à bien cette démarche, une première tâche consiste à modéliser et à simuler le système moteur ainsi qu'un ensemble d'hypothèses. L'objectif est de disposer d'une représentati...

  19. Thermomechanical CSM analysis of a superheater tube in transient state

    Science.gov (United States)

    Taler, Dawid; Madejski, Paweł

    2011-12-01

    The paper presents a thermomechanical computational solid mechanics analysis (CSM) of a pipe "double omega", used in the steam superheaters in circulating fluidized bed (CFB) boilers. The complex cross-section shape of the "double omega" tubes requires more precise analysis in order to prevent from failure as a result of the excessive temperature and thermal stresses. The results have been obtained using the finite volume method for transient state of superheater. The calculation was carried out for the section of pipe made of low-alloy steel.

  20. Coordonnateur, (h/f) Ressources humaines | CRDI - Centre de ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Sous la direction de directrice des ressources humaines, le coordonnateur, ... est le principal responsable de la gestion des dossiers papier et électroniques de la ... ordre de priorité, tenir l'emploi du temps à jour, gérer un système de contrôle, ...

  1. Gestionnaire, Solutions d'affaires en ressources humaines | CRDI ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Gestion des ressources humaines du CRDI (stratégie et planification) ... mise en oeuvre des stratégies et des politiques ainsi qu'à l'amélioration continue dans .... les domaines des RH suivants : acquisition de talents (dotation et recrutement), ...

  2. Distribution des Glossines vecteurs de la Trypanosomose humaine ...

    African Journals Online (AJOL)

    SARAH

    28 févr. 2015 ... RESUME. Objectifs : Dans le but de connaitre la densité apparente et la composition spécifique des glossines dans un ancien foyer de la Trypanosome humaine africaine au Gabon, une enquête entomologique a été menée dans deux biotopes du Parc National de Moukalaba Doudou (Sud Gabon) : le ...

  3. Comparison of two matrix data structures for advanced CSM testbed applications

    Science.gov (United States)

    Regelbrugge, M. E.; Brogan, F. A.; Nour-Omid, B.; Rankin, C. C.; Wright, M. A.

    1989-01-01

    The first section describes data storage schemes presently used by the Computational Structural Mechanics (CSM) testbed sparse matrix facilities and similar skyline (profile) matrix facilities. The second section contains a discussion of certain features required for the implementation of particular advanced CSM algorithms, and how these features might be incorporated into the data storage schemes described previously. The third section presents recommendations, based on the discussions of the prior sections, for directing future CSM testbed development to provide necessary matrix facilities for advanced algorithm implementation and use. The objective is to lend insight into the matrix structures discussed and to help explain the process of evaluating alternative matrix data structures and utilities for subsequent use in the CSM testbed.

  4. Les sciences cognitives ne sont pas des sciences humaines

    Directory of Open Access Journals (Sweden)

    Albert Ogien

    2011-10-01

    Full Text Available Cet article analyse les limites du naturalisme social que Laurence Kaufman et Laurent Cordonier proposent d’adopter dans cette même revue, en critiquant leur plaidoyer pour l’intégration des savoirs des sciences cognitives et des sciences humaines et sociales. Cette critique repose sur la réfutation de trois idées soutenues par les auteurs : 1 la description scientifique des mécanismes cognitifs élémentaires fournit une explication causale des conduites sociales qui doit se substituer à celles des sciences humaines et sociales ; 2 le recours au naturalisme permet de falsifier les préconceptions que ces dernières continuent à entretenir ; 3 le programme de naturalisation de l’esprit n’implique aucune forme de réductionnisme. Cette triple critique permet de rejeter leur appel en faveur d’un modèle intégré de la conduite humaine, en avançant un constat : dans la mesure où on ne sait pas comment combler le hiatus qui sépare les descriptions détaillées du cerveau au travail de l’explication des conduites des individus et de la manière dont ils en assurent la coordination dans le temps même où ils agissent en commun, les sciences humaines et sociales ont peu de choses à aller glaner du côté des sciences cognitives pour améliorer la manière dont elles analysent l’action. C’est que le travail de celles-ci se situe soit au niveau infra-humain du fonctionnement moléculaire, soit au niveau supra-humain de l’évolution ; et que seules les sciences humaines et sociales placent leurs analyses à un niveau simplement humain, en faisant des individus tels qu’ils vivent ensemble la mesure de toutes les choses qui les concernent. Ce qu’elles ne peuvent faire sur un mode naturaliste.Cognitive sciences are not social sciencesThis article examines the limits of the social naturalism proposed by Laurence Kauffman and Laurent Cordonier in this journal by criticizing their plea concerning knowledge integration of

  5. SOMARC teams with private distribution firm to implement CSM program in Ghana.

    Science.gov (United States)

    1985-01-01

    SOMARC, together with a private manufacturer and distributor of pharmaceutical products (Danafco, Limited), is launching a new contraceptive social marketing (CSM) program designed to make low cost, modern contraceptive products widely available in Ghana's cities. Danafco will directly implement the CSM program. Both the US Agency for International Development (USAID) and the government of Ghana will provide support to the program. James R. Kirland, USAID Population Officer, will assume overall responsibility for coordination and monitoring of CSM program activities. By a special amendment to the Pharmacy and Drug Act of 1961, the Ghanaian government has enabled the CSM program to conduct a demonstration project. Under the project, chemical sellers and retailers who successfully complete a special training session will be entitled to dispense oral contraceptives (OCs) without prescription. With the successful completion of this project, it is hoped that the Ghanaian government will further amend the Pharmacy Act to make contraceptives available nationwide on a nonprescription basis. Initially, the Ghana CSM program will market 3 products: a standard dosage OC; a foaming vaginal tablet; and an uncolored condom. Market research is now underway to determine product names for the OCs and vaginal tablets. The condom will be marketed under the name Panther. The project plans to conduct a retail audit to define current prices in the Ghanaian contraceptive market. Danafco will subcontract with Lintas Ghana Limited to provide advertising, package design, and promotion for the Ghana CSM program. Overall campaign efforts will focus on generating a positive climate for the program among influentials in government, religion, education, and health as well as consumers. The advertising campaign will include radio, television, print, and outdoor media. SOMARC, in collaboration with the USAID/Accra mission, hopes to establish an appropriate climate prior to the advertising launch

  6. L'infection a virus de l'Immunodeficience Humaine (VIH), facteur ...

    African Journals Online (AJOL)

    L'infection a virus de l'Immunodeficience Humaine (VIH), facteur predictif de gravite et de mortalite des accidents vasculaires cerebraux au Centre National Hospitalier et Universitaire-Hubert Koutoukou Maga (CNHU-HKM) de Cotonou, Benin.

  7. TIC pour un accès équitable aux ressources humaines en sante en ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Ce projet vise à mieux comprendre comment les TIC peuvent faciliter la distribution équitable des ressources humaines en santé en renforçant et consolidant des activités ... Technologies de l'Information et de la Communication (TIC) pour un Accès équitable aux Ressources Humaines en santé qualifiées, motivées et bien ...

  8. Productivité du Capital Humain dans les Pays de l’UEMOA et de la CEMAC : Une Analyse Comparative

    OpenAIRE

    Élisé Wendlassida Miningou

    2012-01-01

    La présente étude pose le problème de la productivité du capital humain dans les pays de l’UEMOA et de la CEMAC. Dans ce papier, nous mesurons l’efficience avec laquelle le capital humain est mis à contribution dans la production. Pour ce faire, nous appliquons la méthode du Data Envelopment Analysis (DEA) pour mesurer et comparer la productivité du capital humain entre ces deux ensembles de pays. Nos résultats montrent que le capital humain dans la zone UEMOA a été moins productif ...

  9. Corps et esprit : l’identité humaine selon Spinoza

    Directory of Open Access Journals (Sweden)

    Lamine Hamlaoui

    2005-09-01

    Full Text Available Contrairement à Descartes, Spinoza refuse à l’esprit humain et par conséquent à l’homme le statut de substance : l’homme est défini comme l’union de deux modes, un corps et une âme. On ne peut donc plus comme chez Descartes distinguer une identité substantielle, conférée au corps par l’âme, et une identité modale, déterminée par le rapport du corps humain aux autres corps. Ces deux identités sont fondues dans une identité essentielle. L’objet de cet article est de mettre en évidence le statut problématique de cette identité dans l’Éthique. L’esprit humain y est en effet déduit et défini comme l’idée du corps humain, c’est-à-dire le concept que Dieu forme du corps humain. Mais tantôt Spinoza identifie cette idée du corps humain à l’essence de l’esprit humain, tantôt il établit une distinction entre les deux. De même, tantôt en vertu du parallélisme des attributs il identifie l’idée du corps humain à l’idée de l’esprit humain, tantôt il distingue les deux. D’où des tensions qui travaillent le système de l’intérieur.Contrary to Descartes, Spinoza refuses to human mind and therefore to man the status of substance : man is defined as the union of two modes, body and mind. We can’t distinguish, as in Descartes, a substantial identity, conferred to the body by the mind, and a modal identity, determined by the relation between human body and other bodies. Both identities form an essential identity. This paper explains the problematical character of this identity in Spinoza’s Ethic. Human mind is indeed deduced and defined as the idea of human body, namely the concept of human body formed by God. But sometimes Spinoza identifies the idea of human body with the essence of human body, sometimes he makes a distinction between both. In the same way, sometimes he identifies the idea of human body with the idea of human mind, in accordance with parallelism of attributes, sometimes he

  10. The effect of gamma radiation on the ageing of sulfur cured nr/csm and nbr/csm rubber blends reinforced by carbon black

    Directory of Open Access Journals (Sweden)

    Gordana Marković

    2009-10-01

    Full Text Available In this work the effect of the γ-radiation dose on ageing of carbon black reinforced elastomeric materials was studied. The compounds based on natural rubber/chlorosulfonated rubber blend (NR/CSM and butadiene acrylonitrile rubber/chlorosulfonated rubber blend (NBR/CSM (50:50, w/w with different loadings (0, 20, 40, 50, 60, 80 and 100 phr of the filler with the average particle size of 40 nm were cured by sulfur. The obtained elastomeric composites were subjected to radiation doses (100, 200, 300 and 400 kGy in the presence of oxygen. The changes of material mechanical properties were estimated after radiation accelerated ageing. By using Fourier transform infrared measurements (ATR-FTIR it was assessed that after exposure to doses of 100 kGy alcohols, ethers, lactones, anhydrides, esters and carboxylic acids are formed in materials. The formation of shorter polyene sequences and aromatic rings in aged samples are assumed on the basis of the obtained spectra.

  11. Les perspectives nutritionnelles offertes par les OGM en alimentation humaine

    Directory of Open Access Journals (Sweden)

    Pascal Gérard

    2004-03-01

    Full Text Available Une étude des brevets récents, des publications scientifiques ainsi que des documents présentant les projets des firmes de biotechnologie constituent la base de cet article qui présente les perspectives de développement en alimentation humaine des organismes génétiquement modifiés (OGM présentant un intérêt nutritionnel. Si l’on trouve dans les brevets et les publications scientifiques des applications qui concernent l’amélioration ou l’enrichissement de la composition en macro- et micronutriments, ces applications restent curieusement à l’état de projets, très loin de la mise sur le marché. Les critiques aussi bien que les louanges dont sont l’objet les rares cas dont on pourrait envisager une mise en œuvre à moyen terme, comme le « riz doré », sont aussi injustifiées et excessives les unes que les autres. Les violentes polémiques autour des OGM risquent de handicaper le développement d’une technique puissante, qui n’est certes pas indispensable pour apporter une solution à l’éradication de la faim dans le monde, mais qui peut apporter des améliorations à la nutrition des populations, aussi bien des populations des pays en développement que des pays développés.

  12. Les estimations du capital humain au Canada : approche fondee sur le revenu de la vie entiere

    OpenAIRE

    Gu, Wulong; Wong, Ambrose

    2010-01-01

    Dans le present document, nous produisons une estimation de l'investissement en capital humain fonde sur le marche et du stock de ce capital au Canada au cours de la periode s'etendant de 1970 a 2007 selon l'approche fondee sur le revenu de la vie entiere. Nous comparons cette estimation a celle de l'investissement en capital physique et naturel et du stock de ce capital. En suivant la methode elaboree par Jorgenson et Fraumeni, nous estimons le stock de capital humain sous forme du revenu de...

  13. Capital humain et croissance : Evidences sur les données de pays Africains

    OpenAIRE

    Dorothée Boccanfuso; Luc Savard; Bernice E. Savy

    2009-01-01

    La théorie économique a pendant longtemps admis une relation positive entre le capital humain et la croissance économique (Smith, 1776 ; Becker, 1964) qui sera remise en cause à la fin des années 90 dans plusieurs études (Caselli et al., 1996 ; Pritchett, 2001). Parmi les faiblesses identifiées par ces auteurs, la critique relative à l’utilisation du nombre moyen d’années d’étude comme proxy utilisé pour évaluer le stock de capital humain est souvent avancée. La non prise en considération des...

  14. Cost/CYP: a bottom line that helps keep CSM projects cost-efficient.

    Science.gov (United States)

    1985-01-01

    In contraceptive social marketing (CSM), the objective is social good, but project managers also need to run a tight ship, trimming costs, allocating scarce funds, and monitoring their program's progress. 1 way CSM managers remain cost-conscious is through the concept of couple-years-of-protection (CYP). Devised 2 decades ago as an administrative tool to compare the effects of different contraceptive methods, CYP's uses have multiplied to include assessing program output and cost effectiveness. Some of the factors affecting cost/CYP are a project's age, sales volume, management efficiency, and product prices and line. These factors are interconnected. The cost/CYP figures given here do not include outlays for commodities. While the Agency for International Development's commodity costs alter slightly with each new purchase contrast, the agency reports that a condom costs about 4 cents (US), an oral contraceptive (OC) cycle about 12 cents, and a spermicidal tablet about 7 cents. CSM projects have relatively high start-up costs. Within a project's first 2 years, expenses must cover such marketing activities as research, packaging, warehousing, and heavy promotion. As a project ages, sales should grow, producing revenues that gradually amortize these initial costs. The Nepal CSM project provides an example of how cost/CYP can improve as a program ages. In 1978, the year sales began, the project's cost/CYP was about $84. For some time the project struggled to get its products to its target market and gradually overcome several major hurdles. The acquisition of jeeps eased distribution and, by adding another condom brand, sales were increased still more, bringing the cost/CYP down to $8.30 in 1981. With further sales increases and resulting revenues, the cost/CYP dropped to just over $7 in 1983. When the sales volume becomes large enough, CSM projects can achieve economies of scale, which greatly improves cost-efficiency. Fixed costs shrink as a proportion of total

  15. Limitations of BCC_CSM's ability to predict summer precipitation over East Asia and the Northwestern Pacific

    Science.gov (United States)

    Gong, Zhiqiang; Dogar, Muhammad Mubashar Ahmad; Qiao, Shaobo; Hu, Po; Feng, Guolin

    2017-09-01

    This study examines the ability of the Beijing Climate Center Climate System Model (BCC_CSM) to predict the meridional pattern of summer precipitation over East Asia-Northwest Pacific (EA-NWP) and its East Asia-Pacific (EAP) teleconnection. The differences of summer precipitation modes of the empirical orthogonal function and the bias of atmospheric circulations over EA-NWP are analyzed to determine the reason for the precipitation prediction errors. Results indicate that the BCC_CSM could not reproduce the positive-negative-positive meridional tripole pattern from south to north that differs markedly from that observed over the last 20 years. This failure can be attributed to the bias of the BCC_CSM hindcasts of the summer EAP teleconnection and the low predictability of 500 hPa at the mid-high latitude lobe of the EAP. Meanwhile, the BCC_CSM hindcasts' deficiencies of atmospheric responses to SST anomalies over the Indonesia maritime continent (IMC) resulted in opposite and geographically shifted geopotential anomalies at 500 hPa as well as wind and vorticity anomalies at 850 hPa, rendering the BCC_CSM unable to correctly reproduce the EAP teleconnection pattern. Understanding these two problems will help further improve BCC_CSM's summer precipitation forecasting ability over EA-NWP.

  16. Limitations of BCC_CSM's ability to predict summer precipitation over East Asia and the Northwestern Pacific

    KAUST Repository

    Gong, Zhiqiang

    2017-04-05

    This study examines the ability of the Beijing Climate Center Climate System Model (BCC_CSM) to predict the meridional pattern of summer precipitation over East Asia-Northwest Pacific (EA-NWP) and its East Asia-Pacific (EAP) teleconnection. The differences of summer precipitation modes of the empirical orthogonal function and the bias of atmospheric circulations over EA-NWP are analyzed to determine the reason for the precipitation prediction errors. Results indicate that the BCC_CSM could not reproduce the positive-negative-positive meridional tripole pattern from south to north that differs markedly from that observed over the last 20 years. This failure can be attributed to the bias of the BCC_CSM hindcasts of the summer EAP teleconnection and the low predictability of 500 hPa at the mid-high latitude lobe of the EAP. Meanwhile, the BCC_CSM hindcasts\\' deficiencies of atmospheric responses to SST anomalies over the Indonesia maritime continent (IMC) resulted in opposite and geographically shifted geopotential anomalies at 500 hPa as well as wind and vorticity anomalies at 850 hPa, rendering the BCC_CSM unable to correctly reproduce the EAP teleconnection pattern. Understanding these two problems will help further improve BCC_CSM\\'s summer precipitation forecasting ability over EA-NWP.

  17. Analyse du capital humain : diagnostic des dépenses d'éducation au Sénégal

    OpenAIRE

    Youssouph Ba

    2011-01-01

    Le but de notre travail consistait dans un premier temps à revisiter les soubassements théoriques du capital humain et savoir si l'augmentation du capital humain a un effet ponctuel sur la croissance économique (aussi bien dans la sphère des pays industrialisés que dans celle des pays en développement). Dans un second temps, il consistait à mesurer la politique du Sénégal en terme de capital humain : mesurer les efforts de financement de l'éducation d'une part et d'autre part, voir si ces eff...

  18. Hard rock excavation at the CSM/OCRD test site using Swedish blast design techniques

    International Nuclear Information System (INIS)

    Holmberg, R.

    1983-09-01

    This report is the third in a series describing research conducted by the Colorado School of Mines for the Office of Crystalline Repository Development (OCRD) to determine the extent of blast damage in rock surrounding an underground opening. A special room, called the CSM/OCRD room, was excavated at the CSM experimental mine for the purpose of assessing blast damage in the rock around the room. Even though this mine is not proposed as a nuclear waste repository site, the instrumentation and methods of blast damage assessment developed in this project are applicable to proposed repository sites. This report describes the application of Swedish blasting technology for the excavation of the test room. The design of the blasting patterns including the selection of explosives, hole sizes and location, explosive loading densities, and delay intervals is based upon the theories of Langefors and Kihlstrom in combination with methods used at the Swedish Detonic Research Foundation for minimizing unwanted rock damage. The practical application of the design procedures to seven rounds and the achieved results is discussed

  19. Assessment and correction of BCC_CSM's performance in capturing leading modes of summer precipitation over North Asia

    KAUST Repository

    Gong, Zhiqiang

    2017-11-07

    This article examines the ability of Beijing Climate Center Climate System Model (BCC_CSM) in demonstrating the prediction accuracy and the leading modes of the summer precipitation over North Asia (NA). A dynamic-statistic combined approach for improving the prediction accuracy and the prediction of the leading modes of the summer precipitation over NA is proposed. Our results show that the BCC_CSM can capture part of the spatial anomaly features of the first two leading modes of NA summer precipitation. Moreover, BCC_CSM regains relationships such that the first and second mode of the empirical orthogonal function (EOF1 and EOF2) of NA summer precipitation, respectively, corresponds to the development of the El Niño and La Niña conditions in the tropical East Pacific. Nevertheless, BCC_CSM exhibits limited prediction skill over most part of NA and presents a deficiency in reproducing the EOF1\\'s and EOF2\\'s spatial pattern over central NA and EOF2\\'s interannual variability. This can be attributed as the possible reasons why the model is unable to capture the correct relationships among the basic climate elements over the central NA, lacks in its ability to reproduce a consistent zonal atmospheric pattern over NA, and has bias in predicting the relevant Sea Surface Temperature (SST) modes over the tropical Pacific and Indian Ocean regions. Based on the proposed dynamic-statistic combined correction approach, compared with the leading modes of BCC_CSM\\'s original prediction, anomaly correlation coefficients of corrected EOF1/EOF2 with the tropical Indian Ocean SST are improved from 0.18/0.36 to 0.51/0.62. Hence, the proposed correction approach suggests that the BCC_CSM\\'s prediction skill for the summer precipitation prediction over NA and its ability to capture the dominant modes could be certainly improved by choosing proper historical analogue information.

  20. CAPITAL HUMAIN, EDUCATION ET CROISSANCE ÉCONOMIQUE Une approche économétrique

    OpenAIRE

    REZINE, Okacha

    2015-01-01

    Cette recherche examine le lien entre capital humain/éducation et croissance. On s’interroge, en particulier, sur les fondements théoriques de cette relation et sur la manière de la tester. Cette relation est testée sur un panel cylindré comprenant 31 pays africains et, sur la période 1965-2010. La première approche est consacrée à l’analyse des modèles de croissance endogène avec modèle de SOLOW (1956) sans et avec la prise de proxy du capital humain/éducation. Dans la deuxième approche o...

  1. ÉTUDE DE CAS — Cuba : Le logement et le capital humain à Cuba ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    10 janv. 2011 ... ÉTUDE DE CAS — Cuba : Le logement et le capital humain à Cuba ... Centre de recherches pour le développement international (CRDI) du Canada révèle ... Les ressources déjà limitées sont devenues encore plus rares. ... de l'Institut national pour l'hygiène, l'épidémiologie et la microbiologie (INHEM), ...

  2. Impact de la gestion des ressources humaines sur la survie des ...

    African Journals Online (AJOL)

    A partir d'un indice composite, l'indice de gestion des ressources humaines ... (iv) la gestion de la performance, et (v) la formation et le développement du ... Même si à cause du type d'étude quasi-expérimentale réalisée (avant-après), nous ne ... GRH d'une organisation doit aussi devenir un objectif chiffré du management.

  3. In-situ load-deformation characterization of the CSM/OCRD jointed test block

    International Nuclear Information System (INIS)

    Richardson, A.M.; Hustrulid, W.; Brown, S.; Ubbes, W.

    1985-01-01

    An extensive ambient-temperature test series has recently been completed on a block of Precambrian Gneiss at the Colorado School of Mines (CSM) Experimental Mine in Idaho Springs, Colorado. Block tests came into existence out of a desire to test a relatively large volume of rock and thereby minimize the scaling problems encountered when laboratory test results are used to obtain modeling parameters for full-size structures. A typical block test involves isolation of a large, approximately two-meter cube of rock by cutting slots on four sides and inserting flatjacks for loading. Much interest has recently centered around block tests as a promising method for in-situ characterization of rock-masses for licensing future commercial nuclear-waste repositories in crystalline rock. To date only a few block tests have been conducted

  4. Assessment and correction of BCC_CSM's performance in capturing leading modes of summer precipitation over North Asia

    KAUST Repository

    Gong, Zhiqiang; Dogar, Muhammad Mubashar; Qiao, Shaobo; Hu, Po; Feng, Guolin

    2017-01-01

    in the tropical East Pacific. Nevertheless, BCC_CSM exhibits limited prediction skill over most part of NA and presents a deficiency in reproducing the EOF1's and EOF2's spatial pattern over central NA and EOF2's interannual variability. This can be attributed

  5. Limitations of BCC_CSM's ability to predict summer precipitation over East Asia and the Northwestern Pacific

    KAUST Repository

    Gong, Zhiqiang; Dogar, Muhammad Mubashar; Qiao, Shaobo; Hu, Po; Feng, Guolin

    2017-01-01

    This study examines the ability of the Beijing Climate Center Climate System Model (BCC_CSM) to predict the meridional pattern of summer precipitation over East Asia-Northwest Pacific (EA-NWP) and its East Asia-Pacific (EAP) teleconnection

  6. Association of bacteriochlorophyll a with the CsmA protein in chlorosomes of the photosynthetic green filamentous bacterium Chloroflexus aurantiacus

    DEFF Research Database (Denmark)

    Sakuragi, Y; Frigaard, N-U; Shimada, K

    1999-01-01

    with molecular masses of 11 and 18 kDa (CsmN and CmsM), whereas the spectral properties of BChl a and BChl c were not changed. By the new hexanol-detergent (HD) treatment, most BChl c and all of the detected proteins except CsmA were removed from the chlorosomes without changing the BChl a spectral properties....... Subsequent proteinase K treatment of these HD-treated chlorosomes caused digestion of CsmA and a simultaneous decrease of the BChl a absorption band. Based on these results, we suggest that CsmA is associated with BChl a in the chlorosomes. This suggestion was supported by the measured stoichiometric ratio...... of BChl a to CsmA in isolated chlorosomes, which was estimated to be between 1.2 and 2.7 by amino acid analysis of the SDS-PAGE-resolved protein bands....

  7. Les humains sont-ils des entités matérielles ?

    Directory of Open Access Journals (Sweden)

    Tauveron Matthias

    2012-07-01

    Full Text Available Nous étudions la sémantique des noms d’humains dans le lexique français. Dans la littérature, ces noms ont un positionnement indéterminé ou ambigu par rapport au critère concret/abstrait. Ce fait est regrettable car ce critère est considéré comme fondamental. Nous montrons leur positionnement particulier vis-à-vis de ce critère au travers de l’étude de métaphores attestées en corpus dans divers textes écrits. Nous suivons l’optique de Lakoff et Johnson en considérant que la métaphore est un révélateur des catégories de pensée. Dans cet esprit, la question est de savoir si les humains sont des entités matérielles ou non. L’étude est menée sur deux paramètres définitoires des entités matérielles : la masse et la spatialité. Nous apportons des caractérisations lexicales de ces deux propriétés. La masse est envisagée généralement, autour des noms, adjectifs et verbes relevés dans les dictionnaires. Nous proposons une synthèse des divers paramètres dénotant la spatialité dans la littérature, sous la forme de six points indépendants (forme, intérieur/extérieur, sous-parties, changement de posture, localisation, déplacement. L’étude de la spatialité est menée systématiquement dans ces directions grâce à des tests issus des caractérisations lexicales de ces aspects. Les tests font voir que, si les humains sont dotés d’une certaine dimension matérielle (qu’ils partagent ainsi avec les objets concrets, ils ont également au moins trois autres dimensions qui font qu’ils ne se réduisent pas à des objets matériels. Nous montrons ainsi que l’humain est, dans le lexique français, doté d’une multiplicité ontologique : en plus d’une dimension matérielle, il dispose d’une dimension psychologique, une dimension praxéologique et une dimension sociale. De plus, l’étude des métaphores montre que la dimension matérielle est souvent réduite voire anéantie par rapport aux

  8. The subunits of the S-phase checkpoint complex Mrc1/Tof1/Csm3: dynamics and interdependence.

    Science.gov (United States)

    Uzunova, Sonya Dimitrova; Zarkov, Alexander Stefanov; Ivanova, Anna Marianova; Stoynov, Stoyno Stefanov; Nedelcheva-Veleva, Marina Nedelcheva

    2014-01-01

    The S-phase checkpoint aims to prevent cells from generation of extensive single-stranded DNA that predisposes to genome instability. The S. cerevisiae complex Tof1/Csm3/Mrc1 acts to restrain the replicative MCM helicase when DNA synthesis is prohibited. Keeping the replication machinery intact allows restart of the replication fork when the block is relieved. Although the subunits of the Tof1/Csm3/Mrc1 complex are well studied, the impact of every single subunit on the triple complex formation and function needs to be established. This work studies the cellular localization and the chromatin binding of GFP-tagged subunits when the complex is intact and when a subunit is missing. We demonstrate that the complex is formed in cell nucleus, not the cytoplasm, as Tof1, Csm3 and Mrc1 enter the nucleus independently from one another. Via in situ chromatin binding assay we show that a Tof1-Csm3 dimer formation and chromatin binding is required to ensure the attachment of Mrc1 to chromatin. Our study indicates that the translocation into the nucleus is not the process to regulate the timing of chromatin association of Mrc1. We also studied the nuclear behavior of Mrc1 subunit in the process of adaptation to the presence hydroxyurea. Our results indicate that after prolonged HU incubation, cells bypass the S-phase checkpoint and proceed throughout the cell cycle. This process is accompanied by Mrc1 chromatin detachment and Rad53 dephosphorylation. In S. cerevisiae the subunits of the S-phase checkpoint complex Mrc1/Tof1/Csm3 independently enter the cell nucleus, where a Tof1-Csm3 dimer is formed to ensure the chromatin binding of Mrc1 and favor DNA replication and S-phase checkpoint fork arrest. In the process of adaptation to the presence of hydroxyurea Mrc1 is detached from chromatin and Rad53 checkpoint activity is diminished in order to allow S-phase checkpoint escape and completion of the cell cycle.

  9. Pour une ingénierie des Environnements Informatiques pour l'Apprentissage Humain

    OpenAIRE

    Tchounikine , Pierre

    2002-01-01

    Nous proposons dans cet article une réflexion sur la notion d'ingénierie des EIAH (Environnements Informatiques pour l'Apprentissage Humain). Nous posons tout d'abord une définition de l'ingénierie des EIAH : travaux visant à définir des éléments de méthodes et de techniques reproductibles et/ou réutilisables facilitant la mise en place (conception – réalisation – expérimentation – évaluation - diffusion) d'environnements de formation ou d'apprentissage (dans leur articulation avec les dispos...

  10. Hybridation de la ressource humaine dans les associations : déterminants et effets.

    OpenAIRE

    Gontier , Patricia; Dansac , Christophe; Vachée , Cécile

    2014-01-01

    International audience; À l’image de la multiplicité des rôles que peuvent tenir les associations et autres organisations non orientées vers le profit dans nos sociétés, les ressources humaines impliquées dans les associations ou autres organisations non orientées vers le profit sont multiples. Dans leurs motivations, leurs compétences, et leurs parcours, les individus qui contribuent à ces organisations sont très différents. Parmi les bénévoles, on peut ainsi dissocier ceux qui administrent ...

  11. Robots humains, avez-donc une réalité ?

    OpenAIRE

    Amblard , Maxime; Boumaza , Amine

    2015-01-01

    International audience; Plusieurs laboratoires dans le monde travaillent à la création de robots humanoïdes . La technologie ayant considérablement évolué, il apparaît réaliste d’imaginer un quotidien accompagné de tels systèmes, à l’image du robot Nao, dont on discute encore comment lui faire partager des émotions pour simuler un comportement humain. Mais finalement, les robots sont déjà partout et depuis longtemps, dans les usines, les jouets électroniques, nos ordinateurs, nos tablettes, l...

  12. ÉTUDE DE CAS — Cuba : Le logement et le capital humain à Cuba ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    10 janv. 2011 ... Colin Campbell. Des projets communautaires améliorent la santé du cœur de La Havane. La vie en plein centre-ville peut mettre à rude épreuve la résistance des gens. Lorsque les quartiers périclitent, le dépérissement de la santé humaine suit de près. Un projet mené à Cuba avec l'appui du Centre de ...

  13. Le facteur humain et la sûreté de fonctionnement dans le ...

    African Journals Online (AJOL)

    Notre contribution porte sur le rôle fondamental du facteur humain dans le management intégré des risques d'une part et du rôle déterminant qu'il peut avoir à jouer pour que la sûreté de fonctionnement réponde à sa propriété d'autre part. Un rôle illustré à travers une analyse de risque dans un complexe de Gaz Naturel ...

  14. Revision of the dosimetric parameters of the CSM11 LDR Cs-137 source.

    Science.gov (United States)

    Otal, Antonio; Martínez-Fernández, Juan Manuel; Granero, Domingo

    2011-03-01

    The clinical use of brachytherapy sources requires the existence of dosimetric data with enough of quality for the proper application of treatments in clinical practice. It has been found that the published data for the low dose rate CSM11 Cs-137 source lacks of smoothness in some regions because the data are too noisy. The purpose of this study was to calculate the dosimetric data for this source in order to provide quality dosimetric improvement of the existing dosimetric data of Ballester et al . [1]. In order to obtain the dose rate distributions Monte Carlo simulations were done using the GEANT4 code. A spherical phantom 40 cm in radius with the Cs-137 source located at the centre of the phantom was used. The results from Monte Carlo simulations were applied to derive AAPM Task Group 43 dosimetric parameters: anisotropy function, radial dose function, air kerma strength and dose rate constant. The dose rate constant obtained was 1.094 ± 0.002 cGy h -1 U -1 . The new calculated data agrees within experimental uncertainties with the existing data of Ballester et al . but without the statistical noise of that study. The obtained data presently fulfills all the requirements of the TG-43U1 update and thus it can be used in clinical practice.

  15. Csm4, in collaboration with Ndj1, mediates telomere-led chromosome dynamics and recombination during yeast meiosis.

    Directory of Open Access Journals (Sweden)

    Jennifer J Wanat

    2008-09-01

    Full Text Available Chromosome movements are a general feature of mid-prophase of meiosis. In budding yeast, meiotic chromosomes exhibit dynamic movements, led by nuclear envelope (NE-associated telomeres, throughout the zygotene and pachytene stages. Zygotene motion underlies the global tendency for colocalization of NE-associated chromosome ends in a "bouquet." In this study, we identify Csm4 as a new molecular participant in these processes and show that, unlike the two previously identified components, Ndj1 and Mps3, Csm4 is not required for meiosis-specific telomere/NE association. Instead, it acts to couple telomere/NE ensembles to a force generation mechanism. Mutants lacking Csm4 and/or Ndj1 display the following closely related phenotypes: (i elevated crossover (CO frequencies and decreased CO interference without abrogation of normal pathways; (ii delayed progression of recombination, and recombination-coupled chromosome morphogenesis, with resulting delays in the MI division; and (iii nondisjunction of homologs at the MI division for some reason other than absence of (the obligatory CO(s. The recombination effects are discussed in the context of a model where the underlying defect is chromosome movement, the absence of which results in persistence of inappropriate chromosome relationships that, in turn, results in the observed mutant phenotypes.

  16. Le facteur humain. Réinventer notre rapport à la technologie de Vicente

    Directory of Open Access Journals (Sweden)

    Jacques Leplat

    2005-11-01

    Full Text Available Kim Vicente est connu du milieu ergonomique pour son très bon ouvrage « Cognitive work analysis » qui manifeste à la fois son expertise et son talent pédagogique. Ingénieur de formation, il a enseigné ensuite à l’université en tant que « professeur en ingénierie des facteurs humains ». Professeur invité au MIT et conseiller à la NASA, il est l’auteur de nombreuses publications de recherche qu’on rangerait dans l’ergonomie cognitive. Le présent ouvrage, qu’il a publié en anglais en 2003, est d...

  17. Critical analyses on the localized corrosion behaviour in materials of energetic interests: Inconcel 600 CSM and Deltacogne

    International Nuclear Information System (INIS)

    Borello, A.; Frangini, S.; Masci, D.

    1989-06-01

    Concerning the two commonly observed phenomena of localized corrosion of Inconel 600 in high temperature caustic environments normally encountered in steam generators of PWR nuclear reactors, the aim of this work is to investigate the intergranular and the stress corrosion cracking behaviour of two heats of Alloy 600, having different origin. In fact one heat was produced by Centro Sviluppo Materiali (CSM) in laboratory scale; the other one was manufactured by Deltacogne following conventional industrial practices. The evaluation of intergranular corrosion susceptibility has been performed by means of the modified Huey test and the Electrochemical Potentiokinetic Reactivation (EPR). The stress corrosion cracking susceptibility was determined by the slow strain rate technique. The results of the present study show that the CSM heat has a better behaviour than the Deltacogne one as for the stress corrosion cracking susceptibility. On the contrary, concerning the intergranular corrosion resistance, both used tests point out that the Deltacogne material has a lower susceptibility to this type of localized corrosion. The sensitization areas in the TTS diagram, depend, even for the same heat, on the type of the test used for the evaluation. (author)

  18. L'Empowerment au coeur des bouleversements induits par les TIC dans la gestion des ressources humaines

    OpenAIRE

    Blavier, André

    2012-01-01

    Observer l’influence des TIC (Technologies de l’Information et de la Communication” sur les ressources humaines à la lumière du seul débat “pour ou contre les réseaux sociaux dans l’entreprise ou l’organisation ?” est une approche bien trop restrictive. Les défis relatifs à l’évolution des ressources humaines s’inscrivent dans une perspective plus large, celle d’un environnement numérique global. Comme l’a souligné le rapport “Digital Economy Rankings 2010” d’IBM en collaboration avec l’Econ...

  19. Contribution à la théorie du capital humain : Les bénéfices à court ...

    African Journals Online (AJOL)

    Les enfants scolarisés communiquent-ils à leurs parents paysans des connaissances reçues de l'école ? C'est la problématique de notre étude qui se fixe pour objectif de revisiter la théorie classique du capital humain, plus singulièrement dans le registre du délai des bénéfices que l'on en tire (court ou long terme).

  20. FORMER A L’EXERCICE D’UNE MEDECINE BIOTECHNOLOGIQUE ET HUMAINE

    Directory of Open Access Journals (Sweden)

    Jacques BRINGER

    2017-05-01

    Full Text Available Le bond en avant de la médecine au cours des dernières décennies s’est appuyé sur la recherche, l’innovation dans les nouvelles biotechnologies permettant le développement de soins plus efficaces, moins invasifs, mieux ciblés pour nombre de maladies. Dans le même temps, une meilleure gestion des risques et une organisation plus centrée sur le patient impliquent une étroite coopération entre les professionnels de santé activés selon les besoins du patient. Les étudiants en médecine doivent être entrainés à acquérir la pratique des nouvelles technologies et à se préparer à l’action en équipe avant d’intervenir dans le soin. Un tel entrainement par simulation vise à développer des mises en situation de « vraie vie » incluant l’obtention de compétences individuelles ou collectives et l’aptitude des cliniciens à une décision partagée et aux relations humaines telles que la capacité d’écoute, d’annonce et d’accompagnement s’appuyant sur le questionnement éthique et le souci de la personne.

  1. Leadership et confiance développer le capital humain pour des organisations performantes

    CERN Document Server

    Duluc, Alain

    2003-01-01

    Aujourd'hui, l'encadrement des hommes consiste à tirer le meilleur parti de soi-même et des autres pour contribuer au développement de la performance. Ce type de leadership repose sur des valeurs telle qu'honnêteté, confiance, exemplarité, etc. Cet ouvrage propose une définition opérationnelle de ces valeurs et une façon de les mettre en ouvre. Il repose sur les méthodes et outils de développement personnel et organisationnel, élaborés par Will Schutz, un thérapeute américain. Sommaire : La complexité, nouveau passage des entreprises; Développer la confiance et la dimension humaine pour faire face à la complexité; Quelle forme de leadership pour demain?; Développer la confiance dans l'entreprise; La connaissance de soi et des autres, premier pas vers la confiance.

  2. Thermo-mechanical Characterisation of In-plane Properties for CSM E-glass Epoxy Polymer Composite Materials

    DEFF Research Database (Denmark)

    Jakobsen, Johnny; Jensen, Martin; Andreasen, Jens Henrik

    2013-01-01

    The in-plane Young’s modulus of a CSM E-glass/epoxy material is characterised through the use of dynamic mechanical analysis (DMA). The measured data is used to generate material models which describe the property behaviour as a function of conversion and temperature. Gelation of the epoxy resin...... plays a major role in the modulus development and is measured directly on the glass/epoxy material. The Young’s modulus is described through a bi-functional model including the liquid/solid transition of the material. The evolution of Young’s modulus is modelled by decoupling modulus increments caused...... by time and temperature, and is graphically illustrated through a Modulus-Temperature- Transformation (MTT) diagram. Based on the established material models presented in this paper and models in Part-1, it is feasible to assess residual stresses and shape distortions of composite parts made from...

  3. Thermo-Mechanical Characterisation of In-Plane Properties for CSM E-glass Epoxy Polymer Composite Materials – Part 1

    DEFF Research Database (Denmark)

    Jakobsen, Johnny; Jensen, Martin; Andreasen, Jens H.

    2013-01-01

    The in-plane thermo-mechanical properties and residual stresses of a CSM E-glass/Epoxy material are characterised through the use of DSC and TMA. The measured data is used to generate material models which describe the mechanical behaviour as a function of conversion and temperature. The in-plane...

  4. Parole et identité humaine à l’âge classique

    Directory of Open Access Journals (Sweden)

    Pascale Gillot

    2010-03-01

    Full Text Available En prenant appui sur des textes de Descartes et de philosophes post-cartésiens comme Géraud de Cordemoy, ou encore des théoriciens de Port-Royal, tels Lancelot, Arnauld et Nicole, nous nous intéressons au statut double et paradoxal que revêt la parole dans la philosophie classique, au moment où se construit la question de l’union psychophysique et où sont proposées diverses « réponses » à cette question, dans la perspective d’une conceptualisation nouvelle d’une identité humaine rendue problématique. Le paradoxe tient au fait que l’activité de langage est d’abord manifestation de la pensée, indice publiquement observable ou témoignage extérieur de l’existence d’un esprit à l’origine des actes linguistiques, conformément à la théorie cartésienne à ce sujet ; mais la parole dénote aussi, dans la philosophie même de Descartes, une faculté spécifiquement humaine, propre au « vrai homme », en tant qu’il est indissolublement esprit et corps. Nous tentons de montrer que ce qui est en jeu dans les études brèves et éparses que Descartes consacre au langage, puis dans les développements ultérieurs de la Grammaire générale et raisonnée et de la Logique de Port-Royal, à travers la théorie du signe linguistique et de la signification, c’est la compréhension de la relation, nécessairement postulée et pourtant constamment renvoyée à l’ordre d’un lien contre-nature, et par là arbitraire, fruit d’une institution, entre la parole comme phénomène physique et la parole comme activité symbolique par excellence ; si bien que le prodige du phénomène humain du langage, comme expression publique des pensées, donne la mesure de l’énigme que constitue l’unité en l’homme du corps et de l’esprit.The aim of this paper is to lay emphasis on the connection between the mind-body problem and the theory of language which is developed in early-modern philosophy by Descartes and post

  5. JournalBase. Comparer les bases de données scientifiques internationales en sciences humaines et sociales (SHS

    Directory of Open Access Journals (Sweden)

    Denise Pumain

    2010-01-01

    Full Text Available Cet article dresse un tableau comparatif des contenus des bases de données et des listes de référence qui recensent les revues en sciences humaines et sociales (SHS. Il s’appuie sur JournalBase publié le 25 juin 2009 dans Cybergeo. Cette étude porte sur les bases AHCI et SSCI du Web of Science (publié par Thomson Reuters, de Scopus (publié par Elsevier, du European Reference Index for Humanities (ERIH (publié par la Fondation européenne pour la Science et de l’AERES (Agence pour l’évaluation de la recherche en France. La recherche a été réalisée en 2008 avec le soutien financier du TGE Adonis du CNRS. Avec quelque 20 000 entrées correspondant à environ 10 000 journaux différents, c’est une vue quasi exhaustive de la richesse des publications en sciences humaines et sociales qui est apportée par ce tableau. La nomenclature adoptée pour classer les revues par discipline est celle en 27 postes de la Fondation Européenne pour la Science. Les affectations multiples révèlent la multidisciplinarité des revues, assez fréquente en SHS, mais parfois aussi les incohérences des bases de données qui n’ont pas été rectifiées.L’article présente l’historique du projet, la méthodologie mise en place par les auteurs, les difficultés rencontrées dans la comparaison des données. Les premiers résultats mettent en évidence une couverture plus large de la liste ERIH pour les sciences humaines et une surreprésentation des revues anglophones dans les bases de données commerciales pour l’ensemble des disciplines. L’objectif de ce travail est d’alerter sur les contenus de ces bases de données, au moment où les outils bibliométriques soulèvent maints débats quant à leur application dans le champ des sciences humaines et sociales.

  6. L’intégration du capital humain dans un outil de pilotage de la performance : le cas du tableau de bord stratégique

    OpenAIRE

    Borchani, Manel; Cheffi, Walid

    2005-01-01

    Cette communication examine comment un outil de contrôle de gestion, le tableau de bord stratégique (TdB), permet-il d’intégrer le capital humain dans le pilotage de la performance globale de l’entreprise ? La théorie des ressources (resource based view theory) considère que les Ressources Humaines (RH) sont des ressources internes précieuses pour l’entreprise. Cette théorie établit un lien entre elles, les compétences distinctives et l’avantage concurrentiel durable de l’entreprise. Un tel a...

  7. La prolongation de la vie humaine selon Francis Bacon. Ou : quel Tithon voulons-nous être ?

    Directory of Open Access Journals (Sweden)

    Dominique Weber

    2011-07-01

    Full Text Available Afin de comprendre avec exactitude la manière dont Francis Bacon envisage la question de la prolongation de la vie humaine, il faut impérativement examiner l’assise théologique de la réflexion du philosophe à ce sujet. Il convient aussi de restituer l’intégration de cette réflexion dans les objectifs plus amples de la philosophie naturelle nouvelle. Enfin, il est nécessaire de comprendre les dimensions proprement morales de la question. Car la prolongation de la vie humaine n’est pas seulement, au sein de la philosophie naturelle nouvelle, un cas parmi d’autres des recherches qu’il faut désormais effectuer : en réalité, c’est elle qui lui donne et qui lui fixe son sens ; avec elle se joue l’effectivité de l’identité espérée entre science et puissance. Mais il faut encore préciser qu’il ne s’agit aucunement pour l’homme de vieillir pour vieillir : il s’agit pour lui de pouvoir vieillir bien. Les leçons que Bacon tire de la fable de Tithon sont ici véritablement décisives.

  8. Entre guajiros et espagnols, les humains: récits Añun

    Directory of Open Access Journals (Sweden)

    1990-01-01

    Full Text Available L’article présente une série de textes tirés de la tradition orale añun, groupe arawak en voie d’extinction (côte nord-ouest du Lac de Maracaïbo, Venezuela. Sans prendre de position théorique, l’auteur se propose de montrer comment la tradition orale, à travers des récits allégoriques évoquant les dangers de l’intégration, reflète les relations que les Añun entretiennent avec les autres groupes humains de la région et qui dans les contes, se traduisent par des métaphores animales. ENTRE GUAJIROS Y ESPAÑOLES, LOS HUMANOS - RELATOS AÑÚN. Este artículo presenta una serie de relatos de la tradición oral añún, grupo arawak en vías de extinción, localizado en el litoral noroeste del Lago de Maracaibo, Venezuela. Sin tomar ninguna posición teórica, la autora se propone mostrar a través de unos relatos alegóricos que evocan los peligros de la integración, cómo la tradición oral refleja las relaciones experimentadas por los Añún con los demás grupos humanos de la región, traducidas en los cuentos por metáforas animales. BETWEEN GUAJIROS AND SPANIARDS, THE HUMANS - AÑUN TALES. This article presents a selection of tales belonging to the oral tradition of the Añun people, an Arawak group threatened with extinction (North West coast of Maracaibo Lake, Venezuela. Leaving aside all theoretical discussion, the author attempts to show how oral tradition, through allegorical tales illustrating the dangers of integration, reflects the relationships held by the Añun with the other human groups living in the area and which, in the narrative, find expression in animal metaphors.

  9. Selective Protein Extraction from Chlorobium tepidum Chlorosomes Using Detergents. Evidence That CsmA Forms Multimers and Binds Bacteriochlorophyll a

    DEFF Research Database (Denmark)

    Bryant, Donald A; Vassilieva, Elena V; Frigaard, Niels-Ulrik

    2002-01-01

    and location of this BChl a are not yet clearly understood. Chlorosomes were treated with sodium dodecyl sulfate (SDS), Lubrol PX, or Triton X-100, separately or in combination with 1-hexanol, and the extracted components were separated from the residual chlorosomes by ultrafiltration on centrifugal filters....... When chlorosomes were treated with low concentrations of SDS, all proteins except CsmA were extracted. However, this treatment did not significantly alter the size and shape of the chlorosomes, did not extract the BChl a, and caused only minor changes in the absorption spectrum of the chlorosomes....... Cross-linking studies with SDS-treated chlorosomes revealed the presence of multimers of the major chlorosome protein, CsmA, up to homooctamers. Extraction of chlorosomes with SDS and 1-hexanol solubilized all ten chlorosome envelope proteins as well as BChl a. Although the size and shape...

  10. Multi-pentad prediction of precipitation variability over Southeast Asia during boreal summer using BCC_CSM1.2

    Science.gov (United States)

    Li, Chengcheng; Ren, Hong-Li; Zhou, Fang; Li, Shuanglin; Fu, Joshua-Xiouhua; Li, Guoping

    2018-06-01

    Precipitation is highly variable in space and discontinuous in time, which makes it challenging for models to predict on subseasonal scales (10-30 days). We analyze multi-pentad predictions from the Beijing Climate Center Climate System Model version 1.2 (BCC_CSM1.2), which are based on hindcasts from 1997 to 2014. The analysis focus on the skill of the model to predict precipitation variability over Southeast Asia from May to September, as well as its connections with intraseasonal oscillation (ISO). The effective precipitation prediction length is about two pentads (10 days), during which the skill measured by anomaly correlation is greater than 0.1. In order to further evaluate the performance of the precipitation prediction, the diagnosis results of the skills of two related circulation fields show that the prediction skills for the circulation fields exceed that of precipitation. Moreover, the prediction skills tend to be higher when the amplitude of ISO is large, especially for a boreal summer intraseasonal oscillation. The skills associated with phases 2 and 5 are higher, but that of phase 3 is relatively lower. Even so, different initial phases reflect the same spatial characteristics, which shows higher skill of precipitation prediction in the northwest Pacific Ocean. Finally, filter analysis is used on the prediction skills of total and subseasonal anomalies. The results of the two anomaly sets are comparable during the first two lead pentads, but thereafter the skill of the total anomalies is significantly higher than that of the subseasonal anomalies. This paper should help advance research in subseasonal precipitation prediction.

  11. [Social marketers' lack of success in using CSM discipline to harness commercial resources and increase contraceptive prevalence].

    Science.gov (United States)

    Davies, J

    1984-01-01

    Social marketers have certainly shown that the CSM discipline can quickly and cost-effectively harness commercial resources to increase contraceptive prevalence. But why hasn't the social marketing idea caught on in more countries? According to Social Marketing Forum, only a tiny number of countries have active programs after more than a decade of effort. The most likely reason for this lack of success is doubt and fear on the part of both developing countries' officials and donor agencies about allowing marketing enthusiasts--with our very noticeable advertising methods--to join the family planning fight. And what has our answer been? Usually, a head-on retort such as, "But look at all the condoms we've sold]" And that gets us nowhere, because the successful peddling of 1 not-so-impressive method doesn't begin to balance the fears of a possible backlash that brash condom promotions could bring down on official heads. The lesson we should be learning is that social marketers possess to narrow an outlook and promote a small range of products that don't enthuse decisionmakers. Hence, we are often perceived as condom salesmen--and not much more. What should we be doing? We should be selling the idea of using private sector experience to assist national development. That means social development, particularly improved health, family planning and women's education. These 3 activities have proven effective in reducing fertility and would add up to a marketing opportunity--a longterm challenge that should enthuse dicisionmakers, private sector entrepreneurs and donor agencies alike. Further, our model--the commercial sector--is renowned for branching out and secceeding in a broad range of endeavors. As an example, Procter and Gamble uses separate divisions to market different products. Initiatives already exist in many countries to harness the private sector as a development tool. Social marketers should be leading the initiative--and benefitting from it, too. full text

  12. L'évolution des valeurs de soin humain : une analyse dialectique de la proposition d'humanisation de Watson à la lumière d'une perspective nietzschéenne

    OpenAIRE

    Krol, Pawel

    2014-01-01

    La pratique du soin infirmier d’aujourd’hui hérite d’une longue et complexe évolution de valeurs. Outre les valeurs traditionnellement humaines de soigner, la pratique infirmière d’aujourd’hui intègre aussi des valeurs qui façonnent notre monde moderne. Ainsi, nous retraçons d’abord l’évolution de quelques-unes des valeurs traditionnelles rattachées au soin humain conservées dans les pratiques infirmières. Puis, nous montrons que certaines valeurs traditionnelles de soin humain sont progressi...

  13. Simulation de mouvement humain sur postes de travail pour le diagnostic et l'aide à la conception

    OpenAIRE

    Hue, Valentin

    2008-01-01

    Les travaux présentés dans ce mémoire concernent la génération automatique de postures et mouvements humains sur poste de travail industriel. L'objectif poursuivi est d'animer de façon réaliste un mannequin numérique afin de simuler un opérateur dans l'exécution de sa tâche. Cette animation doit permettre d'aider à l'analyse des facteurs biomécaniques pouvant engendrer des Troubles Musculo-Squelettiques. Dans un premier temps, des choix de modélisation sont proposés en fonction de ce contexte...

  14. Capital humain et croissance : la littérature empirique à un tournant ?

    OpenAIRE

    Gurgand, Marc

    2005-01-01

    Depuis le début des années 1990, la littérature empirique sur le rôle du capital humain dans la croissance économique fourmille de résultats contradictoires. Cet article récapitule les éléments du débat en opposant les contributions selon deux axes, celui de la spécification économique et celui des méthodes économétriques. Le premier axe oppose les estimations qui s’appuient sur des modèles de convergence des économies, à proximité de leur équilibre stationnaire et celles, de nature plus comp...

  15. Ouverture commerciale : condition de la contribution effective du capital humain à la croissance économique des pays en développement

    OpenAIRE

    Yves Abessolo

    2005-01-01

    Dans la littérature actuelle une controverse persiste quant à la validation sur données de panel de l'hypothèse selon laquelle le capital humain contribue à la croissance. Nous confirmons ce résultat à l'aide d'un échantillon comprenant 23 pays d'Afrique subsaharienne entre 1980 et 1997. Cependant, l'estimation sur ces mêmes données de panel de modèles à termes interactifs puis à coefficients variables suggère que la contribution du capital humain à la croissance dépend du taux d'ouverture co...

  16. L'écosanté, pour améliorer la santé humaine et préserver l ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    27 oct. 2010 ... Puis, en 1992, il a lancé le programme Santé, société et environnement, qui réunissait des spécialistes de divers domaines dans le but d'étudier les répercussions des facteurs environnementaux sur la santé. La création du programme Écosystèmes et santé humaine (ÉCOSANTÉ) en 1996 a permis de ...

  17. EFFET DES VITAMINES B12, B9 ET B6 ET LEURS INTERACTIONS SUR LA FRAGILITE OSMOTIQUE DES ERYTHROCYTES HUMAINS

    Directory of Open Access Journals (Sweden)

    B HOUCHER

    2001-06-01

    Full Text Available L’effet des vitamines B12, B9 et B6 sur la fragilité osmotique des érythrocytes humains a été exploré in vitro. De fortes concentrations de vitamines B12 et B6 ont protégé les érythrocytes de l’hémolyse hypotonique, avec une protection maxima atteinte respectivement à 10 et 500 µg/ml. A concentrations plus faibles, cependant, ces vitamines ont favorisé grandement l’hémolyse hypotonique. Par contre, la vitamine B9 a montré uniquement un effet hémolytique de 4 à 200 µg/ml. Cet effet peut être expliqué par la nature acide de la molécule. L’effet nul sur la fragilité osmotique de deux vitamines antagonistes, peut probablement être expliqué par l’antagonisme partiel ou par la présence de ces deux vitamines simultanément: ces dernières se lient en quantités appréciables à la cellule intacte de même qu’à l’hémolysat et il y’ a compétition mutuelle entre ces vitamines et leur transport.

  18. Hard rock excavation at the CSM/OCRD test site using crater theory and current United States controlled smooth wall blasting practices, June 1982

    International Nuclear Information System (INIS)

    Sperry, P.E.; Chitombo, G.P.; Hustrulid, W.A.

    1984-08-01

    This report is the fourth in a series describing experiments conducted by the Colorado School of Mines for the Office of Crystalline Repository Development (OCRD) to determine the extent of blast damage in rock surrounding an underground opening. The report describes the application of tunnel design procedures based upon crater theory and current United States controlled smooth wall blasting practices for the excavation of the CSM/OCRD test room in the Colorado School of Mines, Experimental Mine (Edgar Mine) in Idaho Springs, Colorado. Ten blast rounds were used to excavate the test room. The first seven rounds were designed with Swedish Techniques, and described in the third report in this series, and the design of rounds eight through ten used crater theory. Crater theory is described in this document along with its application to the CSM/OCRD Room excavation. Calculation for spacing, burden, number and type of holes, explosives placement, and overall powder factor are discussed. A series of single charge cratering test shots, designed to evaluate some of the input data for the blast designs, are discussed. The input data include: Strain Energy Factor E, a dimensionless factor which varies according to the explosive and rock type; Critical Depth, N, the charge depth at which the explosive begins to fracture rock at the free face; Optimum Depth Ratio Δ 0 , which is a ratio between Optimum Charge Depth, d 0 , and Critical Charge Depth, d/sub c/; and charge Weight, W. A non-linear least squared regression method to best fit the general bell-shape curve of the crater results is discussed. Both scaled weight and scaled volume criteria are reported in the analysis of results. 10 references, 17 figures, 16 tables

  19. Trois modèles « éducatifs » : droit, potentialité et capital humain

    Directory of Open Access Journals (Sweden)

    Ingrid Robeyns

    2011-05-01

    Full Text Available Dans cet article, j’analyse trois logiques normatives qui peuvent fonder les politiques éducatives en portant une attention particulière aux questions liées aux spécificités des sexes. Ces trois modèles éducatifs sont la théorie du capital humain, le discours du droit et l’approche des potentialités. D’abord, je décris cinq rôles que l’éducation peut jouer. Ensuite, j’analyse les trois modèles pouvant fonder les politiques éducatives. La théorie du capital humain pose un certain nombre de problèmes parce qu’elle s’avère économiciste, fragmentée et essentiellement instrumentaliste. Le discours du droit et l’approche des potentialités sont en principe des modèles multidimensionnels et inclusifs et peuvent par le fait même tenir compte des rôles intrinsèques et non économicistes de l’éducation. Toutefois, selon la manière dont quelqu’un satisfait aux exigences spécifiques des cadres théoriques du droit et des potentialités, ceux-ci peuvent également présenter des difficultés. Je termine cet article en soutenant que la visée intrinsèque des politiques éducatives devrait être d’augmenter les potentialités des individus et que nous devrions employer les discours du droit de façon stratégique, c’est-à-dire lorsqu’il est probable qu’ils amènent les gens à réaliser leurs potentialités.In this paper, I discuss three normative approaches that can establish educational policies with special attention to gender issues. These three models of education are human capital theory, the discourse of law and the capabilities theory. First, I describe five roles that education can play. Then I analyze the three foundational models of educational policies. The human capital theory raises a number of problems because it is economistic, fragmented and largely instrumental. The discourse of law and the capabilites theory are usually multidimensional and inclusive; they can thereby take into account

  20. Big Brother is watching but helping you : analyse et interprétation de mouvements humains (expressions, gestes, postures) : Big Brother is watching but helping you : human motion analysis and interpretation

    OpenAIRE

    Caplier , Alice

    2005-01-01

    Mes activités de recherche portent sur l'analyse et l'interprétation des mouvements humains à partir de données visuelles avec comme application principale l'amélioration du processus de communication entre l'homme et la machine. L'idée sous-jacente est de tendre vers une communication homme machine non pas par l'intermédiaire des traditionnels écran/clavier/souris mais vers un processus plus « humain » de communication. Ceci suppose que la machine est capable de reconnaître et d'interpréter ...

  1. Mise à jour sur le nouveau vaccin 9-valent pour la prévention du virus du papillome humain

    Science.gov (United States)

    Yang, David Yi; Bracken, Keyna

    2016-01-01

    Résumé Objectif Informer les médecins de famille quant à l’efficacité, à l’innocuité, aux effets sur la santé publique et à la rentabilité du vaccin 9-valent contre le virus du papillome humain (VPH). Qualité des données Des articles pertinents publiés dans PubMed jusqu’en mai 2015 ont été examinés et analysés. La plupart des données citées sont de niveau I (essais randomisés et contrôlés et méta-analyses) ou de niveau II (études transversales, cas-témoins et épidémiologiques). Des rapports et recommandations du gouvernement sont aussi cités en référence. Message principal Le vaccin 9-valent contre le VPH, qui offre une protection contre les types 6, 11, 16, 18, 31, 33, 45, 52 et 58 du VPH, est sûr et efficace et réduira encore plus l’incidence des infections à VPH, de même que les cas de cancer lié au VPH. Il peut également protéger indirectement les personnes non immunisées par l’entremise du phénomène d’immunité collective. Un programme d’immunisation efficace peut prévenir la plupart des cancers du col de l’utérus. Les analyses montrent que la rentabilité du vaccin 9-valent chez les femmes est comparable à celle du vaccin quadrivalent original contre le VPH (qui protège contre les types 6, 11, 16 et 18 du VPH) en usage à l’heure actuelle. Toutefois, il faut investiguer plus en profondeur l’utilité d’immuniser les garçons avec le vaccin 9-valent contre le VPH. Conclusion en plus d’être sûr, le vaccin 9-valent protège mieux contre le VPH que le vaccin quadrivalent. Une analyse coûtefficacité en favorise l’emploi, du moins chez les adolescentes. Ainsi, les médecins devraient recommander le vaccin 9-valent à leurs patients plutôt que le vaccin quadrivalent contre le VPH.

  2. Vegetation cover and long-term conservation of radioactive waste packages: the case study of the CSM waste disposal facility (Manche District, France).

    Science.gov (United States)

    Petit-Berghem, Yves; Lemperiere, Guy

    2012-03-01

    The CSM is the first French waste disposal facility for radioactive waste. Waste material is buried several meters deep and protected by a multi-layer cover, and equipped with a drainage system. On the surface, the plant cover is a grassland vegetation type. A scientific assessment has been carried out by the Géophen laboratory, University of Caen, in order to better characterize the plant cover (ecological groups and associated soils) and to observe its medium and long term evolution. Field assessments made on 10 plots were complemented by laboratory analyses carried out over a period of 1 year. The results indicate scenarios and alternative solutions which could arise, in order to passively ensure the long-term safety of the waste disposal system. Several proposals for a blanket solution are currently being studied and discussed, under the auspices of international research institutions in order to determine the most appropriate materials for the storage conditions. One proposal is an increased thickness of these materials associated with a geotechnical barrier since it is well adapted to the forest plants which are likely to colonize the site. The current experiments that are carried out will allow to select the best option and could provide feedback for other waste disposal facility sites already being operated in France (CSFMA waste disposal facility, Aube district) or in other countries.

  3. Applying CSM-CERES-Maize to define a sowing window for irrigated maize crop - The Riacho´s Farm case study

    Directory of Open Access Journals (Sweden)

    Denise Freitas Silva

    2011-08-01

    Full Text Available Irrigation use constitutes an alternative to improve maize production in Central Minas Gerais State, Brazil. However, even under adequate water supply conditions, other environmental factors may influence maize crop growth and development and may, ultimately, affect grain yield. This study aimed to establish a sowing window for irrigated maize crop, based on simulation results obtained with the decision support model CSM-CERES-Maize. Simulations were made for crop management conditions of Riacho´s Farm, located in Matozinhos, Minas Gerais State, Brazil. It was employed the model´s seasonal tool, along with a data set containing 46 years of weather data records, to simulate maize yield for weekly sowing scenarios, starting on August 1st and ending on July 24th of each year. One defined an irrigated maize sowing window, taking into account the yield break risk that a farmer would be willing to take. The model proved to be an interesting tool to assist in decision making, regarding crop and irrigation management, for an irrigated maize production system. Assuming a 10% yield break in the expected average maximum maize yield, it was defined as sowing window, the period from January 23rd to March 6th, with February 20th as the best sowing date. Other sowing windows may be established according to the risk that the farmer would be willing to take.

  4. Nuclear wastes management: the lessons from the C.S.M. disposal site (Centre de Stockage de la Manche. Memory-less Centre, Future-less Centre?

    International Nuclear Information System (INIS)

    2006-05-01

    With its 527 217 m 3 of low and medium activity wastes put in storage between 1969 and 1994, the C.S.M.( center of storage of Manche) is and remains to this day a necessary element to understand the problems posed by the eternal storage of nuclear materials and the limits of the notion of reversibility. There are therefore teachings to be drawn. We cannot repeat past mistakes in particular with high activity wastes which we wish to bury deep underground. This report is based on the analysis of the existing bibliography, of the internal A.N.D.R.A. documents which we released to the public, of the lessons drawn from our participation in the official concerting and work groups, and finally of the data obtained after inquiries were done in the region in the framework of R.I.V.I.E;R.E. (citizens network of radioecological surveillance, information and evaluation). In spite of all efforts produced, many questions remain unanswered regarding this site so it is sometimes difficult to be more precise. (N.C.)

  5. Introduction : le rôle des sciences humaines dans la compréhension des rapports entre TIC et développement durable

    Directory of Open Access Journals (Sweden)

    Charlotte Ullmann

    2015-04-01

    Full Text Available Un appel à l’interdisciplinarité des sciences humaines Une vérité qui dérange… Qui en 2007, n’a pas encore vu ce film-documentaire réalisé par Al Gore qui lui a valu d’être prix Nobel de la Paix ? Qui n’a pas été étonné de voir que les publicités des constructeurs automobiles parlent de plus en plus de voiture propre (engagement du Lion bleu, tandis que Gaz de France nous vend des « coins de ciel bleu »… Tout d’un coup, les films catastrophes tels que L’armée des douze singes, Le jour d’aprè...

  6. La gestion des ressources humaines peut-elle être un facteur de fidélisation de la clientèle du centre E. Leclerc Casteldis ?

    OpenAIRE

    Laurie Ple

    2010-01-01

    Le secteur de la grande distribution est un domaine passionnant par son histoire, son évolution et sa place au cœur de nombreuses mutations de notre société. L'explorer à travers la gestion des ressources humaines est tout de suite paru attirant. Étant donné que la grande distribution évolue dans un contexte de plus en plus compétitif, la fidélisation de la clientèle est devenue un de ses grands enjeux. La grande distribution a développé des outils de fidélisation, mais ils sont largement rep...

  7. "A epopeia da decadência": um estudo sobre o Essai sur l'inégalité des races humaines (1853-1855, de Arthur de Gobineau

    Directory of Open Access Journals (Sweden)

    Helga da Cunha Gahyva

    2011-12-01

    Full Text Available O presente artigo discute a concepção racial de Arthur de Gobineau a partir de sua mais famosa obra, o Essai sur l'inégalité des races humaines. Se comumente este tratado é associado à discussão racialista que toma corpo nas últimas décadas do século XIX, pretendo relacioná-lo a uma polêmica característica da virada do século XVII para o XVIII, a Querela das duas raças. Neste sentido, o objetivo do artigo é revelar, em primeiro lugar, como a reflexão de Gobineau é tributária de um conceito de linhagem tornado paulatinamente anacrônico no mundo pós-revolucionário. Em segundo, demonstrar a hipótese segundo a qual o Essai, menos do que um estudo sobre raças pretensamente "biológicas", representa fundamentalmente uma recusa à nova ordem igualitária que se impõe na era moderna.The present article discusses the racial concepts of Arthur de Gobineau based on his most famous work, Essai sur l'inegalité des races humaines. Instead of associating these with the racialist debate of the last decades of the XIX the century, I relate them to a polemical text characteristic of the late XVII and early XVIII century: The Quarrel of the Two Races. In this sense, my main objective is to show that, in the first place, the Gobineau's work owes significant debts to the concept of the "bloodline", an idea which gradually became anachronistic after the French Revolution. In addition, I argue that, rather than being a study of supposedly "biological" races, Gobineau's "Essay" should be regarded as a refusal of the new egalitarian order of modern times.

  8. First regional CSM program planned.

    Science.gov (United States)

    1982-09-01

    6 countries in the English-speaking Caribbean (Antigua, Barbados, Dominica, St. Kitts/Nevis, St. Lucia, and St. Vincent) are scheduled to form the 1st regional contraceptive social marketing program. The program will be under the auspices of the Barbados Family Planning Association. By combining resources, contraceptive social marketing should be able to effectively augment family planning activities in smaller countries where individual programs wuld be too costly. The regional program will also determine whether program elements from 1 country in a region are relevant in other countries. The Caribbean region as a whole has experienced a general decline in both crude birth rates and fertility rates during the past 15 years; however, adolescent fertility rates remain high and an average of 46% of the populations of Caribbean countries are under 15 years of age. Although heavy emigration has traditionally curbed population increases, new restrictive immigration laws are expected. Further increases in the working age population will contribute to already high unemployment rates and hinder economic development. The 6 countries selected for the social marketing program are receptive to innovative family planning approaches and have the basic marketing infrastructure required. Community-based distribution programs already in operation in these countries distribute condoms, oral contraceptives, and barrier methods. The success of these programs has plateaued, and there is a need for delivery systems capable of reaching broader segments of the population. The social marketing program will be phased in to ensure local acceptance among national leaders and consumers. The regional program hopes to borrow elements from Jamaica's contraceptive social marketing program to avoid the costs involved in starting a program from scratch. A major innovation will be the use of mass media advertising for contraceptives.

  9. CSM a success in Bangladesh.

    Science.gov (United States)

    1983-01-01

    The Bangladesh Social Marketing Project (SMP), providing contraceptives at an annual rate of 931,000 couple years of protection (CYP) as of June 1983, is a success. This figure has grown markedly since the start of the program in late 1975, when the SMP provided 80,000 CYPs, or 8% of nonclinical protection provided. The SMP has contributed to the steadily increasing national nonclinical contraceptive distribution. Currently, SMP distribution accounts for as much as the government and nongovernment programs combined. When clinical methods (including sterilizations) are added to national distribution, the SMP share represents about 28% of total contraceptive use. The SMP does not provide clinical methods, but the entire increase in nonclinical protection provided by the national program since 1975 has been the result of SMP product sales. The SMP utilizes the available mass media for promotion, including print, radio, television, as well as outdoor media and point of purchase materials. Mobile Film Units (MFUs) are an innovative promotional method employed by the SMP. Approximately 80 night time outdoor showings are organized each month in rural areas by SMP promoters. Typically, several short films, usually a popular story with a family planning theme, are run. Between each film the SMP products are of advertised. Products are often sold during and after the films. Retail outlets for SMP products include general stores, pharmacies, and other small shops. When products were introduced in 1975 retail outlets totaled 7500. By August 1983 the number of country wide retailers carrying SMP products had grown to nearly 100,000. In 1982 a marketing strategy emphasizing the role of doctors and rural medical practitioners (RMPs) was introduced. There are between 70,00-100,000 RMPs in Bangladesh. They are well known and respected "doctors" in their villages and add an extensive family planning outreach to the SMP system. The most important advantage of using the RMPs is their personal contact with OC users. Since October 1981 the SMP has detailed approximately 30,000 RMPs; 15,000 have attended conferences and 6600 have purchased OCs. Consumers targeted by the SMP have annual incomes ranging from US$200-$400. A well defined organizational system has evolved that delineates the roles of government, the contractor, and the project personnel regarding specific policy, enterprise, management, and operational functions. The project staff of nearly 300 includes managers for the sales, development, marketing, and finance and administration departments.

  10. Nuclear wastes management: the lessons from the C.S.M. disposal site (Centre de Stockage de la Manche). Memory-less Centre, Future-less Centre?; Gestion des dechets radioactifs: les lecons du Centre de Stockage de la Manche (C.S.M.). Centre Sans Memoire, Centre Sans Avenir?

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    2006-05-15

    With its 527 217 m{sup 3} of low and medium activity wastes put in storage between 1969 and 1994, the C.S.M.( center of storage of Manche) is and remains to this day a necessary element to understand the problems posed by the eternal storage of nuclear materials and the limits of the notion of reversibility. There are therefore teachings to be drawn. We cannot repeat past mistakes in particular with high activity wastes which we wish to bury deep underground. This report is based on the analysis of the existing bibliography, of the internal A.N.D.R.A. documents which we released to the public, of the lessons drawn from our participation in the official concerting and work groups, and finally of the data obtained after inquiries were done in the region in the framework of R.I.V.I.E;R.E. (citizens network of radioecological surveillance, information and evaluation). In spite of all efforts produced, many questions remain unanswered regarding this site so it is sometimes difficult to be more precise. (N.C.)

  11. Application of csm- ceres-maize model for seasonal and multi-decadal predictions of maize yield in under subtropical condition of Chitwan, Nepal

    Directory of Open Access Journals (Sweden)

    Lal Prasad Amgain

    2015-12-01

    Full Text Available The average maize yield of 2.5 t/ha in sub-tropical terai and inner terai of Nepal has been very less than its potential yield of about 5.0 t/ha, for which changing climatic scenarios have been reported the critical factors. Cropping system Model (CSM-Crop Estimation through Resource and Environment Synthesis (CERES-Maize, embedded under Decision Support System for Agro-technology Transfer (DSSAT ver. 4.2 was evaluated from a datasets of field experimentation by growing four diverse maize genotypes viz. full season OPV (Rampur Composite, Quality Protein Maize (Posilo Makai-1, Hybrid (Gaurav and Pop corn (Pool-12 under three different planting dates (September 1, October 1 and November 1 in 2009-10 at Rampur Campus, Chitwan. The experiment was laid out in two factor factorial randomized complete block design (RCBD with three replications in slightly acidic (pH 6.7 sandy loam soil having low soil available N( 0.49% and K (148 kg/ha and medium P (16.3 kg/ha status. The ancillary and yield data obtaining from field experiment was analyzed from the M-Stat C software and recorded that Gaurav hybrid produced significantly higher yield under September 1 planting (5.86 t/ha followed by Posilo Makai 1 (5.55 t/ha, Rampur Composite (5.1t/ha and the least with Pool-12 (3.45 t/ha. Further, the heat use efficiency of diverse maize genotypes were also calculated by using the mean temperature based accumulative heat unit system and found the stable yields only with Rampur Composite for all planting dates and the rest genotypes were suitable only to the early winter plantings. Model calibration was done by using September 1 planting date for all 4 maize genotypes while validation was accomplished by using the remaining treatments for predicting growth and yield of different maize genotypes. The year 2006- 07 was found 13, 18, 23 and 7% higher in producing the maize yield than the standard year 2009-10 for Rampur Composite, Posilo Makai-1, Gaurav and Pool-12

  12. « Points de suture ». Panser l’interdépendance humaine dans quatre récits français contemporains

    Directory of Open Access Journals (Sweden)

    Chloé Brendlé

    2018-04-01

    Full Text Available Comment rendre visibles les liens qui unissent les êtres humains d’un monde globalisé et médiatisé ? L’article aborde dans le domaine littéraire cette question posée par les théories du care. Il dégage des poétiques de l’interdépendance à partir de quatre récits d’auteurs français contemporains (Annie Ernaux, Laurent Mauvignier, Emmanuel Carrère, Maylis de Kerangal. Partant de l’analyse de la métaphore de l’« onde de choc », il met au jour une esthétique et une narratologie de la mise en relation, ainsi qu’un désir de communauté. How does one render visible the connections between human beings in a globalized and media-staged world? This article addresses such a line of questioning, which is central to theories of care, within the context of the literary field. It fleshes out a poetics of interdependence based on four narratives by contemporary French authors (Annie Ernaux, Laurent Mauvignier, Emmanuel Carrère, Maylis de Kerangal. With an analysis of the “shock-wave metaphor” as its starting point, it identifies an esthetics and a narratology of connection, as well as a yearning for community.

  13. La Trypanosomose Humaine Africaine dans l’espace ivoiro-burkinabé : optimisation des stratégies de surveillance épidémiologique

    Directory of Open Access Journals (Sweden)

    Kambiré R.

    2012-11-01

    Full Text Available L’objectif de cet article est de décrire les récentes données de surveillance médicale de la Trypanosomose Humaine Africaine (THA au Burkina Faso et en Côte d’Ivoire afin (i de dresser un bilan de la situation actuelle de la maladie dans ces deux pays qui entretiennent depuis plus d’un siècle des liens migratoires, économiques et épidémiologiques intimes et (ii de définir les stratégies à mettre en place dans l’objectif d’une élimination durable. Les résultats de la surveillance active et passive ont montré que les trypanosomés dépistés au Burkina-Faso ces dernières années sont tous des cas importés provenant de Côte d’Ivoire. Cependant, la réintroduction du parasite est effective et le risque d’une reprise de la transmission existe. En Côte d’Ivoire, plusieurs foyers “historiques” toujours endémiques font craindre des phénomènes de réémergence et de propagation. Dans l’objectif d’une élimination durable de la THA dans ces deux pays, les acteurs de la lutte doivent adapter leur système de surveillance en fonction des différents contextes épidémiologiques. Les prévalences actuelles ne justifient plus, excepté des cas particuliers, l’usage systématique et très onéreux du dépistage actif par prospections médicales exhaustives. Elles tendent plutôt à privilégier des systèmes intégrés aux systèmes de santé nationaux et utiliser des méthodes permettant de cibler les zones prioritaires d’intervention à partir notamment d’un échange d’informations épidémiologiques entre les deux pays. Pour accompagner le processus d’élimination durable, les acteurs de la recherche doivent étudier le rôle respectif des réservoirs humain et animal dans le maintien de la transmission, participer au suivi sur le long terme des cas traités et des suspects sérologiques, et évaluer en termes de coût/efficacité les stratégies mises en place par les Programmes Nationaux afin de les

  14. JournalBase - Une étude comparative internationale des bases de données des revues scientifiques en sciences humaines et sociales (SHS

    Directory of Open Access Journals (Sweden)

    Christine Kosmopoulos

    2009-06-01

    Full Text Available Pour la première fois en 2009 ont été ici présentés dans un tableau comparatif les contenus des bases de données qui recensent les revues en sciences humaines et sociales (SHS, du Web of Science (publié par Thomson Reuters et de Scopus (publié par Elsevier ainsi que des listes de référence European Reference Index for Humanities (ERIH (publiée par la Fondation européenne pour la Science et de l'AERES. Avec quelque 20 000 entrées, c’est une vue quasi exhaustive de la richesse des publications en sciences humaines et sociales qui est enfin apportée par ce tableau. La nomenclature adoptée pour classer les revues par discipline est celle en 27 postes de la Fondation Européenne pour la Science. Les affectations multiples révèlent la multidisciplinarité des revues, assez fréquente en SHS, mais parfois aussi les incohérences des bases de données qui n’ont pas été rectifiées.La recherche a été réalisée en 2008 avec le soutien financier du TGE Adonis du CNRS.Une mise à jour prochaine sera proposée en ligne.L’objectif final de ce projet, qui concerne l'ensemble de la communauté internationale en SHS, était de mettre en ligne, en version bilingue anglais/français, la base de données de JournalBase en mode interactif sur une plate-forme collaborative ainsi que le rapport final de l’étude, afin que les décideurs, les scientifiques, les experts de l'information scientifique disposent d’informations à jour et qu’ils puissent contribuer à faire avancer la réflexion sur ces questions, par l’échange d’expériences et de bonnes pratiques d’utilisation.Un article présentant l'historique du projet, la méthodologie mise en place et les difficultés rencontrées dans la comparaison des données a été publié le 8 janvier 2010. Il analyse également les premiers résultats.Désormais vous pouvez accéder à l'information intégrale de JournalBase sur le site : http://journalbase.cnrs.fr

  15. Landslide causes: Human impacts on a Himalayan landslide swarm Les impacts humains sur une séquence de glissements de terrain dans l’Himalaya

    Directory of Open Access Journals (Sweden)

    Martin Haigh

    2012-12-01

    healing as they have in the undisturbed forest along the Kilbury Road. However, past surveys confirm that landslide numbers on the Almora Lower Mall have remained steady since 1985. Since, the impacts of this rainfall event were manifest only as increased landslide outfall, not increased numbers, the chief influences of outfall volume remain hillslope angle, height of the initial roadcut, undermining by channel incision and the fact that these hillsides exist close to criticality, their limits of stability.Les géographes se voient régulièrement sollicités pour diagnostiquer les causes des catastrophes naturelles et fournir des pistes aux décideurs politiques. Notre étude porte sur un des cataclysmes - glissements de terrain et inondations - ayant touché le district himalayen d’Almora (Uttarakhand, durant la fin de la mousson de 2010. Le phénomène a affecté des milliers de kilomètres de routes et ses ravages se sont chiffrés à plus de 125 000 000 $. Les causes ont été investiguées sur une portion de route de 7,4 km qui avait fait l’objet d’une étude antérieure. Les glissements de terrain ont été examinés un par un, avec identification d’une série d’indicateurs environnementaux rendant compte de causes possibles. Les résultats ont montré que le nombre de glissements enregistrés sur la route n’était pas inhabituel. L’étude se porta dès lors sur l’exploration des facteurs susceptibles d’avoir accru leur volume. L’opinion locale y voyait principalement des impacts humains, en particulier le développement urbain récent, ou encore certaines faiblesses géologiques. Cependant, les résultats prouvent que les impacts humains tels que la construction, la déforestation et l’effondrement des terrasses agricoles étaient associés à des glissements de moindre ampleur, tandis que les facteurs géologiques ne montraient pas de corrélations significatives avec le volume des glissements. Les facteurs de génie routier comme la pr

  16. Simulation du mouvement humain en vue d'applications ergonomiques - Vers une approche de simulation basée sur données et assistée par connaissances

    OpenAIRE

    WANG, X

    2003-01-01

    Le mannequin numérique, comme outil de conception, a pour objectif de permettre aux ingénieurs de prendre en compte des facteurs humains dans la conception de produits ou de postes de travail. Il doit être capable de représenter le futur opérateur ou l'utilisateur du produit, de simuler son activité, d'évaluer ses interactions avec son environnement et d'en déduire des informations sur les astreintes subies. Si les avancées technologiques, notamment dans le domaine informatique, permettent un...

  17. La cohérence dans la mobilisation du capital humain:une illustration de la théorie de l’architecture organisationnelle dans les banques de réseau

    OpenAIRE

    Christine Marsal

    2006-01-01

    (VF)S’il est courant d’opposer capital financier et capital humain les organisations mettent en place des mécanismes de coordination afin de faire converger les intérêts des deux catégories de partenaires que sont les salariés et les actionnaires. La théorie de l’architecture organisationnelle permet de fournir un cadre d’analyse pertinent pour rendre compte de ces mécanismes. Dans ce cadre nous pouvons constater la pluralité des mécanismes d’incitation. Parmi eux, les incitations financières...

  18. Kalevipoeg tänapäeval - ühe tulevase Euroopa kultuuri document humain : psühholoogilis-antropoloogilisi aspekte / Peter Petersen ; tõlkinud Krista Räni

    Index Scriptorium Estoniae

    Petersen, Peter, 1933-

    2003-01-01

    Lisa 1. William Butler Yeats. Ta igatseb endale taevakangaid / tõlkinud Märt Väljataga, lk. 2587 ; Lisa 2. Novalis. Neue Fragmente. Nr. 393 (Novalis. Werke und Briefe. Stuttgart ; Hamburg : Deutscher Bücherbund, 1962), lk. 2587-2588 ; Lisa 3. Tabel väärtuste kohta, mida Kalevipoja-eeposes esile tuuakse, lk. 2588. Bibl. lk. 2589-2590. Tõlgitud käsikirjast: "Kalevipoeg heute - document humain einer künftigen Kultur Europas: psychologisch-anthropologische Aspekte"

  19. Adaptation dynamique de mouvements humains

    OpenAIRE

    Hoyet , Ludovic

    2010-01-01

    For years, understanding and simulating human motion has become an important issue for various fields, such as computer animation, robotics, biomechanics, etc. In computer animation, the goal is to use this knowledge to create virtual humans as realistic as possible. With the amount of work already done, it is now possible for virtual humans to handle various tasks as realistically as a real human would do. One important key point in the realism of virtual motions is to verify dynamic laws. E...

  20. ETUDE DE L'EFFET DE QUELQUES FACTEURS SUR LA CYTOTOXICITE INDUITE PAR L'AMPHOTERICINE B ASSOCIEE AUX LIPOPROTEINES DU SERUM SANGUIN CHEZ DES CELLULES DE GLOBULES ROUGES HUMAINES

    OpenAIRE

    BOUCHERIT, ATMANI Zahia

    2014-01-01

    toxiques. Dans le cadre de l'élaboration d'une stratégie de développement de cette molécule visant à augmenter l'index thérapeutique tout en réduisant la toxicité, nous avons étudié l'effet de quelques facteurs sur la cytotoxicité induite par l'amphotéricine B associée à des lipoprotéines du sérum sanguin chez le globule rouge humain (modèle universel de cellules animales supérieures). Dans notre travail nous avons abordé d'une part, les effets des caractéristiques des lipoprot...

  1. Removal of radiostrontium from man; Elimination du radiostrontium de l'organisme humain; Vyvedenie radioaktivnogo strontsiya iz organizma cheloveka; Eliminacion del radioestroncio por el organismo humano

    Energy Technology Data Exchange (ETDEWEB)

    Spencer, H. [Edward Hines, Jr. Hospital Hines, IL (United States)

    1963-02-15

    Studies of the metabolism of radiostrontium were carried out in man under controlled metabolic and dietary conditions. The relatively short-lived radioisotope Sr{sup 85} was used as the tracer. Single tracer doses of Sr{sup 85} were administered intravenously and orally and the plasma levels and urinary and faecal excretions were determined. The main pathway of Sr{sup 85} excretion was found to be via the kidney irrespective of the route of administration of the tracer. An average of 20% of the orally administered dose was absorbed from the intestine and approximately 50% of the absorbed dose was excreted in urine in 12 d by a large number of persons, Studies in which tracer doses of Sr{sup 85} and Ca{sup 45} were given simultaneously by the oral route indicated the preference of the body for Ca{sup 45} absorption and for Sr{sup 85} excretion, the Ca{sup 45}/Sr{sup 85} absorption ratio being 2.6:1. Sr{sup 85} studies carried out during low and high calcium intake in the same persons revealed that the high calcium intake did not lead to any significant change of Sr{sup 85} absorption in most of the persons studied. Since the urinary Sr{sup 85} excretion was found to parallel the urinary calcium excretion, enhancement of urinary calcium was induced by different agents, which increased the calciuria. Intravenously infused stable calcium and strontium, orally administered ammonium chloride given singly or in combination with intravenously infused calcium and certain chelating agents were effective in removing radiostrontium from man as late as two to four weeks after the injection of the tracer. Also, Sr{sup 90} balance studies were carried out in 12 young normal volunteers. No radioisotope was given in this study. The results obtained in Sr{sup 90} studies were similar to those obtained with Sr{sup 85}. (author) [French] Le metabolisme du radiostrontium dans l'organisme humain a ete etudie dans des conditions controlees de metabolisme et de regime alimentaire; le

  2. Modalités d'occupation du territoire et relations humains-grands Carnivores durant le Pléistocène supérieur :Approche archéozoologique, taphonomique et paléoécologique du Bassin mosan dans son contexte nord-ouest européen

    OpenAIRE

    Jimenez, Elodie-Laure

    2017-01-01

    Au sein des territoires du nord-ouest européen, la Belgique et son Bassin mosan ont livré ces 150 dernières années une somme prodigieuse de témoins des populations humaines et animales paléolithiques. Alors que ces vestiges laissent supposer le caractère attractif de la région lors de la dernière glaciation du Pléistocène (115-10 ka BP), ces communautés d’ongulés et leurs prédateurs— humains et grands Carnivores — ont dû toutefois s’adapter à de nombreuses variations environne...

  3. New strategic directions for Caribbean CSM project.

    Science.gov (United States)

    1986-01-01

    Recent changes in the strategy of the Caribbean Contraceptive Social Marketing Project emphasize the condom, under the brand name, Panther. Since 1984, CCSMP began marketing their Perle rand of oral contraceptive, since dropped, in Barbados, St. Vincent and St. Lucia. Now wider commercial connections are envisioned, with support by CCSMP to promote generic brands. The Panther condom campaign will include an array of mass media, point-of-purchase and sporting event advertising. Pharmacies report that Panther is selling as well as the leading commercial brand. CCSMP is looking to introduce an ultra-thin condom and a vaginal foaming tablet. Market research, involving physicians and users as well as retail audits, indicates that although population in numbers alone is not a serious problem in the Caribbean, early pregnancy is a concern in the area.

  4. FPA withdraws from CSM project in Guatemala.

    Science.gov (United States)

    1984-01-01

    Guatemala's family planning association, the Asociacion Pro-Bienestar de la Familia (APROFAM) recently cut its ties with the nation's contraceptive social marketing program. The announced reasons for the disassociation was APROFAM's concerns about the legality of selling donated commodities. APROFAM helped create the program served as a member of the marketing program's board of directors, and was expected to function as the channel for the commidities donated by the US Agency for International Development (USAID). The marketing program will now be managed by the newly created Importadora de Farmaceuticos (IPROFA), a for-profit organization. This alters the legal status of the marketing program, and as a result, the program will be required to pay duties on USAID donated contraceptives. USAID cannot legally pay duties on its own contributions. Instead, the duies will be paid by IPROFA out of the revenues generated by the project. IPROFA will finance the 1st consignment of products with a bank loan, and the loan and duties on subsequent shipments will be paid out of the program's revenues. This strategy is not expected to pose legal problems for USAID, since the agency has no control over how programs use the revenues generated by selling the agency's commodities. As a result of the changed status, the marketing program must acquire it own storage and packaging facilities. According to Manuel DeLucca, the program's resident advisor, these problems will not delay the launch of the program's products scheduled for early 1985. The program plans to sell an oral contraceptive, a vaginal spermicidal tablet, and a condom. Orginal plans called for selling the low dose OC, Norminest; however, Norminest may not be approved for distribution in Guatemala, and USAID may replace Norminest with another product. As a result, the program may market Noriday, a normal dose pill instead of Norminest. Guatemalan registration of the spermicidal tablet the program is planning to sell is pending. The program is engendering considerable interest because of its unique legal status as a commercial enterprise and its freedom from bureaucractic constraints.

  5. Entre culture générale et enjeux des métiers d'ingénieur : la diversité des enseignements en sciences humaines et sociales à l'École Centrale de Lyon

    Directory of Open Access Journals (Sweden)

    Hourcade Nicolas

    2014-01-01

    Full Text Available Ce texte analyse le développement d'enseignements en sciences humaines et sociales à l'École Centrale de Lyon, établissement formant des ingénieurs généralistes. Très limités au milieu des années 1990, les cours de SHS constituent aujourd'hui un aspect significatif de la formation. La première spécificité de cette offre pédagogique est de comprendre un nombre relativement important de cours obligatoires, complétés par des activités optionnelles. Sa seconde particularité est de traiter de thématiques générales à côté de contenus classiques liés aux enjeux des métiers d'ingénieur. Sa troisième caractéristique est de s'appuyer sur une implication de l'équipe SHS dans les activités professionnalisantes, tout en les séparant des enseignements disciplinaires. Enfin, l'inscription des SHS à l'ECL s'effectue plus par l'enseignement que par la recherche, chaque membre de l'équipe étant rattaché à un laboratoire extérieur différent.

  6. Développement humain, développement durable et « pays en développement » : comment articuler et mesurer les différentes dimensions ?

    Directory of Open Access Journals (Sweden)

    Bruno Boidin

    2004-02-01

    Full Text Available Cet article cherche à préciser la place qu’occupent les différentes dimensions du développement durable au sein de l’analyse économique du développement, et en particulier les dimensions humaine et sociale. Ceci nous amène à considérer les relations complexes entre les différents actifs (santé, éducation, capital social…, marquées par des effets d’irréversibilité qui peuvent remettre en cause la durabilité. Se pose alors la question de la mesure du développement durable prenant en compte ces articulations entre les dimensions. Une grille d’évaluation des mesures synthétiques du développement durable est proposée et appliquée à une sélection d’indicateurs.This article seeks to specify the place of various dimensions of sustainable development within development economics, in particular human and social dimensions. This leads us to consider the complex relations between the various assets (health, education, social capital…, characterized by irreversibility effects which can jeopardize sustainability. It is therefore necessary to find a measure of sustainable development, taking into account these interactions between dimensions. We propose criteria to evaluate synthetic measurements of sustainable development, and apply them to selected indicators.

  7. Determination of iron absorption and excretion by whole-body counting; Determination de l'absorption et de l'excretion du fer par la methode de comptage global humain

    Energy Technology Data Exchange (ETDEWEB)

    Hollard, D; Benabid, Y; Berard, M; Bonnin, J; Darnault, J; Millet, M [Commissariat a l' Energie Atomique, Grenoble (France). Centre d' Etudes Nucleaires

    1969-07-01

    Using a whole-body counter, the authors have studied {sup 59}Fe absorption and loss in 8 normal subjects and in 30 iron deficient patients. Results showed that whole-body counting provided an excellent and simple method for iron retention measurements, obviating many inaccuracies of previous technic. Normal absorption of radio iron with this procedure has ranged from 9 per cent to 20 per cent of the administered tracer in normal subjects, with a mean of 15 per cent. A significant increase in {sup 59}Fe absorption was noted in 21 iron-deficient patients in whom the retention ranged from 40 to 100 per cent. However, 3 iron-deficient patients were found to have low absorption, and their severe iron deficiency could be correlated with this defect in absorption. This method permits also the determination of the rate of iron excretion during the following months and therefore the study of the mechanism of some pathological loss. (authors) [French] L'utilisation de la methode de comptage humain global a permis aux auteurs d'etudier l'absorption et l'excretion du fer-59 chez 8 sujets temoins et 30 sujets hyposideremiques. Les resultats montrent que cette technique simple et directe offre de nombreux avantages sur les methodes employees jusqu'a maintenant pour cette determination. La valeur normale de l'absorption du fer chez les temoins est d'environ 15 pour cent de la dose ingeree. Ce chiffre est tres fortement augmente chez 21 sujets hyposideremiques, pouvant atteindre 100 pour cent de la dose ingeree. Par contre, pour 3 malades, cette absorption est si faible qu'elle suggere une carence par defaut d'absorption. Cette methode permet egalement de suivre l'excretion du fer au cours des mois qui suivent l'examen et de determiner le mecanisme de fuites anormales. (auteurs)

  8. Séroprévalence du virus de l'herpès humain-8 chez des patients VIH positif à l'hôpital général de Yaoundé – Cameroun

    Science.gov (United States)

    Jacky, Njiki Bikoï; Paul, Ndom; Lilian, Mupang; Sylvie, Agokeng Demanou

    2015-01-01

    L'épidémiologie de l'infection par le virus herpès humain de type 8 (HHV8) associée à celle à VIH, reste encore méconnue au Cameroun, bien que le pays soit considéré comme une zone endémique pour ces deux virus. L'objectif de ce travail était de ressortir le profil de la séroprévalence du HHV8 au sein de notre population d'étude. 57 personnes ont été recrutées à l'Hôpital Général de Yaoundé et suivies sur une durée 12 mois. Des anticorps IgG anti-HHV8 ont été déterminés par ELISA. Des paramètres autres, tels que l'âge, le sexe, le stade des maladies (SK et VIH/SIDA), le protocole ARV, ainsi que les taux de CD4 ont été utilisés pour déterminer les variables associées à la séropositivité au HHV8. Cette association a été évaluée par le test khi carré. La séroprévalence du HHV8 était de 90% dans notre population en début d'étude et de 74% douze mois plus tard, une séroprévalence qui restait élevée quelque soit le profil clinique, la tranche d'âge, le sexe ou le taux de CD4+ de l'individu. Aucune variable de l'étude n'était significativement associée à la séropositivité du HHV8. Le virus HHV8 semblait circuler au sein de notre population d'étude. Cependant l'on constate, douze mois plus tard, l'absence de manifestations cliniques du SK chez les patients VIH+ positifs, malgré des titres très élevés en IgG anti-HHV8. PMID:26090027

  9. Impact of the economic crisis on human mobility in Japan : a preliminary note L’impact de la crise économique sur la mobilité humaine au Japon : note préliminaire

    Directory of Open Access Journals (Sweden)

    Yoshitaka Ishikawa

    2012-12-01

    Full Text Available The central aim of this paper is to explore the impact of the global economic crisis on different categories of human mobility, including migration and tourism, in Japan. The major findings can be summarized as follows. First, since the fall of 2008 the crisis has had a far-reaching influence on Japan, for both the ethnic majority and minorities. Second, the intensity of the negative impact has varied by metropolitan areas and nationalities. Japanese nationals in the Tokyo metropolitan area and migrant workers (particularly Brazilians in the Nagoya metropolitan area and central Japan manufacturing prefectures are the most affected population groups. Finally, support programs by the Japanese government were problematic, and, in particular, the program that provided incentives for migrant workers to voluntarily return to their home countries was introduced too late. However, it is too early to clearly elucidate the full impact of the crisis, since the latest available data confirm that the current situation remains in a state of crisis.L’article vise à explorer l’impact de la crise économique mondiale sur différentes catégories de mobilité humaine au Japon, y compris les migrations et le tourisme. Les résultats principaux de l’étude peuvent se résumer comme suit. En premier lieu, depuis l’automne 2008, la crise a eu une influence non négligeable sur le pays, à la fois pour la majorité et pour les minorités ethniques. Ensuite, l’intensité de l’impact négatif a varié selon les zones métropolitaines et les nationalités. Les nationaux de la zone métropolitaine de Tokyo, ainsi que les travailleurs migrants (surtout des Brésiliens de la zone de Nagoya et des préfectures manufacturières du centre sont les groupes les plus touchés. Enfin, les programmes d’aide mis en place par le gouvernement japonais se sont révélés problématiques, en particulier celui qui offrait des incitations au retour volontaire vers les pays

  10. Le genre, le récit et le corps : « Aucun de nous ne reviendra » de Charlotte Delbo et « L’espèce humaine » de Robert Antelme

    Directory of Open Access Journals (Sweden)

    Silke Segler-Meßner

    2015-06-01

    Full Text Available L'article présente une relecture du premier volume de la Trilogie d’Auschwitz, Aucun de nous ne reviendra, de Charlotte Delbo dans une perspective du genre (dans le sens double de « genre littéraire » et de « gender » visant à analyser l’influence de la conscience d´être femme sur la mise en scène de la voix narrative ainsi que sur la présentation du monde concentrationnaire. Loin des généralisations stéréotypées, telles que la supposition d’une plus grande force morale dans le groupe des détenues féminines ou d’une plus grande solidarité entre les femmes l’article focalise les procédés narratifs et les images évoquées par le texte de Delbo qui sera comparé ensuite au récit L’espèce humaine de Robert Antelme. Dans la mesure où Charlotte Delbo et Robert Antelme s’obstinent à faire une histoire de leur expérience, il devient impossible d’associer leurs textes à un genre et, par conséquent, la lecture est contaminée par les effets d’une voix qui ne peut plus être située dans un cadre fixe ou un lieu concret. Ce « Je » qui parle appartient à un corps féminin ou masculin qui garde la mémoire traumatique et qui, en se transformant en un « nous », fonctionne comme un écran pour la souffrance et la mort des autres. Il reste alors à analyser les liens (secrets entre voix narrative, corps et genre, non pour rétablir le contexte biographique mais pour faire voir la naissance d’un sujet qui parle et qui, dans sa vulnérabilité, s’expose au regard des autres.

  11. Apports nutritionnels, dépense et bilan énergétiques chez l’homme et les primates non-humains : aspects méthodologiques Nutritional intakes, energy expenditure and energy balance in human and non-human primates: methodological aspects

    Directory of Open Access Journals (Sweden)

    Laurent Tarnaud

    2011-02-01

    Full Text Available Cet article est une revue des méthodes de terrain et des techniques de laboratoire, traditionnelles et récentes, qui permettent d’évaluer les apports alimentaires et nutritionnels, les profils d’activité, la dépense énergétique et les réserves énergétiques corporelles des primates humains et non-humains. Cette revue a pour objectif de faire le point sur l’avancement des techniques utilisées pour estimer les paramètres énergétiques en anthropobiologie. Les primates non-humains et l’homme partagent un certain nombre de traits psycho-physiologiques issus des processus d’adaptation biologique à l’environnement et/ou liés à l’inertie phylogénétique. Identifier les mécanismes qui président à la dynamique énergétique chez les primates non-humains permet ainsi de situer certaines des bases biologiques partagées avec l’homme dans le contexte de l’évolution. Cette revue s'attache donc à présenter les méthodes en dégageant, lorsqu’ils existent, les points de recoupement des différentes approches méthodologiques appliquées à l’homme et aux primates non-humains. Par ailleurs, des comparaisons inter-populationnelles au sein de l’espèce humaine ou chez des primates non-humains permettent de préciser les relations entre les variables écologiques et les adaptations énergétiques. Dans cet article le lecteur trouvera différentes méthodes, présentées dans différents chapitres, selon qu'il s'intéresse à décrire et quantifier les apports alimentaires, nutritionnels et énergétiques des individus dans des conditions environnementales spécifiques, mesurer les dépenses énergétiques associées aux activités ou déterminer le statut nutritionnel et la composition corporelle des individus ou encore préciser le rôle des composés secondaires sur la sélection des items alimentaires et les propriétés pharmacologiques des plantes consommées. À l’origine descriptives, les méthodes actuelles

  12. Culture entrepreneuriale et developpement humain: quelle articulation

    African Journals Online (AJOL)

    As a culture, it can diffuse much by formal education and non-formal channels. In this sense, the school remains one of the key ways to discover the entrepreneurial potential, support and update. We cannot therefore speak of entrepreneurial culture, without referring to learning entrepreneurship. From empirical data, this ...

  13. Directeur, Ressources Humaines | CRDI - Centre de recherches ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Jouer un rôle de leader et établir, dans la planification stratégique du CRDI (qui ... du fonctionnement (administration de la rémunération, recrutement, dotation, ... le vice-président, Ressources, établir le programme des politiques stratégiques ...

  14. Corruption, croissance et capital humain : quels rapports ?

    African Journals Online (AJOL)

    15 oct. 2013 ... secteur public et la définit comme l'abus d'une fonction publique à des .... particulièrement ce dernier et un indice composite à partir des trois qu'il ..... suivant une loi normale de moyenne nulle et de variance constante et finie.

  15. Reconnecter l’humain et la nature

    OpenAIRE

    Brunelle, Charles-Mathieu

    2013-01-01

    Qu’est-ce qui n’a pas été fait pour la nature ? À partir de cette interrogation en forme de constat, les responsables de l’Espace pour la vie – qui rassemble les institutions muséales des sciences de la Nature de Montréal et la Grande Place qui les relie – multiplient les initiatives pour rétablir le contact entre l’homme et la nature et impliquer davantage les citoyens dans la protection de la biodiversité.

  16. The Metabolism of Tritium-Labelled Epinephrine in Man; Metabolisme de l'Adrenaline Tritiee dans l'Organisme Humain; 041c 0435 0414 ; Metabolismo de la Adrenalina Marcada con Tritio en el Hombre

    Energy Technology Data Exchange (ETDEWEB)

    Labrosse, E. H.; Axelrod, J.; Kopin, I. J.; Kety, S. S. [National Institute of Health, Bethesda, MD (United States)

    1962-02-15

    limitees par le fait que l'adrenaline marquee avait une activite specifique relativement faible. Le recours a l'adrenaline tritiee (7-{sup 3}H-dl-adrenaline-d-bitartrate) a permis une meilleure recuperation des substances radioactives administrees, et grace a l'activite specifique plus elevee (superieure a 300 microcuries par milligramme) il a ete possible d'isoler de nouveaux metabolites et de determiner leur quantite. Chez 12 sujets males normaux, 92,6 {+-} 7,7% du tritium contenu dans l'adrenaline-3 infusee a ete evacue dans l'urine dans les 54 heures qui ont suivi l'infusion de l'adrenaline tritiee. L'urine contenait les substances tritiees suivantes: adrenaline inchangee, 6,8 {+-} 1,5%; metanephrine libre, 5,2 {+-} 1,1%; glycuronate de metanephrine, 6,0 {+-} 1,5%; sulfate de metanephrine, 29,5 {+-} 9,0%; metoxy-3-hydroxy-4-phenylglycole, 7,1 {+-} 1,4%; acide dihydroxy-3, 4-mandelique libre et conjugue, 1,6 {+-} 0,6%; acide metoxy-3-hydroxy-4-mandelique, 41,2 {+-} 8,4%. Comme le montrent ces experiences et d'autres se rapportant au meme domaine, l'application biologique de l'adrenaline tritiee a permis de mieux comprendre le metabolisme de cette importante hormone de l'organisme humain. (author) [Spanish] Los autores tenian interes en estudiar el metabolismo de la adrenalina en seres humanos normales. Las investigaciones realizadas en animales indicaron algunos ciclos metabolicos posibles, pero las dosis de radiactividad y de aminopirocatequina empleadas eran superiores a las que el ser humano puede soportar sin peligro. Asimismo, los estudios anteriores acerca del metabolismo de esta hormona en el hombre quedaron limitados por la actividad especifica relativamente baja de la adrenalina marcada. El empleo de adrenalina tritiada (d-bitartrato de 7-{sup 3}H-dl-adtenalma) ha permitido recuperar un porcentaje mayor de la radioactividad administrada, y su actividad especifica mas elevada (mas de 300 {mu}curies/mg) ha hecho posible aislar y determinar cuantitativamente

  17. La correction et la révision de l’écrit en français langue seconde: médiation humaine, médiation informatique Correcting and editing texts written by FSL students: human mediation vs. computer-assisted mediation

    Directory of Open Access Journals (Sweden)

    Chantal Dion

    2003-06-01

    Full Text Available L’apprentissage de la correction / révision de l’écrit par les apprenants de français langue seconde peut-elle tirer profit des correcteurs orthographiques et grammaticaux des traitements de texte ou des correcticiels spécialisés ? La nature de la médiation informatique permet-elle aux apprenants de corriger de façon efficace leurs textes et comment se compare-t-elle avec la correction humaine ? Qu’est-ce qui différencie ces deux médiations ? Des textes rédigés par des anglophones ont été soumis aux deux types de corrections, humaine et informatique, soit deux enseignantes ayant vingt ans d’expérience et la correction informatique effectuée par le correcteur orthographique et grammatical de Word et les deux correcticiels canadiens, Le correcteur 101 et Antidote. Les résultats montrent que la nature de ces médiations n’est pas comparable et que la médiation informatique, pour être efficace, nécessite la participation active, intelligente et instruite de l’utilisateur et que les correcticiels ne peuvent pas corriger efficacement des textes d’étudiants de niveau intermédiaire.Can spellcheckers or grammar correctors, be they part of a word processor or stand-alone programs, help FSL students become more adept at correcting or editing the written texts they produce? Does computer-assisted mediation enable learners to correct their work efficiently and how does it compare with human mediation? What differentiates them? Texts written by anglophone students were corrected using both methods, i.e., on the one hand, by two teachers with 20 years experience and, on the other hand, using the specialized tools available with MSWord as well as two Canadian text correction programs, Le Correcteur 101 and Antidote. It turns out that the two methods are of very different natures ; computer-based correction can only give some positive results if the users have received appropriate training enabling them to actively and

  18. Mesenchymal stem cells favour healing of the cutaneous radiation syndrome; Les cellules souches mesenchymateuses favorisent la cicatrisation des lesions cutanees radio induites

    Energy Technology Data Exchange (ETDEWEB)

    Francois, S.; Mouiseddine, M.; Mathieu, N.; Semont, A.; Monti, P.; Dudoignon, N.; Sache, A.; Boutarfa, A.; Thierry, D.; Voisin, P.; Gourmelon, P.; Chapel, A. [IRSN, Dir. de radioprotection de l' Homme, 92 - Fontenay-aux-Roses (France)

    2006-10-15

    It has been suggested that human Mesenchymal Stem Cells (hMSC) could be used to repair numerous injured tissues. We have studied the potential use of hMSC in order to limit radiation-induced skin lesions. Immuno-deficient NOD/SCID mice were locally irradiated to the leg (30 Gy, dose rate 2.7 Gy/mn) using a {sup 60} Co source in order to induce a severe skin lesion. Cultured bone marrow hMSC were delivered intravenously to the mice. The irradiated skin samples were studied for the presence of the human cells, the severity of the lesions and the healing process. Macroscopic analysis and histology results showed that the lesions were evolving to a less severe degree of radiation dermatitis following hMSC transplant when compared to irradiated non-transplanted controls. Clinical scores for the studied skin parameters of treated mice were significantly improved. A faster healing was observed when compared to untreated mouse. Immuno-histology and Polymerase Chain reaction (PCR) analysis provided evidence that the human cells were found in the irradiated area. These results suggest a possible use of hMSC for the treatment of the early phase of the cutaneous radiation syndrome. A successful transplant of stem cells and subsequent reduction in radiation-induced complication may open the road to completely new strategies in cutaneous radiation syndrome therapy. (authors)

  19. Total Counting and Spectroscopy in the Assessment of Alpha Radioactivity in Human Tissues; Determination de la Radioactivite Alpha des Tissus Humains par Dosage de l'Activite Globale et Spectroscopie; Obshchee izmerenie i spektroskopiya pri opredelenii al'fa-radioaktivnosti tkanej cheloveka; Evaluacion de la Actividad Alfa en los Tejidos Humanos por Recuento Global y Espectroscopia

    Energy Technology Data Exchange (ETDEWEB)

    Mayneord, W. V.; Hill, C. R. [Physics Department, Institute of Cancer Research, Royal Cancer Hospital, Clifton Avenue, Belmont, Surrey (United Kingdom)

    1964-10-15

    'identifier les radionucleides d'apres des mesures de la periode. L'auteur decrit deux spectrometres alpha qui ont ete utilises avec des substances tres diverses (tissus humains et echantillons du milieu ambiant). Il s'est attache particulierement au dosage du {sup 210}Po que l'on sait maintenant etre present dans certains produits alimentaires et dans des tissus humains. Il expose les methodes employees pour l'etude du {sup 239}Pu dans l'atmosphere et donne des exemples de mesures de faibles concentrations de ce radionucleide dans l'air. Il expose egalement les methodes utilisees pour le dosage du {sup 239}Pu dans les tissus humains normaux et communique quelques resultats. Il etudie la contribution du {sup 210}Po dans le debit de dose du au rayonnement naturel dans les os et les organes de reproduction humains; Il montre que cette contribution peut constituer une fraction significative de la dose totale recue. (author) [Spanish] Los autores describen sucintamente un programa de mediciones de la actividad alfa, que abarco siete anos. El programa, que se basaba inicialmente en el empleo de una sensible y sencilla tecnica de recuento, con ayuda de pantallas delgadas de sulfuro de cinc y de cadmio, comprende en la actualidad tecnicas de espectroscopia alfa especiales para fuentes de gran superficie y de baja actividad especifica. Estas tecnicas permiten medir actividades especificas de hasta 10{sup -13} c/g y pueden en ciertos casos alcanzar una resolucion energetica del orden de 40 keV, permitiendo al mismo tiempo una identificacion independiente basada en la medicion del periodo de semidesintegracion. Se describen dos espectrometros alfa utilizados para examinar una gran variedad de materias provenientes del cuerpo humano y del medio ambiente. Se ha dedicado especial atencion al estudio del {sup 210}Po que, como ahora se sabe, se halla presente en buen numero de productos alimenticios y de tejidos humanos. Asimismo, se describen tecnicas de analisis del {sup 239}Pu presente en la

  20. High-sensitivity gamma spectroscopy for extended sources. Application to activity measurements on the human body, on glass, and on soil; Spectrographie gamma a grande sensibilite pour sources etendues. Application a la mesure de l'activite du corps humain, du verre et du sol

    Energy Technology Data Exchange (ETDEWEB)

    Jouve, B

    1962-07-01

    The measurement and location by gamma spectroscopy of human body internal contaminations at maximum permissible levels, and, in certain cases, at lower activities such as that due to {sup 40}K was investigated. The characteristics of the high-sensitivity apparatus used are given, and several assemblies using large-volume NaI(Tl) scintillators are described. The relatively light shielding required for natural radioactivity permitted construction of mobile assembly. Conditions of use are described, and the results are given. All gamma emitting elements were measured in 15 min at levels lower than the tolerance dose. Gamma spectroscopy was also used to determine fission products in the earth and to study radioactive elements in the presence of other emitters. (author) [French] La spectrographie gamma du corps humain permet la mesure et la localisation des contaminations internes au niveau des doses de tolerance et, dans certains cas, celle d'activites plus faibles comme la radioactivite naturelle due principalement au potassium 40. Les caracteristiques des appareils a grande sensibilite permettant ces mesures sont exposees et on decrit plusieurs realisations originales utilisant un scintillateur NaI(Tl) de grand volume. L'epaisseur du blindage a ete limitee a 5 cm de plomb, ainsi, pour une protection suffisante contre les rayonnements ambiants, les appareils sont relativement legers et l'une des realisations a pu etre installee dans un laboratoire mobile. Les conditions d'utilisation (mouvement propre, etalonnage) et les resultats obtenus sont donnes; tous les radioelements emetteurs gamma sont mesurables en 15 minutes a un niveau inferieur a la dose de tolerance. On presente enfin des applications a la spectrographie gamma d'echantillons volumineux (poudres ou liquides) et de tres faible activite: elles interessent des domaines tres varies comme, par exemple, la geophysique (etude des retombees radioactives) ou l'industrie chimique (dosage du potassium dans les

  1. High-sensitivity gamma spectroscopy for extended sources. Application to activity measurements on the human body, on glass, and on soil; Spectrographie gamma a grande sensibilite pour sources etendues. Application a la mesure de l'activite du corps humain, du verre et du sol

    Energy Technology Data Exchange (ETDEWEB)

    Jouve, B

    1962-07-01

    The measurement and location by gamma spectroscopy of human body internal contaminations at maximum permissible levels, and, in certain cases, at lower activities such as that due to {sup 40}K was investigated. The characteristics of the high-sensitivity apparatus used are given, and several assemblies using large-volume NaI(Tl) scintillators are described. The relatively light shielding required for natural radioactivity permitted construction of mobile assembly. Conditions of use are described, and the results are given. All gamma emitting elements were measured in 15 min at levels lower than the tolerance dose. Gamma spectroscopy was also used to determine fission products in the earth and to study radioactive elements in the presence of other emitters. (author) [French] La spectrographie gamma du corps humain permet la mesure et la localisation des contaminations internes au niveau des doses de tolerance et, dans certains cas, celle d'activites plus faibles comme la radioactivite naturelle due principalement au potassium 40. Les caracteristiques des appareils a grande sensibilite permettant ces mesures sont exposees et on decrit plusieurs realisations originales utilisant un scintillateur NaI(Tl) de grand volume. L'epaisseur du blindage a ete limitee a 5 cm de plomb, ainsi, pour une protection suffisante contre les rayonnements ambiants, les appareils sont relativement legers et l'une des realisations a pu etre installee dans un laboratoire mobile. Les conditions d'utilisation (mouvement propre, etalonnage) et les resultats obtenus sont donnes; tous les radioelements emetteurs gamma sont mesurables en 15 minutes a un niveau inferieur a la dose de tolerance. On presente enfin des applications a la spectrographie gamma d'echantillons volumineux (poudres ou liquides) et de tres faible activite: elles interessent des domaines tres varies comme, par exemple, la geophysique (etude des retombees radioactives) ou l'industrie chimique

  2. Comment mesurer la relation humain-technologies-organisation ? How to measure the human-technology-organization relationship? Presentation of a symbiosis-based questionnaire for evaluating the human-technology-organization relationship Cómo medir la relación humano-tecnologías-organización ? Elaboración de un cuestionario de medición de la relación humano-tecnología-organización basado en el modelo de la simbiosis

    Directory of Open Access Journals (Sweden)

    Éric Brangier

    2007-10-01

    Full Text Available Cet article vise à restituer une recherche relative à la mise au point d’une échelle de mesure de la relation entre l’humain, la technologie et l’organisation. Tout d’abord, les auteurs débattent des différents modèles théoriques de l’acceptation des technologies (technology acceptance model, théorie de la satisfaction de l’utilisateur, la théorie de la nonconformité aux attentes, puis proposent de considérer que la relation entre l’humain, la technologie et l’organisation peut s’appréhender selon une approche symbiotique qui considère qu’humains et technologies sont reliés par des rapports de forte dépendance, voire de fusion réciproque ou de couplage mutuel. La présentation d’un modèle de la symbiose humain-technologie-organisation donne ensuite lieu à l’élaboration d’un questionnaire administré à un échantillon de 172 personnes. Enfin, les analyses soulignent que l’approche symbiotique fournit des niveaux d’explicativité très intéressants, notamment en soulignant l’importance du couplage entre l’humain et la machine, et en révélant ainsi que les liens qui tissent la relation entre l’humain, l’organisation et la machine peuvent être dits mutuellement dépendants. Cet article propose donc une alternative aux modèles qui insistent sur les conditions d’acceptation des technologies par l’humain en montrant qu’aujourd’hui les technologies contemporaines sont en passe de devenir des symbiotes qui, d’un point de vue métaphorique, se couplent avec les individus.This article aims to reconstruct research relating to the development of a measurement scale for the man-technology-organization relationship. The authors first discuss various theoretical models for technology acceptance: the technology acceptance model, user’s satisfaction theory, expectancy disconfirmation theory, and then suggest that the man-technology-organization relationship can be studied through a

  3. NOUVELLES FORMES DE LA TRAITE DES ETRES HUMAIN

    OpenAIRE

    Dragos CHILEA; Andreea Georgiana ENACHE

    2011-01-01

    New forms of human trafficking are: I. Trafficking and exploitation of slaves. Trafficking human beings is one method of obtaining slaves. Victims are typically recruited through deceit or trickery (such as a false job offer, false migration offer, or false marriage offer), sale by family members, recruitment by former slaves, or outright abduction. II. Traffic flows of workers in Asia, Africa, Eastern Europe and former Soviet Union, Turkey. In the case of trafficking of workers there is the ...

  4. Mieux nourrir les animaux pour une meilleure alimentation humaine ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    8 nov. 2013 ... Des chercheurs travaillant dans les districts de Morogoro et de Dodoma, en Tanzanie, ont fait une importante découverte : en enrichissant le foin avec des fanes de manioc et des feuilles de patate douce, ils ont fourni aux chèvres laitières un aliment peu coûteux, à teneur élevée en protéines, qui les a ...

  5. Developpement du systeme de gestion des ressources humaines ...

    African Journals Online (AJOL)

    Health workers are facing several problems in order to be successful in their interventions. Lacs Health District faced different issues in human resources management (HRM) and a lot what done to deal with them. In order to sustain, it is important to know the level of its human resources management systems development.

  6. Interaction affective et expressive. Compagnon artificiel-humain

    OpenAIRE

    Riviere , Jérémy

    2012-01-01

    The aim of this thesis is to make an Embodied Conversational Agent (ECA) sincere in order to, on one hand, improve its believability from the human's point of view, and on the other hand make it acceptable in an affective relationship between an artificial companion and a human. The first part of this work consists in creating a Multimodal Conversation Language (MCL) for an ECA, made up of Multimodal Conversation Acts (MCA) such as promise, apologise or demand. These MCA allow the agent to ap...

  7. Être humain, être dans la lune ?

    Directory of Open Access Journals (Sweden)

    Augustin Berque

    2010-09-01

    Full Text Available L’ouvrage commence par une épigraphe de Heidegger : […] ce sont les structures constituant l’existence qu’il s’agit de dégager l’une après l’autre. L’ensemble que forment ces structures réunies, nous l’appelons l’existentialité. Son analytique a le caractère d’une entente non pas existentielle mais existentiale . « […] nicht eines existenziellen, sondern existenzialen Verstehens » (Heidegger, [1927] 1993, p. 12. Il faut en effet savoir, ce que nous ...

  8. Distribution des Glossines vecteurs de la Trypanosomose humaine ...

    African Journals Online (AJOL)

    Objective: In order to know the apparent density and specific composition of the flies in a former home of human African trypanosomes in Gabon, an entomological investigation was conducted in primary forest and Doussala village in the National Park of Moukalaba Doudou (Gabon South). Methodology and Results:The ...

  9. Intelligence artificielle et développement humain

    International Development Research Centre (IDRC) Digital Library (Canada)

    dans le cadre de campagnes sur les médias sociaux, les applications d'IA favorisent ..... réalisations pour le bien social, et d'entraîner des dommages significatifs sont ...... d'assurer le contrôle, d'influencer ou de gérer des personnes et des.

  10. Effects of Monoenergetic Neutron Radiation on Human Cells in Tissue Culture; Effets des Neutrons Monoenergetiques sur des Cellules de Tissus Humains en Culture; Dejstvie oblucheniya monoehnergeticheskimi nejtronami na kletki kul'tury tkanej cheloveka; Efectos de la Radiacion Neutronica Monoenergetica sobre las Celulas Humanas en Cultivos de Tejidos

    Energy Technology Data Exchange (ETDEWEB)

    Broerse, J. J.; Barendsen, G. W. [Radiobiological Institute of the Organization for Health Research TNO, Rijswijk (Z.H.) (Netherlands)

    1964-03-15

    Dose effect relations concerning inhibition of clone formation by kidney cells of human origin in culture after irradiation with monoenergetic neutrons of about 3-MeV and about 15-MeV energy, are reported. For 3-MeV neutrons the dose rate was equal to 0.2 rad/min, while for 15-MeV neutrons dose rates of 2.7 rad/min and 12 rad/min were obtained. The cells were irradiated in culture dishes with a thin Melinex bottom and in small flexible nylon and silicon rubber tubes. Neutron fluxes were determined by measuring the activation of sulphur pellets mounted respectively between the dishes and the tubes. Calculation of the dose on the basis of the neutron flux presented a number of problems which are discussed. Because no radiation equilibrium exists around the cells, the resulting inaccuracies in the dose determinations are investigated. Dose-survival curves for both types of neutrons are presented. For 3-MeV neutrons an RBE was found ranging from 6.5 at low doses to about 3.1 at high doses, while for 15-MeV neutrons the RBE varied from 1.9 to 1.6. By comparison of these RBE-values with the RBE-LET relation obtained in earlier experiments with deuterons and {alpha}-particles, it is possible to derive an effective LET for the neutrons used. In order to elucidate certain problems related to the death of experimental animals after X- or neutron- irradiation, a technique has been developed whereby the cells, contained in small tubes, are used to measure the effective dose (i.e . dose corrected for the RBE) at sites of interest in phantoms or animals. (author) [French] Les auteurs indiquent les relations dose-effet pour l 'inhibition de la formation de lignees par les cellules renales d' origine humaine apres irradiation par des neutrons monoenergetiques de 3 MeV et de 15 MeV. Pour les neutrons de 3 MeV, le debit de dose etait egal a 0,2 rad/min, alors que pour les neutrons de 15 MeV on a obtenu des debits de dose de 2,7 rad/min et de 12 rad/min. L'irradiation des cellules

  11. On CSM classes via Chern-Fulton classes of f-schemes

    OpenAIRE

    Fullwood, James; Wang, Dongxu

    2015-01-01

    The Chern-Fulton class is a generalization of Chern class to the realm of arbitrary embeddable schemes. While Chern-Fulton classes are sensitive to non-reduced scheme structure, they are not sensitive to possible singularities of the underlying support, thus at first glance are not interesting from a singularity theory viewpoint. However, we introduce a class of formal objects which we think of as `fractional schemes', or f-schemes for short, and then show that when one broadens the domain of...

  12. The SMP mobilizes a bright idea: a CSM cinema on wheels.

    Science.gov (United States)

    1985-01-01

    The Bangladesh Family Planning Social Marketing Project (SMP) provides 1 of the best examples of the use of the mass media to promote social marketing. Using a fleet of 7 vans and 1 motor launch, the SMP brings films about family planning to more than a million rural couples a month living in isolated villages. Each film unit has two 16 mm projectors, a generator, a screen and speaker system and is operated by a projectionist and an assistant. 1 mobile unit gives about 25 shows a month at a cost of $75US per show, or less than 2 cents per person. The message reels and advertising spots were produced in Bangladesh, and the musical numbers are taken from local feature films. Every 3-4 months, the vans switch message and musical films, but all units keep separate copies of the advertising spots for Raja and Panther condoms and Maya and Ovacon pills. The motivational films were developed through extensive research, and they address basic social issues. During the show, various promotional items are sold, including calendars with family planning messages, plastic bags, key rings, and contraceptives. According to Robert Ciszewski, executive director of Population Services International, these mobile films are making a profound social change in Bangladesh.

  13. The Impacts of Personal Qualities on Online Learning Readiness at Curtin Sarawak Malaysia (CSM)

    Science.gov (United States)

    Lau, Chun Yun; Shaikh, Junaid M.

    2012-01-01

    Nowadays many educational institutions have embraced online education to cater for flexible and student-centered learning. Through online education, students have an opportunity to gain education at their own convenience, in terms of time and place. However, it is argued that students are less satisfied with online learning than with traditional…

  14. Low Loss Tapered Fiber Waveguide Modulator for Crew Cognitive State Monitoring (CSM)

    Data.gov (United States)

    National Aeronautics and Space Administration — Many crew-related errors in aviation and astronautics are caused by hazardous cognitive states including overstress, disengagement, high fatigue and ineffective crew...

  15. Criteria for feasibility, health and welfare assessment of requirement to use second and subsequent generations of non-human primates or animals from self-sustaining colonies in research Critères d’évaluation de la faisabilité, de l’incidence sanitaire et des répercussions sur le bien-être animal, relatifs à l'obligation future d'utiliser des primates non humains issus uniquement des animaux de deuxième génération et plus ou des animaux provenant de colonies d'élevage auto-entretenues pour la recherche expérimentale

    Directory of Open Access Journals (Sweden)

    David Smith

    2011-10-01

    Full Text Available The European Directive 2010/63/EU on the protection of animals used for scientific purposes requires that a feasibility study must be conducted by the European Commission to determine if all sourcing of non-human primates from parents bred in captivity (F2 or from self-sustaining colonies can be achieved. This study should also include an assessment of animal health and welfare. Prior to the initiation of the European Commission’s study, it was considered by EFPIA and FELASA that the criteria to be used in the feasibility, health and welfare assessment should be established by experts to help expedite such a study. This paper identifies those criteria which may be useful in making policy decisions on the confirmation or reconsideration of the timetable for implementation of the F2 requirement. A key requirement before a number of criteria can be assessed is the generation of base-line data relating to the supply and future demand of non-human primates and the health and welfare status of current breeding colonies supplying the European market. Three groups of criteria have been indentified, namely feasibility, science and research and welfare. Within each group, a number of parameters are defined and their rationale for inclusion, together with suggested information points, is discussed.La directive européenne 2010/63/EU sur la protection des animaux utilisés à des fins scientifiques exige qu'une étude de faisabilité soit conduite par la Commission européenne afin de déterminer si l’approvisionnement en primates non-humains à partir de géniteurs élevés en captivité (F2 ou de colonies d'élevage autosuffisantes, peut être possible. Cette étude devra également inclure une évaluation de la santé des animaux et de leur bien-être. Avant le début de cette étude par la Commission européenne, l'EFPIA et FELASA ont estimé que les critères à utiliser pour les évaluations de la faisabilité, de la santé des animaux et du bien

  16. Les enjeux identitaires de l’humain dans le débat philosophique sur la robotique humanoïde et l’amélioration humaine

    Directory of Open Access Journals (Sweden)

    Béland, Jean-Pierre

    2014-11-01

    Full Text Available Do human identity representations (human identity, natural/artificial distinction still make sense in the context of the development of humanoid robotics (humanizing the robot and human enhancement (automation of the human? The problem is that critical philosophers, like Lin and Allhoff who founded the journal NanoEthics, challenge these representations of human identity, as if the discussion of the ethical evaluation of these representations was exhausted with regards to the two issues that they raise in 2009 in Ethics of Human Enhancement: 25 Questions and Answers, i.e.: “Does the notion of human dignity suffer with human enhancements?” and “Is the natural-artificial distinction morally significant in this debate?” The purpose of this article is to show – in light of various texts that constitute our framework for analyzing moral arguments – the limits of the scope and insufficiency of the critical arguments that Lin and Allhoff use to answer these two questions. But in applying our framework to these authors, we will also show how the question of human identity or the natural/artificial distinction still makes sense in the ethical evaluation.

  17. NATO Human Resources (Manpower) Management (Gestion des ressources humaines (effectifs) de l’OTAN)

    Science.gov (United States)

    2012-02-01

    they need for particular jobs or career paths Gather labour market intelligence coherently and consistently quantify the skill requirements of the...machines, tools, and equipment. Similarly, labour market information defined by industry or occupation is also provided here. This domain is...150 Fax: [49] (0) 228 12 52 16 D-53123 Bonn e-mail: RalflJung@bmvg.bund400.de NORWAY /NORVEGE OSTBYE, Mr. P.R. Head of Section for

  18. Revue des sciences humaines, Université de Constantine.n° 12, 1999

    OpenAIRE

    Soufi, Fouad

    2013-01-01

    Par le nombre élevé d’études réunies, vingt quatre dont dix huit en arabe, quatre en français et deux en anglais, ce numéro a le mérite de donner une vision assez complète des centres d’intérêt des chercheurs de l’université de Constantine (trois contributions extérieures seulement). Thème premier, l’économie : La mondialisation (Belkacem Slatnia), la conservation des monuments historiques en milieu urbain (Ahmed Boudraa), L’échec des politiques industrielles (N. Boumahrat), La fuite des cerv...

  19. Impact de l'exploitation miniere sur la sante humaine : cas de la ...

    African Journals Online (AJOL)

    The liquid and solid wastes as well as the dust from the treatment plant of the phosphorites of Hahotoé-Kpogamé (Southern Togo) pose serious problems of environmental pollution that are source of some diseases like dental fluorosis related to the high content of fluorine in those phosphorites. The analysis of this element ...

  20. Ressources humaines en matière de santé dans la Chine rurale ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Six world-class research teams to investigate overcoming therapeutic resistance in high fatality cancers. The world-class research teams will direct their focus towards new frontiers in cancer research. View moreSix world-class research teams to investigate overcoming therapeutic resistance in high fatality cancers ...

  1. Renforcement de la capacité des ressources humaines dans le ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    -Quelles sont les compétences et les capacités nécessaires pour gérer efficacement le cycle de vie du secteur extractif (exploration, exploitation, gestion, fermeture ... Women in the developing world continue to face obstacles that limit their ability to establish careers and become leaders in the fields of science, technology, ...

  2. Les oméga 3 : de l’alimentation animale à la nutrition humaine

    Directory of Open Access Journals (Sweden)

    Combe Nicole

    2004-01-01

    Full Text Available La dernière édition des Apports nutritionnels conseillés (ANC- éd. 2001 souligne la nécessité d’accroître la consommation d’acide alpha-linolénique (ALA. Celle-ci devrait au minimum doubler et représenter 0,8 % (par rapport à l’énergie totale contre 0,34 % actuellement. Or, l’étude Aquitaine [1] a montré que les lipides d’origine animale contribuaient à près de 75 % de l’apport alimentaire en ALA. Ainsi, parmi les stratégies envisageables pour accroître notre consommation d’ALA, sans changer fondamentalement les habitudes alimentaires des Français, on note un intérêt croissant pour augmenter la teneur en oméga 3 des produits animaux via l’alimentation de ces derniers. Quelques exemples de modification de la composition en acides gras des produits animaux sont exposés. Chez les espèces monogastriques (volaille, porc, le profil des lipides de carcasse est un bon reflet des lipides alimentaires. Ainsi, chez le porc, le niveau d’oméga 3 peut être augmenté d’un facteur 2 à 4, lorsque les animaux reçoivent dans leur alimentation de l’huile de colza, des graines de lin ou de la farine de poissons. En revanche, chez les animaux ruminants, le transfert des acides gras polyinsaturés alimentaires vers les tissus est faible en raison de l’hydrogénation qu’ils subissent dans le rumen. Certaines stratégies qui consistent à protéger ces acides gras de la biohydrogénation permettent néanmoins d’accroître le taux d’ALA dans les tissus et le lait. Ainsi, il apparaît possible d’augmenter la consommation d’oméga 3 de la population, via la consommation de produits issus d’animaux nourris avec des sources d’oméga 3. Cependant, au niveau de la production, ces changements doivent être maîtrisés \\; ils ne peuvent se faire sans un contrôle des qualités d’une part organoleptiques, en raison du degré élevé d’oxydabilité de ces acides gras, d’autre part de texture, en raison de leur caractère « fluide ».

  3. Human Modelling for Military Application (Applications militaires de la modelisation humaine)

    Science.gov (United States)

    2010-10-01

    techniques (rooted in the mathematics-centered analytic methods arising from World War I analyses by Lanchester 2 ). Recent requirements for research and...34Dry Shooting for Airplane Gunners - Popular Science Monthly". January 1919. p. 13-14. 2 Lanchester F.W., Mathematics in Warfare in The World of

  4. Human Behaviour Representation in Constructive Modelling (Representation du comportement humain dans des modelisations creatives)

    Science.gov (United States)

    2009-09-01

    Resources and Performance. Action Group 19. Representation of Human Behavior. Lanchester , F. W. (1916). Aircraft in warfare . The dawn of the fourth...Operations and non-kinetic warfare . The second keynote presentation, by Mr. Mike Greenley, CAE Inc. provided an industry perspective, noting the need for...concentrated on tactical-conventional warfare and the emergence of world-wide “irregular warfare ” and “small wars” drive the present and future need

  5. Contribution à la simulation du mouvement humain en vue d'application en ergonomie

    OpenAIRE

    WANG, X

    2008-01-01

    Ce mémoire constitue une synthèse des travaux de recherche effectués par l' auteur tout d' abord au Laboratoire Ergonomie Santé Confort (LESCO), et puis au Laboratoire de Biomécanique et Mécanique de Chocs (LBMC) de l' Institut National de Recherche sur les Transports et leur Sécurité (INRETS) durant la période janvier 1992 - octobre 2007. La principale source d' inspiration de ces travaux réside dans le domaine spécifique de la simulation ergonomique. Ils portent essentiellement sur l' analy...

  6. Protection des vies humaines et des moyens de subsistance dans la ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    6 juin 2014 ... ... mais l'on craint que ces phénomènes deviennent de plus en plus destructeurs au fur et à ... tirent leur subsistance de la lagune, de ses environs et de son delta. ... Chilika: An Integrated Management Planning Framework for ...

  7. Lutte intégrée contre les maladies humaines et animales pour les ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    La recherche portera sur deux zones agroécologiques du corridor d'élevage du bétail en Tanzanie, soit les districts de Ngorongoro et ceux de Kibaha et de Kilosa, et sera menée par le Southern African Centre for Infectious Disease Surveillance (SACIDS), un consortium d'établissements scientifiques de l'Afrique australe.

  8. Partenaire d'affaires en ressources humaines (h/f) | CRDI - Centre ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    à-d. des solutions de recrutement et de dotation) au sein du portefeuille de clients ... à la promotion et à la mise en oeuvre de la stratégie de gestion des talents en ... les politiques et lignes directrices ainsi que les valeurs de dotation et les lois ...

  9. Human Behavior Representation in Constructive Simulation (La representation du comportement humain dans la simulation constructive)

    Science.gov (United States)

    2009-09-01

    H ig h H ig h V e r y H ig h Figure 6-7: State Variable Decision Effectiveness and Performance. While Lazarus and Folkman (1984...psychological studies have explored these ways of coping. Lazarus and Folkman (1984) distinguished between problem-focused (PFC) and emotion-focused...were used increasingly as a consequence of greater challenge. 6.10.1.1.2 Modeling Lazarus and Folkman (1984) talk about a general concept of stress and

  10. Human Factors in the 21st Century(Les facteurs humains au 21th siecle)

    Science.gov (United States)

    2002-05-01

    Communication, 6(2). Kerbrat-Orrechioni, C. (1990) Les interactions verbales, Armand- Colin , Paris. Lewis, D. 1969 Convention. Cambridge, MA : Harward...decision support (e.g. Taylor, Finnie and Hoy, 1997; Taylor, and Dru Drury , 2001). This is needed to determine the required levels of human control over

  11. Changements climatiques et santé humaine à Accra, Ghana | IDRC ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    existence et le bien-être de la population ghanéenne. La détérioration du milieu rural contribue sensiblement au flux de migrants qui arrivent chaque jour dans les villes. Ces nouveaux arrivants regroupés dans des bidonvilles dépourvus ...

  12. Caractérisation du cerveau humain : application à la biométrie

    OpenAIRE

    Aloui , Kamel

    2012-01-01

    In general, biometrics aims is the identification or verification of individual, especially using their physical or behavioral characteristics. This practice tends to replace the traditional knowledge-based methods such us a password or PIN code and token-based methods such as identity document or a badge. Daily, multiple biometric modalities have been developed, where the products are available and already used in many applications. Biometric recognition is a research area that does not stop...

  13. Séroprévalence du virus de l'immunodéficience humaine, des virus ...

    African Journals Online (AJOL)

    Objectifs: Les agents pathogènes transmissibles par transfusion sanguine constituent un problème de santé publique en Afrique subsaharienne. Le but de ... Un choix plus judicieux des ces tests rapides et le recrutement de donneurs de sang bénévoles non rémunérés et leur fidélisation pourraient améliorer la sécurité ...

  14. Données préliminaires sur le paludisme humain en zones rurale et ...

    African Journals Online (AJOL)

    SARAH

    31 juil. 2017 ... axée sur le diagnostic précoce et la prise en charge rapide des ... recherche investigue sur les connaissances, attitudes et ... paludisme et (vi) sur la source de traitement du paludisme. ... technique ELISA (Burkot et al., 1984).

  15. Institutionnalisation de l'approche Ecosystème et santé humaine en ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Ce projet vise a intégrer l'approche écosanté dans des programmes de maîtrise dans les Universités d'Abomey Calavi au Bénin, de Ouagadougou au Burkina Faso, d'Abobo Adjamé et de Cocody en Côte d'Ivoire et dans l'École nationale polytechnique de l'Université de Yaoundé au Cameroun. La coordination sera ...

  16. Collaboration dans les établissements humains spontanés : s ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    5 mars 2018 ... Frères et sœurs pagayant à l'école ... Il s'agit généralement d'un aspect négligé de la planification urbaine et, dans la plupart des cas, l'accès aux services urbains de base tels que la collecte et la ... Être à l'écoute des intervenants locaux devient de plus en plus important dans le processus d'urbanisme.

  17. Fertilisation du maïs (Zea mays L.) à base d'urines humaines ...

    African Journals Online (AJOL)

    maturité, les traitements à l'urine pour 90, 120 et 150 kg N/ha respectivement indiquent une production de biomasse sèche de 12 ... Mots clés : Toilette écologique, urine hygiénisée, fertilisation, biomasse sèche, rendement grain, maïs. Fertilization of the corn ...... and spring barley in organic farming. Skara series B Crops ...

  18. Séroprévalence du virus de l'immunodéficience humaine, des virus ...

    African Journals Online (AJOL)

    SARAH

    28 févr. 2017 ... 3 Centre de Traitement Ambulatoire VIH/SIDA de Koula-Moutou, Koula-Moutou, Gabon ... déterminée par les tests rapides d'orientation diagnostic. Sur un total de 614 .... recherchés par le test non treponémique RPR (Rapide.

  19. L'ordinateur a visage humain (The Computer in Human Guise).

    Science.gov (United States)

    Otman, Gabriel

    1986-01-01

    Discusses the tendency of humans to describe parts and functions of a computer with terminology that refers to human characteristics; for example, parts of the body (electronic brain), intellectual activities (optical memory), and physical activities (command). Computers are also described through metaphors, connotations, allusions, and analogies…

  20. La mondialisation au banc des accusés: La condition humaine et la ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    J'ai eu la chance de voir mes idéaux professionnels et personnels suivre le même trajet. ... State University et la Youngstown State University, qui ont mis à ma disposition ... du CRDI, spécialement Bill Carman et Kumarian Press, tout particulièrement ...... Rawls, J., 1971, A theory of justice, Cambridge ( États-Unis ), Harvard ...

  1. Changements dans l'utilisation des terres et la santé humaine dans ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Dans l'est de l'Himalaya, l'utilisation des terres change en raison de la croissance ... Au Népal, les chercheurs enquêteront sur les causes de la malnutrition qui ... de l'établissement sur l'environnement (y compris la pollution) et invitera les ... Land Use Transition and Human Health in the context of Climate Change in the ...

  2. Le facteur humain et la sûreté de fonctionnement dans le ...

    African Journals Online (AJOL)

    Elle permettait d'optimiser le couple « performance-coût », en identifiant, évaluant et maîtrisant les pannes qu'il ... gestion des risques deviennent une ...... Etre en mesure de détecter les .... variés qui s'y déroulent, avoir le contrôle du.

  3. Approche systémique du processus de gestion des ressources humaines

    Directory of Open Access Journals (Sweden)

    Cesar Nieto Licht

    2013-08-01

    Full Text Available Rev.esc.adm.neg Mediante la comprensión de la teoría sistémica, su evolución y sus aplicaciones se plantearán los retos generales y específicos que afrontan actualmente los profesionales de Gestión Humana para diseñar y desarrollar sus procesos de manera sistémica, generando valor para la organización y aportando significativamente al desarrollo de la empresa y de los seres humanos que la conforman. Por lo tanto, este artículo presentará una exploración por las herramientas de la era de la máquina, su impacto en el proceso de pensamiento de los administradores, el significado de la era sistémica y sus aplicaciones e incidencias en el diseño de los procesos. Finalmente, se presentarán los retos específicos que los profesionales de Gestión Humana deben afrontar para intervenir sus procesos bajo un enfoque sistémico.

  4. Science, technologie, nature et humain ont rendez-vous au jardin

    Directory of Open Access Journals (Sweden)

    Dargent Olivier

    2015-01-01

    Full Text Available Un jardin expérimental est un espace riche en activités pédagogiques pour les élèves. Il recueille, à priori, naturellement, l’adhésion de chacun, élèves, équipe éducative et parents. Il est enfin une occasion d’avoir une approche différente de celle de la classe, les élèves étant confrontés au vivant dans son environnement. Lors de ces activités proposées dans ce contexte, leur rapport au vivant est directement confronté à la réalité. Quels sont les enjeux didactiques d’une pédagogie axée autour d’activités au jardin expérimental ? A partir de deux activités ; un « totem à insectes » et un « nichoir connecté ». La confrontation du vivant et de leur représentation est analysée.

  5. A reconstituted light-harvesting complex from the green sulfur bacterium Chlorobium tepidum containing CsmA and bacteriochlorophyll a

    DEFF Research Database (Denmark)

    Pedersen, Marie Ø; Pham, Lan; Steensgaard, Dorte B

    2008-01-01

    chlorosomes were lyophilized and extracted with chloroform/methanol (1:1, v/v). The extract was further purified using gel filtration and reverse-phase HPLC and the purity of the preparation confirmed by SDS-PAGE. Mass spectrometric analysis showed an m/z of 6154.8, in agreement with the calculated mass...

  6. Apollo-Soyuz test project. Operations handbook command/service/docking modules (CSM 119/DM 1): Operational procedures reference issue

    Science.gov (United States)

    1974-01-01

    Operational and configuration checks for the Apollo-Soyuz Test Project are presented. The checks include: backup crew prelaunch, prime crew prelaunch, boost and insertion, G and C reference data, G and N reference modes, rendezvous, navigation, Apollo-Soyuz operations, abort procedures, and emergency procedures.

  7. Coupled deformation and fluid-flow behavior of a natural fracture in the CSM in situ test block

    International Nuclear Information System (INIS)

    Gertsch, L.S.

    1989-01-01

    The primary goal was the evaluation of an in situ block test as a data source for modeling the coupled flow and mechanical behavior of natural rock fractures. The experiments were conducted with the Colorado School of Mines in situ test block, an 8 m 3 (280 ft 3 ) gneiss cube which has been the focus of several previous studies. A single continuous fracture within the block was surrounded with instruments to measure stresses, deformations, and gas conductivity. The setup was subjected to combinations of normal and shear stress by pressurizing the block sides differentially with hydraulic flatjacks. The induced fracture deformation, as measured by two separate sensor systems, did not correlate closely with the fracture conductivity changes or with each other. The test fracture is more complicated physically than two parallel rock faces. Many joints which were not detected by mapping intersect the test fracture and strongly influence its behavior. These invisible joints create sub-blocks which react complexly to changes in applied load. The flow tests reflected the aggregate sub-block dislocations in the flow path. The deformation readings, however, were the movements of discrete points sparsely located among the sub-blocks. High-confidence extrapolation of block test results to large volumes, such as required for nuclear waste repository design, is not feasible currently. Present instrumentation does not sample rock mass behavior in situ at the proper scales. More basically, however, a fundamental gap exists between the nature of jointed rock and our conception of it. Therefore, the near-field rock mass must be discounted as an easily controllable barrier to groundwater flow, until radically different approaches to rock mass testing and modeling are developed

  8. The distribution of a pure beta-emitter in the human body. Problems and preliminary results of Bremsstrahlung measurements in vivo; La repartition d'un emetteur beta pur dans l'organisme humain. Problemes poses par les mesures in vivo du rayonnement de freinage et premiers resultats obtenus; Raspredelenie chistogo beta-izluchatel ya v chelovecheskom organizme Problemy i predvaritel'ny e rezul'taty izmerenij tormoznogo izlucheniya v zhivom organizme; Distribucion de un emisor beta puro en el organisme humano. Problemas planteados por las mediciones in vivo de la radiacion de frenado y resultados preliminares obtenidos

    Energy Technology Data Exchange (ETDEWEB)

    Mehl, H G [Strahleninstitut der Freien Universitaet, Berlin (Germany)

    1959-07-01

    In vivo measurements of the distribution of a pure beta-emitter in the human body were previously limited to the localization of radioactivity in superficial tissues only, owing to the short range of the beta particles in tissue. During die last few years the analysis has been extended by means of bremsstrahlung measurements to activities in deep-lying tissues. The present paper deals with problems and results of this new technique. On the basis of an analysis of the physical nature of this radiation, the construction of suitable detection devices is discussed. The theoretical and experimental work done in this field are reviewed. In order to make a proper interpretation of the results obtained, it is necessary to analyse the various factors involved. These include particularly the area ''seen'' by the detector, the specific activity of the tissue seen and the depth of the organ under consideration, A discussion of the results of such measurements already published will permit an assessment of the present situation and of the nature of the problems still unsolved. (author) [French] Les mesures in vivo de la repartition d'un emetteur beta pur dans l'organisme humain se limitaient autrefois a la localisation de la radioactivite dans les tissus superficiels, en raison du faible parcours des particules beta dans l'organisme. Depuis quelques armees, il est possible, grace aux mesures du rayonnement de freinage, d'etudier egalement la radioactivite dans les tissus profonds. L'auteur examine les problemes poses par cette technique nouvelle et les resultats qu'elle permet d'obtenir. Il indique des procedes de detection fondes sur les caracteristiques physiques de ce rayonnement. Il decrit les recherches theoriques et experimentales qui ont ete faites dans ce domaine. Pour interpreter correctement les resultats obtenus, il importe d'analyser les differents facteurs qui interviennent, notamment la surface par le detecteur, l'activite specifique du tissu observe et

  9. Human reliability and human factors in complex organizations: epistemological and critical analysis - practical avenues to action; Fiabilite humaine et facteurs humains dans les organisations complexes: analyse epistemologique et critique voies pratiques pour l`action

    Energy Technology Data Exchange (ETDEWEB)

    Llory, A

    1991-08-01

    This article starts out with comment on the existence of persistent problems inherent to probabilistic safety assessments (PSA). It first surveys existing American documents on the subject which make a certain number of criticisms on human reliability analyses, e.g. limitations due to the scant quantities of data available, lack of a basic theoretical model, non-reproducibility of analyses, etc. The article therefore examines and criticizes the epistemological bases of these analyses. One of the fundamental points stressed is that human reliability analyses do not take account of all the special features of the work situation which result in human error (so as to draw up statistical data from a sufficiently representative number of cases), and consequently lose all notion of the `relationships` between human errors and the different aspects of the working environment. The other key points of criticism concern the collective nature of work which is not taken into account, and the frequent confusion between what operatives actually do and their formally prescribed job-tasks. The article proposes aspects to be given thought in order to overcome these difficulties, e.g. quantitative assessment of the social environment within a company, non-linear model for assessment of the accident rate, analysis of stress levels in staff on off-shore platforms. The method approaches used in these three studies are of the same type, and could be transposed to human-reliability problems. The article then goes into greater depth on thinking aimed at developing a `positive` view of the human factor (and not just a `negative` one, i.e. centred on human errors and organizational malfunctions), applying investigation methods developed in the occupational human sciences (occupational psychodynamics, ergonomics, occupational sociology). The importance of operatives working as actors of a team is stressed.

  10. Improving Human Effectiveness Through Embedded Virtual Simulation (Amelioration de l’efficacite humaine grace a la simulation virtuelle integree)

    Science.gov (United States)

    2014-01-01

    blocks by the US Army Research, Development and Engineering Command (RDECOM) as a development that enables armoured crew the ability to observe...behavioral and physiological sensors, past performance and other competency measures, demographic information, human observations and/or self...tutoring systems may include demographics , input from behavioral and physiological sensors, self-reported and observed data and/or historical

  11. The Human Effects of Non-Lethal Technologies (Impacts humain des technologies non letales) (CD-ROM)

    National Research Council Canada - National Science Library

    2006-01-01

    .... In response to NATO RTO tasking, based on the recommendations of the 2000 Defence Capabilities Initiative, to support preparations for a NATO NLW capability, the Human Factors and Medicine Panel (HFM...

  12. Le traitement de l’insuffisance rénale chronique par dialyse : une aventure technologique et humaine

    OpenAIRE

    Louis , Marc

    2016-01-01

    Non disponible / Not available; L'objectif de ce travail est de comprendre le cheminement historique qui a mené à la dialyse contemporaine.Le rein a été un organe longtemps méconnu. Les descriptions macroscopiques à partir de la renaissance, puis microscopiques à partir du XVIIème siècle ont permis aux scientifiques de percer progressivement les secrets de la physiologie rénale. Alors que les mécanismes régissant la fonction rénale n'étaient pas totalement élucidés, Thomas Graham inventa dans...

  13. Les Comités mixtes de sécurité humaine (CMSH) au Burundi : un ...

    African Journals Online (AJOL)

    As part of a socio-criminological approach, we illustrate the normative context of this security regime, highlight its political appropriation and propose ways to improve it based on the challenges identified. Keywords: Burundi, National Police, Joint Human Security Committees, Security Regime, Socio-criminological Approach ...

  14. Operator Functional State Assessment (L’evaluation de l’aptitude operationnelle de l’operateur humain)

    Science.gov (United States)

    2004-02-01

    sensitive and are affected at lower altitudes. Psychomotor tasks are further compromised by the impairment of muscular coordination produced by...increased weight of blood in the lower body will result in distension of the venous capacitance vessels and a decreased return of blood to the heart. As a...repeated muscular straining against the Gz forces) and thermal and dehydration stress due to the additional layers of protective garments. Gz exposure and

  15. Enquête entomologique dans le foyer historique de trypanosomose humaine africaine de Bendjé (Gabon

    Directory of Open Access Journals (Sweden)

    Kohagne Tongué L.

    2011-11-01

    Full Text Available La situation de la maladie du sommeil est très peu connue au Gabon. De nombreux foyers historiques n’ont pas été prospectés depuis plus de 15 ans. Le foyer historique de Bendjé fournit régulièrement quelques cas, dépistés passivement, qui concernent le plus souvent des pêcheurs dont il est a priori difficile de déterminer le lieu probable de contamination du fait de leur grande mobilité au cours de leurs activités. La présence des hommes infectés dans ce foyer historique pourrait favoriser son réveil s’il existe un contact étroit entre les différents éléments potentiellement présents du cycle épidémiologique (homme, vecteur, trypanosome. Afin de vérifier l’existence éventuelle d’un risque trypanosomien dans ce foyer, nous y avons mené une enquête entomologique. Des pièges ont été posés dans des biotopes fréquentés par l’homme et laissés en place pendant quatre jours. Trois espèces de glossines (Glossina palpalis palpalis, G. pallicera newsteadi et G. caliginea ont été capturées et deux espèces de trypanosomes (Trypanosoma vivax et T. brucei s.l. identifiées par PCR. Ces résultats suggèrent l’existence d’un cycle de transmission animal. Le contact entre les hommes et les glossines est particulièrement étroit dans tous les types de site prospectés, à l’exception de la mangrove.

  16. Télétravail : Les enjeux de la déspatialisation pour le management humain

    Directory of Open Access Journals (Sweden)

    Laurent Taskin

    2006-07-01

    Full Text Available En rompant avec une certaine unité de temps, de lieu et d’action, le télétravail bouleverse l’organisation du travail et l’exercice traditionnel des pratiques de management. La déspatialisation, qui renvoie à la distance physique et psychosociologique induite par la pratique du télétravail, constitue l’enjeu central de cette re-régulation nécessaire qui altère fondamentalement la structure du travail et de la supervision. Au cœur de celle-ci, la question du contrôle semble être la dimension la plus critique pour le management. Cette contribution montre comment le contrôle et l’autonomie, qui sont des forces complémentaires en tension au sein des organisations, sont appelés à être reconfigurés dans le cadre du télétravail ; et comment cette nécessaire re-régulation affecte directement la relation managériale, la socialisation organisationnelle et la gestion des carrières.Telework transforms the traditional office space, its management and routines, by exploding the spatio-temporal framework of work. Despatialization, which refers to the geographical and psycho sociological distance consecutive to telework practice, constitutes the major stake of the necessary re-regulation of work in terms of supervision and structure. In tfis context, the control issue represents the most critical dimension for management. This contribution shows how control and autonomy, which are complementary but tightened forces operating inside organizations, have to be re-cast when developing telework; and how this re-regulation affects directly the managerial relationship, organizational socialization, and career management.

  17. INCOMMANDS TDP: Human Factors Design and Evaluation Guide (PDT INCOMMANDS: Guide de Conception et d’Evaluation des Facteurs Humains)

    Science.gov (United States)

    2009-12-01

    Human-Computer Interface (AHCI) Style Guide, (Report No. 64201-97U/61223), Veridian, Veda Operations, Dayton Ohio. [13] CSFAB Osga, G. and Kellmeyer, D...Interface (AHCI) Style Guide, (Report No. 64201-97U/61223), Veridian, Veda Operations, Dayton Ohio. [14] Osga, G. and Kellmeyer, D. (2000), Combat

  18. Greenhouse effect and climate: the man impact; Effet de serre et climat: l'influence humaine

    Energy Technology Data Exchange (ETDEWEB)

    Fouquart, Y. [Universite des Sciences et technologies de Lille, Lab. d' Optique Atmospherique, 59 - Villeneuve d' Ascq (France)

    2001-04-01

    In this article the author describes the different mechanisms that are involved in the setting of the earth climate. The main natural causes of climate variations are reviewed: - the variations in the orbit of the earth around the sun, - the interactions between oceans and the atmosphere, and - the volcanic eruptions. It is shown that mean earth temperature has continuously increased for the last 150 years. The impact of man activities on climate changes will not be scientifically proved before at least 10 years, but computerized simulations based on models taking into account industrial emissions of aerosols agree with temperatures values recorded since the beginning of the industrial era. This article supports the current opinion that climate is changing beyond natural variations. (A.C.)

  19. Operator Functional State Assessment (l'evaluation de i'aptitude operationnelle de i'operateur humain)

    National Research Council Canada - National Science Library

    Carter, R; Cheuvront, S. N; Sawka, M. N

    2004-01-01

    ...). Perhaps the best example involves heat stress and physical activity. For sedentary persons in temperate conditions, water requirements usually range from 2 to 4 L per day and the kidneys primarily regulate fluid balance...

  20. La catastrophe nucléaire de Tchernobyl entre erreurs humaines et défauts techniques

    CERN Document Server

    Perrineau, Aude

    2015-01-01

    Découvrez enfin tout ce qu'il faut savoir sur la catastrophe nucléaire de Tchernobyl en moins d'une heure ! Le 26 avril 1986 à 1 h 23, une catastrophe d'un nouveau genre ébranle le monde : un réacteur de la centrale nucléaire de Tchernobyl explose. Alors que les autorités soviétiques camouflent l'accident, puis en minimisent l'importance, un nuage radioactif se forme et se propage sur toute l'Europe…Ce livre vous permettra d'en savoir plus sur : Le contexte de l'époque Les acteurs majeurs qui ont participé à l'événement La catastrophe nucléaire de Tchernobyl Les répercussions du drameLe mot

  1. Diversité floristique et infiltration humaine de la forêt classée de la ...

    African Journals Online (AJOL)

    SARAH

    30 juin 2017 ... For hundred seventy for (474) species were recorded in this forest during ..... espèces en danger (EN), espèces qui courent des risques mineurs ''LR'' de ... AA = plantes rares, devenues rares et en voie d'extinction ou ne se ...

  2. Simulation de mouvement humain sur postes de travail pour le diagnostic et l'aide à la conception

    OpenAIRE

    Hue , Valentin

    2008-01-01

    The works presented in this memory concern the automatic generation of postures and human movements on industrial workstation. The aim is to animate in a realistic way a numerical mannequin in order to simulate an operator in the execution of his task. This animation must make it possible to contribute to the analysis of the biomechanical factors which can engender musculo-skeletal disorders. At rst, choices of modelling are proposed according to this speci c context. The model selected is ba...

  3. Les Comités mixtes de sécurité humaine (CMSH) au Burundi : un ...

    African Journals Online (AJOL)

    the political regime in place to find an explanatory framework for its abuses. As part of ... Pour rappel, le Burundi vit, depuis son indépendance en juillet 1962, des ... La mise en place des comités mixtes de sécurité en tant que nouveau régime.

  4. A Designer’s Guide to Human Performance Modelling (La Modelisation des Performances Humaines: Manuel du Concepteur).

    Science.gov (United States)

    1998-12-01

    into the Systems Engineering Process 17 5.3 Validation of HPMs 18 5.4 Commercialisation of human performance modelling software 18 5.5 Model Tool...budget) so that inappropriate models/tools are not offered. The WG agreed that another form of ’ educating ’ designers in the use of models was by means... Commercialisation of human performance modelling Software 5.2.8 Include human performance in system test. g More and more, customer’s are mandating the provision

  5. Réseau sur le développement humain et la capacité - phase III ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Le CRDI lance un nouveau projet dans la région de l'ANASE. L'honorable Chrystia Freeland, ministre du Commerce international, a annoncé le lancement d'un nouveau projet financé par le Centre de recherches pour le développement international (CRDI). Voir davantageLe CRDI lance un nouveau projet dans la région ...

  6. Portable energy: autonomy and integration in the human environment; Energie portable: autonomie et integration dans l'environnement humain

    Energy Technology Data Exchange (ETDEWEB)

    Multon, F; Delamarche, P [Rennes-2 Universite, Lab. de Physiologie et de Biomecanique de l& #x27; Exercice Mulsculaire, UMR. APS, 35 (France); Lucchese, P [CEA Fontenay-aux-Roses, Dir. de la Recherche Technologique, Hydrogene et Pile a Combustible, 92 (France); and others

    2002-07-01

    This colloquium was motivated by the possibility to recover in our environment the energy produced by our movements, but also the heat emitted and the radiations received by the human body in order to supply the energy needs of portable electronic devices (telephones, micro-computers, watches, prostheses etc..). It tries to answer the different problems raised by the implementation of portable energy sources: the energy resources in the human environment, the physical and technological processes of energy production and storage, the electronic energy conversion and remote transmission means, the intelligent energy management, and the existing and potential applications of these processes. This document brings together 16 communications presented by searchers from various domains (biology, medicine, electrochemistry, computer science, mechanics, thermodynamics, electronics etc..) on the following topics: energy in the human body, possibilities of miniaturization of fuel cells, thermo-mechanical micro-generators, thermoelectric generation, solar cells and autonomy, micro-chargeable batteries, double-layer super-capacitors (principles and electrical behaviour), renewable energies in watches, electro-mechanical devices for the exploitation of human movements energy, trans-dermal power supply, new mechanical-aided systems for blood circulation, problems and their solutions related to portable telephones, low voltage and high efficiency power electronic systems for portable applications, remote energy transmission, intelligent energy management (equipments and softwares), electromagnetic environments and health. (J.S.)

  7. Dosage of strontium 90 in human bone ashes; Dosage du strontium 90 sans les cendres d'os humain

    Energy Technology Data Exchange (ETDEWEB)

    Patti, F; Jeanmaire, L [Commissariat a l' Energie Atomique, Fontenay-aux-Roses (France). Centre d' Etudes Nucleaires

    1964-07-01

    The determination of {sup 90}Sr in bones by dosage of its daughter product {sup 90}Y is a 4-step process: 1) elimination of the phosphate ions by precipitation of the Ca and Sr as oxalate in the presence of acid; 2) reduction in the calcium concentration to a suitable level by the addition of a known volume of nitric acid (a single precipitation is sufficient), the precipitation yield of the strontium nitrate is checked by the measurement of the amount of {sup 85}Sr added as tracer; 3) purification by a yttrium hydroxide precipitation; 4) extraction at equilibrium of the {sup 90}Y which is counted to give the concentration. By using 50 gm of ash it is possible to detect about 0.1 pCi of {sup 90}Sr per gram of calcium. The advantages of this technique: -) treatment of a large quantity of bone ash -) the use of a small volume of nitric acid (less than 2 ml/g of ash, and -) the various operations present no difficulty. (authors) [French] Determination du Sr dans les os par dosage de son produit de filiation {sup 90}Y. Principe du dosage: 1 - Eliminer les ions phosphates par precipitation du calcium et du strontium sous forme d'oxalate en milieu acide. 2 - Reduire la concentration en calcium a un niveau convenable par addition d'un volume determine d'acide nitrique (une seule precipitation est necessaire). Le rendement de precipitation du nitrate de strontium est controle par la mesure de {sup 85}Sr ajoute comme traceur. 3 - Purifier par une precipitation d'hydroxyde d'yttrium. 4 - Extraire a l'equilibre l'{sup 90}Y qui eat compte pour determiner le {sup 90}Sr. En traitant 50 g de cendre, il est possible de deceler de l'ordre de 0,1 pCi de {sup 90}Sr par gramme de calcium. Les 3 avantages de cette technique: 1 - traitement d'une quantite importante de cendres d'os, 2 - emploi d'un faible volume d'acide nitrique (moins de 2 ml/g de cendres), et 3 - les diverses operations ne presentent aucune difficulte.

  8. Les origines de l'art et la formation de l'esprit humain : Entretien avec Emmanuel ANATI

    OpenAIRE

    ANATI , Emmanuel; STOCKINGER , Peter; De Pablo , Elisabeth; Legrand , Valérie; Bonnemazou , Camille

    2003-01-01

    Emmanuel ANATI a étudié à l'Université hébraïque de Jérusalem, à Harvard, à Cambridge, dans l'état du Massachusetts et à la Sorbonne. il est le fondateur et le directeur du Centro Camuno di Studi Preistorici à Capo di Ponte dans le Valcamonica en Italie et professeur retraité de paléo-ethnologie à l'Université de Lecce. Il est aussi le fondateur du Comité International pour l'art rupestre (ICOMOS).Ses principaux intérêts scientifiques sont l'art et la religion des cultures préhistoriques et t...

  9. La formation du capital humain en Europe au niveau régional - implications sur la croissance économique

    OpenAIRE

    Hippe , Ralph

    2013-01-01

    This thesis highlights the formation of human capital in the European regions and its implications for economic growth. It is characterised by its combined regional, long-term and European approach. To this end, I refer to Unified Growth Theory and New Economic Geography as the most important recent theoretical contributions and construct an unparalleled new and large database on regional human capital and other economic factors from numerous diverse sources. For the empirical analysis, spati...

  10. Changement technologique, croissance et inégalité : l'importance du capital humain et des institutions

    OpenAIRE

    Esso, Loesse Jacques

    2006-01-01

    The aim of this Ph.D. thesis is to show that technological change is a determinant of long run growth and the dynamics of inter-country inequalities. Specifically, we try to show that technological change represents a channel through which the effects of education, capital market imperfections and institutions affect economic growth and long run convergence. We show that the distribution of human capital determines occupational choices of agents whose source of heterogeneity is the level of h...

  11. Bourses Écosystèmes et santé humaine pour les cycles supérieurs ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Le montant de chaque bourse sera de 15 000 CAD pour la recherche sur le terrain et jusqu'à 4 000 CAD pour participer à une conférence afin de diffuser les résultats des recherches ou pour retourner sur le terrain afin de présenter ses constatations aux parties prenantes locales. En outre, les boursiers participeront à une ...

  12. Les Comités mixtes de sécurité humaine (CMSH) au Burundi : un ...

    African Journals Online (AJOL)

    La police nationale du Burundi mise en place en 2004 a opté pour une philosophie de .... L'approche consociative privilégiée dans la mise en œuvre de l'accord et surtout dans la mise en ..... des enchevêtrements dans les prises de décision.

  13. Pourquoi entrer a l'Universite? L'Exemple d'une universite de lettres et sciences humaines

    Science.gov (United States)

    Canals, Valérie; Diebolt, Claude

    2001-11-01

    The large number of secondary school graduates entering higher education is transforming the nature of universities, particularly in literature and the humanities, by changing the relative numbers of students enrolled in different academic years. At the same time this influx is accompanied by a significant failure rate in the first academic year, calling into question the efficacy of the university system. A national issue with local repercussions, the struggle against failure in the first year is leading to much heart-searching among the universities, whose staff are trying hard to understand why certain students abandon their studies. The enquiry described in this article reveals the co-existence of two student populations: those who enter university as an active choice and those who do so by default. In the case of the first group, entry to university represents an investment for the future which must be carefully managed. In the second case it is a matter of going into higher education as a faute de mieux solution in an economic context in which work is scarce.

  14. Les répercussions de la santé animale sur la santé humaine | CRDI ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    9 déc. 2010 ... De manière générale, le travail du Canadien Craig Stephen et du Sri Lankais Sam Daniel consiste essentiellement à mobiliser les ressources sur place ... Selon le Dr Stephen, vétérinaire à l'Université de Calgary, dans la foulée des éclosions de grippe aviaire, le milieu médical a compris que si l'on voulait ...

  15. Rites et Condition Humaine : Leçon sur les leçons des pères

    African Journals Online (AJOL)

    death, human beings seek to establish peace, both mental somatic and social, that they need to survive. in the context of African communities, we argue that rituals are not .... libérer » de son devoir social de porter et de faire le deuil de son conjoint. Ainsi, elle donne droit à la femme endeuillée de procéder à un bain lustral ...

  16. Une architecture de sélection de l'action pour des humains virtuels autonomes dans des mondes persistants

    OpenAIRE

    De Sevin , Etienne

    2006-01-01

    Nowadays, virtual humans such as non-player characters in computer games need to have a strong autonomy in order to live their own life in persistent virtual worlds. When designing autonomous virtual humans, the action selection problem needs to be considered, as it is responsible for decision making at each moment in time. Indeed action selection architectures for autonomous virtual humans need to be reactive, proactive, motivational, and emotional to obtain a high degree of autonomy and ind...

  17. The Mobile Laboratory for Personnel Spectrometry of the SCPRI; Le Laboratoire Mobile de Spectrometrie Humaine du SCPRI

    Energy Technology Data Exchange (ETDEWEB)

    Pellerin, P.; Moroni, J. P. [Service Central de Protection Contre les Rayonnements Ionisants, Ministere des Affaires Sociales, Le Vesinet (France)

    1969-10-15

    In the event of a nuclear accident involving the risk of activation or radioactive contamination of a widespread population, the Service central de protection contre les rayonnements ionisants (Central Service for Protection against Ionizing Radiations) would immediately be able to send out its new mobile laboratory, which from 1969 onwards will be in routine use for personnel monitoring. The laboratory in question is a 33-ton trailer-type vehicle carrying four fully-shielded whole-body counters, each fitted with two 8 x 4-inch Nal(Tl) crystals, the pulses being analysed by two 400-channel spectrometers. The layouts of the unit and the electronic safety devices installed make it possible to carry out monitoring very rapidly, using only two trained technicians. Under conditions such as may arise at the time of a nuclear accident, as many as several hundred persons a day could be monitored. (author) [French] En cas d'accident nucleaire pouvant impliquer un risque d'activation ou de contamination radioactive pour une population etendue, le Service central de protection contre les rayonnements ionisants pourrait sans difficulte mettre en oeuvre le nouveau laboratoire mobile qu'il va utiliser en routine des 1969 pour le controle de la contamination des travailleurs. Il s'agit d'un vehicule semi-remorque de 33 tonnes comportant quatre anthropogamma- metres a blindage complet, equipes chacun de deux cristaux Nal(Tl) de 8 x 4 pouces, exploites par deux spectrometres a 400 canaux. La disposition de l'ensemble et les dispositifs de securite electroniques permettent un debit tres rapide avec seulement deux techniciens entraines. Dans les conditions qui peuvent se presenter lors d'un accident nucleaire, ce debit pourrait atteindre plusieurs centaines de personnes controlees par jour. (author)

  18. A New Harness For Use with Exercise Countermeasures-Validation of Improved Comfort and Loading with the Center for Space Medicine (CSM) Harness

    Data.gov (United States)

    National Aeronautics and Space Administration — The on-orbit treadmill harness Station Development Test Objective (SDTO) evaluation ran from Increment 21 through 25 aboard the International Space Station...

  19. mxCSM: A 100-slit, 6-Wavelength Wide-Field Coronal Spectropolarimeter for the Study of the Dynamics and the Magnetic Fields of the Solar Corona

    Energy Technology Data Exchange (ETDEWEB)

    Lin, Haosheng, E-mail: lin@ifa.hawaii.edu [Institute for Astronomy, University of Hawaii, Pukalani, HI (United States)

    2016-03-30

    Tremendous progress has been made in the field of observational coronal magnetometry in the first decade of the Twenty-First century. With the successful construction of the Coronal Multichannel Magnetometer (CoMP) instrument, observations of the linear polarization of the coronal emission lines (CELs), which carry information about the azimuthal direction of the coronal magnetic fields, are now routinely available. However, reliable and regular measurements of the circular polarization signals of the CELs remain illusive. The CEL circular polarization signals allow us to infer the magnetic field strength in the corona, and is critically important for our understanding of the solar corona. Current telescopes and instrument can only measure the coronal magnetic field strength over a small field of view. Furthermore, the observations require very long integration time that preclude the study of dynamic events even when only a small field of view is required. This paper describes a new instrument concept that employs large-scale multiplexing technology to enhance the efficiency of current coronal spectropolarimeter by more than two orders of magnitude. This will allow for the instrument to increase the integration time at each spatial location by the same factor, while also achieving a large field of view coverage. We will present the conceptual design of a 100-slit coronal spectropolarimeter that can observe six CELs simultaneously. Instruments based on this concept will allow us to study the evolution of the coronal magnetic field even with coronagraphs with modest aperture.

  20. Comparative study of mean value of 111 and mean value of 100 crystals and capacitance measurements on Si strip detectors in CSM

    International Nuclear Information System (INIS)

    Albergo, S.

    1999-01-01

    For the construction of the silicon microstrip detectors for the tracker of CMS experiment, two different substrate choices were investigated. A high-resistivity substrate with mean value of 111 crystal orientation and a low-resistivity one with mean value of 100 Dirac ket vector crystal orientation. The interstrip and backplane capacitances were measured before and after the exposure to radiation in a range of strip pitches from 60 μm to 240 μm and for values of the width-pitch ratio between 0.1 and 0.5

  1. Improved read disturb and write error rates in voltage-control spintronics memory (VoCSM) by controlling energy barrier height

    Science.gov (United States)

    Inokuchi, T.; Yoda, H.; Kato, Y.; Shimizu, M.; Shirotori, S.; Shimomura, N.; Koi, K.; Kamiguchi, Y.; Sugiyama, H.; Oikawa, S.; Ikegami, K.; Ishikawa, M.; Altansargai, B.; Tiwari, A.; Ohsawa, Y.; Saito, Y.; Kurobe, A.

    2017-06-01

    A hybrid writing scheme that combines the spin Hall effect and voltage-controlled magnetic-anisotropy effect is investigated in Ta/CoFeB/MgO/CoFeB/Ru/CoFe/IrMn junctions. The write current and control voltage are applied to Ta and CoFeB/MgO/CoFeB junctions, respectively. The critical current density required for switching the magnetization in CoFeB was modulated 3.6-fold by changing the control voltage from -1.0 V to +1.0 V. This modulation of the write current density is explained by the change in the surface anisotropy of the free layer from 1.7 mJ/m2 to 1.6 mJ/m2, which is caused by the electric field applied to the junction. The read disturb rate and write error rate, which are important performance parameters for memory applications, are drastically improved, and no error was detected in 5 × 108 cycles by controlling read and write sequences.

  2. mxCSM: A 100-slit, 6-wavelength wide-field coronal spectropolarimeter for the study of the dynamics and the magnetic fields of the solar corona

    Directory of Open Access Journals (Sweden)

    Haosheng eLin

    2016-03-01

    Full Text Available remendous progress has been made in the field of observational coronal magnetometry in the first decade of the 21st century. With the successful construction of the Coronal Multichannel Magnetometer (CoMP instrument, observations of the linear polarization of the coronal emission lines (CELs, which carry information about the azimuthal direction of the coronal magnetic fields, are now routinely available. However, reliable and regular measurements of the circular polarization signals of the CELs remain illusive. The CEL circular polarization signals allow us to infer the magnetic field strength in the corona, and is critically important {bf of} our understanding of the solar corona. Current telescopes and instrument can only measure the coronal magnetic field strength over a small field of view. Furthermore, the observations require very long integration time that preclude the study of dynamic events even when only a small field of view is required. This paper describes a new instrument concept that employees large-scale multiplexing technology to enhance the efficiency of current coronal spectropolarimeter by more than two orders of magnitude. This will allow for the instrument to increase of the integration time at each spatial location by the same factor, while also achieving a large field of view coverage. We will present the conceptual design of a 100-slit coronal spectropolarimeter that can observe six coronal emission lines simultaneously. Instruments based on this concept will allow us to study the evolution of the coronal magnetic field even with coronagraphs with modest aperture.

  3. Guidance system operations plan for manned CSM earth orbital and lunar missions using program COLOSSUS 3. Section 7: Erasable memory programs

    Science.gov (United States)

    Hamilton, M. H.

    1972-01-01

    Erasable-memory programs designed for guidance computers used in command and lunar modules are presented. The purpose, functional description, assumptions, restrictions, and imitations are given for each program.

  4. Bromine-82 Labelling of Human Serum Albumin, Insulin and Fibrinogen by Electrochemical Means; Marquage au Brome-82 de la Serum-Albumine Humaine, de l'Insuline et du Fibrinogene par Voie Electrochimique; ЭЛЕКТРОХИМИЧЕСКОЕ МЕЧЕНИЕ ИЗОТОПОМ БРОМА-82 АЛЬБУМИНА ЧЕЛОВЕЧЕСКОЙ СЫВОРОТКИ, ФИБРИНОГЕНА И ИНСУЛИНА; Marcacion de Sueroalbumina Humana, de Insulina y de Fibrinogeno con Bromo-82 por Via Electroquimica

    Energy Technology Data Exchange (ETDEWEB)

    Rosa, U.; Scassellati, G. A.; Pennisi, G. [Centre de Recherches Nucleaires Sorin, Saluggia (Italy)

    1963-03-15

    The authors describe results obtained with a method using bromine-82 to label human serum albumin, fibrinogen and insulin, three organic substances of special importance in diagnostics and biological research. The method involves electrolytic bromination in an aqueous solution; this is performed in an electrolysis cell, whose anodic zone containing the substance to be labelled is partitioned from the cathodic zone by a dialysis membrane. For each of the three substances mentioned, the degree of bromination produced by a direct current (200, 200, 300 x 10{sup -6} A) was studied as a function of anode potential in 10{sup -3} and 10{sup -4} M solutions of NH{sub 4}Br, the amount of bromine-labelled substance formed being checked by radio electrophoresis for various anodic potential values differing from each other by 50 mV. By immuno- electrophoresis it was ascertained that denaturation of albumin and fibrinogen only starts at anodic potential values for which the degree of labelling is already very high as compared with that yielded by chemical methods of labelling. The method here described has the advantage of rapid execution and is well suited to remote handling in a shielded zone. (author) [French] Les auteurs exposent les resultats obtenus par une methode de marquage au brome- 82 de trois substances organiques particulierement interessantes pour l'usage diagnostique et pour la recherche biologique: albumine de serum humain, fibrinogene et insuline. La methode comporte une bromuration electrolytique en solution aqueuse qu'on execute dans une cellule d'electrolyse dont la zone anodique contient la substance a marquer et est cloisonnee par rapport a la zone cathodique par une membrane a dialyse. Pour chacune des trois substances susmentionnees, on a etudie le rendement de bromuration a courant constant (100, 200, 300 * 10{sup -6} A) en fonction du potentiel anodique, en solution 10{sup -3} et 10{sup -4} M de NH{sub 4}Br, en controlant par radioelectrophorese la

  5. Une tumeur exceptionnelle du doigt: la tumeur fibreuse solitaire

    Directory of Open Access Journals (Sweden)

    Taoufiq Harmouch

    2011-12-01

    Full Text Available La tumeur Fibreuse solitaire (TFS est une proliferation fusocellulaire rare, souvent de localisation intrathoracique. Nous rapportons le cas d�une localisation exceptionnelle au niveau du 3eme doigt de la main droite. En l�absence de marqueur specifique l�interpretation de l�immunomarquage depend du contexte histomorphologique. La similitude avec les differents neoplasmes a cellules fusiformes des tissus mous rend le diagnostic de ces tumeurs mesenchymateuses difficile et tardif. Dans 20a 30 % des cas le comportement de la TFS est celui d�une tumeur maligne localement agressive et recidivante, avec des metastases rares et tardives. Ce comportement impose une surveillance prolongee apres exerese chirurgicale.

  6. How to save the earth planet. Ecology and human spirit. Sauver la planete terre. L'ecologie et l'esprit humain

    Energy Technology Data Exchange (ETDEWEB)

    Al Gore.

    1993-01-01

    The author has undertaken for 25 years in all the struggles for the environment protection. His ecology competences are worldwide recognized. With ''HOW TO SAVE THE EARTH PLANET'' AL GORE calls for help facing a great importance economic crisis, the consequences of which are dramatic. Beyond the exhaustive report, very well documented on the scientific topics, he proposes a true ecologic ''Marshall PLAN'' at the planet level, and a global reflection followed by precise and concrete measures. In the beginning of the XXIst century the challenge taken up by AL GORE is also a true defence plea for the future. We are all concerned and our children too. 27 refs.

  7. Accumuler le capital humain tout au long de la vie: Quels facteurs prédictifs de la participation à la formation permanente?

    Science.gov (United States)

    Boudard, Emmanuel; Morlaix, Sophie

    2003-09-01

    This article addresses the main predictors of adult education, using statistical methods different from those generally used by social science researchers. Its aim is twofold. First, it seeks to explain in a simple and comprehensible manner the methodological value of these methods (in relation to the use of structural models); secondly, it demonstrates the concrete usefulness of these methods on the basis of a recent piece of research on the data from the International Adult Literacy Survey (IALS).

  8. Protection de la santé humaine par la prévention de trafic et consommation illégal de drogues et substances psychotropes

    Directory of Open Access Journals (Sweden)

    Florin Bologeanu

    2009-06-01

    Full Text Available Among the many serious problems that the humanity is facing, the trafficking and consumption of drugs isincreasingly imposing. Adolescents, youth, elderly, that are dependent of this delirium illusory happiness producedin laboratories, are involved in death traffic of a relay through which they follow the path of the plantations that growhallucinogenic flora, up to the consumer over the country and seas, through the jungles and deserts. The oldcaravans, seemingly honest trucks and luxury cars, old vessels and canvas ultrafast the aeronaves, all have the sameheinous goal. Unscrupulous chemists discover each day new substances, more harmful than the ones before. Theorganizations at the level of multinational companies conduct real empires with their laws, their structures, theyquarrel among themselves, they challenge battles in the streets; they even penetrated in parlament, police andpolitical parties.

  9. Arthur Maurice Hocart, Au commencement était le rite. De l’origine des sociétés humaines

    Directory of Open Access Journals (Sweden)

    Jean-Pierre Baud

    2009-04-01

    Full Text Available Il s’agit d’une œuvre qui était déjà en 1954 l’édition tardive d’une œuvre d’un auteur mort en 1939 et dont on a attendu la traduction française pendant un demi-siècle, laquelle semble annoncer une sortie de purgatoire qu’un Van Gennep attend encore (un haut lieu de l’anthropologie juridique ne possédait aucune de ses œuvres en l’an 2000. Au temps où elle était encore une science jeune, l’anthropologie s’était très vite dotée d’un académisme permettant d’accréditer les spécialistes sérieux e...

  10. Organisational and human factors in risk management: common beliefs, deceived ideas; Les Facteurs Organisationnels et Humains de la gestion des risques: idees recues, idees decues

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    2011-09-22

    The author propose critical discussions of common beliefs about the ineluctability of human error, individual ability, the validity of written procedures, good organisation, the culture of safety, the contribution of quality approaches to safety, the continuous improvement of safety, the good usage of the return on experience, the rigour and objectivity of the FOH (organisational and human factor) approach, and appealing to experts in FOHs

  11. Dispositifs de gestion et risques psychosociaux. Une étude qualitative des risques humains et de leur gestion dans les organisations.

    OpenAIRE

    Beau, Pauline

    2017-01-01

    Since the late 2000s, psychosocial risks (job strain, anxiety, burn out…) are a debating point. The literature explains it by the dissemination of a results-oriented culture which demands more and more to people and controls their performance by using management tools. Furthermore, to prevent psychosocial risks organizations also use management tools. That's why we focus our attention on the use of management tools in organizations to study the complex links between management control and psy...

  12. Les impacts humains des changements organisationnels autour des TIC Human impacts of organizational changes based on ITC Impactos humanos de los cambios organizacionales en torno a los TIC

    Directory of Open Access Journals (Sweden)

    Robert Picard

    2007-10-01

    Full Text Available La taille des systèmes mis en place dans les grandes organisations, leur caractère exogène par rapport aux pratiques de l’entreprise (progiciels de gestion intégrés, posent des défis relativement nouveaux, difficiles à relever pour les acteurs. En effet, les métiers des informaticiens comme ceux des utilisateurs en sont le plus souvent profondément affectés.Les informaticiens doivent réviser leur mode d’action, révision qui s’accompagne d’une moindre autonomie, d’exigences de coopération plus élevées, et d’une multidisciplinarité à laquelle ils n’ont pas nécessairement été préparés.Les professionnels utilisateurs peuvent perdre des repères professionnels historiques, changement accompagné d’une révision des pratiques, de la modification des structures et de l’environnement de travail. Ils doivent parfois acquérir de nouvelles qualifications, de façon coûteuse, et certains peuvent perdre leur travail.Ces problématiques seront illustrées par deux situations concrètes très récentes, observées dans un grand groupe de service, pour chacune des populations.Many organizational changes are related to (or initiated by the introduction of information and communication technology (ICT tools.The size of the systems implemented in large organizations, their external nature vis-à-vis the company’s practices (Enterprise Resource Planning are rather new challenges, which are difficult for the actors to tackle. In fact, the jobs of data processing people as well as of professional users are often the most affected.Data processing people must revise their way of doing things, a change that is accompanied by a loss of autonomy and greater demands for cooperation and multidisciplinarity that they are not necessarily prepared for.Professional users may lose some historical guidelines, a change that is accompanied by a review of their practices, organizational changes, and changes in the work environment. They must sometimes develop new capacities, which may be costly for them, and some may even lose their jobs.These questions will be illustrated in two actual recent situations observed in a major service provider, for each of the populations.Numerosos cambios organizacionales están asociados a (o provocados por la introducción de herramientas tecnológicas de información o de comunicación (TIC.El tamaño de los sistemas implantados en las grandes organizaciones y su carácter exógeno con relación a las prácticas de la empresa (programas de gestión integrada, plantean desafíos relativamente nuevos, difíciles de asumir para los actores. Efectivamente, tanto el oficio de los especialistas en informática, como el de los profesionales usuarios, se ven muy frecuentemente afectados.Los especialistas en informática deben revisar su manera de hacer, revisión que se acompaña de una menor autonomía, exigencias de cooperación más elevadas y de un trabajo multidisciplinario para el cual no fueron necesariamente preparados. Los profesionales usuarios pueden perder puntos históricos de referencia profesional, cambio acompañado de una revisión de las prácticas, de la modificación de las estructuras y del medio ambiente del trabajo. A veces, deben adquirir nuevas calificaciones, a un costo alto y algunos pueden perder su trabajo.Estas problemáticas serán ilustradas a través de dos situaciones concretas muy recientes, observadas en un gran grupo proveedor de servicios, para ambos grupos de empleados.

  13. Le modèle sociopsychologique du phénomène OVNI : un cadre conceptuel interprétatif en sciences humaines

    OpenAIRE

    Abrassart, Jean-Michel

    2016-01-01

    The goal of this PhD thesis is to present what we can currently say about the belief in the extraterrestrial origin of UFOs from a human sciences point of view. We will defend the Psychosocial Model, which tries to explain sightings, abductions and waves in a mundane way. It is part of the broader project of anomalistic psychology, which aims at explaining the paranormal without bringing into the discussion paranormal processes. We will deconstruct the ufological discourse based on our partic...

  14. Les pratiques de sélection des exécutifs dans les entreprises multinationales : gestion des ressources humaines dans la gestion des affaires internationales.

    OpenAIRE

    Lakshman , Sangeetha

    2013-01-01

    Multinationals that are moving abroad for its subsidiary operation may use any one of the typology such as Global, Multi-domestic,Transnational, and International strategy in order to manage and maintain their business abroad. International staffing is a critical elementof the implementation of the four strategies for doing business globally. In staffing the international operation, the organization mayfollow one of the three staffing approaches or a combination of three approaches (PCN, HCN,...

  15. Haïti : les pouvoirs de l'art dans Le Sang et la Mer de Gary Victor et La Belle Amour humaine de Lyonel Trouillot

    Directory of Open Access Journals (Sweden)

    Odile Gannier

    2012-11-01

    Full Text Available Dans cet article, l'auteure pose une question en écho aux événements de janvier 2010 : "comment écrire encore après les catastrophes ?". Elle en prend pour témoins les œuvres de Gary Victor et de Lyonel Trouillot (respectivement parues en 2010 et 2011 qui, pour l'une, raconte l'histoire d'une orpheline, Hérodiane, au parcours difficile, et rapporte, pour l'autre, l'enquête d'Anaïse, une étrangère, sur les traces de sa famille haïtienne. Odile Gannier analyse la construction de l'intrigue et des personnages, mais aussi les tonalités et les genres représentés dans les deux œuvres, ainsi que leurs multiples similitudes avec d'autres formes de production artistique (la peinture en particulier.

  16. Uninhabited Military Vehicles (UMVs): Human Factors Issues in Augmenting the Force (Vehicules Militaires sans Pilote (UMV): Questions Relatives aux Facteurs Humains lies a l’augmentation des Forces)

    Science.gov (United States)

    2007-07-01

    of this type of capability. Within two years, solar -electric airplanes incorporating energy storage for night-time operations will be capable of...Applications,” Proceedings of the IEEE, Vol. 77(4), pp. 541-580. [72] Diaper , D. (1989). Task Analysis for Human-Computer Interaction, Chichester, U...Geddes, N. (1990). A plan and goal based method for computer-human system design. In: D. Diaper (Ed.) Human-Computer Interaction – INTERACT ‘90

  17. Earth in the balance. Ecology and the human spirit; Urgence Planete Terre. L'esprit humain face a la crise ecologique

    Energy Technology Data Exchange (ETDEWEB)

    Al Gore

    2007-07-01

    This book is the translation of the original American edition 'earth in the balance'. When Earth in the Balance first came out, it caused quite a stir and for good reason. It convincingly makes the case that a crisis of epidemic proportions is nearly upon us and that if the world does not get its act together soon and agree to some kind of 'Global Marshall Plan' to protect the environment, we're all up a polluted creek without a paddle. Myriad plagues are upon us, but the worst include the loss of biodiversity, the depletion of the ozone layer, the slash-and-burn destruction of rain forests, and the onset of global warming. None of this is new, of course, nor was it new in 1992. But most environmentalists will still get a giddy feeling reading such a call to action as written by a prominent politician. The book is arranged into three sections: the first describes the plagues; the second looks at how we got ourselves into this mess; and the final chapters present ways out. Gore gets his points across in a serviceable way, though he could have benefited from a firmer editor's hand; at times the analogies are arcane and the pacing is odd kind of like a Gore speech that climaxes at weird points and then sinks just as the audience is about to clap. Still, at the end you understand what's been said. Gore believes that if we apply some American ingenuity, the twin engines of democracy and capitalism can be rigged to help us stabilize world population growth, spread social justice, boost education levels, create environmentally appropriate technologies, and negotiate international agreements to bring us back from the brink. For example, a worldwide shift to clean, renewable energy sources would create huge economic opportunities for companies large and small to design, build, and maintain solar panels, wind turbines, fuel cells, and other eco friendly innovations.

  18. From human error to organizational failure: a historical perspective; De l'erreur humaine a la defaillance organisationnelle: essai de mise en perspective historique

    Energy Technology Data Exchange (ETDEWEB)

    Guarnieri, F. [Mines ParisTech, 75 - Paris (France); Cambon, J. [Centre de Recherche sur les Risques et les Crises (CRC), 75 - Paris (France); Boissieres, I. [Institut pour une Culture de Securite Industrielle (ICSI), 31 - Toulouse (France)

    2008-09-15

    This article hinges around three main parts.The first part goes back over the foundations of the human factor approach. It introduces the basic assumptions as well as some of the methods which have been developed. The second part accounts for the reasons why organizational factors have drawn our attention at the first place underlying two major points: the limits of the human factor approach but also the original contribution and the innovative aspect of sociology. At last, the third part describes the keystone principles and hypotheses on which lay the foundations of the organizational factor approach and draws a brief overview of the methods which have lately been implanted within the industrial world. (authors)

  19. What is Essential for Virtual Reality Systems to Meet Human Performance Goals? (les Caracteristiques essentielles des systemes VR pour atteindre les objectifs militaires en matiere de performances humaines)

    Science.gov (United States)

    2001-03-01

    training world will be digital cinema, the convergence of television with the World Wide Web, and the continued rapid growth of multiplayer Internet...innocent civilians from being hurt in factional violence while preventing, as much as possible, new flare ups among the factions. By sharing an immersive

  20. Caractérisation et simulation des mouvements d'atteinte par un opérateur humain en position assise en vue d'applications ergonomiques

    OpenAIRE

    CHEVALOT, N

    2006-01-01

    La simulation de mouvements d'atteinte effectués par un opérateur assis est particulièrement utile pour les constructeurs d'automobiles. Elle permet d'améliorer l'ergonomie de l'habitacle et des commandes, le plus en amont possible dans la conception. Elle consiste à simuler un mouvement et à prédire son inconfort. Cependant, ce type de simulation se heurte à des problèmes pratiques et théoriques. Pour la partie pratique, une méthode de simulation générique et stable pour tout type de mouveme...

  1. Caractérisation et simulation des mouvements d'atteinte par un opérateur humain en position assise en vue d'applications ergonomiques

    OpenAIRE

    Chevalot , Nicolas

    2006-01-01

    Simulation of seated reaching movements is useful for designing the interior of a car. It allows assessing reachability of control commands and their discomfort in an early phase of design, through virtual simulation. However, this kind of simulation encounters theoretical and pratical problems. Practically, the whole simulation process should be designed for all kind of reach tasks, arising the problems of robustness and genericity. Theoretically, it is important to understand how the moveme...

  2. Abondance et distribution des grands singes et des activités humaines dans le Parc National de Campo Ma'an, Sud Cameroun

    Directory of Open Access Journals (Sweden)

    Tchamba, MN.

    2015-01-01

    Full Text Available Abundance and Distribution of Great Apes and Human Activities in the Campo Ma'an National Park, South Cameroon. The Campo Ma'an National Park (CMNP located in South Cameroon, has a rich biodiversity and is part of the priority areas of the Central Africa Network of Protected Areas. In order to improve the knowledge on great apes in this park, an inventory was conducted between October and November 2011 using the linear transect technique. In total, 103 transects, 2.5 km each, were established and surveyed. The results of the study confirm the presence of the two species of great apes in the CMNP, chimpanzees (Pan troglodytes troglodytes and gorillas (Gorilla gorilla gorilla. The inventory suggested that chimpanzees had a nest density of 0.158 nest∙km-2, allowing an estimated density of 0.555 indiv.km-2, for a total population estimated at 1466 animals weaned throughout the Park. Chimpanzees were mainly located in the northern part of the Park, near the hilly area of Niété. Gorillas had an estimated average encounter rate of 1.080 sign per km. They also appeared to be more concentrated around the area of Niété. Poaching was the preferred type of human activity in the Park and was located in the northern part of the Park. It is strongly recommended to implement the results of this study by performing regular surveys, about every 3 months, in order to monitor the demography of the great apes populations in the Park.

  3. Génétique épidémiologique et moléculaire de l’obésité humaine

    Directory of Open Access Journals (Sweden)

    Iron Albert

    2000-01-01

    Full Text Available L’obésité est une pathologie majeure pour plusieurs raisons qu’il est difficile de hiérarchiser. D’abord parce qu’elle est commune, concernant aujourd’hui près d’un individu sur trois dans les pays industrialisés. Ensuite, parce qu’elle est grave en raison des complications nombreuses et sévères, parmi lesquelles on peut citer des cardiopathies, le diabète, l’HTA, des cancers, etc. Enfin, parce que répondant à la définition de maladie multifactorielle résultant de l’interaction entre des facteurs héréditaires et des facteurs environnementaux, sa connaissance a beaucoup progressé ces dernières années, notamment grâce à l’apport de la génétique moléculaire. À l’échelon individuel et d’une manière simple, on peut définir l’obésité comme résultant d’un excès de tissu adipeux qui va se traduire par un poids élevé par rapport à ce qu’on peut considérer comme étant un poids idéal donné par la formule de Lorentz : Poids idéal (kg = Taille (cm – 100 – [Taille (cm – 150]/4 (homme ou 2,5 (femme Sous l’angle épidémiologique, c’est-à-dire à l’échelle des populations, l’obésité sera définie à partir de critères de nature anthropologique utilisés aussi en clinique pour typer le patient obèse. On peut prendre en compte le rapport du tour de hanche sur le tour de taille (qui permet de définir une obésité de type androïde ou gynoïde selon que ce rapport est supérieur ou inférieur à 0,85 ou la mesure de l’adiposité évaluée par l’appréciation des plis cutanés (en particulier le pli tricipital ou surtout l’indice de corpulence qui est le critère majeur des épidémiologistes pour l’étude de l’obésité chez l’adulte. Cet indice est la référence pour la définition de l’obésité chez l’adulte ; il est aussi appelé indice de masse corporelle (IMC ou indice de Quetelet ; il exprime le rapport du poids (en kg au carré de la taille (en m. Il a été choisi par l’OMS en 1998 pour établir la classification de l’obésité adulte [1]. Entre 18,5 et 25, le poids du sujet est normal, souhaitable avec un risque standard. Au-delà de 25, on définit d’abord une zone de surpoids puis trois degrés de sévérité et de complications croissantes.

  4. L'influence du principe de dignité humaine sur l'évolution du droit public de la vie en détention

    OpenAIRE

    Diani , Florian

    2016-01-01

    As from the early 2000s, the European Court of Human Rights started to give unprecedentedlegal effect and meaning to the principle of human dignity applied to conditions of detention, drawing, when doing so, in particular on Article 3 of the European Convention on Human Rights prohibiting torture and inhumane or degrading treatment or punishment. This major development, which has enabled the Court to have its case law implemented to a significant extent in prisons, has forced French administr...

  5. Risk from transportation and handling of butane; Etude de cas: jusqu`ou quantifier les risques lies aux facteurs humains ? Application au transport routier

    Energy Technology Data Exchange (ETDEWEB)

    Rao, B.; Celier, J.

    1997-12-31

    This paper presents the results and recommendations derived from a detailed assessment of a butane supply and butane transportation system. Based on a hazard and operability (HAZOP) study performed earlier, the need to undertake a more detailed assessment of the risks associated with the handling and transport of butane for the maleic anhydride (MAN) unit at a site was identified in order to ensure that all reasonable risk mitigation actions had been evaluated. Therefore, PLG initiated this study to quantify the likelihood and consequences of butane releases. The scope of the risk assessment includes all operations and activities with the handling and transport of butane, including: loading of butane trucks at the butane loading terminal; transport of butane by tank truck from the loading terminal to the plant site; unloading of the butane into the MAN unit storage sphere. Risks were quantified in terms of the likelihood of butane releases that could leas to a fire (pool or vapor cloud), an unconfined vapor cloud explosion (UVCE), or a boiling expanding vapor explosion (BLEVE), and the consequences of such releases in terms of the potential impact on both plant workers and the general public who live or work near the butane loading terminal, the transport route, or the plant site. (author)

  6. Mesurer et justifier l'investissement humain, informatique et financier dans l'exploitation et la diffusion d'un fonds documentaire : le cas de BETC Euro RSCG

    OpenAIRE

    Meynier, Audrey

    2007-01-01

    Ce mémoire a pour objectif de proposer une méthode d'audit pour la revalorisation d'un fonds documentaire spécifique, constitué en majorité d'ouvrages de photographie et de graphisme. La première partie aborde le projet de réinformatisation du service bibliothéconomique d'un point de vue méthodologique en présentant différentes approches complémentaires : la gestion d'un projet informatique, la méthode budgétaire de l'analyse de la valeur et le marketing documentaire, davantage orienté utilis...

  7. The exposures to natural radioactivity as a result of human activities; Les expositions a la radioactivite naturelle du fait des activites humaines

    Energy Technology Data Exchange (ETDEWEB)

    Rannou, A.; Dupuis, M.; Bottollier-Depois, J.F.; Leprieur, F.; Pasquier, J.L.; Doremus, P.; Pierre, J.P. [Institut de Radioprotection et de Surete Nucleaire, 92 - Clamart (France); Bernhard, S. [ALGADE, 87 6 Bessines sur Gartempe (France); Delporte, V. [Drection Generale de la Surete Nucleaire et de la Radioprotection, 75 - Paris (France); Servent, J.P. [Institut National de Recherche et de Securite, 75 - Paris (France); Marchand, D. [DRASS Bretagne (France); Dupuis, M.; Bottollier-Depois, J.F.; Leprieur, F.; Pasquier, J.L.; Doremus, P.; Pierre, J.P. [Institut de Radioprotection et de Surete Nucleaire, 92 - Clamart (France); Surbeck, H. [Neuchatel Univ. (Switzerland); Degrange, J.P. [Centre d' Etude sur l' Evaluation de la Protection dans le Domaine Nucleaire, 92 - Fontenay aux Roses (France)

    2005-07-01

    The new regulation in matter of radiation protection, coming from the transposition of the European directive 96/29/EURATOM modifies the code of the public health and the labour code. The exposures to natural radioactivity by the very fact of human activities are the object of specific dispositions. These new dispositions apply to professional areas that were, until now, little concerned by the regulation relative to ionizing radiations. The S.F.R.P., in relationship with the Minister in charge of labour, and the A.F.T.I.M. (French organisation of safety technicians and engineers and labour physicians) organizes two days of information and exchange on the subject. This meeting concerns industry and research departments but also inspectors and labour physicians and other actors having a look on the risk management in societies. After some reminder on radioactivity and its effects, the regulation and the global risk management on working place, several actual examples are presented, covering the different known situations of exposure to the natural radioactivity ( radon, cosmic rays, use of radioactive material in an industrial process, production of radioactive waste). The days finish by a round table conference on the stakes and practical entailment of the new regulation. (N.C.)

  8. Traitement de l'hétérogénéité sémantique dans les interactions humain-agent et agent-agent

    OpenAIRE

    Mazuel , Laurent

    2008-01-01

    The main purpose of this thesis is the management of semantic heterogeneity in human-agent and agent-agent interaction. We especially focus on the situation where a software agent, supplied with a knowledge representation model, has to understand requests coming from different interlocutors; either it is a human user or another software agent.Most work in this domain either focus on human-agent interaction or agent-agent interaction. On the contrary, we suggest that it is possible to use a co...

  9. Scientific days on electromagnetic fields: from dosimetry to human health - Conference proceedings; Journees scientifiques - Champs electromagnetiques: de la dosimetrie a la sante humaine - Recueil des resumes et presentations

    Energy Technology Data Exchange (ETDEWEB)

    Wiart, J.; Ghanmi, A.; Picon, O.; Conil, E.; Varsier, N.; Hadjem, A.; Sudret, B.; Magne, I.; Souques, M.; Gaudaire, F.; De Seze, R.; Jawad, O.; Lautru, D.; Dricot, J.M.; Horlin, F.; De Doncker, P.; Drissaoui, A.; Musy, F.; Nicolas, L.; Perrussel, R.; Scorretti, R.; Voyer, D.; Jala, M.; Moulines, E.; Levy-Leduc, C.; Mahfouz, Z.; Gati, A.; Fouad Hanna, V.; Leveque, P.; Arnaud-Cormos, D.; Zhadobov, M.; Jarrige, P.; Gaborit, G.; Kohler, S.; Ticaud, N.; Duvillaret, L.; Guelilia, Z.; Loison, R.; Gillard, R.; Laisne, A.; Favet, D.; Benadhira, R.; Mir, L.; Nadi, M.; Kourtiche, D.; Gazeau, F.; Wilhelm, C.; Delemotte, L.; Breton, M.; Tarek, M.; Marc-Vergnes, J.P.; Yardin, C.; Perrin, A.; Le Drean, Y.; Sauleau, R.; Lambrozo, J.; Selmaoui, B.; Ghosn, R.; Thuroczy, G.; Villegier, A.S.; Loos, N.; Brenet-Dufour, V.; Liabeuf, S.; Bach, V.; Moretti, D.; Lewis, N.; Garenne, A.; Poulletier De Gannes, F.; Haro, E.; Lagroye, I.; Bornat, Y.; Boutaib, Y.; Saighi, S.; Renaud, S.; Veyre, B.; Schuz, J.; Deltour, I.; Van Deventer, E.; Vecchia, P.; Merckel, O.; Bellaouel, A.; Demaret, P.; Donati, P.; Jovanovic, D.; Chauvin, S.; Desreumaux, J.P.; Fouquet, L.; Picard, D.; Massardier-Pilonchery, A.; Hours, M.; Bergeret, A.; Person, C.; Toutain, Y.; Butet, R.; Berrahma, K.; Balderelli, I.; Stelmaszyk, V.; Cretallaz, C.; Lamproglou, I.; Amourette, C.; Diserbo, M.; Fauquette, W.; Martigne, P.; Collin, A.; Lagroye, I.; Ait Aissa, S.; Hurtier, A.; Taxile, M.; Le Montagner, L.; Athane, A.; Duleu, S.; Percherancier, Y.; Geffard, M.; Ruffie, G.; Billaudel, B.; Veyret, B.; Pelletier, A.; Delanaud, S.; Libert, J.P.; Schunck, T.; Bieth, F.; Soubere Mahamoud, Y.; Le Quement, C.; Ferrand, G.; Le Guevel, R.; Carton, P.H.; Luong, M.; Tanvir, S.; Selmaoui, B.; Silva Pires-Antonietti, V.; Sonnet, P.; Pulvin, S.; Kuster, O.; Tetelin, C.

    2012-04-15

    This document brings together the available presentations (articles and slides) given at the URSI scientific days on electromagnetic fields: dosimetry, peoples' exposure, biological and health risks, risk management, and medical uses. 48 presentations are compiled in this document and deal with: 1 - Stochastic dosimetry: variability challenge; 2 - How to estimate the exposure to 50/60 Hz magnetic field in an epidemiological study?; 3 - Joint analysis of population exposure and radio coverage of GSM and UMTS mobile phone networks; 4 - Study of the specific energy absorption rate (SAR) sensitiveness to phone positions near the head for 2 GSM mobile phones; 5 - Statistical Study of SAR under Wireless Channel - Exposure in Indoor Environment; 6 - Uncertainty propagation in numerical dosimetry: how to reduce calculation costs?; 7 - Use of a simplified pregnant woman model for foetus exposure analysis; 8 - SAR estimation using multi-exposure with a mobile phone; 9 - State-of-the-art in experimental dosimetry (RF and pulses); 10 - Mm-waves dosimetry: issues, stakes and actual solutions; 11 - Use of DG-FDTD for a dosimetry calculation in a strongly multi-scale problem: determination of the eye-SAR near a HF/VHF vehicle-borne source; 12 - Dosimetric measurements with a fiber-type electro-optical sensor; 13 - Partial experimental evaluation of basic restrictions in the HF/VHF range; 14 - Repetitive trans-cranial magnetic stimulation Stimulation (rTMS) in psychiatry: present day situation and perspectives; 15 - Medical applications of electric fields; 16 - Measurements for life: new perspectives? 17 - Nano-particles and magnetic stimuli for medical imaging and therapy; 18 - Molecular Insights into electroporation and siRNA electro-transfer through model cell membranes; 19 - State of knowledge on electromagnetic fields hypersensitivity (HS-CEM); 20 - Experimentation methodology: from results to interpretation; 22 - Mm waves - update on biological effects at 40-60 GHz; 23 - Electromagnetic interferences and cardiac implants; 24 - RF effects on central nervous system: sleep, cognition, Electro-encephalography, vascularisation; 25 - Specific effects of an exposure to mobile phone RF waves on the autonomous nervous control of the cutaneous vasomotor tone; 26 - The ERNAM project: exposure of neuronal networks to the GSM-1800 signal; 27 - Mobile phones, power lines and cancer: the epidemiological evidence leading to classification as possible carcinogens; 28 - EMF Risk Assessment and Management: A WHO Perspective; 29 - Evolution of ICNIRP guidelines; 30 - Assessment of RF-linked risks at the Anses: from dialogue management recommendations; 31 - Characterization of mobile phone-absorbing medium interactions for non-invasive dosimetry; 32 - Status of electromagnetic radiation exposures and evaluation of prevention means; 33 - General public exposure to RF in France; 34 - Power emitted by a mobile phone in voice communication: from 2G to 3G VoIP; 35 - Digital dosimetry in HF/VHF range; 36 - Professional exposure of mobile phone maintenance technicians; 37 - Robot-less multi-sensors dosimetry for real time SAR measurement; 38 - High performance SAR meter for the characterization of 3G mobile phones exposure; 39 - RF dosemeters and user's body diffraction; 40 - RF waves and health: summary of 2007-2011 scientific publications; 41 - Behaviour of adult male wistar rats during high power pulsed electromagnetic waves (3 GHz); 42 - Wi-Fi effects: results of IMS Lab studies; 43 - Effects on the energy fluxes of young rats homeostasis during a chronic exposure to RF fields; 44 - Biological effects of very-high power and ultra-large range radiations: ISL's research programme; 45 - Study of cell-scale biological effects of pulsed RF fields used in high-resolution NMR-imaging; 46 - Effects of cell phone radiofrequency exposure on the human cytochrome P450 reductase; 47 - CEA's 'electromagnetic safety' working group; 48 - In situ evaluation of electromagnetic fields from UHF RFID readers

  10. Émergence du modèle de la compétence : de la rationalisation économique à la rationalisation du facteur humain

    OpenAIRE

    Naji, Faïrouz

    2016-01-01

    Today, the strict purely economic vision of the company gave way to more global approach involving human factor. From now on, the difference between successful companies and those which fail is in their human capital. This article explores the way which led the economic rationalization to that of the human factor. It interrogates the role of skills approach in this process and examines, through the model at three levels (Dietrich, 2008), the integrated implementation of skills approach.

  11. Colonisation humaine et développement sur une frontière écologique. Le Despoblado, le Sahel du Piura-Pérou Septentrional

    Directory of Open Access Journals (Sweden)

    1991-01-01

    Full Text Available Le despoblado de Piura est une formation végétale mixte arborée et herbacée, un sahel qui, malgré des précipitations très irrégulières, associe plusieurs ressources complémentaires. Elles ont été diversement utilisées au fur et à mesure de l’intervention de nouvelles techniques. - Cueillette des racines et fruits de la pampa d’interfluves. - Arboriculture sur huerta d’inférofluse à l’amont, et cultures saisonnières sur les lits intermittents et petit élevage caprin sur l’algarrobal des interfluves. - Cultures commerciales d’irrigation permanente par dérivation des eaux de la sierra et maintien d’un petit élevage de despoblado. Trois étapes de la colonisation du Piura. Mais la dernière, si elle permet de supporter une forte densité paysanne, ne peut éviter les conséquences des fortes pluies exceptionnelles. COLONIZACIÓN HUMANA Y DESARROLLO SOBRE FRONTERA ECOLÓGICA. EL DESPOBLADO, EL SAHEL DE PIURA, NORTE-PERÚ. El despoblado de Piura es una formación vegetal mixta, arboleda y savana ocasional, un sahel que, a pesar de lluvias muy irregulares, combina varios recursos complementarios. Ésos fueron aprovechados distintamente a medida de la intervención de nuevas técnicas. - Recolección de raíces y frutas en las pampas de las planicies secas - Arboricultura en las huertas de las cabezas de conos torrenciales y cultura estacional sobre los cauces inundables de las quebradas, aguas abajo, y cría de cabras y asnos en el algarrobal de las pampas - Cultivos comerciales de riego permanente por desvío de aguas de los grandes ríos de la sierra, y permanencia de la ganadería de caprinos sobre las pampas del despoblado. Son tres etapas del asentamiento humano. Pero la última, si tiene la ventaja de soportar grandes densidades campesinas, no puede arrastrar el peligro de las lluvias excepcionales. HUMAN SETTLING AND DEVELOPMENT ON AN ECOLOGIC FRONTIERS. THE DESPOBLADO, THE SAHEL OF SEPTENTRIONAL PIURA-PERU. A Piura despoblado is a mixed botanical formation of trees and herbs, the sahel, although having random precipitations, combines additional complementary resources. Both have been made available by applying new techniques on them as detailed: - Roots and fruit recollection from the dry plain pampas - Arboriculture in the upper damphuertas, seasonal cultivations on periodic river beds, and low scale breeding of caprin stock in non flooded algarrobales - Permanent commercial irrigation agriculture, through carrying waters of the highlands and the preservation of low scale animal stock in despoblados. The Piura settlings denote three stages. But the last, even though able to admit crowds of peasants could not avoid the consequences of heavy floods.

  12. Relation entre la faune de quelques rivières du nord-ouest de l'Angleterre et les activités humaines

    Directory of Open Access Journals (Sweden)

    MACAN T. T.

    1976-01-01

    Full Text Available MINSHALL et KUEHNE ont signalé que, dans la « Région des lacs » en Angleterre, alors que la faune typique d'un ruisseau à fond pierreux peut monter jusqu'aux sources dans les montagnes, il y a des zones où la faune est pauvre, hormis les Plécoptères. Dans ces dernières eaux, le pH et le taux en calcium sont faibles, comme l'ont montré SUTCLIFFE et CARRICK qui pensent qu'il s'agit d'une pollution atmosphérique. De telles communautés habitent les affluents de la Rivière Lune. La rivière elle-même traverse une gorge où, grâce aux éboulis, le fond est stable. La faune actuelle est riche en espèces et en individus, surtout en larves de Tricoptères avec filet. C'est presque la seule région où les mollusques ne risquent pas d'être écrasés par les pierres roulantes. En aval, dans une longue plaine alluviale, le substrat est instable et, en conséquence, les espèces sont peu nombreuses bien que les individus de quelques-unes soient abondants. Une augmentation de l'enrichissement actuel provenant des villes et des prairies cultivées pourrait provoquer une croissance excessive des algues filamenteuses. Celles-ci font disparaître la vraie faune lithicole et disparaissent elles-mêmes en temps de crue, en emportant vers l'aval les animaux qu'elles hébergent. Au-delà de la plaine, la rivière traverse une région à pierre meulière, sur un lit plat et lisse. Entre deux barrages, ce lit est couvert de mousses habitées par 4 espèces d'éphémères qui ne se trouvent ailleurs, que dans de petites baies où le courant est faible. On a remarqué dans une rivière voisine la disparition de telles espèces après l'amélioration du lit par les ingénieurs.

  13. Stimulation cérébrale profonde hypothalamique pour l'obésité chez le primate non humain : Une approche préclinique.

    OpenAIRE

    Torres , Napoleon

    2008-01-01

    Abstract Object: Deep brain stimulation (DBS) has become an effective therapy in a variety of brain disorders. Recently, Hypothalamic DBS in cases of chronic intractable cluster headache has revived the interest in this region, which is also well-known to be involved in food intake and energy balance regulation. In the other hand, risks and problems related with implantation in this area has raised several questions regarding the safety of this approach. In this study, the authors proposed an...

  14. Bombacopsis glabra (Pasquale A. Robyns (Bombacaceae espèce utile pour l'élevage et pour l'alimentation humaine

    Directory of Open Access Journals (Sweden)

    Breyne, H.

    1983-01-01

    Full Text Available Usefulness of Bombacopsis glabra (Pasquale A. Robyns (Bombacaceae for animal and human nutrition. After some botanical reflections, the author gives agronomical and practical facts about Bombacopsis glabra (Pasquale A. Robyns. He insists especially how easy it is to multiply this species with cuttings. This characteristic is largely used in some countries of the third world to erect fences. Chemical analysis of the leaves has shown that this Bombacaceae can produce a good fodder. After analysis of the seeds, the author comes to conclusion that they are interesting for human food supply.

  15. Sensor Data Fusion and Integration of the Human Element. (la Fusion de donnees de senseur et l’integration du facteur humain)

    Science.gov (United States)

    1999-02-01

    It is postulated that by the year 2007, HgCdTe MWIR FPAs will be in production in a 2048 x 2048 size with 10 micron pitch-performance, providing...April 1998. [14] Ruckdeschel, W., "Modellierung regelbasierten Verhaltens mit Petrinetzen", Fortschritts-Bericht, VDI - Reihe 12 Nr 335 Düsseldorf... VDI Verlag, 1997. [15] Stütz, P., Onken, R., "Adaptive Pilot Modelling within Cockpit Crew Assistance", in Proceedings of 7m International

  16. Caractérisation, germination et conservation des graines de Carapa procera DC. (Meliaceae, une espèce utile en santé humaine et animale

    Directory of Open Access Journals (Sweden)

    Sanogo, S.

    2013-01-01

    Full Text Available Characterization, germination and conservation of seeds of Carapa procera DC. (Meliaceae, a useful medicinal species for human and animal health. Carapa procera DC. (Meliaceae is a widespread species occurring in the woodlands of Africa and Latin America. It is a medicinal plant overexploited by the rural populations of southern Mali. Leaves, fruits and seeds, the bark of the trunk and the roots are used in the preparation of medicine for human and animal health. Such uses result in enormous pressures on natural stands of the species, which have great difficulty in regenerating naturally. Cultivation of C. procera was investigated through studies of its seed physiology and seedling production techniques for reintroduction into its natural habitat. Results showed that fresh seeds of C. procera had a moisture content of over 50% (based on fresh weight and ≥ 90% germination. When seeds were dried in a ventilated room condition, their moisture content dropped below 20% after 2 weeks, resulting in a total loss of their germination capacity. Carapa procera seeds can therefore be described as recalcitrant seeds. Stored in kegs containing wood chips, 50% of (small size seeds germinated after one month and 33% after three months, maintaining a 23.5% moisture content. This study recommends that seed moisture content should be kept at above 35% in order to maintain seed viability in storage. We found that using a substrate of silty clay in the nursery allowed a good growth of seedlings (≥ 40 cm, which could be planted out in the field within three months. In order to sustainably use and conserve C. procera in the savannah areas of West Africa, it is recommended that the species be cultivated through the establishment of plantations in its habitat by rural communities.

  17. Étude structurale de l'assemblage du complexe télomérique humain TRF2/RAP1

    OpenAIRE

    Gaullier , Guillaume

    2015-01-01

    Telomeres are the ends of eukaryotic linear chromosomes. They are made oftandem repeats of a short guanine-rich motif and bound by specific proteins.In vertebrates, these proteins form a complex called shelterin, theintegrity of which is critical to ensure proper replication of chromosomeends and to protect them against illicit targeting by DNA double-strandbreak repair pathways. Telomere dysfunctions lead to genome instability,which can ultimately cause senescence or cancer. Telomeres are a ...

  18. Le fractionnement membranaire et les partenaires d'interaction de la tyrosine kinase YES1 chez les spermatozoïdes humains

    OpenAIRE

    Poirier, Édith

    2012-01-01

    Les spermatozoïdes sont des cellules haploïdes hautement spécialisées ayant pour but ultime la fécondation de l'ovocyte. Afin de devenir aptes à la fécondation, les cellules germinales mâles subissent plusieurs étapes de maturation, impliquant bien des modifications tant au niveau protéique, membranaire et intracellulaire. Toutefois, les spermatozoïdes de mammifères fraîchement éjaculés sont incapables de féconder et acquièrent leur plein pouvoir fécondant à l'intérieur du tractus génital fem...

  19. Quand les proverbes français explicitent l’humain par le biais pronominal (qui/on ou nominal (homme/femme

    Directory of Open Access Journals (Sweden)

    Mercedes Banegas Saorín

    2016-12-01

    Full Text Available Nous nous penchons ici sur les proverbes introduits par les pronoms et par des syntagmes nominaux pour déterminer dans quelle mesure la structure syntaxique joue sur la structure informative de ces énoncés qui acquièrent un sens conventionnel codé. Nous les rapprochons des énoncés génériques, sans perdre de vue les propriétés auxquelles satisfont la plupart des proverbes : généricité, schéma implicatif et montée hypo-hypéronymique. Comme la classe des proverbes n’est pas formellement homogène, nous aboutissons, d’une part, à l’établissement d’une sous-classe des proverbes dits pronominaux et, d’autre part, à une nouvelle typologie des proverbes, très proche de celle des phrases génériques qui fait consensus.

  20. NUL PARMI EUX N´ÉTAIT INDIGENT LA RELEVANCE D´UNE ÉCLESIOLOGIE SOLIDAIRE POUR LE RACHAT DE LA DIGNITÉ HUMAINE

    OpenAIRE

    JOSE LUIZ NEGRI

    2003-01-01

    Partindo da realidade sócio-econômica e religiosa- cultural do povo latinoamericano, que durante quinhentos anos vem sofrendo todo tipo de humilhação, proponho a reflexão sobre a eclesiologia solidária, a fim de que a dignidade humana seja resgatada em todas as suas dimensões. Para alcançar este objetivo, tenho inspirado- me em Jesus Cristo Libertador e no compromisso com seu Evangelho, nas reflexões teológico-pastorais das três grandes Conferências do Episcopado...

  1. Surveillance épidémiologique de la rage humaine dans un contexte d’endémie de rage canine en Cote d’Ivoire

    OpenAIRE

    Tiembré , I.; Dagnan , S; Douba , A; Adjogoua , E V; Bourhy , Hervé; Dacheux , L; Kouassi , L; Dosso , M; Odehouri-Koudou , P; Tiembré , P

    2010-01-01

    International audience; The objective of this study was to analyze the epidemiologic monitoring of human rabies in the rabies medical center of Abidjan.; A cross-sectional study was undertaken based on files of patients having consulted in the rabies center after exposure and suspicion of human rabies between January 2001 and June 2009.; Twenty-six cases of human rabies were reported in 10,706,136 inhabitants (annual incidence of 0.028 cases per 100,000). The number of detected cases increase...

  2. Comparison of Anterior and Posterior Surgery for Degenerative Cervical Myelopathy: An MRI-Based Propensity-Score-Matched Analysis Using Data from the Prospective Multicenter AOSpine CSM North America and International Studies.

    Science.gov (United States)

    Kato, So; Nouri, Aria; Wu, Dongjin; Nori, Satoshi; Tetreault, Lindsay; Fehlings, Michael G

    2017-06-21

    Surgeons often choose between 2 different approaches (anterior and posterior) for surgical treatment of degenerative cervical myelopathy on the basis of imaging features of spinal cord compression, the number of levels affected, and the spinal alignment. However, there is a lack of consensus on which approach is preferable. The objective of the present study was to use magnetic resonance imaging (MRI)-based propensity-score-matched analysis to compare postoperative outcomes between the anterior and posterior surgical approaches for degenerative cervical myelopathy. A total of 757 patients were enrolled in 2 prospective multicenter AOSpine studies, which involved 26 international sites. Preoperative MRIs were reviewed to characterize the causes of the cord compression, including single-level disc disease, multilevel disc disease, ossification of the posterior longitudinal ligament, enlargement of the ligamentum flavum, vertebral subluxation/spondylolisthesis, congenital fusion, number of compressed levels, or kyphosis. The propensity to choose anterior decompression was calculated using demographic data, preoperative MRI findings, and the modified Japanese Orthopaedic Association (mJOA) scores in a logistic regression model. We then performed 1-to-1 matching of patients who had received anterior decompression with those who had the same propensity score but had received posterior decompression to compare 2-year postoperative outcomes and 30-day perioperative complication rates between the 2 groups after adjustment for background characteristics. A total of 435 cases were included in the propensity score calculation, and 1-to-1 matching resulted in 80 pairs of anterior and posterior surgical cases; 99% of these matched patients had multilevel compression. The anterior and posterior groups did not differ significantly in terms of the postoperative mJOA score (15.1 versus 15.3, p = 0.53), Neck Disability Index (20.5 versus 24.1, p = 0.44), or Short Form-36 (SF-36) Physical Component Summary (PCS) score (41.9 versus 40.9, p = 0.30). The overall rates of perioperative complications were similar between the 2 groups (16% versus 11%, p = 0.48); however, dysphagia/dysphonia was reported only in the anterior group whereas surgical site infection and C5 radiculopathy were reported only in the posterior group. Anterior and posterior decompression for degenerative cervical myelopathy resulted in similar postoperative outcomes and rates of complications. Therapeutic Level III. See Instructions for Authors for a complete description of levels of evidence.

  3. Spectroscopic properties of a reconstituted light-harvesting complex from the green sulfur bacterium Chlorobium tepidum containing CsmA and bacteriochlorophyll a

    DEFF Research Database (Denmark)

    Pedersen, Marie Østergaard; Pham, Lan; Steensgaard, Dorte Bjerre

    2008-01-01

    chlorosomes were lyophilized and extracted with chloroform/methanol (1:1, v/v). The . Isolated chlorosomes were lyophilized and extracted with chloroform/methanol (1:1, v/v). The extract was further purified using gel filtration and reverse-phase HPLC and the purity of the preparation confirmed by SDS...

  4. Dicty_cDB: VSF769 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available dnsgaknlyviavkgikgrlnrlpsagvgdmv matvkkgkpelrkkvctglvvrqrkhwkrkdgvyiyfednagvmcnpkgevkgnilgpva kecsdlwpkvatna... dmvmatvkkgkpelrkkvctglvvrqrkhwkrkdgvyiyfednagvmcnpkgevkgnilg pvakecsdlwpkvatnagtiv*int Homology vs CSM-cDNA

  5. Quantum mechanics as a natural generalization of classical statistical mechanics

    International Nuclear Information System (INIS)

    Xu Laizi; Qian Shangwu

    1994-01-01

    By comparison between equations of motion of geometrical optics (GO) and that of classical statistical mechanics (CSM), it is found that there should be an analogy between GO and CSM instead of GO and classical mechanics (CM). Furthermore, by comparison between the classical limit (CL) of quantum mechanics (QM) and CSM, the authors find that CL of QM is CSM not CM, hence they demonstrated that QM is a natural generalization of CSM instead of CM

  6. SN 2010jl: Optical to Hard X-ray Observations Reveal an Explosion Embedded In a Ten Solar Mass Cocoon

    DEFF Research Database (Denmark)

    Ofek, Eran O.; Zoglauer, Andreas; Boggs, Steven E.

    2014-01-01

    Some supernovae (SNe) may be powered by the interaction of the SN ejecta with a large amount of circumstellar matter (CSM). However, quantitative estimates of the CSM mass around such SNe are missing when the CSM material is optically thick. Specifically, current estimators are sensitive to uncer......Some supernovae (SNe) may be powered by the interaction of the SN ejecta with a large amount of circumstellar matter (CSM). However, quantitative estimates of the CSM mass around such SNe are missing when the CSM material is optically thick. Specifically, current estimators are sensitive...

  7. Human Internal Contamination with Strontium-90 Titanate; Contamination Interne du Corps Humain par le Titanate de Strontium 90; 0412 041d 0414 ; Contaminacion Interna del Cuerpo Humano con Titanato de Estroncio-90

    Energy Technology Data Exchange (ETDEWEB)

    Bradley, F. J.; Wald, N.; Wechsler, R. L. [Graduate School of Public Health and School of Medicine, University of Pittsburgh, Pittsburgh, PA (United States)

    1964-11-15

    Strontium-90 has been used in multikilocurie quantities recently as a heat source for thermoelectric generators. The titanate was carefully selected for this purpose as the chemical form which best met requirements including inertness to corrosive attack in the event of accidental release to the environment. An industrial accidental exposure of one worker on 26 June 1963 to strontium-90 titanate powder, originally in the form of particles of about 120 {mu}m and less, provided an opportunity to attempt the assessment of the human body burden of this supposedly highly insoluble compound. Because of the physical and biological behaviour of the particles, it was assumed that the actual particle size which was dispersed and ingested and/or inhaled by the exposed person was in the range of 1 to 30 {mu}m. Three techniques were used to estimate the body burden. Whole-body radiation counting carried out by Dr. Charles H. Miller at Argonne National Laboratory, which only gave an upper limit because of the non-specific Bremsstrahlung spectrum from strontium-90, yttrium-90 indicated an initial total-body burden of 4.8 {mu}c. The second method, total urinary and faecal output collection, totalled 5.0 for the first 20 d. Combining that amount with an estimate of the amount retained in the body, an initial total-body burden of 5.2 {mu}c was obtained. The third technique, blood radioactivity determination, indicated an initial total-body burden of 6 {mu}c. The ratio of faecal to urinary output in the first 20 d was 15 to 1, and 94% of the total strontium-90 excretion was via the gastro-intestinal tract. It is of interest, however, that a significant fraction was evidently soluble. By the 20th post-incident day, it was estimated that the retained body burden was only 5% of the total intake. Methods used in that period to enhance faecal excretion by MgSO{sub 4} and urinary excretion by a combination of Ca-gluconate and NH{sub 4}CI are described. Subsequent excretion patterns and the current estimate of the retained body burden are presented. (author) [French] Le strontium 90 a ete recemment utilise en quantites de l'ordre de plusieurs kilocuries comme source de chaleur pour des generateurs thermoelectriques. Apres une etude approfondie, on a choisi a cette fin le titanate comme etant la forme chimique dont les proprietes satisfont le mieux aux exigences de la situation et qui notamment resiste bien a la corrosion en cas de liberation accidentelle dans l'environnement. A la suite de la contamination accidentelle d'un ouvrier par du titanate de strontium 90 en poudre - a l'origine sous forme de particules d'environ 120 M au maximum le 20 juin 1963, on a pu tenter d'evaluer la charge corporelle de ce compose, considere comme tres peu soluble. D'apres le comportement physique et biologique des particules, on a suppose que la dimension effective des particules dispersees puis absorbees par voie digestive ou respiratoire, ou par l'une et l'autre a la fois, etait comprise entre 1 et 30 {mu}. Trois techniques differentes ont ete utilisees pour l'evaluation de la charge corporelle. En recourant a l'anthropogammameme, qui en raison de la non-specificite du spectre du rayonnement de freinage du strontium 90 - yttrium 90 n'a donne qu'une limite superieure, Dr. Charles E. Miller, du Laboratoire national d'Argonne, a evalue la charge corporelle totale initiale a 4,8 {mu}c. Avec la deuxieme methode, fondee sur la collecte de la totalite des excreta elimines par voie urinaire et fecale, la charge corporelle totale a ete evaluee a 5,0 {mu}c pour les 20 premiers jours. En additionnant cette radioactivite a celle que l'on estime avoir ete retenue par l'organisme, on a obtenu une charge corporelle totale initiale de 5,2 {mu}c. Avec la troisieme methode, c'est-a-dire la determination de la radioactivite dans le sang, on a obtenu une charge corporelle initiale totale de 6 {mu}c. Le rapport elimination fecale/elimination urinaire a ete, pendant les 20 premiers jours, de 15 a 1,94% de la quantite totale de strontium 90 eliminee a ete evacuee par'l'intermediaire du tractus gastro-intestinal. Il y a lieu toutefois de noter qu une fraction significative de cette quantite etau manifestement soluble. Vingt jours apres l'accident, on a calcule que la retention ne representait que 5%de la radioactivite totale absorbee. Les auteurs decrivent les methodes'qui' ont ete utilisees au cours de cette periode pour stimuler l'elimination fecale au moyen de MgSO{sub 4} et l'elimination urinaire en combinant le gluconate de calcium et NH{sub 4}CI. Ils donnenj des indications sur le regime ulterieur de-relimination et sur les dernieres evaluations de la retention. (author) [Spanish] Recientemente el estroncio 90 viene utilizandose en cantidades de multikilocuries como fuente termica para generadores termoelectricos. El titanato fue cuidadosamente eiegido para este proposito como la forma quimica que reune las mejores condiciones, incluyendo la resistencia a la corrosion; para el'caso de una liberacion accidental al medio ambiente. El accidente sufrido por un obrero de la industria el 26 de junio de 1963 al exponerse a la accion de polvo de titanato de estroncic-90, originalmente en forma de particulas de unas 120 {mu} o menos, brindo la oportunidad de determinar la carga corporal de este compuesto; que se considera-como altamente insoluble. Debido al comportamiento fisico y biologico de las particulas, se supuso que el tamano real de las mismas, que se dispersaron fueron ingeridas o inhaladas, o ambas cosas, por la-persona expuesta, era del orden de 1 a 30 p. Se utilizaron tres tecnicas diferentes para estimar-la carga corporal. La antropogamma- metria lleyada a cabo por el Dr. Charles E. Miller en el Laboratorio Nacional de Argonne, que solo proporciono un limite superior debido a la inespecificidad del espectro de la radiacion de frenado (Bremsstrahlung) del estroncio-90 - itrio-90, indico una cantidad total de 4,8 {mu}c para la carga corporal inicial. El segundo metodo, basado en la recoleccion de toda'la orina y hecesarrojo un total de 5,0 {mu}c en los 20 primeros dias. Al combinar esta cantidad con una estimacion de la que qufedaba retenida en el cuerpo, se obtuvo una carga inicial de-5.2 Me. La'tercera tecnica, esto es, la determinacion de radiactividad en la sangre, indico una carga inicial de 6 {mu}c. La relacion de contenidos en heces y orina fue, durante los primeros 20 d, de 15 a 1, realizandose la excrecion del 94% de la totalidad del estroncio-90 por el tracto gastrointestinal. Es de destacar, sin embargo, que una buena parte era soluble. Al vigesimo dia del accidente, se calculo que la cantidad presente en el cuerpo era solamente un 5% del total inicial. Se describen los metodos empleados durante aquel periodo para estimular la excrecion fecal por medio de MgSO y-la urinaria por una combinacion de gluconato de calcio y NH Cl. Asimismo, se presentan esquemas de excrecion y evaluaciones actuales de la cantidad retenida por el cuerpo. (author) [Russian] Stroncij-90 ispol'zovalsja nedavno v bol'shih kolichestvah (neskol'ko kilokjuri) kak istochnik tepla dlja termojelektricheskih generatorov. Dlja jetoj celi posle tshhatel'nogo otbora byl vzjat titanat, kak himicheskaja forma, nailuchshim obrazom otvechajushhaja vsem trebovanijam, vkljuchaja inertnost'-k vlijaniju k rrozii v, sluchae, avarijnogo vysvobozhdenija v okruzhajushhuju sredu. Posle promyshlennogo avarijnogo obluchenija odnogo rabochego 26 ijunja 1963 goda poroshkom titanata stroncija-90,pervonachal'no v forme chastic okolo 120 mikron i-mel'che, sdelana popytka ocenit' soderzhanie vo vsem organizme, jetogo, kak-predpolagaetsja, v vysshej stepeni nerastvorimogo soedinenija. Uchityvaja fizicheskoe i biologicheskoe povedenie chastic,predpolozhili, chto fakticheskij razmer chasticy, kotoraja dispersirovalas, pogloshhalas' i/ili vdyhalas' obluchennym pacientom, sostavljal 1-30 mikron. Dlja ocenki soderzhanija radioaktivnosti v organizme ispol'zovalis' tri metoda. Pervyj metod- izmerenie obluchenija vsego organizma. Ono provodilos' d-rom Ch.Millerom v Argonskoj nacional'noj laboratorii, chto pozvolilo opredelit' tol'ko verhnij predel iz-za nejarko vyrazhennogo spektra tormoznogo izluchenija stroncij-90 - ittrij-90 i ukazalo na pervonachal'noe soderzhanie radioaktivnosti vo vsem organizme ravnoe'4,8 mkkjuri. Vtoroj metod - sbor vsego kolichestva mochi i- kala dal 5 mkkjuri dlja pervyh 20 dnej.: Putem soedinenija jetogo kolichestva s predpolagaemym kolichestvom, ostavshimsja v organizme,bylo polucheno pervonachal'noe1 soderzhanie radioaktivnosti vo vsem-organizme 5,2. mkkjuri. Tretij metod -opredelenie .radioaktivnosti krovi ukazal na pervonachal'noe soderzhanie radioaktivnosti vo vsem organizme ravnoe -6 mkkjuri. Sootnoshenie vydelenija izotopa s mochoj i kalom v pervye 20.dnej sostavljalo 15,: 1 i 94% vydeljajushhegosja stroncija-90 prohodilo cherez zheludochno-kishechnyj trakt. Odnako interesno otmetit', chto znachitel'naja frakcjja byla nesomnenno rastvorima. K 20 dnju posle avarii bylo podschitano', chto zaderzhka izotopa v organizme sostavljala tol'ko 5% ot obshhego pogloshhenija. Daetsja opisanie metodov, ispol'zovavshihsja v jetot'period, dlja uvelichenija vyvedenija s'kalom s pomoshh'ju- MgSO i vydelenija s mochoj putem kombinacii gljukonata kal'cija's NH{sub 4}Cl. Predstavleny posledujushhie sposoby vyvedenija -odnovremennaja ocenka ostavshegosja v organizme kolichestva izotopa. (author)

  8. Molecular and functional characterization of a human ATM gene analogue at Arabidopsis thaliana; Caracterisation moleculaire et Fonctionnelle d'un Homologue du gene humain ATM chez Arabidopsis thaliana

    Energy Technology Data Exchange (ETDEWEB)

    Garcia, V.

    2001-12-15

    The human ATM gene, whose inactivation is responsible for the human disease ataxia telangiectasia is conserved throughout the Eukaryotes and plays an important role in the cellular responses to DNA damage, in particular to DNA double-strand breaks (DSBs). Here we describe the identification of an Arabidopsis thaliana homologue of ATM (AtATM), and the molecular and cytological characterization of plants, hereafter called atm, carrying a disrupting T-DNA insertion in this gene. AtATM covers a 32 kb region on chromosome 3. The AtATM transcript has a complex structure, is 12 kb long and formed by 79 exons. The transcriptional level of AtATM is very low in all the tissues tested, and does not vary after exposure to ionizing radiations (IR). In atm plants, the protein is not detected suggesting the mutants are null. The atm mutants are partially sterile. Aberrant segregation of chromosomes during meiosis I on both male and female sides account for this sterility. However, meiotic recombination frequency is normal. Mutant plants are also hypersensitive to gamma rays and methyl methane sulfonate, but not to UV-B, pointing to a specific defect of atm mutants in the response to DNA DSBs. In plants, ionizing radiations induce a strong, rapid and transient transcriptional activation of genes involved in the cellular response to or the repair of DSBs. This transcriptional regulation of AtRAD51, AtPARP1, atGR1 and AtL1G4 is lost in the atm mutants . The absence of AtRAD51 induction associated with ionizing radiation sensitivity suggest that AtAtm play an important function in DSB repair by homologous recombination. In addition we show that homologous intra-chromosomal recombination frequency is elevated in the mutant comparing to wild-type, with or without gamma irradiation. These results show the implication of AtAtm in the genomic stability. (author)

  9. Human exposure to a 60 Hz, 1800 micro tesla magnetic field: a neuro behavioral study; Exposition humaine a un champ magnetique de 1 800 microtesla a 60 Hz: une etude neurocomportementale

    Energy Technology Data Exchange (ETDEWEB)

    Legros, A.; Corbacio, M.; Prato, F.S.; Thomas, A.W. [Lawson Health Research Institute and University of Western Ontario, St Joseph Health' s Care (Canada); Beuter, A. [Laboratoire IMS Institut de Polytechnique de Bordeaux, Universite de Bordeaux, 33 (France); Goulet, D. [Hydro-Quebec TransEnergie, Montreal (Canada); Lambrozo, J.; Souques, M. [Electricite de France, Service des Etudes Medicales, 75 - Paris (France); Plante, M. [Hydro-Quebec, Direction Sante et securite, Montreal (Canada)

    2010-05-15

    The effects of time-varying magnetic fields (MF) on humans have been actively investigated for the past three decades. One important unanswered question that scientists continue to investigate is the potential for MF exposure to have acute effects on human biology. Different strategies have been used to tackle this question using various physiological, neuro-physiological and behavioral indicators. For example, researchers investigating electro-encephalography (EEG) have reported that Extremely Low Frequency (ELF, < 300 Hz) MF can increase the resting occipital alpha rhythm (8-12 Hz) [1, 2]. Interestingly, other studies have demonstrated that human motor behavior can be modulated by ELF MF exposure, reporting that such an exposure can reduce anteroposterior standing balance oscillations [3, 4] or decrease physiological tremor intensity [5]. However, the main limitation in this domain is the difficulty of reproducing the results. A possible reason for this is the large variety of experimental approaches employed. Therefore, the aim of this project is to investigate the effects of a 60 Hz, 1800 muT MF exposure on physiological (i.e. heart rate and peripheral blood perfusion), neuro-physiological (brain electrical activity), and behavioral (postural oscillations, voluntary motor functions, and physiological tremor) aspects in humans using a single experimental procedure.Though the results from this study suggest a subtle reduction of human standing balance as well as a subtle increase of physiological tremor amplitude with MF exposure, no effect appeared on other investigated parameters, suggesting that one hour of 60 Hz, 1800 muT MF exposure may modulate human involuntary motor control without being detected in the electrical activity of the brain. (authors)

  10. Différenciation génétique des populations humaines pour les gènes de la réponse aux médicaments

    OpenAIRE

    Patillon, Blandine

    2014-01-01

    Response to drug treatment can be highly variable between individuals, both in terms of therapeutic effect (efficacy) and of adverse reactions (toxicity).Genetic factors affecting drug pharmacodynamics and pharmacokinetics play a major role in this inter-individual variability. Some of these factors are heterogeneously distributed among human populations. Local adaptation of populations to their environment partly explained those differences. Indeed,during human evolution, populations had to ...

  11. Consequences of gamma-irradiation on inflammatory cytokine regulation in human monocytes/macrophages; Consequences de l`irradiation gamma sur la regulation des cytokines de l`inflammation dans les monocytes/macrophages humains

    Energy Technology Data Exchange (ETDEWEB)

    Pons, I.; Gras, G.; Dormont, D.

    1995-12-31

    Inflammation is a frequent radiation-induced damage, especially after therapeutic irradiation. In this study, we have investigated, the inflammatory cytokine regulation after ionizing irradiation of monocytes/macrophages from four donors. Semi-quantitative RT-PCR revealed, after in vitro 24 h-differentiated monocytes irradiation between 5 to 40 Gy, no induction of interleukin-I{beta} (IL I{beta}), interleukin-6 (IL-6) and tumor necrosis factor-{alpha} (TNF-{alpha} mRNA) expression. Moreover, protein quantitation shows no significant increase of post-irradiation secretion. (author). 6 refs.

  12. Chromosomes and irradiation: in vitro study of the action of X-rays on human lymphocytes; Chromosomes et radiations: etude in vitro de l'action des rayons X sur les lymphocytes humains

    Energy Technology Data Exchange (ETDEWEB)

    Mouriquand, C; Patet, J; Gilly, C; Wolff, C

    1966-07-01

    Radioinduced chromosomal aberrations were studied in vitro on leukocytes of human peripheral blood after x irradiation at 25, 50, 100, 200, and 300 R. The numeric and structural anomalies were examined on 600 karyotypes. The relationship between these disorders and the dose delivered to the blood are discussed. An explanation on their mechanism of formation is tentatively given. (authors) [French] L'etude in vitro des anomalies chromosomiques radioinduites a ete pratiquee sur des leucocytes de sang peripherique preleve chez 4 sujets et irradie aux doses de 25, 50, 100, 200, 300 R. Les aberrations numeriques et structurales ont ete examinees sur 600 caryotypes. Les rapports entre ces anomalies et les doses appliquees sont etudies. Une hypothese sur leur mecanisme de formation est avancee. (auteurs)

  13. Human and technical factors in the doses reduction and optimization at Cogema/Marcoule; Facteurs techniques et humains dans la reduction et l'optimisation des doses a Cogema/Marcoule

    Energy Technology Data Exchange (ETDEWEB)

    Bourgogne, J.L. [Cogema, 30 - Marcoule (France)

    1998-07-01

    In the case of Cogema/Marcoule, the constant decrease of radiation doses is attributed to three factors: technical with a surveillance system and doses optimization, relational with the promotion of confidence in teams of radiation protection services as an acceptation factor of radiation protection techniques and psychological with an evolution of minds towards the ALARA approach. (N.C.)

  14. Light ions radiobiological effects on human tumoral cells: measurements modelling and application to hadron-therapy; Mesures et modelisation des effets radiobiologiques des ions legers sur des cellules tumorales humaines: application a l'hadrontherapie

    Energy Technology Data Exchange (ETDEWEB)

    Jalade, P

    2005-11-15

    In classical radiotherapy, the characteristics of photons interactions undergo limits for the treatment of radioresistant and not well located tumours. Pioneering treatments of patients at the Lawrence Laboratory at Berkeley has demonstrated two advantages of hadrons beams: the Relative Biologic Effect (the RBE) and the ballistic of the beams. Since 1994, the clinical centre at Chiba, has demonstrated successfully the applicability of the method. A physics group, managed by G. Kraft, at Darmstadt in Germany, has underlined the advantages of carbon beams. An European pool, called ENGIGHT (European Network for LIGHt ion Therapy) has been created in which the French ETOILE project appeared. The purpose of the thesis concerns measurements and models of 'in vitro' human cells survival. In the first part, the nowadays situation in particles interactions, tracks and cells structures and radiobiology is presented here. The second is devoted to the models based on the beam tracks and localization of the physical dose. Discussion of sensitivity to various parameters of the model has been realized with the help of numerical simulations. Finally the predictions of the improved model has been compared to experimental irradiations of human cells with argon and carbon beams of the GANIL machine. Conclusion of such study shows the performance and limits of a local model for predicting the radiobiological efficiency of light ions in hadron-therapy. (author)

  15. La toxoplasmose au cours de l'infection par le virus de l'immunodéficience humaine : épidémiologie descriptive et facteurs prédictifs

    OpenAIRE

    Rabaud , Christian

    2000-01-01

    We have first studied extra-cerebral localizations of toxoplasmosis during HIVinfection : 199 cases were recorded during a multicentric national survey begun in 1992, the greatest serie published today. Extra-cerebral toxoplasmosis was recorded in 1.5 to 2 % of French AIDS patients. All organs could be attacked. Diagnosis methods differ considering extra-cerebral localization. Mainly, at least one focal manifestation consistent with an acute disorder in the extracerebral organ infected with T...

  16. Développement d'un modèle ostéoarticulaire du genou humain pour une analyse dynamique du contact en grands déplacements

    OpenAIRE

    Bideau , Nicolas; Dao , T.T.; Rassineux , Alain; Ho Ba Tho , Marie-Christine

    2011-01-01

    National audience; Le principal objectif de ce travail est le développement d'un modèle tridimensionnel de l'articulation du genou en grands déplacements. A partir des données d'imagerie médicale (IRM), un modèle géométrique 3D a été développé. Ce modèle est résolu par la méthode des éléments finis. La simulation proposée permet de comprendre le comportement dynamique des différentes structures articulaires lors d'un mouvement de grande amplitude.

  17. Les sciences humaines dans les parcours scientifiques et techniques professionnalisants : quelles finalités et quelles modalités pratiques ? Présentation générale 

    Directory of Open Access Journals (Sweden)

    Bernard Comité éditorial : Alain

    2014-01-01

    Full Text Available Cette introduction a été rédigée par les membres du comité éditorial, également membres du groupe « Sciences et Techniques en interférences » 1 de l'Université Paris-Est-Créteil (UPEC. Elle décrit d'abord l'origine de ce volume collectif, le contexte institutionnel et de recherche des questions qui y sont soulevées. Elle présente le mode de composition du recueil, notamment la manière dont la répartition thématique des différentes contributions a été obtenue. Ensuite, cinq parties correspondant aux cinq sections du volume introduisent les contributions qui y ont été rassemblées en soulignant, lorsqu'il y a lieu, les thématiques communes et les champs concernés. La première partie, Etudes comparatistes, renvoie à des études globales au niveau français ou européen. Elle est complétée par la seconde, Influence du contexte local, qui présente des études de cas plus localisées et focalisées sur l'importance du contexte institutionnel. La partie suivante, Dispositif pédagogiques, présente d'autres études de cas qui problématisent principalement l'ingénierie pédagogique mise en œuvre. La quatrième partie, Formation et Recherche, s'intéresse à trois modes originaux d'articulation entre formation professionnelle et initiation à la recherche. Enfin la dernière partie, Fondements et Enjeux, rassemble des contributions à caractère philosophique, sociologique et historique interrogeant les enjeux fondamentaux sous-jacents à la conception des formations qui font l'objet du volume.

  18. Light ions radiobiological effects on human tumoral cells: measurements modelling and application to hadron-therapy; Mesures et modelisation des effets radiobiologiques des ions legers sur des cellules tumorales humaines: application a l'hadrontherapie

    Energy Technology Data Exchange (ETDEWEB)

    Jalade, P

    2005-11-15

    In classical radiotherapy, the characteristics of photons interactions undergo limits for the treatment of radioresistant and not well located tumours. Pioneering treatments of patients at the Lawrence Laboratory at Berkeley has demonstrated two advantages of hadrons beams: the Relative Biologic Effect (the RBE) and the ballistic of the beams. Since 1994, the clinical centre at Chiba, has demonstrated successfully the applicability of the method. A physics group, managed by G. Kraft, at Darmstadt in Germany, has underlined the advantages of carbon beams. An European pool, called ENGIGHT (European Network for LIGHt ion Therapy) has been created in which the French ETOILE project appeared. The purpose of the thesis concerns measurements and models of 'in vitro' human cells survival. In the first part, the nowadays situation in particles interactions, tracks and cells structures and radiobiology is presented here. The second is devoted to the models based on the beam tracks and localization of the physical dose. Discussion of sensitivity to various parameters of the model has been realized with the help of numerical simulations. Finally the predictions of the improved model has been compared to experimental irradiations of human cells with argon and carbon beams of the GANIL machine. Conclusion of such study shows the performance and limits of a local model for predicting the radiobiological efficiency of light ions in hadron-therapy. (author)

  19. Use of Biopsy Tissue Samples, Incubated In Vitro for Autoradiographic Measurement of Cell Proliferation in Human Tissues; Utilisation de Biopsies Incubees In Vitro pour la Mesure Autoradiographique de la Proliferation Cellulaire de Tissus Humains

    Energy Technology Data Exchange (ETDEWEB)

    Galand, P. [Faculte de Medecine de l' Universite Libre de Bruxelles, Bruxelles (Belgium)

    1970-02-15

    To avoid the radiobiological hazards linked to the use of {sup 3}H-thymidine, several workers have performed in vitro incubations of biopsy material in the presence of this labelled DNA -precursor. Attempts were made to define the proliferative pattern of the tissue from the distribution and intensity of labelling in autoradiographs. However, for true estimation of the cell cycle length, one has to know the S-phase (DNA-synthesis phase) duration, since the labelling index reflects only the part taken by this phase in the whole cell cycle. We chose the ''double-labelling technique'' with two dose levels of {sup 3}H-thymidine, which was developed by Maurer's group. By administering two pulses of the tritiated precursor (a weak dose and a heavy dose) at a given time interval and submitting the treated tissue to the autoradiographic process, one can calculate the S-phase duration(s) after the formula N{sub h}/N{sub w} = S/t. N{sub h} is the number of heavily labelled nuclei (i.e. those nuclei that were engaged in S-phase during the second pulse labelling); N{sub w} is the number of weakly labelled nuclei, corresponding to the cells which left S-phase during the time interval (t) between the two pulse labellings. From the percentage of heavily labelled nuclei in the whole population (L.I.), the generation time (G.T.) is then given by the formula G.T. = S/L.I. x 100. Human rectal and gastric biopsies were submitted to this procedure which, because of its brevity, requires simple survival conditions. Normal and pathologic cases were studied. Endometrial tissue is also currently under study. In parallel, experiments on animal tissues were also performed in order to make a comparison for the same individual between in vitro and in vivo measurements. This latter was realized by the classic method of the wave of labelled mitoses. The following aspects were examined: (1) Proper choice of the dose range, for valid recognition of ''weakly'' and ''heavily'' labelled cells; (2) choice of the region of the sample where homogeneous labelling occurs after the diffusion of the labelled thymidine, and (3) tests on the stability of the biopsy during incubation. This was done by using varied time interval between {sup 3}H-thymidine administrations. The good correlation between the results obtained in this way also gives supports to the validity of our distinction between the two kinds of labelling intensity. In conclusion, this method could be applied to several types of tissues, provided they can be obtained by biopsy, and with proper safeguards, namely in the choice of the doses range and in the definition of the proliferating population. (author) [French] Afin d'eviter les risques d'effets radiobiologiques lies a l'utilisation de thymidine tritiee, plusieurs chercheurs ont procede a des incubations de biopsies in vitro en presence de ce precurseur radiomarque de l'ADN. Ils s' efforcaient de definir le taux de proliferation cellulaire d'apres la distribution et l' intensite du marquage dans les autoradiographies. Toutefois, pour evaluer exactement la duree du cycle mitotique ou temps de generation, il est necessaire de connaitrez duree de la phase S (phase de synthese de l'ADN), car l'index de marquage ne depend que de l'importance de cette phase par rapport a la duree totale du cycle mitotique. L'auteur a choisi la methode du 'double marquage', utilisant deux differentes doses de thymidine tritiee, qui a ete mise au point par Maurer et ses collaborateurs. En administrant deux doses du precurseur tritie (une dose faible et une dose forte) a un intervalle de temps donne et en soumettant le tissu traite au processus autobiographique, on peut calculer la duree (s) de la phase S d'apres la formule N{sub F}/N{sub f} = S/t. Np est le nombre de noyaux fortement marques (c'est-a-dire les noyaux qui etaient en phase S pendant le deuxieme marquage); Nf est le nombre de noyaux faiblement marques, correspondant aux cellules qui ont quitte la phase S pendant l'intervalle de temps (t) entre les deux marquages. D'apres le pourcentage de cellules fortement marquees par rapport a la population totale (LI), on peut obtenir le temps de generation (TG) d'apres la formule: TG = S/LI x 100. Des biopsies rectales et gastriques de patients ont ete etudiees a l'aide de cette methode qui, etant donne la brievete du temps d'experience, exige des conditions de simple survie. Des cas normaux et des cas pathologiques ont ete etudies. Des tissus d'endometre font aussi actuellement l'objet d'etudes. Parallelement, des experiences ont ete executees sur des tissus animaux afin de comparer, pour le meme sujet, les mesures in vitro et in vivo. Les mesures in vivo ont ete effectuees au moyen de la methode classique de la 'courbe des mitoses marquees'. Les questions suivantes ont ete etudiees: 1) Choix des doses de thymidine tritiee permettant de distinguer les cellules 'faiblement' et 'fortement' marquees; 2) Determination de la zone de l'echantillon ou le marquage des noyaux est homogene apres diffusion de la thymidine tritiee; 3) Etude de la stabilite de la biopsie pendant l'incubation. A cette fin, l'auteur a fait varier l'intervalle de temps entre les deux administrations de thymidine tritiee. La concordance des resultats obtenus de cette maniere constitue egalement un argument en faveur de la validite de la methode du double marquage. L'auteur conclut que cette methode pourrait etre appliquee a plusieurs types de tissus, a condition que ceux-ci puissent etre preleves par biopsie et que les precautions necessaires soient prises, en ce qui concerne l'intervalle des doses et la definition de la population de cellules qui prolifere. (author)

  20. Use of recombinant human thyrotropin (rh TSH) as a method of preparation for radioiodine therapy in thyroid disorders; Utilisation de la thyreostimuline humaine recombinante dans la preparation au traitement par iode-131 des pathologies thyroidiennes

    Energy Technology Data Exchange (ETDEWEB)

    Taieb, D.; Guillet, B.A.; Tessonnier, L.; Mundler, O. [Centre Hospitalo-Universitaire de la Timone, Service Central de Biophysique et de Medecine Nucleaire, 13 - Marseille (France)

    2008-02-15

    The introduction of recombinant human TSH (rh TSH) as a method of preparation for radioiodine therapy of follicular-derived thyroid tumors (benign and malignant) is a significant medical advance. Rh TSH has been approved for use in remnants ablation after total thyroidectomy for carcinoma. There are other potential uses for rh TSH that have not yet been licensed. The use of rh TSH allows to reduce administrated doses in goiters through an increase of iodine uptake and a more homogeneous distribution of radioiodine in the gland. Rh TSH also improves thyroid cancer patients quality of life by avoiding hypothyroidism. (authors)

  1. Balance between automation and human actions in nuclear power plant operation. Results of international cooperation; Equilibre entre automatisation et action humaine dans la conduite des centrale nucleaires, resultats de la cooperation internationale

    Energy Technology Data Exchange (ETDEWEB)

    Sun, B [CEA Centre d' Etudes Nucleaires de Fontenay-aux-Roses, 92 (France). Dept. d' Analyse de Surete; Bastl, W [Gesellschaft fuer Reaktorsicherheit m.b.H. (GRS), Garching (Germany); Olmstead, R [Atomic Energy of Canada Ltd, Mississauga (Canada); Oudiz, A [Electric Power Research Inst., Palo Alto, CA (United States); Jenkinson, J [Nuclear Electric PLC, Gloucester (United Kingdom); Kossilov, A [International Atomic Energy Agency, Vienna (Austria)

    1990-07-01

    Automation has long been an established feature of power plants. In some applications, the use of automation has been the significant factor which has enabled plant technology to progress to its current state. Societal demands for increased levels of safety have led to greater use of redundancy and diversity and this, in turn, has increased levels of automation. However, possibly the greatest contributory factor in increased automation has resulted from improvements in information technology. Much recent attention has been focused on the concept of inherently safe reactors, which may simplify safety system requirements and information and control system complexity. The allocation of tasks between man and machine may be one of the most critical activity in the design of new nuclear plants and major retro-fits and it therefore warrants a design approach which is commensurate in quality with the high levels of safety and production performance sought from nuclear plants. Facing this climate, in 1989 the International Atomic Energy Agency (IAEA) formed an advisory group from member countries with extensive experience in nuclear power plant automation. The task of this group was to advise on the appropriate balance between manual and automatic actions in plant operation. (author) [French] L'automatisation a longtemps ete une caracteristique bien etablie des centrales nucleaires. Dans certaines applications, l'utilisation de l'automatisation a ete le facteur decisif qui a permis a la technologie des centrales de progresser jusqu'a son etat actuel. Les exigences de l'opinion publique en matiere de securite renforcee ont conduit a l'utilisation d'une plus grande redondance et a une plus grande diversification et ceci, en retour, a encore accru le niveau d'automatisation. Toutefois, il est possible que le facteur preponderant de cet accroissement de l'automatisation soit constitue par les progres effectues dans la technologie de l'information. Plus recemment, l'attention s'est portee sur le concept de reacteurs 'intrinsequement surs', ce qui pourrait simplifier les equipements de securite, et reduire la complexite des systemes d'information et de controle. La repartition des taches entre homme et machine pourrait bien etre l'une des etapes les plus critiques dans la conception d'une centrale nucleaire et l'un des progres les plus sensibles; de ce fait, elle garantit une approche dans la conception qui est commensurable en qualite avec les hauts niveaux de securite et de qualite de production recherches pour les centrales nucleaires. C'est dans ce climat que l'Agence Internationale pour l'Energie Atomique (AIEA) a constitue en 1989 un groupe de recherche auquel participent les pays membres, lequel groupe possede une experience etendue dans le domaine de l'automatisation des centrales nucleaires. La tache de ce groupe etait d'evaluer ou se situait le juste equilibre entre actions manuelles et automatiques dans la conduite des centrales. Se basant sur des recherches anterieures et sur l'experience de ses membres, le groupe a determine que toute solution unique, totalement deterministe, au probleme de la repartition des taches est impossible. Cependant, dans la mesure ou le role de l'operateur est appele progressivement a se transformer, avec le temps, en un role de gestionnaire du systeme, il est imperatif qu'une procedure systematique de repartition des taches soit utilisee par l'equipe chargee de la conception. Le groupe a propose une methodologie qui s'appuie sur des travaux deja publies, mais il adopte une approche pragmatique, adaptee aux besoins reels des projets. Cette methodologie caracterise un certain nombre de facteurs qui relevent des processus de prise de decision, guide une telle prise de decision, et identifie les secteurs dont il considere qu'ils doivent devenir l'objet de recherches ulterieures. (author)

  2. Analyse des génomes à la recherche de répétitions en tandem polymorphes : outils d?épidémiologie bactérienne et locus hypermutables humains

    OpenAIRE

    Denoeud , France

    2003-01-01

    thèse soutenue par la DGA; Tandem repeats are consecutive occurrences of a DNA unit. Such structures are found in all organisms, prokaryotes as well as eukaryotes. Although their biological function is not fully understood, they have diverse practical applications. In bacteria, polymorphic tandem repeats (with varying copy numbers), are powerful tools for strain identification in bacterial epidemiology. In humans, some tandem repeats mutate at a very high rate: hypermutable minisatellites are...

  3. L’Homme, un itinéraire vietnamien. Humanisme et sujet humain au xxe siècle Man, a Vietnamese Itinerary. Humanism and the Human Subject in the 20th Century

    Directory of Open Access Journals (Sweden)

    Daniel Hémery

    2009-10-01

    Full Text Available Cette étude interroge la confrontation qui s’est instaurée au Vietnam depuis le milieu du xixe siècle – et sans doute bien avant – entre la conception de l’homme-individu importée par les Occidentaux en Asie orientale et les philosophies du sujet qui s’y étaient développées depuis l’antiquité chinoise. Cette confrontation a-t-elle abouti dans la culture vietnamienne à une réévaluation socialement acceptée du statut du sujet et sur une nouvelle figure de l’humanisme ? Quel bilan provisoire dresser ?This paper examines the mid 19th century encounter in Vietnamese culture of the concept of the individual imported by Westerners to Far East Asia with the philosophical tradition of the human subject that has developed in China since the classic period. Did this conflictual encounter result in a new, socially acceptable evaluation of the human statute and in a renewed Vietnamese humanism? This article concludes with a provisional assessment of a cultural confrontation.

  4. Study of the cell cycle control for human malignant mesothelioma lines. Interferon and radiations effect; Etude de la regulation du cycle cellulaire de lignees de mesotheliome malin humain. Effet de l'interferon et des radiations

    Energy Technology Data Exchange (ETDEWEB)

    Vivo, C

    1999-07-01

    In order to better understand the inhibition mechanisms of the IFN-R-HU on tumoral development, the IFN-R-U effect on MM lines has been studied. Three groups of lines has been distinguished: eight sensitive lines, two intermediate and three resistant. The sensitive lines showed a triple locking of the cell cycle: in phases S, G1 and G2. The study of the cell cycle control points function, realized by the MM lines radiation exposure showed the points function on G1/S and-or on G2/M and the dependence or non dependence of the cycle stop of the protein P53 and P21 W at F1/CIP1. (A.L.B.)

  5. Development of emergency response training program based on human factors; Developpement d'un programme de formation pour la reaction aux situations d'urgences base sur les facteurs humains

    Energy Technology Data Exchange (ETDEWEB)

    Nakata, Y. [Osaka Gas Co., Ltd. (Japan)

    2000-07-01

    A training program has been developed at Osaka Gas Co., Ltd. to improve personal response to emergency situations by enabling plant shift chiefs to understand the unique human behavioral patterns that appear during emergencies. The program provides comprehensive and systematic training consisting of lectures and seminars based on a Human Factor Handbook, simulation training, and feedback training. The program can also be applied to all areas of the process industry. (author)

  6. Silver Games : étude des facteurs humains dans le développement de jeux vidéos adaptés aux personnes âgées

    OpenAIRE

    Legouverneur, Gregory

    2014-01-01

    For many years, research in the field of aging has focused on understanding this complex phenomenon and identifying solutions to medical, economic, psychological or sociological issues linked to it. In this context, the aim of this thesis was to identify factors that facilitate the use of video games as a medium for cognitive stimulation in older adults. To answer this question, two studies were carried out: the first one focused on exploring the gameplay of the Nintendo Wii, and the second o...

  7. Sujet, être, être-là : Heidegger, ou l’être humain entre pensée juive et philosophie grecque Subject, Being, Being-there: Heidegger or the Human Being between Jewish Thinking and Greek Philosophy

    Directory of Open Access Journals (Sweden)

    Josef Schovanec

    2011-10-01

    Full Text Available In the sixties and seventies, theoretical discussions in European social sciences focused on the nature of the human being. Proponents of the rational subject, characterizing. Enlightenment-prone Western classical philosophy, went against the advocates of the much older and less-known anti-subjective tradition. Our study aims at giving an archaeological insight into this second paradigm, going back first to Heidegger, the master thinker of contemporary European social sciences, then to the religious – mainly Jewish – roots of his thought. It views human being not as an achieved and autonomous entity, but as an emanation of the Being. Men have to follow the path it sets and its voice, free themselves from material assets which are mere impediments, and eventually enter into a superior dimension of thinking. Beyond our limited case-study, the whole question of the persistence of another main - albeit forgotten - way of thinking in the very heart of modernity is being raised anew.

  8. Detection of sequential activation of left atrium and coronary sinus musculature in the general population

    Directory of Open Access Journals (Sweden)

    Masaki Ota, MD

    2016-12-01

    Conclusions: Far-field LA potentials are often recorded in the CS during sequential LA and CSM activation in the general population. The timing of LA potentials in CS recordings reflected the direction of conduction across the CSM.

  9. Dicty_cDB: VFK143 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Q) /CSM/SL/SLC3-C/SLC352Q.Seq.d/ 1336 0.0 SFE831 (SFE831Q) /CSM/SF/SFE8-B/SFE831Q.Seq.d/ 1336 0.0 AHD492 (AHD492...Q) /CSM/AH/AHD4-D/AHD492Q.Seq.d/ 1336 0.0 AFG189 (AFG189Q) /CSM/AF/AFG1-D/AFG

  10. Spectrum structure and coherent state of the two-particle Calogero-Sutherland model: an application of the pseudo-angular-momentum operator method

    International Nuclear Information System (INIS)

    Li Wenbo; Li Mishan; Li Yaling; Wen Xiaoyang; Yuan Guangjun; Zhang Chi; Yang Tao

    2005-01-01

    The generality of the Calogero-Sutherland model (CSM) is studied with the aid of its several variations. The CSM is then solved by a new approach, the pseudo-angular-momentum operator method. The symmetry in spectrum space and valid region of the parameter are discussed. Analytic expressions of the eigenstate are obtained. The coherent states of the CSM are also discussed

  11. 22 Sanou_F 03.pmd

    African Journals Online (AJOL)

    hond

    au niveau du corps humain, il peut s'agir d'un faux visage, de l'aspect réel d'un visage humain ; au niveau des arts plastiques, le masque peut être la reproduction d'un visage humain ou animal ; le masque peut aussi être un simple objet à l'image des masques à gaz, d'une élévation de terre, d'un abri en acier, etc. Il existe ...

  12. Replacing soybean meal for cottonseed meal on performance of lactating dairy cows.

    Science.gov (United States)

    Imaizumi, Hugo; De Souza, Jonas; Batistel, Fernanda; Santos, Flávio Augusto Portela

    2016-01-01

    Cottonseed meal (CSM) is an alternative source of protein, and previous studies have been shown that it can replace soybean meal (SBM) without decrease animal performance. However, Brazilian CSM has a different chemical composition compared with the usual CSM reported in the literature. The objective of this experiment was to evaluate the effects of replacing SBM for Brazilian CSM on performance and energy balance of mid-lactating dairy cows. Forty-two Holstein cows were used in a replicate 3 × 3 Latin square design. Increasing contents of CSM (0, 15, and 30% of dry matter (DM)) were fed in diets to replace SBM. Milk yield and feed efficiency were linearly reduced with the replacement of CSM for SBM (P = 0.001). Milk fat content tended to increase quadratically (P = 0.07) with CSM addition. Replacing SBM for CSM affected milk protein content quadratically (P = 0.05). Milk urea nitrogen and plasma urea nitrogen (PUN) tended to respond quadratically (P = 0.06 and 0.10) when CSM replaced SBM to the diets. Variation in body weight (BW) also responded quadratically as CSM replaced SBM (P = 0.05). Altogether, the findings suggest better performance when cows receive SBM diet compared with the Brazilian CSM diet.

  13. Cervical spondylotic myelopathy: the clinical phenomenon and the current pathobiology of an increasingly prevalent and devastating disorder.

    Science.gov (United States)

    Kalsi-Ryan, Sukhvinder; Karadimas, Spyridon K; Fehlings, Michael G

    2013-08-01

    Cervical spondylotic myelopathy (CSM) is a common disorder involving chronic progressive compression of the cervical spinal cord due to degenerative disc disease, spondylosis, or other degenerative pathology. CSM is the most common form of spinal cord impairment and causes functional decline leading to reduced independence and quality of life. Despite a sound understanding of the disease process, clinical presentation and management, a universal definition of CSM and a standardized index of severity are not currently used universally. Work is required to develop a definition and establish clinical predictors of progression to improve management of CSM. Despite advances in decompressive and reconstructive surgery, patients are often left with residual disability. Gaps in knowledge of the pathobiology of CSM have limited therapeutic advances to complement surgery. Although the histopathologic and pathophysiologic similarities between CSM and traumatic spinal cord injury have long been acknowledged, the unique pathomechanisms of CSM remain unexplored. Increased efforts to elucidate CSM pathobiology could lead to the discovery of novel therapeutic targets for human CSM and other spinal cord diseases. Here, the natural history of CSM, epidemiology, clinical presentation, and current methods of clinical management are reported, along with the current state of basic scientific research in the field.

  14. Conférence principale : Le changement climatique mondial, ses ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    10 mai 2011 ... Écosystèmes et santé humaine ... dioxyde de carbone dans l'atmosphère « très au‑delà de la limite [historique] ... de développement humain sans surcharger son environnement ». ... Institut national pour la recherche spatiale.

  15. 413-IJBCS-Article-Dr Biego Henri

    African Journals Online (AJOL)

    User

    humaine est clairement établie. En effet, ces .... Les valeurs entre parenthèses représentent les valeurs limites (minima et extrema). Tableau 2: .... National de Recherche Agronomique en. 2001. ... Initiative de Programme Ecosystèmes et Santé. Humaine. Centre de Recherches pour le. Développement International, p. 4.

  16. Gestionnaire, Relations de travail et relations avec les employés (h/f ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Assurer l'établissement de rapports organisationnels fiables sur le rendement de la gestion des ressources humaines par rapport au Plan de mise en oeuvre des ressources humaines, au Rapport annuel du CRDI, aux tableaux de bord organisationnels et autres obligations de production de rapports en coordonnant la ...

  17. 2183-IJBCS-Article-Bouet Alphonse

    African Journals Online (AJOL)

    hp

    Short Communication http://indexmedicus.afro.who.int. Impact de la surveillance humaine sur les dégâts d'oiseaux en riziculture pluviale. Alphonse BOUET 1* ..... dès le lever du soleil pour rejoindre leurs refuges après le coucher du soleil. Il faut par ailleurs une ressource humaine suffisante pour mieux quadriller le champ.

  18. : tous les projets | Page 436 | CRDI - Centre de recherches pour le ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Tout -, Développement, Économie, Environnement, Évaluation, Alimentation et agriculture ... Les auteurs du Rapport arabe sur le développement humain 2005 mettent en évidence un ... à savoir l'abondance de capital humain féminin qualifié dans la région du Moyen-Orient et de ... Programme: Emploi et croissance.

  19. Partners in Physics with Colorado School of Mines' Society of Physics Students

    Science.gov (United States)

    Moore, Shirley; Stilwell, Matthew; Boerner, Zach

    2011-04-01

    The Colorado School of Mines (CSM) Society of Physics Students (SPS) revitalized in 2008 and has since blown up with outreach activity, incorporating all age levels into our programs. In Spring 2010, CSM SPS launched a new program called Partners in Physics. Students from Golden High School came to CSM where they had a college-level lesson on standing waves and their applications. These students then joined volunteers from CSM in teaching local elementary school students about standing waves beginning with a science show. The CSM and high school students then helped the children to build make-and-take demonstrations incorporating waves. This year, rockets are the theme for Partners in Physics and we began with demonstrations with local middle school students. In Spring 2011, CSM SPS will be teaching elementary school students about projectile motion and model rockets along with these middle school students. Colorado School of Mines Department of Physics

  20. Dicty_cDB: SLG376 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 572Q) /CSM/SS/SSD5-C/SSD572Q.Seq.d/ 555 e-157 CHB571 (CHB571Q) /CSM/CH/CHB5-C/CHB571Q.Seq.d/ 494 e-139 CFD492 (CFD492...Q) /CSM/CF/CFD4-D/CFD492Q.Seq.d/ 474 e-133 own update 2003.10.30 Homology vs DNA Score E Sequences

  1. Developing a conceptual model for the internal data source to measure customer satisfaction

    OpenAIRE

    Al-Mutawa, T; Eldabi, T; Brinkman, WP

    2006-01-01

    Traditional CSM approach is performed at certain frequencies. The gap between such events can be termed as a ‘blind period’, because customer satisfaction is left unobserved and unmanaged. The blind period may sometimes accelerate the growth of customer dissatisfaction. One way to eliminate the impact of the blind period is to reduce the gap between CSM events. The initial assessment indicates that conducting CSM more frequently, may weaken the accuracy of measurement, and increase the cost o...

  2. Dicty_cDB: VFA373 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available qlfqeilkkmfnmplkvsngwvy*vlmkkl*irilqsivfalyskr nsltklvnvm*lslnitlssntlivqkkkfhhsfvmvfqmvvlqlhsllvfqlvsqlnss lmvklqlevllvq*llilftnfrei...kixkyxxxklnkk*kikkklifkkn Homology vs CSM-cDNA Score E S

  3. Dicty_cDB: VHE632 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available KKIFXFFFXKKK--- ---YKKLFINNIYIQWVTEHSKHTTVTT*aldtitsrpttvitiitltsisktteaklx* epiavntfqlvtinkftshttytvtnqxst*...tshttytvtnqxst*ntttvkxqskvittxtylltvtvmsxxpi ttiimlxskntsykqinkxkkk Homology vs CSM-cDNA Score E Sequences p

  4. Dicty_cDB: VHH141 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available avntfqlvtinkftshttytvtthssx*ntttvkxqskvittttslltvtvmsxppit tiimllskntsxkqinktikmckilk Translated Amino Acid ...tvtthssx*ntttvkxqskvittttslltvtvmsxppit tiimllskntsxkqinktikmckilk Homology vs CSM-cDNA Score E Sequences pr

  5. Corporate Sustainability Management and Its Market Benefits

    Directory of Open Access Journals (Sweden)

    Joonhyun Kim

    2018-05-01

    Full Text Available An increasing number of firms around the world are applying corporate sustainability management (CSM to their business operations, and the research interest on the effect of CSM in terms of the capital market benefit has grown rapidly under the different research settings across various countries. This study investigates whether CSM contributes to increasing firm value and improving the market response to earnings disclosure, using Korean firms as the sample. The test results show that firms with CSM reporting outperform the other firms in terms of Tobin’s Q and the market-adjusted stock returns over a year. Further, investors respond more strongly to the earnings announcement events of the CSM firms than the non-CSM firms, which is more likely to be attributed to the enhanced corporate disclosure practice of the CSM firms than an improvement in earnings quality. Our findings indicate that the shareholders of firms with CSM reporting can enjoy relatively higher market valuations and enhanced information content of earnings disclosures. In conclusion, the results show that the CSM activities in pursuit of a harmonious relationship with the various stakeholders bring different forms of market benefits to shareholders as well.

  6. Dicty_cDB: Contig-U14032-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available IIIIIITIIIXXIXIXKXXXXXYXY Frame B: xxxxxxkxxxxxkxkkx*kkx*k*x********q***xx*xxkkxxxxxxii Frame C: xxxxxxxxkxxxx...kkxnkkxnknxnnnnnnnnnnnnxnxxnxkkxxxxxxls own update ---------- Homology vs CSM-c

  7. Dicty_cDB: SFC593 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available IIIIIIIIIXXHXHX A Frame B: ---sssssssssssssssssssssssssssssssssssssssssssssssssssvxixix l Frame C: ---hhhh...hhhhhhhxhxhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhxssssss s Homology vs CSM-cDNA *****

  8. Cellulose/soy protein isolate composite membranes: evaluations of in vitro cytocompatibility with Schwann cells and in vivo toxicity to animals.

    Science.gov (United States)

    Luo, Lihua; Gong, Wenrong; Zhou, Yi; Yang, Lin; Li, Daokun; Huselstein, Celine; Wang, Xiong; He, Xiaohua; Li, Yinping; Chen, Yun

    2015-01-01

    To evaluate the in vitro cytocompatibility of cellulose/soy protein isolate composite membranes (CSM) with Schwann cells and in vivo toxicity to animals. A series of cellulose/soy protein isolate composite membranes (CSM) were prepared by blending, solution casting and coagulation process. The cytocompatibility of the CSM to Schwann cells were evaluated by MTT (3-(4,5-dimethylthiazol-2-yl)-2,5-diphenyltetrazolium bromide) assay and by direct cells culture of Schwann cells on the surfaces of the CSM, respectively. The in vivo toxicity of the CSM to animals were also evaluated by acute toxicity testing, skin sensitization testing, pyrogen testing and intracutaneous stimulation testing, respectively, according to the ISO 10993 standard. The MTT assay showed that the cell viability of Schwann cells cultured in extracts from the CSM was higher than that from the neat cellulose membrane without containing SPI component. The direct cells culture indicated that the Schwann cells could attach and grow well on the surface of the CSM and the incorporation of SPI into cellulose contributed to improvement of cell adhesion and proliferation. The evaluations of in vivo biological safety suggested that the CSM showed no acute toxicity, no skin sensitization and no intracutaneous stimulation to the experimental animals. The CSM had in vitro cytocompatibility with Schwann cells and biological safety to animals, suggesting potential for the applications as nerve conduit for the repair of nerve defect.

  9. Exploring the Physics of Unstable Nuclei

    Science.gov (United States)

    Volya, Alexander

    In this presentation the Continuum Shell Model (CSM) approach is advertised as a powerful theoretical tool for studying physics of unstable nuclei. The approach is illustrated using 17O as an example, which is followed by a brief presentation of the general CSM formalism. The successes of the CSM are highlighted and references are provided throughout the text. As an example, the CSM is applied perturbatively to 20O allowing one to explore the effects of continuum on positions of weakly bound states and low-lying resonances, as well as to discern some effects of threshold discontinuity.

  10. Proteomic comparison by iTRAQ combined with mass spectrometry of egg white proteins in laying hens (Gallus gallus) fed with soybean meal and cottonseed meal

    Science.gov (United States)

    He, Tao; Zhang, Haijun; Wang, Jing; Wu, Shugeng; Yue, Hongyuan; Qi, Guanghai

    2017-01-01

    Cottonseed meal (CSM) is commonly used in hens’ diets to replace soybean meal (SBM). However, the molecular consequences of this substitution remains unclear. To investigate the impact of this substitution at the molecular level, iTRAQ combined with biochemical analysis was performed in Hy-Line W-36 hens supplemented with a mixed diet of CSM and SBM. Egg weight, albumen height, and Haugh unit were significantly reduced in the CSM100 group (100% crude protein of SBM replaced by CSM) compared with the SBM group (Phen diet. PMID:28813468

  11. Dicty_cDB: VSE508 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available GAPSDEDRHVGDLGNIVADGESNTKGTISDKIISLFGEHTI VGRTMVVHADQDDLGKGGKPDSLTTGAAGARLGCGVIGVSQ*isn*nktllnikeappfy yyyfl...DSLTTGAAGARLGCGVIGVSQ*isn*nktllnikeappfy yyyfl Homology vs CSM-cDNA Score E Seque

  12. Dicty_cDB: VSB406 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available GTVRKAIARVLTVFNQTQKNHLR XVYSKKSSSKIPTDLRYKKTRAIRRRLTNKQSKVVTLRVSKTATNFPQRVFAVKA*ici* milknkiy Translated Ami...RRLTNKQSKVVTLRVSKTATNFPQRVFAVKA*ici* milknkiy Homology vs CSM-cDNA Score E Sequences producing significant a

  13. Dicty_cDB: VFD272 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available NIDGLKNVQTICYNNMSQCYLKEKKVPMLW*lqkkh*nyhqmilkhsl eklklyl*wrnmmklskiskks Translate...IAK YNKALRYLDCCSNIDGLKNVQTICYNNMSQCYLKEKKVPMLW*lqkkh*nyhqmilkhsl eklklyl*wrnmmklskiskks Homology vs CSM-cDNA

  14. The effect of carotid sinus massage is independent of posture in patients with heart disease

    DEFF Research Database (Denmark)

    Mickley, H; Hansen, K N; Oxhøj, H

    1989-01-01

    unilateral right- and left-sided CSM performed in the supine and in the sitting position, while heart rate and systolic blood pressure were monitored. No statistically significant differences in the CSM-induced response in systolic blood pressure or heart rate were found between the two postures....... In the supine position the drop in heart rate was significantly greater after right-sided than after left-sided CSM (P less than 0.05). In only one patient (1%) was a significant carotid sinus reflex evoked. The response was cardioinhibitory with asystole for 3700 ms during right-sided, supine CSM...

  15. Exploring the physics of unstable nuclei

    International Nuclear Information System (INIS)

    Volya, Alexander

    2015-01-01

    In this presentation the Continuum Shell Model (CSM) approach is advertised as a powerful theoretical tool for studying physics of unstable nuclei. The approach is illustrated using 17 O as an example, which is followed by a brief presentation of the general CSM formalism. The successes of the CSM are highlighted and references are provided throughout the text. As an example, the CSM is applied perturbatively to 20 O allowing one to explore the effects of continuum on positions of weakly bound states and low-lying resonances, as well as to discern some effects of threshold discontinuity. (author)

  16. Dicty_cDB: AFE377 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available iikkikxtrsvglfaslfyfffqkkx*kk--- ---xixqliiiiiiiiiiiiiiiiiiiiiiiiiiiiiiixiixxxxii...ssssssssssssssssxssxxxxsssalxxxxiixxx iixixi Homology vs CSM-cDNA Score E Sequences producing significant al

  17. Strong late-time circumstellar interaction in the peculiar supernova iPTF14hls

    Science.gov (United States)

    Andrews, Jennifer E.; Smith, Nathan

    2018-06-01

    We present a moderate-resolution spectrum of the peculiar Type II supernova (SN) iPTF14hls taken on day 1153 after discovery. This spectrum reveals the clear signature of shock interaction with dense circumstellar material (CSM). We suggest that this CSM interaction may be an important clue for understanding the extremely unusual photometric and spectroscopic evolution seen over the first 600 d of iPTF14hls. The late-time spectrum shows a double-peaked intermediate-width H α line indicative of expansion speeds around 1000 km s-1, with the double-peaked shape hinting at a disc-like geometry in the CSM. If the CSM were highly asymmetric, perhaps in a disc or torus that was ejected from the star 3-6 yr prior to explosion, the CSM interaction could have been overrun and hidden below the SN ejecta photosphere from a wide range of viewing angles. In that case, CSM interaction luminosity would have been thermalized well below the photosphere, potentially sustaining the high luminosity without exhibiting the traditional observational signatures of strong CSM interaction (narrow H α emission and X-rays). Variations in density structure of the CSM could account for the multiple rebrightenings of the light curve. We propose that a canonical 1 × 1051 erg explosion energy with enveloped CSM interaction as seen in some recent SNe, rather than an entirely new explosion mechanism, may be adequate to explain the peculiar evolution of iPTF14hls.

  18. Dicty_cDB: SLH810 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available frhfsdcriwlfwfcfinshtvsfflrisck*CFSFFFWTSGFSIRYLIYCNHLI ILIILCFVIISLFVTFL Translated Amino Acid sequence (Al...rame C: *fncyfrhfsdcriwlfwfcfinshtvsfflrisck*CFSFFFWTSGFSIRYLIYCNHLI ILIILCFVIISLFVTFL Homology vs CSM-cDNA

  19. Human Factors Issues for Controlling Uninhabited Aerial Vehicles: Preliminary Findings in Support of the Canadian Forces Joint Unmanned Aerial Vehicle Surveillance Target Acquisition System Project (Incidence des Facteurs Humains sur le Pilotage des Vehicules Aeriens Telepilotes: Constatations Preliminaires a L’Appui du Projet de Systeme Interarmees D’Acquisition D’Objectif au Moyen de Vehicules Aeriens Telepilotes de Surveillance des Forces Canadiennes)

    Science.gov (United States)

    2010-11-01

    signal detection theory measures of the user’s sensitivity (d ) and the user’s own criterion ( ) (Macmillan & Creelman , 1991), whereby a drop in arousal...Medical Research Council, H. M. Stationery Office. [67] Macmillan, N. A., & Creelman , C. D. (1991). Detection theory: A user’s guide. New York, NY

  20. DIANE, a simulation code for the interaction of neutrons with living tissues. Application to low doses of fast neutrons on human tumoral cells; DIANE, un code de simulation de l'interaction des neutrons avec la matiere vivante. Applications aux faibles doses de neutrons rapides sur des cellules tumorales humaines

    Energy Technology Data Exchange (ETDEWEB)

    Nenot, M.L

    2003-07-15

    Our work deals with the irradiation of cells and living tissues by 14 MeV neutrons at very low doses (a few 10{sup -2} Gy). Such experiments require an accurate knowledge of the values of neutron dose rates and fluences at the level of cell cultures. We have performed measurements of fluence rates through an activation method applied to gold and copper foils. The fluence rate is deduced from the gamma rays emitted by the irradiated foils. Neutron doses and dose rates have been measured through varied methods: PIN diodes, ionization tissue equivalent chambers, and Geiger-Mueller counters. We have designed the DIANE code to simulate the impact of energetic neutrons on cells. This code can be used with isolated cells or macroscopic tissues, it takes into account the roles of the ionisation electrons produced by recoil nuclei entering the cell. This point is all the more important since recent works have highlighted the impact of very low energy electrons on DNA. (A.C.)

  1. Influence de l'érythropoïétine recombinante humaine sur les fonctions cardiovasculaire et rénale chez le rat présentant une dysfonction endothéliale : effets des interactions avec l'exercice chronique

    OpenAIRE

    Meziri , Fayçal

    2011-01-01

    The chronic administration of rHuEPO can engender side effects. An increase of the hematocritinduced by rHuEPO, by increasing the erythrocytosis, the blood viscosity and the shear stress onvascular surface, can be responsible of arterial high blood pressure and arterial thrombosis. Thepresence of a normal endothelial function and nitric oxide (NO) can counter the noxious effectsof rHuEPO. On these bases, we studied the cardiovascular effects of a chronic administration ofrHuEPO in various fra...

  2. Adaptive response to ionizing radiation in normal human skin fibroblasts. Enhancement of DNA repair rate and modulation of gene expression. Reponse adaptative au rayonnement ionisant des fibroblastes de peau humaine. Augmentation de la vitesse de reparation de l'ADN et variation de l'expression des genes

    Energy Technology Data Exchange (ETDEWEB)

    Toledo, S.M. de; Mitchel, R.E.J. (Atomic Energy of Canada Ltd., Chalk River, ON (Canada). Chalk River Nuclear Labs.); Azzam, E. (Atomic Energy of Canada Ltd., Chalk River, ON (Canada). Chalk River Nuclear Labs. Ottawa Univ., ON (Canada). Dept. of Biology); Raaphorst, G.P. (Ottawa Univ., ON (Canada). Dept. of Biology)

    Low doses and dose rates of ionizing radiation enhance the rate of DNA repair in human fibroblasts and protect the cells against radiation-induced micronucleus formation. Chronic exposures reduce the mRNA levels of the genes topoisomerase II and FACC-1 (Fanconi's anemia, group C). (authors). 11 refs., 1 tab., 2 figs.

  3. Risque de salmonellose humaine liée à la consommation de fromage à pâte molle au lait cru : développement d'un modèle pour l'appréciation quantitative du risque

    OpenAIRE

    Fares , Almabrouk

    2007-01-01

    Salmonellae are one of the most important causes of foodborne illness associated with raw dairy products. The assessment of the real risk associated with the consumption of these products is needed and the most appropriate method to achieve this goal is the risk analysis process which links pathogens in food to the public health problem. The main aim of this thesis is to quantitatively assess the risk of human salmonellosis linked to the consumption of Camembert cheese made from raw milk. A d...

  4. Palaeo-ethnology, palaeo-environment and palaeo-climatology of Piaui, Brazil: palynological studies on human coprolites collected at the ``Pedra Furada`` site; Paleoethnologie, paleoenvironnement et paleoclimatologie du Piaui, Bresil: apport de l`etude pollinique de coprolithes humains recueillis dans le gisement prehistorique de ``Pedra Furada``

    Energy Technology Data Exchange (ETDEWEB)

    Chaves, S.; Renault-Miskovsky, J. [Institut de Paleontologie, 75 - Paris (France)]|[Universidade Federal, Rio de Janeiro, RJ (Brazil)

    1996-06-13

    Fossil human faeces were collected from the rock-shelter of ``Pedra Furada`` (Piaui, Brazil), which is considered nowadays as one of the most ancient prehistoric sites in America. These dated coprolites range from 8,500 to 7,000 BP and are evidence of an occupation phase connected with ``Serra Talhada`` cultural traditions I and II. These coprolites were analysed by palynological studies. The results have given palaeo-climatological and palaeo-environmental data with an emphasis on palaeo-ethnological aspects. Evidence emerges regarding the range of medicinal and food plants of the prehistoric humans who inhabited the site for some 1,500 years. (authors). 32 refs., 3 figs.

  5. Bulky PAH-DNA induced by exposure of a co-culture model of human alveolar macrophages and embryonic epithelial cells to atmospheric particulate pollution; Adduits encombrants a l'ADN dans des cocultures de cellules pulmonaires humaines exposees a une pollution atmospherique particulaire

    Energy Technology Data Exchange (ETDEWEB)

    Abbas, Imane; Garcon, Guillaume; Billet, Sylvain; Shirali, Pirouz [Universite Lille Nord de France - Lille (France); Unite de Chimie Environnementale et Interactions sur le Vivant, MREI, Universite du Littoral Cote d' Opale, Dunkerque (France); Andre, Veronique; Le Goff, Jeremie; Sichel, Francois [GRECAN, Universite de Caen Basse-Normandie et centre Francois Baclesse, Caen (France); Roy Saint-Georges, Francoise; Mulliez, Philippe [Service de Pneumologie, Hopital Saint-Philibert, GHICL, Lille (France)

    2012-01-15

    Because of their deep penetration in human lungs, fine airborne particulate matter were described as mainly responsible for the deleterious effects of exposure to air pollution on health. Organic constituents are adsorbed on particles surface and, after inhalation, some (polycyclic aromatic hydrocarbons, PAHs) can be activated into reactive metabolites and can bind to DNA. The formation of bulky DNA adducts has been researched after exposure of mono-and co-cultures of alveolar macrophages (AM) and human embryonic human lung epithelial (L132), to fine air pollution particulate matter Air samples have been collected with cascade impactor and characterized: size distribution (92.15% < 2.5{mu}.m), specific surface area (1 m{sup 2}/g), inorganic (Fe, AI, Ca, Na, K, Mg, Pb, etc.) and organic compounds (PAHs, etc.). {sup 32}P post-labeling method was applied to detect bulky DNA adducts in AM and L132, in mono-and co-cultures, 72 h after their exposure to atmospheric particles at their Lethals and Effects concentrations or (LC or CE) to 50% (i.e. MA: EC{sub 50} = 74.63 {mu}g/mL and L132: LC-5-0 = 75.36 {mu}g/mL). Exposure to desorbed particles (MA: C1= 61.11 {mu}g/mL and L132 : C2 = 61.71 {mu}g/mL) and B[a]P (1 {mu}M) were included. Bulky PAH-DNA adducts were detected in AM in mono-culture after exposure to total particles (Pt), to B[a]P and desorbed particles (Pd). Whatever the exposure, no DNA adduct was detected in L132 in mono-culture. These results are coherent with the enzymatic activities of cytochrome P450 l Al in AM and L132. Exposure of co-culture to Pt, or Pd induced bulky adducts to DNA in AM but not in L132. Exposure to B[a]P alone has altered the DNA of AM and L132, in co-culture. Exposure to Pt is closer to the environmental conditions, but conferred an exposure to amounts of genotoxic agents compared to studies using organic extracts. The formation of bulky DNA adducts was nevertheless observed in AM exposed to Pt, in mono- or co-culture, indicating that they were competent in terms of metabolic activation of PAHs. The DNA damage in the L132 in co-culture following exposure to B[a]P have suggested that some PAH metabolites generated by the MA could be have a genotoxic action on L132. (authors)

  6. In vitro cytotoxic effects of PM{sub 2.5} from the city of Abidjan (Ivory Coast) on human A549 lung cells; Effets cytotoxiques in vitro des PM{sub 2,} {sub 5} de la ville d'Abidjan (Cote-d'Ivoire) sur des cellules pulmonaires humaines

    Energy Technology Data Exchange (ETDEWEB)

    Kouassi, Kouakou-Serge [Universite Lille Nord de France, Lille (France); Unite de Chimie Environnementale et Interactions sur le Vivant, EA 4492 MREI, Universite du Littoral Cote d' Opale, Dunkerque (France); Universite Cocody-Abidjan et Institut Pasteur, Abidjan (Cote d' Ivoire); Billet, Sylvain; Garcon, Guillaume; Verdin, Anthony; Courcot, Dominique; Shirali, Pirouz [Universite Lille Nord de France, Lille (France); Unite de Chimie Environnementale et Interactions sur le Vivant, EA 4492 MREI, Universite du Littoral Cote d' Opale, Dunkerque (France); Diouf, Amadou [Laboratoire de Toxicologie, Faculte de Medecine Pharmacologie Odontologie, Universite Cheikh Anta Diop, Dakar (Senegal); Cazier, Fabrice [Universite Lille Nord de France, Lille (France); Centre Commun de Mesures, MREI 1, Universite du Littoral Cote d' Opale, Dunkerque (France); Djaman, Joseph [Universite Cocody-Abidjan et Institut Pasteur, Abidjan (Cote d' Ivoire)

    2012-01-15

    Epidemiological studies associate air pollution, especially particulate, increased morbidity and mortality from respiratory and cardiovascular origin . Africa, which has an urbanization rate among the highest in the world, is particularly exposed. The 'Initiative on the air quality in Sub-Saharan Africa' showed the importance of atmospheric concentrations of certain pollutants such as nitrogen oxides, sulfur dioxide and particulate matter (PM{sub 10}). Like the great capitals of Africa, Abidjan, economic capital and most industrialized city of Ivory Coast is facing an air pollution from industrial-urban and health consequences for its population of nearly 6 million inhabitants. To better understand the mechanisms of action resulting from pulmonary exposure to particulate atmospheric aerosols, we proposed: (i) to collect atmospheric particles (PM{sub 2.5}) using high volume cascade impaction in the District of Abidjan in three influences (rural, urban or industrial), (ii) to determine their main physicochemical, (iii) assess their cytotoxicity and their role in the induction of oxidative damage in a model of human lung cells (A549) in culture. The chemical composition of the atmospheric particles revealed their heterogeneity, and many inorganic (e.g. Al, Ca, Fe, Mn, Zn, Ni, Cr, Cu, Pb, Mg) and organic compounds (e.g. paraffins) were quantified at the three sites. Their effect concentrations (EC) to 10 and 50% on the A549 were as follows: influence rural: EC{sub 10} = 5.91 {mu}g/cm{sup 2} and EC{sub 50} 29.55 {mu}g/cm{sup 2}, urban influence: EC{sub 10} = 5 .45 {mu}g/cm{sup 2} and EC{sub 50} = 27.23 {mu}g/cm{sup 2}, and industrial influence: EC{sub 10} = 6.86 {mu}g/cm{sup 2} and EC{sub 50} = 34.29 {mu}g/cm{sup 2}. Exposure of A549 cells to Abidjan city's PM samples for 24, 48 or 72 hours to their EC{sub 10} or EC{sub 50} induced oxidative damage, as demonstrated by the formation of malon-dialdehyde, changes in enzyme activity of superoxide dismutase and alteration of glutathione status. (authors)

  7. Investigation of double strand breaks induced by alpha particle irradiation using C.N.B.G. microbeam in human keratinocytes; Mise en evidence de cassures double brin de l'ADN induites par irradiation de keratinocytes humains en microfaisceau alpha

    Energy Technology Data Exchange (ETDEWEB)

    Pouthier, Th

    2006-12-15

    To understand the mechanisms of interaction of ionizing radiation with living tissues exposed to low and protracted doses remains a major issue for risk evaluation. The response cannot be found in epidemiological studies because the only available data concern accidental exposures to high doses of radiation. The natural exposure represents the main source of exposure in the daily life, just before the medical sources (radiology, radiotherapy). In addition, this kind of exposure is very difficult to reproduce in vitro by irradiating cell lines. The method per preference is based on random irradiation of cell populations. The mean number of particles having traversed cells is then calculated on the basis of Poisson statistics. In addition to inevitable multiple impacts, the numerous potential intracellular targets (nuclei, cytoplasm), the indirect effects induced by the impact of particles on neighbouring cells or simply the extracellular targets, constitute phenomena that make more complex the interpretation of experimental data. A charged particle microbeam was developed at C.E.N.B.G. to perform the targeted irradiation of individual cells with a targeting precision of a few microns. It is possible to deliver a counted number of alpha particles down to the ultimate dose of one alpha per cell, to target predetermined cells and then to observe the response of the neighbouring cells. This facility has been validated during this work on human keratinocyte cells expressing a recombinant nuclear fluorescent protein (histone H2B-GFP). The combination of ion micro-beams with confocal microscopy and numeric quantitative analysis allowed the measurement of DNA double strand breaks via the phosphorylation of the histone H2A.X in individual cells. The mechanisms of DNA reparation and apoptosis induction were also in the scope of those studies. The experimental results obtained during this thesis validate the methodology we have developed by demonstrating the targeting reproducibility and the dose control. A dose-effect relationship has been also investigated as a function of time. (author)

  8. Molecular and structural characterisation of the human sodium/iodide symporter (h N.I.S.) C-terminus and the implication of this domain in the transporter regulation; Caracterisation moleculaire et structurale de l'extremite C-Terminale du co-transporteur sodium/iode humain (h N.I.S.): Implication de ce domaine dans la regulation du transporteur

    Energy Technology Data Exchange (ETDEWEB)

    Huc, S

    2007-12-15

    The human natrium iodide symporter (h N.I.S.) is an intrinsic membrane protein expressed in thyroid cells where it allows iodide uptake and accumulation. It is composed of thirteen transmembrane helices and its ninety- three amino acids long cytosolic C-terminus presents many potential post-translational regulatory sites. A first part of the PhD work has been dedicated to the expression in a bacterial system and to the purification of the cytosolic C-terminal fragment. Biochemical and structural characterisation have revealed that this C-terminus is very flexible but prone to dimerization. The fragment has also been used as a bait to test the interactions with PDZ domain proteins spotted on a membrane. Several proteins interacting with the (natrium/iodide symporter) N.I.S. C-terminus have thus been identified and the study of their implication in the protein regulation has been initiated. A second part of the work has underlined the existence of a N.I.S. fragment co-purified with the entire protein. This fragment has been found in cells in culture stably expressing N.I.S. and also in human thyroid extracts and in rodent thyroid cells. We observed that this fragment is spontaneously associated with the entire protein. It is composed of the last 131 amino acid of the protein and so comprises the last transmembrane domain and the C-terminal extremity. The expression of a truncated form of h N.I.S., lacking the last 131 amino acids, shows that this protein is not correctly addressed to the cell membrane and cells expressing this mutated symporter cannot accumulate iodide. However, our results show that the co-expression of the two N.I.S. parts, the truncated form lacking the last 131 amino acid, and the complementary C-terminal fragment, leads to cells presenting 10 % of the activity of cells expressing the whole N.I.S.. (author)

  9. Regulation of heating and air-conditioning systems based on human thermal sensation: impact on the energy consumption in buildings; Regulation des systemes de chauffage et de climatisation basee sur la sensation thermique humaine: impact sur la consommation d'energie dans les batiments

    Energy Technology Data Exchange (ETDEWEB)

    Endravadan, M.

    2006-02-15

    This study is based on the adaptive approach. The thermal comfort of an individual depends on indoor conditions that can be controlled. However, changes in activity or clothing adjustments are difficult to control and measure in the field experiments. Behavioural actions undertaken by the occupant to overcome the discomfort could be varying and may have diverse consequences. Sometimes these actions are beneficial to the occupant, although often they lead to disastrous amounts of energy consumption. Hence, it becomes crucial to consider the human behaviour and the thermal inertia of the building. The creation of numerical models is useful to study the coupling between these two components and to evaluate the effects of the behaviour on comfort and the energy. The simulations were conducted using TRNSYS software. A model such as 'Global Behavioural Regulator' (GBR) was created to evaluate the effects of clothing or thermostat adjustments made by the occupant depending on his thermal sensation (PMV). The energy costs of several types of regulators have been compared in various seasons for example, winter and summer using a light and heavy weight building. The heating of a whole-building may not be necessary in temperate climates or during mid-season. However, comfortable working conditions could be assured for the occupants with the use of an individual heating system such as a 'Local Heating System' (LHS). In such a context, it becomes interesting to evaluate the occupant's behaviour in regards to local heating and its effects on comfort and energy consumption. The LHS consists of three radiant panels; therefore, it is important to evaluate the local heat exchanges with precision. Experiments conducted with the manikin were used to validate the infra-red model; whereas experiments with real subjects were studied to understand the occupant behaviour on the LHS as a function of their local thermal sensations. These analyses led to the creation of a 'Local Behavioural Regulator' (LBR). The results show that such a system is advantageous in certain situations and does lead to comfort conditions with reduced energy costs. (author)

  10. Recommandations à l'égard d'usages pédagogiques de dispositifs humains et numériques pour favoriser la présence en formation à distance : synthèse de trois recensions systématiques

    OpenAIRE

    Petit , Matthieu; Deaudelin , Colette; Brouillette , Louis

    2015-01-01

    International audience; To think about the devices set up to promote presence in distance education, this article summarizes recommendations from three systematic reviews of literature on the subject, mainly around the three categories of presence (teaching, cognitive and social) from the community of inquiry model.; Afin de réfléchir aux dispositifs à mettre en place pour favoriser une présence en formation à distance, cet article fait la synthèse de recommandations issues de trois recension...

  11. Metabolic activation of volatile organic compounds and polycyclic aromatic hydrocarbons coated onto airborne PM{sub 2.5} in isolated human alveolar macrophages; Etude de l'activation metabolique des composes organiques volatils et des hydrocarbures aromatiques polycycliques d'un aerosol anthropogenique par des macrophages alveolaires humains en culture primaire

    Energy Technology Data Exchange (ETDEWEB)

    Saint-Georges, F.; Mulliez, P. [Hopital Saint Philibert - GHICL-FLM, Service de Pneumologie, 59 - Lomme (France); Saint-Georges, F.; Abbas, I.; Garcon, G.; Billet, S.; Verdin, A.; Shirali, P. [LCE-EA2598, Lab. de Recherche en toxicologie Industrielle et Environnementale - ULCO-MREI, 59 - Dunkerque (France); Gosset, P. [Hopital Saint Vincent, Laboratoire d' Anatomie et de Cytologie Pathologiques - GHICL-FLM, 59 - Lille (France); Courcot, D. [LCE-EA2598, Lab. de Catalyse et Environnement - ULCO-MREI, 59 - Dunkerque (France)

    2009-01-15

    To contribute to improve the knowledge of the underlying mechanisms of action involved in air pollution Particulate Matter (PM)-induced cytotoxicity, we were interested in the metabolic activation of Volatile Organic Compounds (VOC) and/or Polycyclic Aromatic Hydrocarbons (PAH)-coated onto Dunkerque City's PM{sub 2.5} in human Alveolar Macrophages (AM) isolated from Bronchoalveolar Lavage Fluid (BALF). This in vitro cell lung model is very close to the normal in vivo situation, notably in the characteristics that AM display in terms of gene expression of phase I and phase II-metabolizing enzymes. The bronchoscopic examinations and BAL procedures were carried out without any complications. The exposure of AM, during 24, 48 or 72 h, to increasing concentrations of the collected aerosol induced significant variations of the activities of the extracellular lactate dehydrogenase and the mitochondrial dehydrogenase. The lethal concentrations at 10% and 50% were 14.93 and 74.63 {mu}g/mL for AM, respectively, and indicated the relatively higher sensibility of such target lung cells. VOC and/or PAH-coated at low levels onto the surface of the particulate fraction significantly induced gene expression of cytochrome P450 (GYP) 1A1, CYP2E1, NADPH Quinone oxido-reductase (NQO)-1) and Glutathione S-Transferase (GST)P1 and M3, versus controls, suggesting thereby the formation of biologically reactive metabolites. Moreover, these results suggested the role of physical vector of carbonaceous core of PM, which can, therefore, increase both the penetration and the retention of attached-VOC into the cells, thereby enabling them to exert a more durable induction. Hence, we concluded that the metabolic activation of the very low doses of VOC and/or PAH-coated onto Dunkerque City's PM{sub 2.5} is one of the underlying mechanisms of action closely involved in its cytotoxicity in isolated human AM in culture. (author)

  12. Proposition d’un modèle d’organisation pour une gestion intégrée de la sécurité sanitaire des aliments, dans ses trois dimensions : technique, humaine et organisationnelle, à l’échelle libanaise

    Directory of Open Access Journals (Sweden)

    Fadi Nicolas

    2017-06-01

    Full Text Available Nicolas, F. Chevrier, C. Rizk, T. Assaf, C. and Yaghy, J. 2017. Proposal of an organizational model for an integrated management of food safety, in its three dimensions: technical, human and organizational, on Lebanese scale. Lebanese Science Journal, 18(1: 1-25. A critical analysis of the Lebanese food industry in its main sectors, namely milk and its derivatives, red meat and white meat, was made from facility inspections, investigations and management manufacturing procedures and/or processing, as well as microbiological and chemical analysis of different samples. It showed the inadequacy or the failure of the measures adopted, either at the organoleptic quality of food produced or the safety of consumer foods. Hence the need for the establishment of a new management system, supported by appropriate governance and meet international requirements, resulting in an ongoing, controlled and acceptable risk, and the restoration and strengthening of trust in the Lebanese health system. However, health problems often exceeding their initial importance and direct effect of triggering factor - minimal disruption transforming rapidly into a major crisis - any food system finds himself constantly undermined with permanent instability. This instability is characteristic of complex phenomena, and therefore, it returns us to the theory that the system is considered as a network of interdependent actors working to the satisfaction of the consumer in a given geographical area. Such a system must necessarily be global; it must incorporate all stakeholders in the food chain and be able to self-adjust to permanent and continuous way. From these considerations, we propose to the Lebanese authorities, in addition to the new food safety legislation food, adopted in January 2015, a specific model based on the principle of systemic triangulation (governance, risk analysis, regulatory and legislation and operating as a global system of governance and management of health food. The role of the authorities return to set standards of this system and the regulatory framework of the structure and behavior. The risk analysis tool, based on international standards, guarantor of international recognition of the proposed model should then be able to arrange its components continuously, in three dimensions, technical, human and organizational, and for that the entire system does not depart from the main objective, the protection of public health.

  13. Obésité et grossesse : étude de l'influence d'un marqueur de l'obésité sur les mécanismes cellulaires et tissulaires de l'accouchement dans un modèle d'explants myométriaux humains

    OpenAIRE

    Wendremaire, Maeva

    2012-01-01

    Maternal obesity is associated with a wide spectrum of delivery disorders, such as delayed or post-term delivery, that might be explained partly by the increase in plasma leptin levels in obese women, as leptin inhibits in vitro myometrial contractility. Delivery involves uterine apoptosis and remodelling of the extracellular matrix, via the activation of matrix metalloproteinases (MMP). This study was aimed to assess the role of leptin on human myometrium, by studying the interaction of lept...

  14. Rôle du stress du réticulum endoplasmique et de l’autophagie dans la régulation des réponses immune et angiogénique activées par des stress ischémiques et inflammatoires dans l’épithélium rénal humain

    OpenAIRE

    Fougeray, Sophie

    2012-01-01

    Under pathological conditions, kidney is subjected to multiple toxic, ischemic and immunological failures that promote the occurrence of chronic kidney disease and the development of acute kidney injury. In response to stress, renal parenchymal cells activate biological adaptive processes permitting the maintenance of cell viability and renal homeostasis. These adaptive responses can also activate innate immunity and induce tissue remodeling (fibrogenesis and angiogenesis). However, accurate ...

  15. Adverse events after cervical spinal manipulative therapy: consensus based classification and definitions

    NARCIS (Netherlands)

    Dr. C.P. van der Schans; M. Schmitt; dr. S.E. Lakke; H.A. Kranenburg

    2015-01-01

    Cervical spinal manipulations (CSM) are frequently employed techniques to alleviate neck pain and headache. Minor and major complications following CSM have been described, though clear consensus on definition and the classification of the complications had not yet been achieved. As a result,

  16. What Is Commercial Social Marketing?

    DEFF Research Database (Denmark)

    Anker, Thomas Boysen; Stead, Martine

    The aim of this paper is to introduce the concept of commercial social marketing (CSM) and discuss some major ethical aspects of CSM. In the first section, we introduce 6 social marketing benchmark criteria. Against this background, we demonstrate Dove’s ‘Campaign for Real Beauty’ to be an instance...

  17. Gait impairment in cervical spondylotic myelopathy: comparison with age- and gender-matched healthy controls.

    LENUS (Irish Health Repository)

    Malone, Ailish

    2012-12-01

    Gait impairment is a primary symptom of cervical spondylotic myelopathy (CSM); however, little is known about specific kinetic and kinematic gait parameters. The objectives of the study were: (1) to compare gait patterns of people with untreated CSM to those of age- and gender-matched healthy controls; (2) to examine the effect of gait speed on kinematic and kinetic parameters.

  18. Strategic Sustainability Management for Enhancing Corporate Value: in the context of Korean Business Circles

    NARCIS (Netherlands)

    Y-G. Ahn

    2007-01-01

    textabstractIn line with the growing importance of Corporate Sustainability Management (CSM) in business circles, the linkages between CSM, corporate values and performance is becoming increasingly higher on the agenda both for internal corporate management purposes and for external relations for

  19. Modeling Type II-P/II-L Supernovae Interacting with Recent Episodic Mass Ejections from Their Presupernova Stars with MESA and SNEC

    Science.gov (United States)

    Das, Sanskriti; Ray, Alak

    2017-12-01

    We show how dense, compact, discrete shells of circumstellar gas immediately outside of red supergiants affect the optical light curves of Type II-P/II-L supernovae (SNe), using the example of SN 2013ej. Earlier efforts in the literature had used an artificial circumstellar medium (CSM) stitched to the surface of an evolved star that had not gone through a phase of late-stage heavy mass loss, which, in essence, is the original source of the CSM. In contrast, we allow enhanced mass-loss rate from the modeled star during the 16O and 28Si burning stages and construct the CSM from the resulting mass-loss history in a self-consistent way. Once such evolved pre-SN stars are exploded, we find that the models with early interaction between the shock and the dense CSM reproduce light curves far better than those without that mass loss and, hence, having no nearby dense CSM. The required explosion energy for the progenitors with a dense CSM is reduced by almost a factor of two compared to those without the CSM. Our model, with a more realistic CSM profile and presupernova and explosion parameters, fits observed data much better throughout the rise, plateau, and radioactive tail phases as compared to previous studies. This points to an intermediate class of supernovae between Type II-P/II-L and Type II-n SNe with the characteristics of simultaneous UV and optical peak, slow decline after peak, and a longer plateau.

  20. Continuum Level Density in Complex Scaling Method

    International Nuclear Information System (INIS)

    Suzuki, R.; Myo, T.; Kato, K.

    2005-01-01

    A new calculational method of continuum level density (CLD) at unbound energies is studied in the complex scaling method (CSM). It is shown that the CLD can be calculated by employing the discretization of continuum states in the CSM without any smoothing technique

  1. Reliability of three-dimensional gait analysis in cervical spondylotic myelopathy.

    LENUS (Irish Health Repository)

    McDermott, Ailish

    2010-10-01

    Gait impairment is one of the primary symptoms of cervical spondylotic myelopathy (CSM). Detailed assessment is possible using three-dimensional gait analysis (3DGA), however the reliability of 3DGA for this population has not been established. The aim of this study was to evaluate the test-retest reliability of temporal-spatial, kinematic and kinetic parameters in a CSM population.

  2. Adverse events after cervical spinal manipulative therapy: consensus based classification and definitions

    NARCIS (Netherlands)

    Kranenburg, Rik; Jorna-Lakke, Sandra; Schmitt, M.A.; van der Schans, Cees

    2016-01-01

    Cervical spinal manipulations (CSM) are frequently employed techniques to alleviate neck pain and headache. Minor and major complications following CSM have been described, though clear consensus on definition and the classification of the complications had not yet been achieved. As a result,

  3. Dicty_cDB: SLH287 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SL (Link to library) SLH287 (Link to dictyBase) - - - Contig-U16243-1 SLH287Z (Link... to Original site) - - SLH287Z 614 - - - - Show SLH287 Library SL (Link to library) Clone ID SLH287 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/SL/SLH2-D/SLH287Q.Seq.d/ Representative seq. ID SLH28...7Z (Link to Original site) Representative DNA sequence >SLH287 (SLH287Q) /CSM/SL/SLH2-D/SLH287Q.Seq.d/ XXXXX...6Q) /CSM/SS/SSJ6-B/SSJ636Q.Seq.d/ 1217 0.0 SLH575 (SLH575Q) /CSM/SL/SLH5-D/SLH575Q.Seq.d/ 1217 0.0 SLH287 (SLH287Q) /CSM/SL/SLH2

  4. Dicty_cDB: SLH218 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SL (Link to library) SLH218 (Link to dictyBase) - - - Contig-U16325-1 SLH218F (Link to Original site) SLH2...18F 419 - - - - - - Show SLH218 Library SL (Link to library) Clone ID SLH218 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/SL/SLH2-A/SLH218Q.Seq.d/ Representative seq. ID SLH21...8F (Link to Original site) Representative DNA sequence >SLH218 (SLH218Q) /CSM/SL/SLH2-A/SLH218Q.Seq.d/ CCATG...) /CSM/SL/SLI3-C/SLI370Q.Seq.d/ 831 0.0 SLI170 (SLI170Q) /CSM/SL/SLI1-C/SLI170Q.Seq.d/ 831 0.0 SLH218 (SLH218Q) /CSM/SL/SLH2-A/SLH2

  5. Command and Service Module Communications

    Science.gov (United States)

    Interbartolo, Michael

    2009-01-01

    This viewgraph presentation examines Command and Service Module (CSM) Communications. The communication system's capabilities are defined, including CSM-Earth, CSM-Lunar Module and CSM-Extravehicular crewman communications. An overview is provided for S-band communications, including data transmission and receiving rates, operating frequencies and major system components (pre-modulation processors, unified S-band electronics, S-band power amplifier and S-band antennas). Additionally, data transmission rates, operating frequencies and the capabilities of VHF communications are described. Major VHF components, including transmitters and receivers, and the VHF multiplexer and antennas are also highlighted. Finally, communications during pre-launch, ascent, in-flight and entry are discussed. Overall, the CSM communication system was rated highly by flight controllers and crew. The system was mostly autonomous for both crew and flight controllers and no major issues were encountered during flight.

  6. Characteristics of combustion flame sprayed nickel aluminum using a Coanda Assisted Spray Manipulation collar for off-normal deposits

    Science.gov (United States)

    Archibald, Reid S.

    A novel flame spray collar called the Coanda Assisted Spray Manipulation collar (CSM) has been tested for use on the Sulzer Metco 5P II combustion flame spray gun. A comparison study of the stock nozzle and the CSM has been performed by evaluating the porosity, surface roughness, microhardness, tensile strength and microscopy of normal and off-normal sprayed NiAl deposits. The use of the CSM collar resulted in the need to position the sprayed coupons closer to the gun, which in turn affected the particle impact energy and particle temperatures of the NiAl powder. For the CSM, porosities had a larger scatterband, surface roughness was comparably the same, microhardness was lower, and tensile strength was higher. The microscopy analysis revealed a greater presence of unmelted particles and steeper intersplat boundaries for the CSM. For both processes, the porosity and surface roughness increased and the microhardness decreased as the spray angle decreased.

  7. The structure and emerging trends of construction safety management research: a bibliometric review.

    Science.gov (United States)

    Liang, Huakang; Zhang, Shoujian; Su, Yikun

    2018-03-29

    Recently, construction safety management (CSM) practices and systems have become important topics for stakeholders to take care of human resources. However, few studies have attempted to map the global research on CSM. A comprehensive bibliometric review was conducted in this study based on multiple methods. In total, 1172 CSM-related papers from the Web of Science Core Collection database were examined. The analyses focused on publication year, country-institute, publication source, author and research topics. The results indicated that the USA, China, Australia and the UK took leading positions in CSM research. Two branches of journals were identified, namely the branch of engineering science and that of safety science and social science. Additionally, seven themes together with 28 specific topics were detected to allow researchers to track the main structure and temporal evolution of CSM research. Finally, the main research trends and potential research directions were discussed to guide the future research.

  8. Free harmonic oscillators, Jack polynomials, and Calogero-Sutherland systems

    International Nuclear Information System (INIS)

    Gurappa, N.; Panigrahi, Prasanta K.

    2000-01-01

    The algebraic structure and the relationships between the eigenspaces of the Calogero-Sutherland model (CSM) and the Sutherland model (SM) on a circle are investigated through the Cherednik operators. We find an exact connection between the simultaneous nonsymmetric eigenfunctions of the A N-1 Cherednik operators, from which the eigenfunctions of the CSM and SM are constructed, and the monomials. This construction allows us to simultaneously diagonalize both CSM and SM (after gauging away the Hamiltonians by suitable measures) and also enables us to write down a harmonic oscillator algebra involving the Cherednik operators, which yields the raising and lowering operators for both of these models. The connections of the CSM with free oscillators and the SM with free particles on a circle are established in a novel way. We also point out the subtle differences between the excitations of the CSM and the SM

  9. Libros

    Directory of Open Access Journals (Sweden)

    Facultad de Medicina Revista

    1952-09-01

    Full Text Available Precis de Parasitologie Humaine / Sindromes Pathologiques du Nourrisson et. de L'enfant / Practique Neurnlogique / Precis D'Anatomie / Traite de Medecine / Traite de Therapeutique Chirurgicale

  10. Best of Affective Computing and Intelligent Interaction 2013 in Multimodal Interactions

    NARCIS (Netherlands)

    Soleymani, Mohammad; Soleymani, M.; Pun, T.; Pun, Thierry; Nijholt, Antinus

    The fifth biannual Humaine Association Conference on Affective Computing and Intelligent Interaction (ACII 2013) was held in Geneva, Switzerland. This conference featured the recent advancement in affective computing and relevant applications in education, entertainment and health. A number of

  11. The Ebola Virus and Human Rights Concerns in Africa

    African Journals Online (AJOL)

    AJRH Managing Editor

    2015-09-03

    Sep 3, 2015 ... Keywords: Ebola, Public Health, human right. Résumé ... Mots clé : Ebola, de santé publique, droit humain. Introduction ... public health and human rights. This article .... Political Rights (ICCPR)21 and the International.

  12. Fulltext PDF

    Indian Academy of Sciences (India)

    2011-11-12

    Nov 12, 2011 ... Mechnikov: The Nature of Man (1903) and The Prolonga- tion of Life: Optimistic ... 36(5), December 2011, 769–772, * Indian Academy of Sciences 769. Series .... Metchnikoff E 1903 Etudes sur la nature humaine. Essai de.

  13. Aircraft Trajectories Computation-Prediction-Control. Volume 1 (La Trajectoire de l’Avion Calcul-Prediction-Controle)

    Science.gov (United States)

    1990-03-01

    Vigilance and Performance in Automatized Systems. Org.: Prof A. Coblentz Laboratoire d’Anthropologie et d’Ecologie Humaine - Universit& Rene Descartes , PARIS...Humaine - Universit6 Ren6 Descartes , PARIS, September 1988 BOY G., CEP-Onera "Assistance A l’Opdrateur: Une Approche de l’Intelligence Artificielle...Appliqi6e, Universit6 Ren6 Descartes - Paris V "Effect of Monotony on Vigilance and Biomechanical Behaviour" In: Commission of European Communities

  14. Contrôleur Régional (h/f) | CRDI - Centre de recherches pour le ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    En collaboration avec la Division des ressources humaines, administrer, mettre en œuvre et évaluer des règlements administratifs, des systèmes, des contrôles et des services reliés à tous les aspects de la gestion des ressources humaines au bureau régional, ce qui comprend le recrutement, la classification et la ...

  15. 1514-IJBCS-Article-Melima Mamatchi

    African Journals Online (AJOL)

    KODJIO NORBERT

    déterminées dans le sang humain à Gbodjomé (zone de référence) et à Kpémé où les populations consomment des aliments ... Cd et du Pb, qui provoquent un stress oxydatif dans l'organisme humain qui présente une disponibilité à la bioaccumulation de ces ..... reins, le foie, le système nerveux, le sang et peuvent être ...

  16. La Santé: Une Approche Écosystémique

    International Development Research Centre (IDRC) Digital Library (Canada)

    Le défi consiste à satisfaire les besoins humains sans altérer ni mettre en danger ... L'évolution de cette science a influencé la réflexion de médecins comme le docteur ... Pour les artisans d'une vision globale, l'humain et ses aspirations, son .... coûteux que bien des soins médicaux et des interventions en santé primaire.

  17. Résultats de recherche | Page 137 | CRDI - Centre de recherches ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    ... Croissance de l'économie et débouchés économiques des femmes 12 Apply ... Les auteurs du Rapport arabe sur le développement humain 2005 mettent en évidence ... à savoir l'abondance de capital humain féminin qualifié dans la région du ... Quinze années de guerre civile et l'instabilité politique et économique qui ...

  18. Résultats de recherche | Page 53 | CRDI - Centre de recherches ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Corruption, opportunités économiques et concurrence. Published date. 1 janvier 2012. Études ... Mouvements sociaux dans le contexte de conflits armés : causes et effets de la défense des droits humains (1980-2012). La place de plus en plus prépondérante qui occupe la défense des droits humains dans les ...

  19. Nephrolepis biserrata, une Ptéridophyte utilisée comme plante ...

    African Journals Online (AJOL)

    SARAH

    30 sept. 2014 ... Extraction des épines de palmiers du corps humain : Dans la réalisation des activités humaines. (entretien des plantations de palmiers à huile, chasse, etc.), les accidents liés aux piquants des feuilles de palmiers sont courants. Pour extraire les restes d'organes de cette plante du corps après ces.

  20. Isolation and characterization of cobalt-sensitive mutant of Neurospora crassa

    Directory of Open Access Journals (Sweden)

    Krishnapuram Rashmi

    2014-12-01

    Full Text Available Objective: To isolate and demonstrate the mechanism of metal transport in cobalt-sensitive mutant (CSM of Neurospora crassa (N. crassa. Methods: Isolation of CSM of N. crassa, I50 determination, growth measurements, metal ion uptake studies and sexual crosses were performed to determine the mechanism of sensitivity and locus. Results: CSMs of N. crassa were isolated by mutagenesis with diethyl sulfate. More than 500 isolates were screened and out of these isolates, CSM-I was 5-fold and CSM-II was 10-fold sensitive to Co on liquid medium as compared to the wild type. Compositional analysis of cell wall revealed the decrease in total phosphate content. N. crassa CSM bound much less cobalt to cell wall fraction than wild type. The data indicated closer linkage between resistance and mating type locus (mat, which is, located on LG I. Conclusions: A CSM of N. crassa is 5-fold more sensitive than wild type and cross sensitive to nickel and copper and hyper-accumulates 2-4 fold more toxic metal ions over wild type. The mechanism for sensitivity is decreased in cobalt-binding to cell wall fraction and increased intracellular uptake. N. crassa-acon-3 morphologically resembles the CSM, cobalt-sensitive and maps to similar locus.

  1. Comparisons Between Experimental and Semi-theoretical Cutting Forces of CCS Disc Cutters

    Science.gov (United States)

    Xia, Yimin; Guo, Ben; Tan, Qing; Zhang, Xuhui; Lan, Hao; Ji, Zhiyong

    2018-05-01

    This paper focuses on comparisons between the experimental and semi-theoretical forces of CCS disc cutters acting on different rocks. The experimental forces obtained from LCM tests were used to evaluate the prediction accuracy of a semi-theoretical CSM model. The results show that the CSM model reliably predicts the normal forces acting on red sandstone and granite, but underestimates the normal forces acting on marble. Some additional LCM test data from the literature were collected to further explore the ability of the CSM model to predict the normal forces acting on rocks of different strengths. The CSM model underestimates the normal forces acting on soft rocks, semi-hard rocks and hard rocks by approximately 38, 38 and 10%, respectively, but very accurately predicts those acting on very hard and extremely hard rocks. A calibration factor is introduced to modify the normal forces estimated by the CSM model. The overall trend of the calibration factor is characterized by an exponential decrease with increasing rock uniaxial compressive strength. The mean fitting ratios between the normal forces estimated by the modified CSM model and the experimental normal forces acting on soft rocks, semi-hard rocks and hard rocks are 1.076, 0.879 and 1.013, respectively. The results indicate that the prediction accuracy and the reliability of the CSM model have been improved.

  2. Data-driven risk identification in phase III clinical trials using central statistical monitoring.

    Science.gov (United States)

    Timmermans, Catherine; Venet, David; Burzykowski, Tomasz

    2016-02-01

    Our interest lies in quality control for clinical trials, in the context of risk-based monitoring (RBM). We specifically study the use of central statistical monitoring (CSM) to support RBM. Under an RBM paradigm, we claim that CSM has a key role to play in identifying the "risks to the most critical data elements and processes" that will drive targeted oversight. In order to support this claim, we first see how to characterize the risks that may affect clinical trials. We then discuss how CSM can be understood as a tool for providing a set of data-driven key risk indicators (KRIs), which help to organize adaptive targeted monitoring. Several case studies are provided where issues in a clinical trial have been identified thanks to targeted investigation after the identification of a risk using CSM. Using CSM to build data-driven KRIs helps to identify different kinds of issues in clinical trials. This ability is directly linked with the exhaustiveness of the CSM approach and its flexibility in the definition of the risks that are searched for when identifying the KRIs. In practice, a CSM assessment of the clinical database seems essential to ensure data quality. The atypical data patterns found in some centers and variables are seen as KRIs under a RBM approach. Targeted monitoring or data management queries can be used to confirm whether the KRIs point to an actual issue or not.

  3. AGAINST THE WIND: RADIO LIGHT CURVES OF TYPE IA SUPERNOVAE INTERACTING WITH LOW-DENSITY CIRCUMSTELLAR SHELLS

    Energy Technology Data Exchange (ETDEWEB)

    Harris, Chelsea E.; Nugent, Peter E.; Kasen, Daniel N., E-mail: chelseaharris@berkeley.edu [Astronomy Department, University of California Berkeley, Berkeley, CA (United States)

    2016-06-01

    For decades a wide variety of observations spanning the radio through optical and on to the X-ray have attempted to uncover signs of type Ia supernovae (SNe Ia) interacting with a circumstellar medium (CSM). The goal of these studies is to constrain the nature of the hypothesized SN Ia mass-donor companion. A continuous CSM is typically assumed when interpreting observations of interaction. However, while such models have been successfully applied to core-collapse SNe, the assumption of continuity may not be accurate for SNe Ia, because shells of CSM could be formed by pre-supernova eruptions (novae). In this work, we model the interaction of SNe with a spherical, low-density, finite-extent CSM and create a suite of synthetic radio synchrotron light curves. We find that CSM shells produce sharply peaked light curves. We also identify a fiducial set of models that obey a common evolution and can be used to generate radio light curves for an interaction with an arbitrary shell. The relations obeyed by the fiducial models can be used to deduce CSM properties from radio observations; we demonstrate this by applying them to the nondetections of SN 2011fe and SN 2014J. Finally, we explore a multiple shell CSM configuration and describe its more complicated dynamics and the resultant radio light curves.

  4. Chitin Synthases with a Myosin Motor-Like Domain Control the Resistance of Aspergillus fumigatus to Echinocandins

    Science.gov (United States)

    Jiménez-Ortigosa, Cristina; Aimanianda, Vishukumar; Muszkieta, Laetitia; Mouyna, Isabelle; Alsteens, David; Pire, Stéphane; Beau, Remi; Krappmann, Sven; Beauvais, Anne; Dufrêne, Yves F.

    2012-01-01

    Aspergillus fumigatus has two chitin synthases (CSMA and CSMB) with a myosin motor-like domain (MMD) arranged in a head-to-head configuration. To understand the function of these chitin synthases, single and double csm mutant strains were constructed and analyzed. Although there was a slight reduction in mycelial growth of the mutants, the total chitin synthase activity and the cell wall chitin content were similar in the mycelium of all of the mutants and the parental strain. In the conidia, chitin content in the ΔcsmA strain cell wall was less than half the amount found in the parental strain. In contrast, the ΔcsmB mutant strain and, unexpectedly, the ΔcsmA/ΔcsmB mutant strain did not show any modification of chitin content in their conidial cell walls. In contrast to the hydrophobic conidia of the parental strain, conidia of all of the csm mutants were hydrophilic due to the presence of an amorphous material covering the hydrophobic surface-rodlet layer. The deletion of CSM genes also resulted in an increased susceptibility of resting and germinating conidia to echinocandins. These results show that the deletion of the CSMA and CSMB genes induced a significant disorganization of the cell wall structure, even though they contribute only weakly to the overall cell wall chitin synthesis. PMID:22964252

  5. RNA and DNA Targeting by a Reconstituted Thermus thermophilus Type III-A CRISPR-Cas System.

    Science.gov (United States)

    Liu, Tina Y; Iavarone, Anthony T; Doudna, Jennifer A

    2017-01-01

    CRISPR-Cas (clustered regularly interspaced short palindromic repeats-CRISPR-associated) systems are RNA-guided adaptive immunity pathways used by bacteria and archaea to defend against phages and plasmids. Type III-A systems use a multisubunit interference complex called Csm, containing Cas proteins and a CRISPR RNA (crRNA) to target cognate nucleic acids. The Csm complex is intriguing in that it mediates RNA-guided targeting of both RNA and transcriptionally active DNA, but the mechanism is not well understood. Here, we overexpressed the five components of the Thermus thermophilus (T. thermophilus) Type III-A Csm complex (TthCsm) with a defined crRNA sequence, and purified intact TthCsm complexes from E. coli cells. The complexes were thermophilic, targeting complementary ssRNA more efficiently at 65°C than at 37°C. Sequence-independent, endonucleolytic cleavage of single-stranded DNA (ssDNA) by TthCsm was triggered by recognition of a complementary ssRNA, and required a lack of complementarity between the first 8 nucleotides (5' tag) of the crRNA and the 3' flanking region of the ssRNA. Mutation of the histidine-aspartate (HD) nuclease domain of the TthCsm subunit, Cas10/Csm1, abolished DNA cleavage. Activation of DNA cleavage was dependent on RNA binding but not cleavage. This leads to a model in which binding of an ssRNA target to the Csm complex would stimulate cleavage of exposed ssDNA in the cell, such as could occur when the RNA polymerase unwinds double-stranded DNA (dsDNA) during transcription. Our findings establish an amenable, thermostable system for more in-depth investigation of the targeting mechanism using structural biology methods, such as cryo-electron microscopy and x-ray crystallography.

  6. RNA and DNA Targeting by a Reconstituted Thermus thermophilus Type III-A CRISPR-Cas System.

    Directory of Open Access Journals (Sweden)

    Tina Y Liu

    Full Text Available CRISPR-Cas (clustered regularly interspaced short palindromic repeats-CRISPR-associated systems are RNA-guided adaptive immunity pathways used by bacteria and archaea to defend against phages and plasmids. Type III-A systems use a multisubunit interference complex called Csm, containing Cas proteins and a CRISPR RNA (crRNA to target cognate nucleic acids. The Csm complex is intriguing in that it mediates RNA-guided targeting of both RNA and transcriptionally active DNA, but the mechanism is not well understood. Here, we overexpressed the five components of the Thermus thermophilus (T. thermophilus Type III-A Csm complex (TthCsm with a defined crRNA sequence, and purified intact TthCsm complexes from E. coli cells. The complexes were thermophilic, targeting complementary ssRNA more efficiently at 65°C than at 37°C. Sequence-independent, endonucleolytic cleavage of single-stranded DNA (ssDNA by TthCsm was triggered by recognition of a complementary ssRNA, and required a lack of complementarity between the first 8 nucleotides (5' tag of the crRNA and the 3' flanking region of the ssRNA. Mutation of the histidine-aspartate (HD nuclease domain of the TthCsm subunit, Cas10/Csm1, abolished DNA cleavage. Activation of DNA cleavage was dependent on RNA binding but not cleavage. This leads to a model in which binding of an ssRNA target to the Csm complex would stimulate cleavage of exposed ssDNA in the cell, such as could occur when the RNA polymerase unwinds double-stranded DNA (dsDNA during transcription. Our findings establish an amenable, thermostable system for more in-depth investigation of the targeting mechanism using structural biology methods, such as cryo-electron microscopy and x-ray crystallography.

  7. The incoming global technological and industrial revolution towards competitive sustainable manufacturing

    DEFF Research Database (Denmark)

    Jovane, F.; Yoshikawa, H.; Alting, Leo

    2008-01-01

    , knowledge-based, competitive sustainable manufacturing (CSM) has been widely considered as main enabler. This paper presents the necessary steps from economic growth to sustainable development. The reference model for proactive action (RMfPA) is proposed to develop and implement CSM, at national and global...... levels. Furthermore, we also review strategies to pursue CSM at the macro-meso-field level in addition to ongoing national initiatives in different countries and by international organizations. A case study concerning the European Manufuture initiative is cited. The overall results conclude that RMf...

  8. Diagnosis of Intracranial Lesions by Gamma-Encephalography using Human Serum Albumin Labelled with Iodine-131; Diagnostic des lesions intracraniennes par la gamma-encephalographie a l'aide de la serumalbumine humaine marquee a l'iode 131; Diagnoz vnutricherepnykh povrezhdenij putem gamma-ehntsefalografii pri pomoshchi mechenoj iodom-131 albuminovoj syvorotki cheloveka; Diagnostico de las lesiones intracraneanas por gammaencefalografia mediante sero- albumina humana marcada con yodo-131

    Energy Technology Data Exchange (ETDEWEB)

    Planiol, Therese [Institut National d' Hygiene, Paris (France)

    1959-07-01

    Six hundred patients were examined by means of serum albumin labelled with iodine-131. Radioactivity was read twice with an scintillation counter in contact with the skull, two hours and twenty-four hours after the radioactive injection. Of 175 intracranial tumours, 150 were accompanied by a focus of persistent gamma hyperactivity. Of those not detected by the examination, half were tumours of the hemispheres and half of the posterior fossa and pineal body. Abscesses, haematomata and cirsoid aneurisms were detected. In one-third of the cases acute cerebro-vascular lesions produced abnormal readings, half of which had the peculiar appearance pathognomonic of softening (or thrombosis); the others resembled tumour graphs, the only difference being that the abnormal readings associated with acute vascular lesions disappeared in a few weeks. Two-thirds of these acute lesions were associated with a negative gamma-encephalogram. Arterial aneurisms, non-tumourous epileptogenic foci, and various purely neurological conditions gave normal results in 96 per cent of cases. Brain investigation by radioalbumin can provide valuable information not only on the presence and exact location of a neurosurgical injury but also on its nature. In particular, it seems very likely to detect a meningioma, glioblastoma or metastatic growth. These properties, together with information on positive diagnosis and location, make it a specially useful neurodiagnostic method. Gamma-encephalography also seems likely to be one of the most reliable ways of detecting relapses and of following-up the effects of medical treatment or radiotherapy. (author) [French] 600 malades ont ete examines a l'aide de la serumalbumine marquee a l'iode 131, les mesures de radioactivite etant faites par un compteur a scintillations place au contact du crane, en deux seances, deux heures et vingt-quatre heures apres l'injection radioactive. Sur 175 tumeurs intracraniennes, 150 se sont accompagnees d'un foyer d'hyperactivite gamma durable. Celles qui ont echappe a l'examen sont pour moitie des tumeurs des hemispheres, pour moitie des tumeurs de la fosse posterieure et des pinealomes. Les abces, les hematomes, les anevrysmes cirsoides ont ete detectes. Les accidents cerebro-vasculaire s ont engendre dans un tiers des cas des anomalies: la moitie de ces graphiques anormaux ont un aspect particulier aux ramollissements (ou thromboses), dont le diagnostic peut ainsi etre evoque; les autres ressemblent aux graphiques tumoraux, la seule difference etant la disparition des anomalies en quelques semaines, en cas d'accident vasculaire; les deux tiers de ces lesions s'accompagnent d'un gamma-encephalogramm e negatif. Les anevrysmes arteriels, les foyers epileptogenes non tumoraux, les affections diverses purement neurologiques ont donne, dans 96% des cas, des resultats normaux. L'exploration cerebrale par la radio-albumine peut apporter des informations precieuses, non seulement sur la presence d'une lesion neuro-chirurgical e et sur la localisation exacte, mais aussi au point de vue de sa nature. En particulier, elle donne de grandes probabilites en faveur soit d'un meningiome, soit d'un glioblastome, soit de metastases. Ces possibilites, jointes aux renseignements concernant le diagnostic positif et topographique, lui conferent un interet particulier parmi les methodes de diagnostic neurologique. La gamma-encephalographie s'annonce en outre comme un des moyens les plus surs pour deceler les recidives et suivre les effets d'une therapeutique, medioale ou radiotherapique. (author) [Spanish] Se ha reconocido a 600 enfermos mediante seroalbumina marcada con yodo-131; la radiactividad se midio dos veces, a saber, 2 y 24 horas despues de la inyeccion de la sustancia radiactiva, con un contador de centelleo colocado en contacta con el craneo. En 150 de los 175 tumores intracraneanos examinados se ha observado un foco de hiperactividad gamma duradero. La mitad de los tumores que no se han detectado en el reconocimiento son tumores de los hemisferios y la otra mitad, tumores de la fosa posterior y pinealomas. Con este metodo pueden observarse los abcesos, los hematomas y los aneurismas cirsoides. Los accidentes cerebro-vasculares han originado en la tercera parte de los casos anomalias en los graficos; la mitad de los graficos anormales presenta el aspecto caracteristico de los reblandecimientos (o trombosis), lo cual permite su diagnoestico; el resta de los graficos es semejante a los graficos tumorales, siendo la unica diferencia que, en caso de accidente vascular, las anomallas desaparecen despues de algunas semanas; las dos terceras partes de estas lesiones dan un gammaencefalogram a negativo. Los aneurismas arteriales, los centros epileptoegenos no tumorales y las distintas afecciones puramente neurologicas presentan resultados normales en el 96 por ciento de los casos. La exploration del cerebro mediante albumina radiactiva puede suministrar informaciones de gran valor, no solo respecta de la existencia de una lesion neuro-quirurgica y su localizacion exacta, sino tambien respecto de su naturaleza. En particular, facilita grandemente el diagnostico de un meningeoma, de un glioblastoma o de metastasis. Esta, ademas de las informaciones relativas al diagnoestico positivo y topografico, hace que este procedimiento sea uno de los metodos mas interesantes de diagnostico neurologico. Por otra parte, la gammaencefalografia constituye uno de los medios mas seguros de descubrir la reaparicion de estas enfermedades y de observar los efectos de una terapeutica medica o de un tratamiento radioterapico. (author) [Russian] 600 chelovek bylo podvergnuto obsledovaniyu pri pomoshchi albuminovoj syvorotki, mechenoj iodom-131, prichem izmerenie radioaktivnosti provodilos' soedinennymi s cherepnoj korobkoj stsintyalitsionnym ischetchikami v dva priema: sperva spustya dva chasa i zatem dvadtsat' chetyre chasa posle radioaktivnoj in{sup e}ktsii. Iz sta semidesyati pyati vnutricherenykh opukholej sto pyat'desyat sopovozhdalis' ochagom dlitel'noj povyshennoj gamma-aktivnosti. Opukholi, kotorye ne poddalis' obsledovaniyu, yavlyayutsya napolovinu opukholyami polushariya mozga, a napolovinu - opukholyami zadnej polosti i shishkovidnoj zhelezy. Byli obnaruzheny gnojniki, krovyanye opukholi, mestnye vetvistye anevrizmy. Povrezhdenie mozgovoj tkani i krovenosnykh sosudov vyzvalo v odnoj treti sluchaev anomalii: polovina ehtikh anormal'nykh grafikov imeet formu, kharakternuyu dlya razmyagcheniya godovnogo mozga (ili tromboz), nalichie kotorogo mozhet byt' takim obrazom ustanovleno; drugie zhe napominayut grafiki opukholej s toj edinstvennoj raznitsej, chto anomalii ischezayut cherez neskol'ko nedel' v sluchayakh povrezhdeniya krovenosnykh sosudov; dve treti ehtikh povrezhdenij dayut otritsatel'nuyu gamma- ehntsefalogrammu. Rasshirenie arterij, bezopukhol'ny e ochagi, vyzyvayushchie pripadki ehpillepsii i razlichnye zabolevaniya chisto nevrologicheskog o kharaktera dali v 96% sluchaev normal'nye rezul'taty. Obsledovanie mozga pri pomoshchi radioaktivnog o albumina mozhet dat' tsennye svedeniya ne tol'ko o nalichii i tochnom mestonakhozhdeni i nevrokhirurgicheskikh povreyasdenij, no i v otnoshenii ikh kharaktera. V chastnosti, ono daet bol'shie vozmozhnosti dlya opredeleniya opukholej mozgovykh obolochek, gliom i metastazov. Ehti vozmozhnosti, sovmestno so svedeniyami, kasayushchimisya polozhitel'nogo i topograficheskogo diagnoza, pridayut dannomu vidu obsledovaniya osobyj interes po sravneniyu s drugimi metodami nevrologicheskog o diagnoza. Krome togo gamma-ehntsefalografi ya obeshchaet stat' odnim iz naibolee tochnykh sredstv dlya obnaruzheniya retsidivov i dlya nablyudeniya za khodom lecheniya obychnymi metodami ili radioterapii. (author)

  9. Dicty_cDB: VHD492 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHD492 (Link to dictyBase) - - - Contig-U15308-1 - (Link to Original site) - - VHD492...Z 675 - - - - Show VHD492 Library VH (Link to library) Clone ID VHD492 (Link to dicty...iol.tsukuba.ac.jp/CSM/VH/VHD4-D/VHD492Q.Seq.d/ Representative seq. ID - (Link to ...Original site) Representative DNA sequence >VHD492 (VHD492Q) /CSM/VH/VHD4-D/VHD492Q.Seq.d/ XXXXXXXXXXCTTCATC...xkiipink Homology vs CSM-cDNA Score E Sequences producing significant alignments: (bits) Value VHD492 (VHD492Q) /CSM/VH/VHD4-D/VHD492

  10. Dicty_cDB: SHD492 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SH (Link to library) SHD492 (Link to dictyBase) - - - Contig-U16471-1 SHD492P (Link to Original site) SHD492...F 121 SHD492Z 819 SHD492P 920 - - Show SHD492 Library SH (Link to library) Clone ID SHD492... URL http://dictycdb.biol.tsukuba.ac.jp/CSM/SH/SHD4-D/SHD492Q.Seq.d/ Representative seq. ID SHD492...P (Link to Original site) Representative DNA sequence >SHD492 (SHD492Q) /CSM/SH/SHD4-D/SHD492....Seq.d/ 805 0.0 SHD613 (SHD613Q) /CSM/SH/SHD6-A/SHD613Q.Seq.d/ 805 0.0 SHD492 (SHD492Q) /CSM/SH/SHD4-D/SHD492

  11. Dicty_cDB: SLH286 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SL (Link to library) SLH286 (Link to dictyBase) - - - Contig-U16366-1 SLH286Z (Link... to Original site) - - SLH286Z 386 - - - - Show SLH286 Library SL (Link to library) Clone ID SLH286 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/SL/SLH2-D/SLH286Q.Seq.d/ Representative seq. ID SLH28...6Z (Link to Original site) Representative DNA sequence >SLH286 (SLH286Q) /CSM/SL/SLH2-D/SLH286Q.Seq.d/ XXXXX...Seq.d/ 646 0.0 SLK513 (SLK513Q) /CSM/SL/SLK5-A/SLK513Q.Seq.d/ 646 0.0 SLI160 (SLI160Q) /CSM/SL/SLI1-C/SLI160Q.Seq.d/ 646 0.0 SLH2

  12. Dicty_cDB: SLH242 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SL (Link to library) SLH242 (Link to dictyBase) - - - Contig-U16343-1 SLH242Z (Link... to Original site) - - SLH242Z 476 - - - - Show SLH242 Library SL (Link to library) Clone ID SLH242 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/SL/SLH2-B/SLH242Q.Seq.d/ Representative seq. ID SLH24...2Z (Link to Original site) Representative DNA sequence >SLH242 (SLH242Q) /CSM/SL/SLH2-B/SLH242Q.Seq.d/ XXXXX...d/ 910 0.0 SLI231 (SLI231Q) /CSM/SL/SLI2-B/SLI231Q.Seq.d/ 910 0.0 SLH242 (SLH242Q) /CSM/SL/SLH2-B/SLH2

  13. Dicty_cDB: SLH224 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SL (Link to library) SLH224 (Link to dictyBase) - - - Contig-U16287-1 SLH224F (Link to Original site) SLH2...24F 565 - - - - - - Show SLH224 Library SL (Link to library) Clone ID SLH224 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/SL/SLH2-A/SLH224Q.Seq.d/ Representative seq. ID SLH22...4F (Link to Original site) Representative DNA sequence >SLH224 (SLH224Q) /CSM/SL/SLH2-A/SLH224Q.Seq.d/ AAAAA.../SS/SSF8-A/SSF805Q.Seq.d/ 1033 0.0 SLH288 (SLH288Q) /CSM/SL/SLH2-D/SLH288Q.Seq.d/ 1033 0.0 SLH224 (SLH224Q) /CSM/SL/SLH2-A/SLH2

  14. Dicty_cDB: SLH247 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SL (Link to library) SLH247 (Link to dictyBase) - - - Contig-U16280-1 SLH247Z (Link... to Original site) - - SLH247Z 632 - - - - Show SLH247 Library SL (Link to library) Clone ID SLH247 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/SL/SLH2-B/SLH247Q.Seq.d/ Representative seq. ID SLH24...7Z (Link to Original site) Representative DNA sequence >SLH247 (SLH247Q) /CSM/SL/SLH2-B/SLH247Q.Seq.d/ XXXXX...ant alignments: (bits) Value SLH247 (SLH247Q) /CSM/SL/SLH2-B/SLH247Q.Seq.d/ 1253 0.0 SLA487 (SLA487Q) /CSM/S

  15. Dicty_cDB: SLH285 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SL (Link to library) SLH285 (Link to dictyBase) - - - Contig-U16287-1 SLH285F (Link to Original site) SLH2...85F 326 - - - - - - Show SLH285 Library SL (Link to library) Clone ID SLH285 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/SL/SLH2-D/SLH285Q.Seq.d/ Representative seq. ID SLH28...5F (Link to Original site) Representative DNA sequence >SLH285 (SLH285Q) /CSM/SL/SLH2-D/SLH285Q.Seq.d/ AAAAA...ue SSF805 (SSF805Q) /CSM/SS/SSF8-A/SSF805Q.Seq.d/ 617 e-176 SLH288 (SLH288Q) /CSM/SL/SLH2-D/SLH288Q.Seq.d/ 617 e-176 SLH285 (SLH2

  16. Dicty_cDB: SLH222 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SL (Link to library) SLH222 (Link to dictyBase) - - - Contig-U16475-1 SLH222Z (Link... to Original site) - - SLH222Z 433 - - - - Show SLH222 Library SL (Link to library) Clone ID SLH222 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/SL/SLH2-A/SLH222Q.Seq.d/ Representative seq. ID SLH22...2Z (Link to Original site) Representative DNA sequence >SLH222 (SLH222Q) /CSM/SL/SLH2-A/SLH222Q.Seq.d/ XXXXX...603Q.Seq.d/ 728 0.0 SLI537 (SLI537Q) /CSM/SL/SLI5-B/SLI537Q.Seq.d/ 728 0.0 SLH222 (SLH222Q) /CSM/SL/SLH2

  17. Dicty_cDB: SLH241 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SL (Link to library) SLH241 (Link to dictyBase) - - - Contig-U15835-1 SLH241E (Link... to Original site) - - - - - - SLH241E 371 Show SLH241 Library SL (Link to library) Clone ID SLH241 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/SL/SLH2-B/SLH241Q.Seq.d/ Representative seq. ID SLH24...1E (Link to Original site) Representative DNA sequence >SLH241 (SLH241Q) /CSM/SL/SLH2-B/SLH241Q.Seq.d/ GAAGT....Seq.d/ 638 0.0 VFE160 (VFE160Q) /CSM/VF/VFE1-C/VFE160Q.Seq.d/ 638 0.0 SLH241 (SLH241Q) /CSM/SL/SLH2-B/SLH24

  18. Dicty_cDB: SLH265 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SL (Link to library) SLH265 (Link to dictyBase) - - - Contig-U13901-1 SLH265Z (Link... to Original site) - - SLH265Z 631 - - - - Show SLH265 Library SL (Link to library) Clone ID SLH265 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/SL/SLH2-C/SLH265Q.Seq.d/ Representative seq. ID SLH26...5Z (Link to Original site) Representative DNA sequence >SLH265 (SLH265Q) /CSM/SL/SLH2-C/SLH265Q.Seq.d/ XXXXX... alignments: (bits) Value SLH265 (SLH265Q) /CSM/SL/SLH2-C/SLH265Q.Seq.d/ 1059 0.0 VFL442 (VFL442Q) /CSM/VF/V

  19. Dicty_cDB: SLH207 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SL (Link to library) SLH207 (Link to dictyBase) - - - Contig-U11514-1 SLH207P (Link to Original site) SLH2...07F 689 SLH207Z 675 SLH207P 1364 - - Show SLH207 Library SL (Link to library) Clone ID SLH2...e URL http://dictycdb.biol.tsukuba.ac.jp/CSM/SL/SLH2-A/SLH207Q.Seq.d/ Representative seq. ID SLH2...07P (Link to Original site) Representative DNA sequence >SLH207 (SLH207Q) /CSM/SL/SLH2-A/SLH2...**yi Homology vs CSM-cDNA Score E Sequences producing significant alignments: (bits) Value SLH207 (SLH207Q) /CSM/SL/SLH2-A/SLH2

  20. Dicty_cDB: SLH278 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SL (Link to library) SLH278 (Link to dictyBase) - - - Contig-U16382-1 SLH278Z (Link... to Original site) - - SLH278Z 528 - - - - Show SLH278 Library SL (Link to library) Clone ID SLH278 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/SL/SLH2-D/SLH278Q.Seq.d/ Representative seq. ID SLH27...8Z (Link to Original site) Representative DNA sequence >SLH278 (SLH278Q) /CSM/SL/SLH2-D/SLH278Q.Seq.d/ XXXXX...75 (SLH375Q) /CSM/SL/SLH3-D/SLH375Q.Seq.d/ 1047 0.0 SLH278 (SLH278Q) /CSM/SL/SLH2-D/SLH278Q.Seq.d/ 1047 0.0

  1. Dicty_cDB: SLH221 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SL (Link to library) SLH221 (Link to dictyBase) - - - Contig-U16381-1 SLH221Z (Link... to Original site) - - SLH221Z 595 - - - - Show SLH221 Library SL (Link to library) Clone ID SLH221 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/SL/SLH2-A/SLH221Q.Seq.d/ Representative seq. ID SLH22...1Z (Link to Original site) Representative DNA sequence >SLH221 (SLH221Q) /CSM/SL/SLH2-A/SLH221Q.Seq.d/ XXXXX...LH722 (SLH722Q) /CSM/SL/SLH7-A/SLH722Q.Seq.d/ 559 e-158 SLH221 (SLH221Q) /CSM/SL/SLH2-A/SLH221Q.Seq.d/ 559 e

  2. Dicty_cDB: FC-BR23 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-BR23 (Link to dictyBase) - - - Contig-U15008-1 FC-BR23Z (Li...nk to Original site) - - FC-BR23Z 641 - - - - Show FC-BR23 Library FC (Link to library) Clone ID FC-BR23 (Li.../dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-BR/FC-BR23Q.Seq.d/ Representative seq. ID FC-BR2...3Z (Link to Original site) Representative DNA sequence >FC-BR23 (FC-BR23Q) /CSM/FC/FC-BR/FC-BR23Q.Seq....9 0.0 SLA211 (SLA211Q) /CSM/SL/SLA2-A/SLA211Q.Seq.d/ 1029 0.0 FC-BR23 (FC-BR23Q) /CSM/FC/FC-BR/FC-BR2

  3. Dicty_cDB: Contig-U14477-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available vmvvvivfylqviynlriivilmvqlivivf*mglvmvtviiivivii i*rinnnnsnnnnnsnnnkikmif*yqiinrlnnyf*shyqkfiiiqrldfwdyqrler* *hhlyqrlvnqvvivq*fhwisl...amvlaimxxx own update 2004. 6.10 Homology vs CSM-cDNA Query= Contig-U14477-1 (Conti

  4. Dicty_cDB: SSJ639 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available vih*l*i*lqeinnqlpklnhyhgqfqkvmihfvqfldlyq kiklki*imlnygvvsmvksnkkviptk*fsmfhi*fnilvql*h*nlai*f*lvhllvl vq*nldk*lnvvslv*iltcnsisf*erei...killkl*iinkkkkn* Homology vs CSM-cDNA Score E Sequences producing significant align

  5. Dicty_cDB: SSF460 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SS (Link to library) SSF460 (Link to dictyBase) - - - Contig-U03803-1 SSF460Z (Link... to Original site) - - SSF460Z 453 - - - - Show SSF460 Library SS (Link to library) Clone ID SSF460 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/SS/SSF4-C/SSF460Q.Seq.d/ Representative seq. ID SSF46...0Z (Link to Original site) Representative DNA sequence >SSF460 (SSF460Q) /CSM/SS/SSF4-C/SSF460Q.Seq.d/ XXXXX...s) Value SSM309 (SSM309Q) /CSM/SS/SSM3-A/SSM309Q.Seq.d/ 424 e-118 SSH196 (SSH196Q) /CSM/SS/SSH1-D/SSH196Q.Seq.d/ 424 e-118 SSF4

  6. Operational Law Handbook 2002

    Science.gov (United States)

    2002-03-26

    Denmark Egypt France [Greece] India Iraq Japan Luxembourg Morocco Nepal [the Netherlands] Norway Oman Pakistan Saudi Arabia [Spain...Support Equipment CSH Combat Support Hospital CSM Command Sergeant Major CSP Contracting Support Plan CSR Controlled Supply Rate CSS Combat Service

  7. Contraceptive social marketing and community-based distribution systems in Colombia.

    Science.gov (United States)

    Vernon, R; Ojeda, G; Townsend, M C

    1988-01-01

    Three operations research experiments were carried out in three provinces of Colombia to improve the cost-effectiveness of Profamilia's nonclinic-based programs. The experiments tested: (a) whether a contraceptive social marketing (CSM) strategy can replace a community-based distribution (CBD) program in a high contraceptive use area; (b) if wage incentives for salaried CBD instructors will increase contraceptive sales; and (c) whether a specially equipped information, education, and communication (IEC) team can replace a cadre of rural promoters to expand family planning coverage. All three strategies proved to be effective, but only the CSM system yielded a profit. Despite this, Profamilia discontinued its CSM program soon after the experiment was completed. Unexpected government controls regulating the price and sale of contraceptives in Colombia made the program unprofitable. As a result, family planning agencies are cautioned against replacing CBD programs with CSM. Instead, CBD programs might adopt a more commercial approach to become more efficient.

  8. Dicty_cDB: CHQ790 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available TSSSHKFTPHPTHSRKIHWQLSIPPLDGEVIKYSVFYSGLNLPASRLLKKXKN*l ilinkyk Translated Amino Acid sequence (All Frames) ...PPLDGEVIKYSVFYSGLNLPASRLLKKXKN*l ilinkyk Homology vs CSM-cDNA Score E Sequences producing significant alignm

  9. Dicty_cDB: CHJ780 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ) Frame A: iqkcqinkkkkkkn*kkfx*vxkgxsfxkkkkxpxfffxkkxxkxkkkkxkkxxxxxprg lxkkkxxxkkxkkxxkkkkkxkktf*xpxxx...fggxxkxxxxgxxppxxxxxxpxpxkxwx pxkxxpxxxxggtpxxxxxlfxxxxpxfxkkxflkkkkxkktffxxff*kxxxkk-...--- Frame C: skmsnk*kkkkkklkkilxgxkrx*f*xkkkkxpfffx*kkxkxkkkkxkkxxxxxxpga xkkkkxxkkkxkxxkkkkkxkknxlxppxxfwgxxxxkxxggxxpxxxxxx...ppxxkxlxp pxxgpxxxpggnpxxxxxxfxxxkxxfxxkxffkkkkxxknffxxfflkxxxkk--- Homology vs CSM-cDNA Sc

  10. Dicty_cDB: CHQ769 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available klklnl*NQFVTKTSNLKKK--- ---xxxxxxxxxkkkkkkkkkkkkkxxxxxxxxxfff*kkkkkn Frame B: lnhcsilfifklnintikks*n*ickinl*...qklvi*kk--- ---XXXXXXXXXKKKKKKKKKKKKNXXKXXXXXXFFFKKKKKKI Frame C: *iivvfcsysn*isiqlkkvkikfvksicnkn**fkkk--- ---xxxxxxxxx...kkkkkkkkkkkkxxxkxxxxxxfflkkkkkk* Homology vs CSM-cDNA Score E Sequences producing significant al

  11. Dicty_cDB: VFH554 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available RXKXXXXXXXQRXXXXEXXXXXX--- Frame B: eledsklxgxvytkkxn*rxlxxihwxrsxxxrxrkxxx*rgxyxxxiqrxhxxxxkrsn trrxxxrxxxernxxxkgxrxxxaxxxkexxxxx...gxxga--- Frame C: s*ktrnxxgxfiqkkxirgxxhxytgqeaxxagxexaxtkexhxxtxyrxhtxxxxrgat peexxaexxxketgxxkgkggxxxxxtkxxx...ggxxxxxx--- Homology vs CSM-cDNA Score E Sequences produ

  12. Dicty_cDB: AFK258 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available AF (Link to library) AFK258 (Link to dictyBase) - - - Contig-U15883-1 AFK258Z (Link... to Original site) - - AFK258Z 705 - - - - Show AFK258 Library AF (Link to library) Clone ID AFK258 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/AF/AFK2-C/AFK258Q.Seq.d/ Representative seq. ID AFK25...8Z (Link to Original site) Representative DNA sequence >AFK258 (AFK258Q) /CSM/AF/AFK2-C/AFK258Q.Seq.d/ XXXXX...its) Value CFC754 (CFC754Q) /CSM/CF/CFC7-C/CFC754Q.Seq.d/ 656 0.0 AFM846 (AFM846Q) /CSM/AF/AFM8-B/AFM846Q.Seq.d/ 656 0.0 AFK2

  13. Dicty_cDB: VHK246 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHK246 (Link to dictyBase) - - - Contig-U16440-1 VHK246P (Link to Original site) VHK2...46F 617 VHK246Z 760 VHK246P 1357 - - Show VHK246 Library VH (Link to library) Clone ID VHK2...e URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHK2-B/VHK246Q.Seq.d/ Representative seq. ID VHK2...46P (Link to Original site) Representative DNA sequence >VHK246 (VHK246Q) /CSM/VH/VHK2-B/VHK2...y vs CSM-cDNA Score E Sequences producing significant alignments: (bits) Value VHK246 (VHK246Q) /CSM/VH/VHK2-B/VHK2

  14. Dicty_cDB: CFI644 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Original site) Representative DNA sequence >CFI644 (CFI644Q) /CSM/CF/CFI6-B/CFI644Q.Seq.d/ XXXXXXXXXXTCCAAATTTCCATANA.... >CFI644Z.Seq NNNNNNNNNNTCCAAATTTCCATANATGTGTTTAAAAACGTGGNGGNATNTTAAGNTGNG AATTTNANCCCCCNANACAACCNANATCCCTT

  15. Porous carbon with small mesoporesas an ultra-high capacity adsorption medium

    Science.gov (United States)

    Gao, Biaofeng; Zhou, Haitao; Chen, De; Yang, Jianhong

    2017-10-01

    Resins (732-type), abundant and inexpensive resources were used to prepare porous carbon with small mesopores (CSM) by carbonization and post-chemical-activation with potassium hydroxide (KOH). The N2 adsorption measurements revealed that CSM had high surface areas (1776.5 m2 g-1), large pore volumes (1.10 cm3 g-1), and nearly optimal narrow small mesopore sizes ranging from 2 to 7 nm. CSM was used as adsorbent to investigate the adsorption behavior for Rhodamine B (RhB). Due to the optimal pore size distributions (PSD), intensive-stacking interaction, S-doped, and electrostatic attraction, the CSM exhibited an ultra-high-capacity of 1590 mg g-1 for RhB in aqueous solutions.

  16. Dicty_cDB: SHE454 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VTHTPVNVDDNNKCTIDTCTKEGGVTHTPINTDDNNACTLDSCSXXXGVSHTPNK X****xmdl*nscsklnwlx*ippinwddxnxc--- Frame C: lmitmp...vhlipvhhqlvfptpqltvmivihvp*thvqiqpvv*tlqsmlmiiihvl*mlv pnqqvshipq*m*mittnvqlmhvpkkvv*lilqstlmitm...xmiitnvqlihvpkkvv*lilqsilmitmpvplipahxxlvfpippin xddnnxwtcrihvpnstgxgkylqltgtixxxv--- Homology vs CSM-cDNA S

  17. A Window of Opportunity for Aceh, Indonesia Post-Tsunami: Historic Continuity, Current Points of Interest, and a Pattern. Output of the Cultural Simulation Model

    National Research Council Canada - National Science Library

    2006-01-01

    ...) for the Situation in Aceh, Indonesia. The CSM uses news filtering, a knowledge acquisition and contextual memory method, which we refer to as a Cultural Construct, as well as interaction by modelers, subject matter experts (SMEs...

  18. Dicty_cDB: FC-BS09 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-BS09 (Link to dictyBase) - - - Contig-U16215-1 FC-BS09Z (Li...nk to Original site) - - FC-BS09Z 626 - - - - Show FC-BS09 Library FC (Link to library) Clone ID FC-BS09 (Li.../dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-BS/FC-BS09Q.Seq.d/ Representative seq. ID FC-BS...09Z (Link to Original site) Representative DNA sequence >FC-BS09 (FC-BS09Q) /CSM/FC/FC-BS/FC-BS09Q.Seq....ignments: (bits) Value SSF360 (SSF360Q) /CSM/SS/SSF3-C/SSF360Q.Seq.d/ 854 0.0 FC-BS09 (FC-BS09Q) /CSM/FC/FC-BS/FC-BS

  19. Dicty_cDB: Contig-U01997-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Contig-U01997-1 gap included 886 2 1683026 1682230 MINUS 3 4 U01997 1 0 0 0 0 0 2 0 0 0 0 0 0 0 Show Contig...-U01997-1 Contig ID Contig-U01997-1 Contig update 2001. 8.29 Contig sequence >Contig-U01997-1 (Contig-U01997-1Q) /CSM_Contig/Contig-U01997...ATTGAAATAATATTTATTTATTTTTTTAAAAAAAAAAAA AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA Gap gap included Contig...nfkvfgieiifiyffkkkkkkkkkkkkkkkkkkk own update 2004. 6. 9 Homology vs CSM-cDNA Query= Contig-U01997-1 (Contig-U01997-1Q) /CSM_Contig.../Contig-U01997-1Q.Seq.d (896 letters) Database: CSM 6905 sequences; 5,674,871 total l

  20. Dicty_cDB: Contig-U03367-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Contig-U03367-1 no gap 323 - - - - 2 1 U03367 0 0 0 0 0 0 0 0 0 0 0 0 1 1 Show Contig-U03367-1 Contig... ID Contig-U03367-1 Contig update 2001. 8.29 Contig sequence >Contig-U03367-1 (Contig-U03367-1Q) /CSM_Contig/Contig...TTGCGGGTTGGCAGGACTGTNGGNAGGCATGGNCATCGGTATNNTTGGAG ATGCTNGTGTGAGGGCGAATGCT Gap no gap Contig length 323 Chro...HLXXGLXCGLAGLXXGMXIGXXGDAXVRANA own update 2004. 6. 9 Homology vs CSM-cDNA Query= Contig-U03367-1 (Contig...-U03367-1Q) /CSM_Contig/Contig-U03367-1Q.Seq.d (323 letters) Database: CSM 6905 sequ

  1. Dicty_cDB: Contig-U09694-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Contig-U09694-1 gap included 1129 1 4027135 4026071 MINUS 3 4 U09694 2 0 1 0 0 0 0 0 0 0 0 0 0 0 Show Contig...-U09694-1 Contig ID Contig-U09694-1 Contig update 2002. 9.13 Contig sequence >Contig-U09694-1 (Contig-U09694-1Q) /CSM_Contig/Contig-U0969...TTAAATTAAAACAACAACAATTTCATAATATAAATAAT Gap gap included Contig length 1129 Chromosome number (1..6, M) 1 Chr...iklkqqqfklkqqqfhninn own update 2004. 6.10 Homology vs CSM-cDNA Query= Contig-U09694-1 (Contig-U09694-1Q) /CSM_Contig/Contig...E Sequences producing significant alignments: (bits) Value Contig-U09694-1 (Contig-U09694-1Q) /CSM_Contig

  2. Dicty_cDB: Contig-U12086-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Contig-U12086-1 gap included 1101 3 5710254 5711336 PLUS 1 2 U12086 0 0 0 0 0 0 0 1 0 0 0 0 0 0 Show Contig...-U12086-1 Contig ID Contig-U12086-1 Contig update 2002.12.18 Contig sequence >Contig-U12086-1 (Contig-U12086-1Q) /CSM_Contig/Contig-U12086...ATCGGATTA Gap gap included Contig length 1101 Chromosome number (1..6, M) 3 Chromosome length 6358359 Start ...te 2004. 6.10 Homology vs CSM-cDNA Query= Contig-U12086-1 (Contig-U12086-1Q) /CSM_Contig/Contig...Sequences producing significant alignments: (bits) Value Contig-U12086-1 (Contig-U12086-1Q) /CSM_Contig/Conti... 404 e-113 Contig

  3. Dicty_cDB: Contig-U12545-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Contig-U12545-1 gap included 1165 3 3275272 3276395 PLUS 1 2 U12545 0 1 0 0 0 0 0 0 0 0 0 0 0 0 Show Contig...-U12545-1 Contig ID Contig-U12545-1 Contig update 2002.12.18 Contig sequence >Contig-U12545-1 (Contig-U12545-1Q) /CSM_Contig/Contig-U12545...CGTTCTAAATCACTCATTAAAAGATTAAAAATTAAANAAGGTAATATC TCACGACNGCTNNCTCATACACACN Gap gap included Contig length 11...vliknlskrkerkis*klyqlkriqlsl vknwlklvlnhslkd*klxkvishdxxliht own update 2004. 6.10 Homology vs CSM-cDNA Query= Contig...-U12545-1 (Contig-U12545-1Q) /CSM_Contig/Contig-U12545-1Q.Seq.d (1175 letters) Database: CSM 6905 s

  4. Innovations in Site Characterization Case Study: The Role of a Conceptual Site Model for Expedited Site Characterization Using the Triad Approach at the Poudre River Site, Fort Collins, Colorado

    Science.gov (United States)

    This case study examines how systematic planning, an evolving conceptual site model (CSM), dynamic work strategies, and real time measurement technologies can be used to unravel complex contaminant distribution patterns...

  5. Dicty_cDB: SSD104 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available v i*sncfrs*pcrikiftnvl*iwheyitnslfstdiq*ncic*ctwgsdtsd Homology vs CSM-cDNA Score E Sequences producing sign...kkklmcftnkgwitiifwtsicfscseli*titcwtkwhtqgte*rls aswrs*ttifitrvchnrttwtf**wq*itftnwiw*mnesi*ycnfsttectltd*ti

  6. Triad Issue Paper: Using Geophysical Tools to Develop the Conceptual Site Model

    Science.gov (United States)

    This technology bulletin explains how hazardous-waste site professionals can use geophysical tools to provide information about subsurface conditions to create a more representative conceptual site model (CSM).

  7. Soome maiustustetootja Leaf saab peatselt uue omaniku / Tõnis Arnover

    Index Scriptorium Estoniae

    Arnover, Tõnis, 1952-

    2004-01-01

    Hollandi kontsern CSM otsustas loobuda maiustusetootmisest, sh. Soome magusatootjast Leaf ning keskenduda pagaritööstustoorme, biokemikaalide ning suhkrutoodete valmistamisele. Diagramm: CSMi kasumlikkus vähenes. Vt. samas: Eestis menukad kurgupastillid

  8. Dicty_cDB: SHD666 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ickrislelfir *f*fhfrefntr*yw*icnlfciingfpskn*sn*tifhrcssnpslfvgkcyikysiq* ng*ktkh...ciingfpskn*sn*tifhrcssnpslfvgkcyikysiq* ng*ktkhxtcif*ixixf Homology vs CSM-cDNA Score E Sequences producing

  9. Dicty_cDB: VFE203 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available tfyfyvngakxsefsganeatlxxtlxanx*ffv kliiaqkm Translated Amino Acid sequence (All F...yfyvngakxsefsganeatlxxtlxanx*ffv kliiaqkm Homology vs CSM-cDNA Score E Sequences producing significant align...iaqkmqqik*INKKK--- ---NQINNLY*kmskvihvtsnexlxkylqhqxvvvdfsaewcgpcxxxapvfdklsnef ttftfvhvdidkvxthpivkxixsxptf

  10. Dicty_cDB: CHI526 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available YVPXIESCXNNHYNXQLSXSIN*iny*xki kkiilitiii**ln*fansn Translated Amino Acid sequenc...ALDGTHMNPSYVPXIESCXNNHYNXQLSXSIN*iny*xki kkiilitiii**ln*fansn Homology vs CSM-cDNA Score E Sequences produci

  11. Seasonal changes in suspended sediment load in the Gauthami-Godavari Estuary

    Digital Repository Service at National Institute of Oceanography (India)

    Reddy, N.P.C.; Rao, B.P.; Rao, K.M.; Rao, V.S.

    Studies carried out on suspended matter characteristics of the the Gautami Godavari Estuary revealed that the concentration of suspended matter (CSM) during southwest monsoon influenced mainly by the increased run off at both Neelarevu and Vrudha...

  12. Dicty_cDB: SLC485 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SL (Link to library) SLC485 (Link to dictyBase) - - - Contig-U16358-1 SLC485Z (Link... to Original site) - - SLC485Z 452 - - - - Show SLC485 Library SL (Link to library) Clone ID SLC485 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/SL/SLC4-D/SLC485Q.Seq.d/ Representative seq. ID SLC48...5Z (Link to Original site) Representative DNA sequence >SLC485 (SLC485Q) /CSM/SL/SLC4-D/SLC485Q.Seq.d/ XXXXX... 825 0.0 SLG820 (SLG820Q) /CSM/SL/SLG8-A/SLG820Q.Seq.d/ 825 0.0 SLC485 (SLC485Q) /CSM/SL/SLC4-D/SLC4

  13. Dicty_cDB: SLC443 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SL (Link to library) SLC443 (Link to dictyBase) - - - Contig-U16518-1 SLC443P (Link to Original site) SLC4...43F 466 SLC443Z 304 SLC443P 770 - - Show SLC443 Library SL (Link to library) Clone ID SLC4... URL http://dictycdb.biol.tsukuba.ac.jp/CSM/SL/SLC4-B/SLC443Q.Seq.d/ Representative seq. ID SLC4...43P (Link to Original site) Representative DNA sequence >SLC443 (SLC443Q) /CSM/SL/SLC4-B/SLC4...Homology vs CSM-cDNA Score E Sequences producing significant alignments: (bits) Value SLC443 (SLC443Q) /CSM/SL/SLC4-B/SLC4

  14. Dicty_cDB: SLC407 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SL (Link to library) SLC407 (Link to dictyBase) - - - Contig-U16560-1 SLC407Z (Link... to Original site) - - SLC407Z 365 - - - - Show SLC407 Library SL (Link to library) Clone ID SLC407 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/SL/SLC4-A/SLC407Q.Seq.d/ Representative seq. ID SLC40...7Z (Link to Original site) Representative DNA sequence >SLC407 (SLC407Q) /CSM/SL/SLC4-A/SLC407Q.Seq.d/ XXXXX...vvtkf*cqt e** Homology vs CSM-cDNA Score E Sequences producing significant alignments: (bits) Value SLC407 (SLC407Q) /CSM/SL/SLC4

  15. Dicty_cDB: SLC404 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SL (Link to library) SLC404 (Link to dictyBase) - G22406 DDB0190371 Contig-U03918-1 SLC4...04E (Link to Original site) - - - - - - SLC404E 229 Show SLC404 Library SL (Link to library) Clone ID SLC4...riginal site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/SL/SLC4-A/SLC404Q.Seq.d/ ...Representative seq. ID SLC404E (Link to Original site) Representative DNA sequence >SLC404 (SLC404Q) /CSM/SL/SLC4-A/SLC4...y vs CSM-cDNA Score E Sequences producing significant alignments: (bits) Value SLC404 (SLC404Q) /CSM/SL/SLC4-A/SLC4

  16. Dicty_cDB: SLC486 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SL (Link to library) SLC486 (Link to dictyBase) - - - Contig-U16480-1 SLC486E (Link... to Original site) - - - - - - SLC486E 451 Show SLC486 Library SL (Link to library) Clone ID SLC486 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/SL/SLC4-D/SLC486Q.Seq.d/ Representative seq. ID SLC48...6E (Link to Original site) Representative DNA sequence >SLC486 (SLC486Q) /CSM/SL/SLC4-D/SLC486Q.Seq.d/ GTCAT...7Q.Seq.d/ 868 0.0 SLD427 (SLD427Q) /CSM/SL/SLD4-B/SLD427Q.Seq.d/ 868 0.0 SLC486 (SLC486Q) /CSM/SL/SLC4-D/SLC4

  17. Dicty_cDB: SLC441 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SL (Link to library) SLC441 (Link to dictyBase) - - - Contig-U00414-1 SLC441P (Link to Original site) SLC4...41F 207 SLC441Z 473 SLC441P 680 - - Show SLC441 Library SL (Link to library) Clone ID SLC4... URL http://dictycdb.biol.tsukuba.ac.jp/CSM/SL/SLC4-B/SLC441Q.Seq.d/ Representative seq. ID SLC4...41P (Link to Original site) Representative DNA sequence >SLC441 (SLC441Q) /CSM/SL/SLC4-B/SLC4...Q) /CSM/SL/SLI1-C/SLI162Q.Seq.d/ 896 0.0 SLC441 (SLC441Q) /CSM/SL/SLC4-B/SLC441Q.Seq.d/ 896 0.0 AFK293 (AFK2

  18. Dicty_cDB: SLC436 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SL (Link to library) SLC436 (Link to dictyBase) - - - Contig-U16460-1 SLC436Z (Link... to Original site) - - SLC436Z 344 - - - - Show SLC436 Library SL (Link to library) Clone ID SLC436 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/SL/SLC4-B/SLC436Q.Seq.d/ Representative seq. ID SLC43...6Z (Link to Original site) Representative DNA sequence >SLC436 (SLC436Q) /CSM/SL/SLC4-B/SLC436Q.Seq.d/ XXXXX.../CSM/SL/SLE2-C/SLE258Q.Seq.d/ 470 e-132 SLC773 (SLC773Q) /CSM/SL/SLC7-D/SLC773Q.Seq.d/ 470 e-132 SLC4

  19. Dicty_cDB: SLC413 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SL (Link to library) SLC413 (Link to dictyBase) - - - Contig-U15735-1 SLC413P (Link to Original site) SLC4...13F 686 SLC413Z 466 SLC413P 1152 - - Show SLC413 Library SL (Link to library) Clone ID SLC4...e URL http://dictycdb.biol.tsukuba.ac.jp/CSM/SL/SLC4-A/SLC413Q.Seq.d/ Representative seq. ID SLC4...13P (Link to Original site) Representative DNA sequence >SLC413 (SLC413Q) /CSM/SL/SLC4-A/SLC4...iknkikkknikqkkkk Homology vs CSM-cDNA Score E Sequences producing significant alignments: (bits) Value SLC413 (SLC413Q) /CSM/SL/SLC4

  20. Dicty_cDB: SLC434 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SL (Link to library) SLC434 (Link to dictyBase) - - - Contig-U15434-1 SLC434Z (Link... to Original site) - - SLC434Z 438 - - - - Show SLC434 Library SL (Link to library) Clone ID SLC434 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/SL/SLC4-B/SLC434Q.Seq.d/ Representative seq. ID SLC43...4Z (Link to Original site) Representative DNA sequence >SLC434 (SLC434Q) /CSM/SL/SLC4-B/SLC434Q.Seq.d/ XXXXX...logy vs CSM-cDNA Score E Sequences producing significant alignments: (bits) Value SLC434 (SLC434Q) /CSM/SL/SLC4-B/SLC4

  1. Dicty_cDB: SLC403 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SL (Link to library) SLC403 (Link to dictyBase) - - - Contig-U16252-1 SLC403Z (Link... to Original site) - - SLC403Z 492 - - - - Show SLC403 Library SL (Link to library) Clone ID SLC403 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/SL/SLC4-A/SLC403Q.Seq.d/ Representative seq. ID SLC40...3Z (Link to Original site) Representative DNA sequence >SLC403 (SLC403Q) /CSM/SL/SLC4-A/SLC403Q.Seq.d/ XXXXX...-B/SLE731Q.Seq.d/ 902 0.0 SLC403 (SLC403Q) /CSM/SL/SLC4-A/SLC403Q.Seq.d/ 902 0.0 SLC241 (SLC241Q) /CSM/SL/SL

  2. Dicty_cDB: SLC450 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SL (Link to library) SLC450 (Link to dictyBase) - - - Contig-U16382-1 SLC450Z (Link... to Original site) - - SLC450Z 416 - - - - Show SLC450 Library SL (Link to library) Clone ID SLC450 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/SL/SLC4-C/SLC450Q.Seq.d/ Representative seq. ID SLC45...0Z (Link to Original site) Representative DNA sequence >SLC450 (SLC450Q) /CSM/SL/SLC4-C/SLC450Q.Seq.d/ XXXXX...cant alignments: (bits) Value SLC450 (SLC450Q) /CSM/SL/SLC4-C/SLC450Q.Seq.d/ 678 0.0 VFO858 (VFO858Q) /CSM/V

  3. Dicty_cDB: SLC409 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SL (Link to library) SLC409 (Link to dictyBase) - - - Contig-U14931-1 SLC409Z (Link... to Original site) - - SLC409Z 483 - - - - Show SLC409 Library SL (Link to library) Clone ID SLC409 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/SL/SLC4-A/SLC409Q.Seq.d/ Representative seq. ID SLC40...9Z (Link to Original site) Representative DNA sequence >SLC409 (SLC409Q) /CSM/SL/SLC4-A/SLC409Q.Seq.d/ XXXXX... SLH501 (SLH501Q) /CSM/SL/SLH5-A/SLH501Q.Seq.d/ 858 0.0 SLF191 (SLF191Q) /CSM/SL/SLF1-D/SLF191Q.Seq.d/ 858 0.0 SLC409 (SLC4

  4. Dicty_cDB: SLC473 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SL (Link to library) SLC473 (Link to dictyBase) - - - Contig-U16054-1 SLC473F (Link to Original site) SLC4...73F 698 - - - - - - Show SLC473 Library SL (Link to library) Clone ID SLC473 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/SL/SLC4-D/SLC473Q.Seq.d/ Representative seq. ID SLC47...3F (Link to Original site) Representative DNA sequence >SLC473 (SLC473Q) /CSM/SL/SLC4-D/SLC473Q.Seq.d/ AGAAA... CSM-cDNA Score E Sequences producing significant alignments: (bits) Value SLC473 (SLC473Q) /CSM/SL/SLC4

  5. Dicty_cDB: SLC470 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SL (Link to library) SLC470 (Link to dictyBase) - - - Contig-U15735-1 SLC470Z (Link... to Original site) - - SLC470Z 386 - - - - Show SLC470 Library SL (Link to library) Clone ID SLC470 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/SL/SLC4-C/SLC470Q.Seq.d/ Representative seq. ID SLC47...0Z (Link to Original site) Representative DNA sequence >SLC470 (SLC470Q) /CSM/SL/SLC4-C/SLC470Q.Seq.d/ XXXXX...Seq.d/ 533 e-151 SLF229 (SLF229Q) /CSM/SL/SLF2-B/SLF229Q.Seq.d/ 533 e-151 SLC470 (SLC470Q) /CSM/SL/SLC4-C/SLC4

  6. Dicty_cDB: SLC487 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SL (Link to library) SLC487 (Link to dictyBase) - - - Contig-U12865-1 SLC487Z (Link... to Original site) - - SLC487Z 404 - - - - Show SLC487 Library SL (Link to library) Clone ID SLC487 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/SL/SLC4-D/SLC487Q.Seq.d/ Representative seq. ID SLC48...7Z (Link to Original site) Representative DNA sequence >SLC487 (SLC487Q) /CSM/SL/SLC4-D/SLC487Q.Seq.d/ XXXXX...1 0.0 SSF377 (SSF377Q) /CSM/SS/SSF3-D/SSF377Q.Seq.d/ 801 0.0 SLC492 (SLC492Q) /CSM/SL/SLC4-D/SLC4

  7. Dicty_cDB: SLC435 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SL (Link to library) SLC435 (Link to dictyBase) - - - Contig-U16260-1 SLC435E (Link... to Original site) - - - - - - SLC435E 373 Show SLC435 Library SL (Link to library) Clone ID SLC435 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/SL/SLC4-B/SLC435Q.Seq.d/ Representative seq. ID SLC43...5E (Link to Original site) Representative DNA sequence >SLC435 (SLC435Q) /CSM/SL/SLC4-B/SLC435Q.Seq.d/ GGAGA...I815Q) /CSM/SL/SLI8-A/SLI815Q.Seq.d/ 694 0.0 SLC435 (SLC435Q) /CSM/SL/SLC4-B/SLC4

  8. Dicty_cDB: SLC489 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SL (Link to library) SLC489 (Link to dictyBase) - - - Contig-U16255-1 SLC489P (Link to Original site) SLC4...89F 628 SLC489Z 172 SLC489P 800 - - Show SLC489 Library SL (Link to library) Clone ID SLC4... URL http://dictycdb.biol.tsukuba.ac.jp/CSM/SL/SLC4-D/SLC489Q.Seq.d/ Representative seq. ID SLC4...89P (Link to Original site) Representative DNA sequence >SLC489 (SLC489Q) /CSM/SL/SLC4-D/SLC4...SSD212Q.Seq.d/ 1001 0.0 SLE207 (SLE207Q) /CSM/SL/SLE2-A/SLE207Q.Seq.d/ 1001 0.0 SLC489 (SLC489Q) /CSM/SL/SLC4-D/SLC4

  9. Dicty_cDB: CFE281 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available KICPQWPARNHATAL RAGTVSFYLSPKMTSDAPADPSQDVFFQNSIHSSPFGN--- ---CLSSKGKRTLNINILGLKEIISKYSSXPLNQR*knstlnfirtix*fiiy**w*fiq yn*rstskxsiem...tlnfirtix*fiiy**w*fiq yn*rstskxsiemnsspxnsxwl Homology vs CSM-cDNA Score E Sequen

  10. Pd Alloy Membranes for Hydrogen Separation from Coal-Derived Syngas

    National Research Council Canada - National Science Library

    Alptekin, Gokhan O; DeVoss, Sarah; Amalfitano, Bob; Way, Douglas; Thoen, Paul; Lusk, Mark

    2006-01-01

    TDA Research Inc., in collaboration with Colorado School of Mines (CSM) is developing a sulfur and CO-tolerant membrane to produce the clean hydrogen from syngas using Pd membrane films prepared on a variety of supports (e.g...

  11. Dicty_cDB: SHL846 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available vlivyhviq*iqlllmkhqeyyisn *aqhhiimmlkskkfnhh*ihhhqmvvkenhqnyqvvqllvlqlvvllvlvl*lvlsfil n*slvlkkhsiniliivfdgvnyklgsklq*iihkfk*itlitlen...in*ciiknihnixt vsyxyxiil Homology vs CSM-cDNA Score E Sequences producing significa

  12. Fulltext PDF

    Indian Academy of Sciences (India)

    GOVERNMENT OF INDIA. NATIONAL BOARD FOR HIGHER MATHEMATICS. OYC Building, CSM Marg, Mumbai 400 001. SCHOLARSHIPS ... National Board for Higher Mathematics (NBHM) ... (in BLOCK LETTERS WITH PIN CODE). [3.] ...

  13. Integrated Microchannel Reformer/Hydrogen Purifier for Fuel Cell Power Systems, Phase I

    Data.gov (United States)

    National Aeronautics and Space Administration — Makel Engineering, Inc. (MEI) and Colorado School of Mines (CSM) propose to develop an integrated hydrogen generator and purifier system for conversion of in-situ...

  14. Dicty_cDB: SLE172 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available d/ 1126 0.0 VHJ195 (VHJ195Q) /CSM/VH/VHJ1-D/VHJ195Q.Seq.d/ 1102 0.0 SLD492 (SLD492Q) /CSM/SL/SLD4-D/SLD492... 0.0 1 ( AU052538 ) Dictyostelium discoideum slug cDNA, clone SLD492. 817 0.0 1 ( C83939 ) Dictyostelium dis

  15. Dicty_cDB: SLA508 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available e-101 SLD569 (SLD569Q) /CSM/SL/SLD5-C/SLD569Q.Seq.d/ 250 1e-65 SLD492 (SLD492Q) /CSM/SL/SLD4-D/SLD492...oideum slug cDNA, clone SLD569. 250 2e-62 1 ( AU052538 ) Dictyostelium discoideum slug cDNA, clone SLD492. 7

  16. The Relationship Between Key Supply Chain Management Process Implementation, Competitive Advantage and Organizational Performance

    Science.gov (United States)

    2012-03-01

    with inputs from 3M; CEMEX; The Coca - Cola Company; CSX Corporation; Fletcher-Challenge; Goodyear Tire and Rubber Company; Hewlett-Packard Company...customer’s expectations. Ultimately, CSM process metrics should reflect the impact of CSM on the organization’s efficiency and financial performance...order fulfillment solutions, the associated benefits to the customer, and the impact on the financial performance of the firm, its customers and

  17. THE MORPHOLOGY AND DYNAMICS OF JET-DRIVEN SUPERNOVA REMNANTS: THE CASE OF W49B

    Energy Technology Data Exchange (ETDEWEB)

    González-Casanova, Diego F.; De Colle, Fabio [Instituto de Ciencias Nucleares, Universidad Nacional Autónoma de México, A. P. 70-543, 04510 D. F. (Mexico); Ramirez-Ruiz, Enrico [Department of Astronomy and Astrophysics, University of California, Santa Cruz, CA 95064 (United States); Lopez, Laura A. [MIT-Kavli Institute for Astrophysics and Space Research, 77 Massachusetts Avenue, 37-664H, Cambridge, MA 02139 (United States)

    2014-02-01

    The circumstellar medium (CSM) of a massive star is modified by its winds before a supernova (SN) explosion occurs, and thus the evolution of the resulting supernova remnant (SNR) is influenced by both the geometry of the explosion as well as the complex structure of the CSM. Motivated by recent work suggesting the SNR W49B was a jet-driven SN expanding in a complex CSM, we explore how the dynamics and the metal distributions in a jet-driven explosion are modified by the interaction with the surrounding environment. In particular, we perform hydrodynamical calculations to study the dynamics and explosive nucleosynthesis of a jet-driven SN triggered by the collapse of a 25 M {sub ☉} Wolf-Rayet star and its subsequent interaction with the CSM up to several hundred years following the explosion. We find that although the CSM has small-scale effects on the structure of the SNR, the overall morphology and abundance patterns are reflective of the initial asymmetry of the SN explosion. Thus, we predict that jet-driven SNRs, such as W49B, should be identifiable based on morphology and abundance patterns at ages up to several hundred years, even if they expand into a complex CSM environment.

  18. CIRCUMSTELLAR SHELL FORMATION IN SYMBIOTIC RECURRENT NOVAE

    Energy Technology Data Exchange (ETDEWEB)

    Moore, Kevin; Bildsten, Lars [Department of Physics, Broida Hall, University of California, Santa Barbara, CA 93106 (United States)

    2012-12-20

    We present models of spherically symmetric recurrent nova shells interacting with circumstellar material (CSM) in a symbiotic system composed of a red giant (RG) expelling a wind and a white dwarf accreting from this material. Recurrent nova eruptions periodically eject material at high velocities ({approx}> 10{sup 3} km s{sup -1}) into the RG wind profile, creating a decelerating shock wave as CSM is swept up. High CSM densities cause the shocked wind and ejecta to have very short cooling times of days to weeks. Thus, the late-time evolution of the shell is determined by momentum conservation instead of energy conservation. We compute and show evolutionary tracks of shell deceleration, as well as post-shock structure. After sweeping up all the RG wind, the shell coasts at a velocity {approx}100 km s{sup -1}, depending on system parameters. These velocities are similar to those measured in blueshifted CSM from the symbiotic nova RS Oph, as well as a few Type Ia supernovae that show evidence of CSM, such as 2006X, 2007le, and PTF 11kx. Supernovae occurring in such systems may not show CSM interaction until the inner nova shell gets hit by the supernova ejecta, days to months after the explosion.

  19. Study of cover source mismatch in steganalysis and ways to mitigate its impact

    Science.gov (United States)

    Kodovský, Jan; Sedighi, Vahid; Fridrich, Jessica

    2014-02-01

    When a steganalysis detector trained on one cover source is applied to images from a different source, generally the detection error increases due to the mismatch between both sources. In steganography, this situation is recognized as the so-called cover source mismatch (CSM). The drop in detection accuracy depends on many factors, including the properties of both sources, the detector construction, the feature space used to represent the covers, and the steganographic algorithm. Although well recognized as the single most important factor negatively affecting the performance of steganalyzers in practice, the CSM received surprisingly little attention from researchers. One of the reasons for this is the diversity with which the CSM can manifest. On a series of experiments in the spatial and JPEG domains, we refute some of the common misconceptions that the severity of the CSM is tied to the feature dimensionality or their "fragility." The CSM impact on detection appears too difficult to predict due to the effect of complex dependencies among the features. We also investigate ways to mitigate the negative effect of the CSM using simple measures, such as by enlarging the diversity of the training set (training on a mixture of sources) and by employing a bank of detectors trained on multiple different sources and testing on a detector trained on the closest source.

  20. Surgical Treatment of Cervical Spondylotic Myelopathy Associated Hypertension--A Retrospective Study of 309 Patients.

    Directory of Open Access Journals (Sweden)

    Ze-qun Li

    Full Text Available Hypertension is the most prevalent cardiovascular disease, and various risk factors are known to be involved in it. Cervical spondylotic myelopathy (CSM is the most common non-traumatic cause of myelopathy, which displays neurological symptoms and may induce systemic symptoms. To date, it is still unknown whether CSM is associated with hypertension, and if so, whether the decompression operations can attenuate CSM associated hypertension. Here, a total of 309 patients with CSM who received anterior or posterior decompression surgery were enrolled as subjects. Blood pressure measurements were performed before and within one week after the surgery. Among the 309 subjects, 144 (46.6% of them exhibited hypertension before surgery, a significantly higher ratio than that of the whole population. One week after surgery, blood pressure of 106 (73.6% patients turned back to normal. Blood pressure of another 37(25.7% patients decreased with different degrees, although still higher than normal. Moreover, it appears that both approaches were effective in improving blood pressure, while the posterior approach was more effective in decreasing systolic blood pressure. We speculate this type of hypertension might result from hyperactivity of sympathetic nervous system as the heart rate of these patients decreased after surgery as well. Collectively, compression of spinal cord in CSM patients might be associated with hypertension, and decompression surgery largely attenuated this type of hypertension. These findings prove CSM to be a potential associated factor of high blood pressure and may shed light on therapies of hypertension in clinics.

  1. Balance of Autonomic Nervous System Predicts Who Benefits from a Self-management Intervention Program for Irritable Bowel Syndrome.

    Science.gov (United States)

    Jarrett, Monica E; Cain, Kevin C; Barney, Pamela G; Burr, Robert L; Naliboff, Bruce D; Shulman, Robert; Zia, Jasmine; Heitkemper, Margaret M

    2016-01-31

    To determine if potential biomarkers can be used to identify subgroups of people with irritable bowel syndrome (IBS) who will benefit the most or the least from a comprehensive self-management (CSM) intervention. In a two-armed randomized controlled trial a CSM (n = 46) was compared to a usual care (n = 46) group with follow-up at 3 and 6 months post randomization. Biomarkers obtained at baseline included heart rate variability, salivary cortisol, interleukin-10 produced by unstimulated peripheral blood mononuclear cells, and lactulose/mannitol ratio. Linear mixed models were used to test whether these biomarkers predicted improvements in the primary outcomes including daily abdominal pain, Gastrointestinal Symptom score and IBS-specific quality of life. The nurse-delivered 8-session CSM intervention is more effective than usual care in reducing abdominal pain, reducing Gastrointestinal Symptom score, and enhancing quality of life. Participants with lower nighttime high frequency heart rate variability (vagal modulation) and increased low frequency/high frequency ratio (sympathovagal balance) had less benefit from CSM on abdominal pain. Salivary cortisol, IL-10, and lactulose/mannitol ratio were not statistically significant in predicting CSM benefit. Baseline symptom severity interacts with treatment, namely the benefit of CSM is greater in those with higher baseline symptoms. Cognitively-focused therapies may be less effective in reducing abdominal pain in IBS patients with higher sympathetic tone. Whether this a centrally-mediated patient characteristic or related to heightened arousal remains to be determined.

  2. Effect of fillers on parameters of dry and swollen polymer matrix networks

    Directory of Open Access Journals (Sweden)

    Stojčeva-Radovanović Blaga

    2002-01-01

    Full Text Available The effect of nano- and micro- particle size of SiO2 on dry and swollen parameter network of the polymer matrix blends of acrylontrile-butadiene (NBR and chlorosulphonated polyethylene (CSM such as: volume and mass degree of swelling Rv and Rw; volume fraction of NBR-CSM polymer matrix in swollen gel V2 elasticity modulus G; interaction parameter between NBR-CSM polymer matrix and solvent λ and crossiinking density ν, was tested. The influence of nano-and micro- particle size of SiO2 on physical and mechanical properties, as well as effectiveness volume ratio of filiers in NBR-CSM polymer matrix at 300% elongation was tested using Einstein-Quth-Gold equation. The Kraus equation for swelling test of NBR-CSM polymer matrix containing nano- and micro- particle size of SiO2. Test results have shown that a greater interaction of nano-particie size of SiO2 with NBR-CSM polymer matrix, and possible chemical bonding, than the one of micro-silica was a consequence of a greater contact area. This results in better physical and mechanical properties.

  3. The Origin and Evolution of the Infrared Light Curve of SN2010jl

    Science.gov (United States)

    Dwek, Eli; Sarangi, Arkaprabha; Arendt, Richard; Fox, Ori; Kallman, Timothy; Kazanas, Demosthenes

    2018-01-01

    SN2010jl is a luminous core-collapse supernova (CCSN) of Type IIn that is surrounded by a dense circumstellar medium (CSM). The supernova (SN) luminosity vastly exceeds the available power from radiactive elements in the ejecta, and is powered by the interaction of the SN shock wave with the ambient medium. Upper limits on the UV and near-IR (NIR) emission from pre-explosion images of the region suggest that any progenitor star was hidden by pre-existing CSM dust. After day ~80, the SN spectrum shows the development of an IR excess above the extrapolated UVO emission arising from the shocked CSM. This IR component is attributed to thermal emission from dust.After day ~300, the light curve exhibits a rise in the NIR luminosity, concurrent with a steep decline at UVO wavelengths. Ruling out any possible contribution of SN-condensed dust to the IR light curve, we show that the early IR emission arises from the pre-existing CSM dust that survived the flash of radiation from the shock breakout. The late IR emission arises from newly-formed CSM dust that condensed in the cooling dust-free postshock gas of the advancing SN shock wave. Our analysis presents the first detailed modeling of dust formation in a cooling postshock environment, and provides important insights into the interaction of the SN shock wave with the CSM.

  4. Petites considérations polémiques et néanmoins objectives sur la recherche (en littérature) et sa diffusion (électronique)

    OpenAIRE

    Dozo, Björn-Olav; Provenzano, François

    2012-01-01

    Le présent article fait écho à certains débats qui traversent les milieux de la recherche en sciences humaines et sociales. Les acteurs de la diffusion de la recherche se réunissent (compte rendu de la rencontre qui s’est tenue au 16e salon de la revue, ayant pour thème : « revues de sciences humaines au temps d'Internet : quelles promesses ? Quelles menaces ? »), une liste de diffusion/ discussion concernant les revues en Sciences Humaines et Sociales a été créée, différents acteurs (http://...

  5. Predicting prostate cancer-specific outcome after radical prostatectomy among men with very high-risk cT3b/4 PCa: a multi-institutional outcome study of 266 patients.

    Science.gov (United States)

    Moltzahn, F; Karnes, J; Gontero, P; Kneitz, B; Tombal, B; Bader, P; Briganti, A; Montorsi, F; Van Poppel, H; Joniau, S; Spahn, M

    2015-03-01

    The value of radical prostatectomy (RP) as an approach for very high-risk prostate cancer (PCa) patients is controversial. To examine the risk of 10-year cancer-specific mortality (CSM) and other-cause mortality (OCM) according to clinical and pathological characteristics of very high-risk cT3b/4 PCa patients treated with RP as the primary treatment option. In a multi-institutional cohort, 266 patients with very high-risk cT3b/4 PCa treated with RP were identified. All patients underwent RP and pelvic lymph-node dissection. Competing-risk analyses assessed 10-year CSM and OCM before and after stratification for age and Charlson comorbidity index (CCI). Overall, 34 (13%) patients died from PCa and 73 (28%) from OCM. Ten-year CSM and OCM rates ranged from 5.6% to 12.9% and from 10% to 38%, respectively. OCM was the leading cause of death in all subgroups. Age and comorbidities were the main determinants of OCM. In healthy men, CSM rate did not differ among age groups (10-year CSM rate for ⩽64, 65-69 and ⩾70 years: 16.2%, 11.5% and 17.1%, respectively). Men with a CCI ⩾1 showed a very low risk of CSM irrespective of age (10-year CSM: 5.6-6.1%), whereas the 10-year OCM rates increased with age up to 38% in men ⩾70 years. Very high-risk cT3b/4 PCa represents a heterogeneous group. We revealed overall low CSM rates despite the highly unfavorable clinical disease. For healthy men, CSM was independent of age, supporting RP even for older men. Conversely, less healthy patients had the highest risk of dying from OCM while sharing very low risk of CSM, indicating that this group might not benefit from an aggressive surgical treatment. Outcome after RP as the primary treatment option in cT3b/4 PCa patients is related to age and comorbidity status.

  6. Bundled payment reimbursement for anterior and posterior approaches for cervical spondylotic myelopathy: an analysis of private payer and Medicare databases.

    Science.gov (United States)

    Virk, Sohrab S; Phillips, Frank M; Khan, Safdar N

    2018-03-01

    OBJECTIVE Cervical spondylotic myelopathy (CSM) is a progressive spinal condition that often requires surgery. Studies have shown the clinical equivalency of anterior versus posterior approaches for CSM surgery. The purpose of this study was to determine the amount and type of resources used for anterior and posterior surgical treatment of CSM by using large national databases of clinical and financial information from patients. METHODS This study consists of 2 large cohorts of patients who underwent either an anterior or posterior approach for treatment of CSM. These patients were selected from the Medicare 5% National Sample Administrative Database (SAF5) and the Humana orthopedic database (HORTHO), which is a database of patients with private payer health insurance. The outcome measures were the cost of a 90-day episode of care, as well as a breakdown of the cost components for each surgical procedure between 2005 and 2014. RESULTS A total of 16,444 patients were included in this analysis. In HORTHO, there were 10,332 and 1556 patients treated with an anterior or posterior approach for CSM, respectively. In SAF5, there were 3851 and 705 patients who were treated by an anterior or posterior approach for CSM, respectively. The mean ± SD reimbursements for anterior and posterior approaches in the HORTHO database were $20,863 ± $2014 and $23,813 ± $4258, respectively (p = 0.048). The mean ± SD reimbursements for anterior and posterior approaches in the SAF5 database were $18,219 ± $1053 and $25,598 ± $1686, respectively (p reimbursements for a rehabilitation/skilled nursing facility and hospital/inpatient care for patients who underwent a posterior approach in both the private payer and Medicare databases. In all cohorts in this study, the hospital-related reimbursement was more than double the surgeon-related reimbursement. CONCLUSIONS This study provides resource utilization information for a 90-day episode of care for both anterior and posterior approaches

  7. Melatonin Production, Sleep Patterns and Modeled Performance Effectiveness in Subjects in the High Arctic

    Science.gov (United States)

    2014-05-01

    de la photopériode liées aux saisons dans le Haut Arctique exercent une pression particulièrement forte sur le rythme circadien humain, ce qui peut...travaux décrits était d’étudier le rythme circadien du personnel envoyé dans le Haut Arctique en mesurant régulièrement la mélatonine fabriquée par...extrêmes de la photopériode liées aux saisons dans le Haut Arctique exercent une pression particulièrement forte sur le rythme circadien humain, ce

  8. Au-delà du vecteur | CRDI - Centre de recherches pour le ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    30 mai 2011 ... L'équipe du programme Écosystèmes et santé humaine (ÉCOSANTÉ) du CRDI travaille avec des chercheurs de pays en développement en vue de trouver des solutions aux problèmes de santé humaine reliés à l'état des écosystèmes. Regarder la vidéo sur YouTube (sélectionner le sous-titrage en ...

  9. Intelligence Naturelle et Intelligence Artificielle

    OpenAIRE

    Dubois, Daniel

    2011-01-01

    Cet article présente une approche systémique du concept d’intelligence naturelle en ayant pour objectif de créer une intelligence artificielle. Ainsi, l’intelligence naturelle, humaine et animale non-humaine, est une fonction composée de facultés permettant de connaître et de comprendre. De plus, l'intelligence naturelle reste indissociable de la structure, à savoir les organes du cerveau et du corps. La tentation est grande de doter les systèmes informatiques d’une intelligence artificielle ...

  10. Tactile Displays for Orientation, Navigation and Communication in Air, Sea and Land Environments (Les systemes d’affichage tactiles pour l’orientation, la navigation et la communication dans les environments aerien, maritime et terrestre)

    Science.gov (United States)

    2008-08-01

    localiser le stimulus, et la perception de la direction externe du stimulus basée sur la localisation de ce stimulus. Les facteurs humains concernant ces...problèmes de perception sont exposés dans le Chapitre 3. Les autres facteurs humains , notamment les principes de codage, les questions cognitives et...with a TSAS system was performed. With an initial investment of capital (R&D funds) of $20M, the 5 year internal rate of return was estimated at 4

  11. Une approche écosanté pour le contrôle de la fièvre de la vallée du ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    17 août 2016 ... La fièvre de la vallée du Rift est une maladie grave qui se transmet par la piqûre d'un moustique qui infecte l'être humain, le bétail et les animaux sauvages. De plus, les êtres humains peuvent contracter la maladie par tout contact avec des animaux infectés. La maladie s'est répandue dans toute l'Afrique ...

  12. Evaluation of energy digestibility and prediction of digestible and metabolizable energy from chemical composition of different cottonseed meal sources fed to growing pigs.

    Science.gov (United States)

    Li, J T; Li, D F; Zang, J J; Yang, W J; Zhang, W J; Zhang, L Y

    2012-10-01

    The present experiment was conducted to determine the digestible energy (DE), metabolizable energy (ME) content, and the apparent total tract digestibility (ATTD) of energy in growing pigs fed diets containing one of ten cottonseed meals (CSM) collected from different provinces of China and to develop in vitro prediction equations for DE and ME content from chemical composition of the CSM samples. Twelve growing barrows with an initial body weight of 35.2±1.7 kg were allotted to two 6×6 Latin square designs, with six barrows and six periods and six diets for each. A corn-dehulled soybean meal diet was used as the basal diet, and the other ten diets were formulated with corn, dehulled soybean meal and 19.20% CSM. The DE, ME and ATTD of gross energy among different CSM sources varied largely and ranged from 1,856 to 2,730 kcal/kg dry matter (DM), 1,778 to 2,534 kcal/kg DM, and 42.08 to 60.47%, respectively. Several chemical parameters were identified to predict the DE and ME values of CSM, and the accuracy of prediction models were also tested. The best fit equations were: DE, kcal/kg DM = 670.14+31.12 CP+659.15 EE with R(2) = 0.82, RSD = 172.02, penergy varied substantially among different CSM sources, and that some prediction equations can be applied to predict DE and ME in CSM with an acceptable accuracy.

  13. Effect of feeding cottonseed meal on some hematological and serum biochemical parameters in broiler birds

    Directory of Open Access Journals (Sweden)

    G. Thirumalaisamy

    2016-07-01

    Full Text Available Aim: The study was undertaken to find out the effect of feeding cottonseed meal (CSM on performance of hematological and serum biochemical parameters in broiler birds. Materials and Methods: A 6-week biological trial was carried out with 432-day-old Cobb 400 broiler chicks distributed to nine experimental diets with six replicates, each containing eight chicks. The experimental diets were formulated based on total amino acids (BTAA or based on digestible amino acids (BDAA with or without iron supplementation with two levels of CSM (2% and 4% and control diet based on maize – soybean. The whole blood was subjected to hematological studies. The serum samples were analyzed for protein fractions and lipid profiles. Results: The packed cell volume (PCV value, red blood cell (RBC numbers, and hemoglobin (Hb were lower in iron unsupplemented CSM BTAA or BDAA diets than the control (33.86-35.54 vs. 36.41%, 2.78-2.87 vs. 2.98 × 106/μl, and 10.30-10.70 vs. 10.88%. Supplementation of iron in CSM diets improved the PCV, RBC numbers, and Hb, and the values were comparable to the control. White blood cell numbers, mean corpuscular volume, mean corpuscular Hb (MCH, and MCH concentration values were comparable to the control. The erythrocyte osmotic fragility (EOF was poor in birds fed diets containing up to 4% CSM BTAA or CSM BDAA without iron supplementation (32.02-32.57 vs. 28.77%. Supplementation of iron improved the EOF. The serum cholesterol level did not change with or without iron supplementation. Conclusion: This study suggested that feeding of CSM BTAA or BDAA up to 4% level voiding iron supplementation lowers the hematological parameters, whereas supplementation of iron did not alter serum protein fractions and cholesterol profile; however, it had lowered some hematological parameters, which was rectified by iron supplementation.

  14. Ancillary outcome measures for assessment of individuals with cervical spondylotic myelopathy.

    Science.gov (United States)

    Kalsi-Ryan, Sukhvinder; Singh, Anoushka; Massicotte, Eric M; Arnold, Paul M; Brodke, Darrel S; Norvell, Daniel C; Hermsmeyer, Jeffrey T; Fehlings, Michael G

    2013-10-15

    Narrative review. To identify suitable outcome measures that can be used to quantify neurological and functional impairment in the management of cervical spondylotic myelopathy (CSM). CSM is the leading cause of acquired spinal cord disability, causing varying degrees of neurological impairment which impact on independence and quality of life. Because this impairment can have a heterogeneous presentation, a single outcome measure cannot define the broad range of deficits seen in this population. Therefore, it is necessary to define outcome measures that characterize the deficits with greater validity and sensitivity. This review was conducted in 3 stages. Stage I: To evaluate the current use of outcome measures in CSM, PubMed was searched using the name of the outcome measure and the common abbreviation combined with "CSM" or "myelopathy." Stage II: Having identified a lack of appropriate outcome measures, we constructed criteria by which measures appropriate for assessing the various aspects of CSM could be identified. Stage III: A second literature search was then conducted looking at specified outcomes that met these criteria. All literature was reviewed to determine specificity and psychometric properties of outcomes for CSM. Nurick grade, modified Japanese Orthopaedic Association Scale, visual analogue scale (VAS) for pain, Short Form (36) Health Survey (SF-36), and Neck Disability Index were the most commonly cited measures. The Short-Form 36 Health Survey and Myelopathy Disability Index have been validated in the CSM population with multiple studies, whereas the modified Japanese Orthopaedic Association Scale score, Nurick grade, and European Myelopathy Scale each had only one study assessing psychometric characteristics. No validity, reliability, or responsiveness studies were found for the VAS or Neck Disability Index in the CSM population. We recommend that the modified Japanese Orthopaedic Association Scale, Nurick grade, Myelopathy Disability Index

  15. Understanding surgery choices for breast cancer: how might the Theory of Planned Behaviour and the Common Sense Model contribute to decision support interventions?

    Science.gov (United States)

    Sivell, Stephanie; Edwards, Adrian; Elwyn, Glyn; Manstead, Antony S. R.

    2010-01-01

    Abstract Objective  To describe the evidence about factors influencing breast cancer patients’ surgery choices and the implications for designing decision support in reference to an extended Theory of Planned Behaviour (TPB) and the Common Sense Model of Illness Representations (CSM). Background  A wide range of factors are known to influence the surgery choices of women diagnosed with early breast cancer facing the choice of mastectomy or breast conservation surgery with radiotherapy. However, research does not always reflect the complexities of decision making and is often atheoretical. A theoretical approach, as provided by the CSM and the TPB, could help to identify and tailor support by focusing on patients’ representations of their breast cancer and predicting surgery choices. Design  Literature search and narrative synthesis of data. Synthesis  Twenty‐six studies reported women’s surgery choices to be influenced by perceived clinical outcomes of surgery, appearance and body image, treatment concerns, involvement in decision making and preferences of clinicians. These factors can be mapped onto the key constructs of both the TPB and CSM and used to inform the design and development of decision support interventions to ensure accurate information is provided in areas most important to patients. Conclusions  The TPB and CSM have the potential to inform the design of decision support for breast cancer patients, with accurate and clear information that avoids leading patients to make decisions they may come to regret. Further research is needed examining how the components of the extended TPB and CSM account for patients’ surgery choices. PMID:20579123

  16. Effects of dietary gossypol concentration on growth performance, blood profiles, and hepatic histopathology in meat ducks.

    Science.gov (United States)

    Zeng, Q F; Yang, G L; Liu, G N; Wang, J P; Bai, S P; Ding, X M; Luo, Y H; Zhang, K Y

    2014-08-01

    The objective of this study was to determine the effects of gossypol from cottonseed meal (CSM) on growth performance, blood biochemical profiles, and liver histopathology of ducks. A total of 900 1-d-old ducks were randomly allocated to 5 treatments with 12 pens/treatment and 15 ducks/pen. The 5 experimental diets were formulated in such a way that 0% (a corn-soybean meal basal diet, diet 1), 25% (diet 2), 50% (diet 3), 75% (diet 4), and 100% (diet 5) of protein from soybean meal were replaced with that from CSM. All diets were formulated on a digestible amino acid basis. The experiment included 2 phases, the starter phase (1 to 3 wk) where the test diets contained graded levels of CSM and the growth phase (4 to 5 wk) where birds were fed a corn-soybean basal diet to examine the recovery of ducks after CSM withdrawal. Dietary CSM and gossypol linearly (P ducks among all treatments. These results suggest that meat ducks' dietary TG and FG concentration should be lower than 928.9 and 77.2 mg/kg, respectively, during d 1 to 21 of age and that a 2-wk withdrawal of diets containing gossypol should be considered. © Poultry Science Association Inc.

  17. Pair production of heavy quarkonium and Bc(*) mesons at hadron colliders

    International Nuclear Information System (INIS)

    Li Rong; Zhang Yujie; Chao Kuangta

    2009-01-01

    We investigate the pair production of S-wave heavy quarkonium at the LHC in the color-singlet mechanism (CSM) and estimate the contribution from the gluon fragmentation process in the color-octet mechanism (COM) for comparison. With the matrix elements extracted previously in the leading-order calculations, the numerical results show that the production rates are quite large for the pair production processes at the LHC. The p t distribution of double J/ψ production in the CSM is dominant over that in the COM when p t is smaller than about 10 GeV. For the production of double Υ, the contribution of the COM is always larger than that in the CSM. The large differences in the theoretical predictions between the CSM and COM for the p t distributions in the large p t region are useful in clarifying the effects of COM on the quarkonium production. We also investigate the pair production of S-wave B c and B c * mesons, and the measurement of these processes is useful to test the CSM and extract the long-distance matrix elements for the B c and B c * mesons. Aside from numerical calculations, analytical expressions for the production differential cross sections of all these processes are also given.

  18. The Monopolin Complex Crosslinks Kinetochore Components to Regulate Chromosome-Microtubule Attachments

    Energy Technology Data Exchange (ETDEWEB)

    Corbett, Kevin D.; Yip, Calvin K.; Ee, Ly-Sha; Walz, Thomas; Amon, Angelika; Harrison, Stephen C. (Harvard-Med); (MIT)

    2010-09-27

    The monopolin complex regulates different types of kinetochore-microtubule attachments in fungi, ensuring sister chromatid co-orientation in Saccharomyces cerevisiae meiosis I and inhibiting merotelic attachment in Schizosaccharomyces pombe mitosis. In addition, the monopolin complex maintains the integrity and silencing of ribosomal DNA (rDNA) repeats in the nucleolus. We show here that the S. cerevisiae Csm1/Lrs4 monopolin subcomplex has a distinctive V-shaped structure, with two pairs of protein-protein interaction domains positioned {approx}10 nm apart. Csm1 presents a conserved hydrophobic surface patch that binds two kinetochore proteins: Dsn1, a subunit of the outer-kinetochore MIND/Mis12 complex, and Mif2/CENP-C. Csm1 point-mutations that disrupt kinetochore-subunit binding also disrupt sister chromatid co-orientation in S. cerevisiae meiosis I. We further show that the same Csm1 point-mutations affect rDNA silencing, probably by disrupting binding to the rDNA-associated protein Tof2. We propose that Csm1/Lrs4 functions as a molecular clamp, crosslinking kinetochore components to enforce sister chromatid co-orientation in S. cerevisiae meiosis I and to suppress merotelic attachment in S. pombe mitosis, and crosslinking rDNA repeats to aid rDNA silencing.

  19. Microwave synthesis and adsorption performance of a novel crosslinked starch microsphere

    Energy Technology Data Exchange (ETDEWEB)

    Lin, Qintie, E-mail: qintlin@163.com [School of Environmental Science and Engineering, Guangdong University of Technology, Guangzhou 510006 (China); National Engineering Laboratory for Rice and By-Product Deep Processing, Center South University of Forestry and Technology, Changsha 41004 (China); Pan, Jianxin [School of Environmental Science and Engineering, Guangdong University of Technology, Guangzhou 510006 (China); Lin, Qinlu [National Engineering Laboratory for Rice and By-Product Deep Processing, Center South University of Forestry and Technology, Changsha 41004 (China); Liu, Qianjun [School of Environmental Science and Engineering, Guangdong University of Technology, Guangzhou 510006 (China)

    2013-12-15

    Highlights: • CSM was synthesized in a microwave-assisted inversed emulsion system. • The adsorption of methyl violet on CSM was exothermic and spontaneous. • The adsorption process followed the pseudo-second-order kinetics. • The isothermal data obeyed the Langmuir model. • pH variations did not significantly affect the adsorption of methyl violet onto CSM. -- Abstract: A new crosslinked starch microsphere (CSM) was synthesized in a microwave-assisted inversed emulsion system with soluble starch (ST) as a raw material, MBAA as a crosslinker, and K{sub 2}S{sub 2}O{sub 8}–NaHSO{sub 3} as an initiator. The synthesized starch microsphere was characterized and examined by scanning electron microscope (SEM), FTIR spectroscopy and adsorption isotherms of N{sub 2} at 77 K. Adsorption performance was investigated in methyl violet solution. The results showed that the maximum adsorption capacity for MV was 99.3 mg/g at 298 K, and the adsorption fitted pseudo-second-order kinetic model well with correlation coefficients greater than 0.99. The isothermal data obeyed the Langmuir model better compared to Freundlich model and Tempkin model, and the adsorption was exothermic and spontaneous. pH variations (2.0–10.0) did not significantly affect the adsorption of MV onto CSM.

  20. Chemical surety material decontamination and decommissioning of Los Alamos National Laboratory Chemical Surety Material Laboratory area TA-3, building SM-29, room 4009

    International Nuclear Information System (INIS)

    Moore, T.E.; Smith, J.M.

    1994-04-01

    From 1982 through 1987, Los Alamos National Laboratory (LANL) performed surety laboratory operations for the U.S. Army Medical Research and Development Command (MRDC). Room 4009 in building SM-29, TA-3, was used as the laboratory for work with the following chemical surety material (CSM) agents: sarin (GB), soman (GD), lewisite (L), and distilled mustard (HD) radio-labelled with H 3 or C 14 . The work was confined to three CSM-certified fume hoods, located in room 4009 (see diagram in Appendix C). The laboratory ceased all active operations during the late 1986 and early 1987 period. From 1987 until 1993 the laboratory was secured and the ventilation system continued to operate. During late 1992, the decision was made to utilize this laboratory space for other operations, thus a decision was made to dismantle and reconfigure this room. LANL sub-contracted Battelle Memorial Institute (BMI) to draw upon the CSM experience of the technical staff from the Hazardous Materials Research Facility (HMRF) to assist in developing a decontamination and decommissioning plan. BMI was subcontracted to devise a CSM safety training course, and a sampling and air monitoring plan for CSM material to ensure personnel safety during all disassembly operations. LANL subcontracted Johnson Controls personnel to perform all disassembly operations. Beginning in early 1993 BMI personnel from the HMRF visited the laboratory to develop both the safety plan and the sample and air monitoring plan. Execution of that plan began in September 1993 and was completed in January 1994

  1. Spatio-temporal evaluation of plant height in corn via unmanned aerial systems

    Science.gov (United States)

    Varela, Sebastian; Assefa, Yared; Vara Prasad, P. V.; Peralta, Nahuel R.; Griffin, Terry W.; Sharda, Ajay; Ferguson, Allison; Ciampitti, Ignacio A.

    2017-07-01

    Detailed spatial and temporal data on plant growth are critical to guide crop management. Conventional methods to determine field plant traits are intensive, time-consuming, expensive, and limited to small areas. The objective of this study was to examine the integration of data collected via unmanned aerial systems (UAS) at critical corn (Zea mays L.) developmental stages for plant height and its relation to plant biomass. The main steps followed in this research were (1) workflow development for an ultrahigh resolution crop surface model (CSM) with the goal of determining plant height (CSM-estimated plant height) using data gathered from the UAS missions; (2) validation of CSM-estimated plant height with ground-truthing plant height (measured plant height); and (3) final estimation of plant biomass via integration of CSM-estimated plant height with ground-truthing stem diameter data. Results indicated a correlation between CSM-estimated plant height and ground-truthing plant height data at two weeks prior to flowering and at flowering stage, but high predictability at the later growth stage. Log-log analysis on the temporal data confirmed that these relationships are stable, presenting equal slopes for both crop stages evaluated. Concluding, data collected from low-altitude and with a low-cost sensor could be useful in estimating plant height.

  2. Analysis of insecticide resistance-related genes of the Carmine spider mite Tetranychus cinnabarinus based on a de novo assembled transcriptome.

    Science.gov (United States)

    Xu, Zhifeng; Zhu, Wenyi; Liu, Yanchao; Liu, Xing; Chen, Qiushuang; Peng, Miao; Wang, Xiangzun; Shen, Guangmao; He, Lin

    2014-01-01

    The carmine spider mite (CSM), Tetranychus cinnabarinus, is an important pest mite in agriculture, because it can develop insecticide resistance easily. To gain valuable gene information and molecular basis for the future insecticide resistance study of CSM, the first transcriptome analysis of CSM was conducted. A total of 45,016 contigs and 25,519 unigenes were generated from the de novo transcriptome assembly, and 15,167 unigenes were annotated via BLAST querying against current databases, including nr, SwissProt, the Clusters of Orthologous Groups (COGs), Kyoto Encyclopedia of Genes and Genomes (KEGG) and Gene Ontology (GO). Aligning the transcript to Tetranychus urticae genome, the 19255 (75.45%) of the transcripts had significant (e-value insecticide resistance in arthropod were generated from CSM transcriptome, including 53 P450-, 22 GSTs-, 23 CarEs-, 1 AChE-, 7 GluCls-, 9 nAChRs-, 8 GABA receptor-, 1 sodium channel-, 6 ATPase- and 12 Cyt b genes. We developed significant molecular resources for T. cinnabarinus putatively involved in insecticide resistance. The transcriptome assembly analysis will significantly facilitate our study on the mechanism of adapting environmental stress (including insecticide) in CSM at the molecular level, and will be very important for developing new control strategies against this pest mite.

  3. Studies of chemical interactions between chlorosulphonated polyethylene and nit rile rubber

    Directory of Open Access Journals (Sweden)

    Marković Gordana

    2005-01-01

    Full Text Available Highly polar rubbers interact with each other through their active functional groups via condensation or substitution reactions at high temperature. Chlorosulphonated polyethylene (CSM rubber is a highly reactive rubber, the reactivity of with is due to the -SO2CI groups. When CSM reacts with nit rile rubber (NBR, a chemical reaction takes place between the two rubbers at high temperature. Fourier transform infrared (FTIR studies support that CSM/NBR (50/50 w/w isothermally induces a self cross-linking blend, when cross-linking takes place via the acrylonitrile groups of NBR and the SO2CI groups or the insitu generated allyl chloride moieties of CSM. There is a loss of some -CN groups during cross-linking. This may be due to an attack on the -CN groups by HCI (produced during the heating of CSM in the presence of inherent moisture in the polymers. Amid type of linkage is formed due to cross-linking.

  4. Conceptual Site Model for Newark Bay—Hydrodynamics and Sediment Transport

    Directory of Open Access Journals (Sweden)

    Parmeshwar L. Shrestha

    2014-02-01

    Full Text Available A conceptual site model (CSM has been developed for the Newark Bay Study Area (NBSA as part of the Remedial Investigation/Feasibility Study (RI/FS for this New Jersey site. The CSM is an evolving document that describes the influence of physical, chemical and biological processes on contaminant fate and transport. The CSM is initiated at the start of a project, updated during site activities, and used to inform sampling and remediation planning. This paper describes the hydrodynamic and sediment transport components of the CSM for the NBSA. Hydrodynamic processes are influenced by freshwater inflows, astronomical forcing through two tidal straits, meteorological conditions, and anthropogenic activities such as navigational dredging. Sediment dynamics are driven by hydrodynamics, waves, sediment loading from freshwater sources and the tidal straits, sediment size gradation, sediment bed properties, and particle-to-particle interactions. Cohesive sediment transport is governed by advection, dispersion, aggregation, settling, consolidation, and erosion. Noncohesive sediment transport is governed by advection, dispersion, settling, armoring, and transport in suspension and along the bed. The CSM will inform the development and application of a numerical model that accounts for all key variables to adequately describe the NBSA’s historical, current, and future physical conditions.

  5. Milk-clotting activity of berries extracts from nine Solanum plants

    African Journals Online (AJOL)

    USER

    2010-06-21

    Jun 21, 2010 ... milk than reconstituted skim milk powder (Martin et al., 2008). Preparation of coagulation ... This raw skim milk was stored at 4°C with sodium azide. (0.2 g/l) added as ..... Lait, Produit laitier et Nutrition humaine. Rome. p. 176.

  6. Women and the Justice System in Cambodia | CRDI - Centre de ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Le CRDI lance un nouveau projet dans la région de l'ANASE ... de détestable, à savoir l'abondance de capital humain féminin qualifié. ... une compréhension des interactions entre différentes structures de pouvoir (sexe, classe, ethnie et âge).

  7. le recours a l'avortement a antananarivo (madagascar)

    African Journals Online (AJOL)

    LPE

    ... Marseille, cedex 03; 2Université d'Antananarivo – Faculté des lettres et sciences humaines Madagascar. .... toutes les conséquences psychologiques, sociales, ..... souvent décrites dans la littérature comme un ..... Une revue de la littérature.

  8. Lutte contre les zoonoses helminthiques et élimination de ces ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Les infections par des parasites du genre Schistosoma et la douve du foie peuvent entraîner des maladies graves, notamment l'anémie, un retard de croissance, la malnutrition, ainsi que le cancer du foie. Les parasites qui causent ces maladies ont des cycles de vie complexes. Ils se transmettent entre humains, animaux ...

  9. Livres | Page 29 | CRDI - Centre de recherches pour le ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Couverture du livre Culture, Environment, and Food to Prevent Vitamin A Deficiency. Culture, Environment, and Food to Prevent Vitamin A Deficiency. Dans cet ouvrage qui s'adresse aux planificateurs du développement et aux étudiants en nutrition, santé publique et anthropologie culturelle humaine, on aborde des enjeux ...

  10. African Journal of Neurological Sciences - 2009 Vol. 28 No 1

    African Journals Online (AJOL)

    HISTOIRE DU FOYER DE LA TRYPANOSOMOSE HUMAINE AFRICAINE DE NOLA EN REPUBLIQUE. CENTRAFRICAINE, DE 1971 à 2004. HISTORY OF HUMAN AFRICAN TRYPANOSOMIASIS OF NOLA IN CENTRAL AFRICAN REPUBLIC,. FROM 1971 TO 2004. MBELESSO Pascal 1. KOONA-KOONA Joseph Adonis ...

  11. Past Failures for Future Learning

    DEFF Research Database (Denmark)

    Wadum, Jørgen

    2004-01-01

    efficace dans un domaine spécialisé se constitue en amont par l’implication de structures dotées d’une expertise et de savoir-faire. L’ICOM-CC regroupe des professionnels de la conservation et dispose de moyens humains et techniques pour participer efficacement et activement aux projets liés à des...

  12. Ce que nous faisons | Page 23 | CRDI - Centre de recherches pour ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Sujet(s): EAST AFRICA, CENTRAL AFRICA, ENVIRONMENTAL DEGRADATION, SOCIAL CHANGE, Climate change, HEALTH HAZARDS. Région(s): Africa, South of Sahara. Programme(s): Alimentation, environnement et santé. Ce projet contribuera à l'établissement d'une chaire en écosanté sur la santé des humains et ...

  13. Health Benefits ana Risks of Genetically Modified Foods

    African Journals Online (AJOL)

    impact on human health. The efforts to produce ... vitesse plus rapide que la compréhension de leur potentiel impact sur la santé humaine. Les efforts .... tive function, bone growth and is responsible for protecting mucous membrane cells. Vitamin A de- .... gens: eggs, milk, fish, peanuts, shellfish, soy, tree nuts and Wheat.

  14. Asie du sud | Page 85 | CRDI - Centre de recherches pour le ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Read more about Les liens entre les changements dans l'utilisation des terres et la santé humaine dans l'est de l'Himalaya. Langue French. Read more about Tabagisme, tabagisme passif, maladies chroniques et pauvreté en Chine. Langue French. Read more about Active and Passive Smoking, Chronic Disease and ...

  15. ÉTUDE DE CAS — Quito, Équateur : Les fermes de Quito, sources d ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    agriculture urbaine d'abord mis de l'avant par la municipalité de Quito pour ... mais en mai 2002, AGRUPAR était créée au sein de la Dirección de Desarrollo Humano Sustentable (Division du développement humain durable).

  16. Lutter contre le paludisme sans DDT

    International Development Research Centre (IDRC) Digital Library (Canada)

    Nancy Minogue

    La participation de la collectivité aux stratégies de contrôle, une surveillance ... Le contrôle de la maladie passe par une meilleure gestion de l'environnement. En vertu de ... de la santé humaine, ou écosanté, est un processus dynamique qui.

  17. 131 IDENTITES ET APPRENTISSAGE DES LANGUES ...

    African Journals Online (AJOL)

    22 juin 2017 ... 1Département de Langues Africaines et Linguistique, Faculté des Arts, Lettres et Sciences Humaines,. Université de .... En revanche, une catégorie de répondants estime que la langue ... de s'exposer soi-même. Ils précisent ...

  18. Renforcement des capacités de recherche sur les TIC-D au Moyen ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    La recherche sur les incidences et les impacts des technologies de l'information et de la communication (TIC) sur le développement social et humain est embryonnaire au Moyen-Orient et en Afrique du Nord (région MOAN). Ce projet vise à encourager les chercheurs de la région MOAN à entreprendre des recherches ...

  19. Le Don De Corps En Cote D\\'ivoire | Broalet | African Journal of ...

    African Journals Online (AJOL)

    Introduction Le don de corps qui permet de se procurer le matériel anatomique de dissection que constitue le cadavre humain n\\'existe pas en Afrique noire et notamment en Cote d\\' Ivoire. Objectif Recueillir des informations sur le don de corps à Abidjan. Méthode Les auteurs rapportent les informations recueillies au cours ...

  20. Ensemble pour apprendre à s'attaquer à de grandes questions de ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    25 janv. 2011 ... À LIRE ÉGALEMENT. Les répercussions de la santé animale sur la santé humaine · Porter le domaine de la microbiologie plus loin · Initiative de recherche en santé mondiale ...

  1. 2736-IJBCS-Article-Ernest Amoussou

    African Journals Online (AJOL)

    hp

    ² Laboratoire Pierre PAGNEY, Climat, Eau, Ecosystème et Développement ... 3 Institut National de Recherches Agronomiques du Bénin (INRAB), Direction ... Les processus naturels et humains ont des conséquences sur les capacités ..... Ces communes sont situées à la limite du .... l'ensemble des initiatives prises par les.

  2. Le Maroc entre la transition démocratique et une nouvelle ...

    African Journals Online (AJOL)

    sulaiman.adebowale

    9 avr. 2008 ... instance de l'État marocain, l'INDH (Initiative Nationale du Dévelop- .... une pensée du commencement et des limites (Nassar 1997: 57-80). Ces ... l'Initiative. Nationale pour le Développement Humain – INDH – été 2005) tel.

  3. Migrants volontaires et migrants citoyens : les recompositions des ...

    African Journals Online (AJOL)

    initiative d'anciens migrants établis dans le champ associatif local. .... à contrôler ces projets, pour lesquels la question des moyens humains demeure ..... un ferment de l'idée nationale ; ils participent aussi au jeu politique factionnel.

  4. Ce que nous faisons | Page 41 | CRDI - Centre de recherches pour ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    aflatoxine du maïs et le degré d'exposition pour les humains au Zimbabwe. Ce projet examine des solutions d'après-récolte novatrices pour éviter la contamination du grain par l'aflatoxine. Zimbabwe. PROJECT ...

  5. Beyond Propietorship: Murphree's Laws on Community-based ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    aflatoxine du maïs et le degré d'exposition pour les humains au Zimbabwe. Ce projet examine des solutions d'après-récolte novatrices pour éviter la contamination du grain par l'aflatoxine. Voir davantageTechnologies de gestion ...

  6. Algérie : tous les projets | CRDI - Centre de recherches pour le ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Sujet: GRASSLANDS, PASTORALISTS, Livestock, SOIL DEGRADATION, LAND MANAGEMENT, LAND ... sur les aspects de la santé humaine touchés par la quantité et la qualité de l'eau ... Évolution des partis politiques dans le monde arabe.

  7. Transnational Corporations and Local Innovation | CRDI - Centre de ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    25 sept. 2013 ... ... les ressources humaines, les structures du marché et l'innovation et le développement ... Dinesh Abrol est scientifique en chef au National Institute of Science, ... Le Centre de recherches pour le développement international est ... ont conclu un accord de coopération scientifique et technologique en ...

  8. 2325-IJBCS-Article-Agnes Essoh Yves

    African Journals Online (AJOL)

    hp

    un danger pour les activités touristiques donc économiques, la biodiversité lagunaire et la santé humaine. .... peuvent être domestiques et/ou industrielles, ce qui nécessite des traitements différents selon (CEAEQ, 2014). ..... des risques sanitaires encourus respectivement par les milieux récepteurs (lagune, sol) et par.

  9. Les Cahiers du CREAD

    African Journals Online (AJOL)

    Admin

    politiques, au cœur de cette stratégie développementiste qui a enfanté. 3 La formation ... humaines dans l'une des entreprises nationales algériennes pendant les ...... les années comme critères de recrutement pour deux différents niveaux ...

  10. 2525-IJBCS-Article-Paul Ayihadji Fernand H

    African Journals Online (AJOL)

    hp

    La tomate est un produit maraîcher très important dans l'alimentation humaine en Afrique et dans le monde. ... montrent que pour transformer 15 kg de tomate, la durée de cuisson et la consommation en énergie pour la ..... sauce tomate.

  11. Combler l'écart entre la recherche et le savoir | IDRC - International ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    7 janv. 2011 ... Selon les professeurs Chevalier et Buckles, il est plus urgent que jamais de faire participer tous les êtres humains, sans exception, à l'application et à la coproduction de connaissances. Le défi consiste à « porter au carré ... Trade liberalization: Poverty's friend or foe? They are the familiar images of global ...

  12. A worldwide survey of human male demographic history based on Y-SNP and Y-STR data from the HGDP-CEPH populations

    NARCIS (Netherlands)

    W. Shi (Wentao); Q. Ayub (Qasim); M. Vermeulen (Mark); R.G. Shao (Rong Guang); S.B. Zuniga (Sofia); K. van der Gaag (Kristiaan); P. de Knijff (Peter); M.H. Kayser (Manfred); Y. Xue (Yali); C. Tyler-Smith (Chris)

    2010-01-01

    textabstractWe have investigated human male demographic history using 590 males from 51 populations in the Human Genome Diversity Project-Centre d'Étude du Polymorphisme Humain worldwide panel, typed with 37 Y-chromosomal Single Nucleotide Polymorphisms and 65 Y-chromosomal Short Tandem Repeats and

  13. Pollution de l'environnement | CRDI - Centre de recherches pour le ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    , mettant en péril la vie humaine et les écosystèmes. De plus, ils sont souvent sources de conflit entre populations et industrie. En adoptant une approche écosystémique globale pour examiner les intérêts divergents et leurs conséquences, ...

  14. Caractérisation physico-chimique et bactériologique des eaux ...

    African Journals Online (AJOL)

    identification et le dénombrement des coliformes fécaux et totaux, des streptocoques fécaux et des clostridium perfringens. La présence de ces bactéries traduit une pollution d'origine fécale rendant ces eaux impropres à la consommation humaine.

  15. Livres | Page 22 | CRDI - Centre de recherches pour le ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Large Mines and the Community : Socioeconomic and Environmental Effects in Latin America, Canada, and Spain. Les humains s'établissent à proximité des ressources naturelles depuis des centaines d'années. Directeur(s) : Gary McMahon et Felix Remy. Maison(s) d'édition : Banque mondiale, CRDI. ISBN: Épuisé.

  16. Étendre le programme de Bourses canadiennes du jubilé de ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    'éducation limitent le développement du capital humain, ce qui entraîne de graves déficits en matière de compétences. Les obstacles à la transition des jeunes chercheurs d'un milieu universitaire à un milieu de travail productif présentent un ...

  17. Tanzania | Page 2 | IDRC - International Development Research ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Pour que les pays parviennent à des niveaux importants de développement économique et humain, il doit y avoir une certaine industrialisation », affirme Gussai Sheikheldin, titulaire d'une bourse de recherche du CRDI en 2016. Certaines institutions au sein du pays aident à orienter le processus. » Read more about ...

  18. 61 Contamination du lait caillé et de l'œuf consommé en Côte d ...

    African Journals Online (AJOL)

    dell

    Environnement,. Université ... Résumé. La présente étude vise à évaluer l'aspect sanitaire de l'alimentation humaine à travers deux produits à ... un lourd fardeau social et économique sur les communautés et sur leurs systèmes de santé [7].

  19. Résultats de recherche | Page 3 | CRDI - Centre de recherches pour ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    adresse principalement aux établissements de soins de santé du secteur public. ... Une équipe de recherche internationale s'emploie à protéger la santé humaine et l'environnement en améliorant les pratiques agricoles dans quatre pays ...

  20. Résultats de recherche | Page 68 | CRDI - Centre de recherches ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Participation citoyenne, technologies de collaboration et réglementation. L'accès aux services de base (eau, assainissement, énergie et communications) à un coût abordable est essentiel au développement et à la santé humains. Projet.

  1. 6 - Article Perret

    African Journals Online (AJOL)

    Administrateur

    La Caisse Nationale de Retraite (CNR) : elle gère les pensions et allocations de ...... politique de population en Algérie», Revue Sciences Humaines, n°12, p. ... Source : U.S. Census Bureau, International Data Base (http://www.coopami.org).

  2. l'annexe B pour connaître les critères d'évaluation

    International Development Research Centre (IDRC) Digital Library (Canada)

    William Bickford

    Motivation organisationnelle : L'organisme possède une connaissance acceptable de ses lacunes en matière de leadership stratégique, de ressources humaines, de gestion financière et d'infrastructure organisationnelle et de communications. En particulier : • des preuves de son appropriation et de son engagement à ...

  3. : tous les projets | Page 538 | CRDI - Centre de recherches pour le ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Région: Middle East, Central Asia, Far East Asia, South Asia, Jordan, Lebanon, Malaysia, Syria, Yemen, Palestine, Réunion ... et de la communication (TIC) pour le développement humain, social et économique du Moyen-Orient, notamment en Jordanie, au Liban, en Palestine (Cisjordanie et Gaza), en Syrie et au Yémen.

  4. Santé | Page 25 | CRDI - Centre de recherches pour le ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Dans cet ouvrage qui s'adresse aux planificateurs du développement et aux étudiants en nutrition, santé publique et anthropologie culturelle humaine, on aborde des enjeux de l'utilisation des sources naturelles d'aliments pour prévenir la carence en vitamine A. Read more about Culture, Environment, and Food to Prevent ...

  5. Résultats de recherche | Page 418 | CRDI - Centre de recherches ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Culture, Environment, and Food to Prevent Vitamin A Deficiency. Dans cet ouvrage qui s'adresse aux planificateurs du développement et aux étudiants en nutrition, santé publique et anthropologie culturelle humaine, on aborde des enjeux de l'utilisation des sources naturelles d'aliments pour prévenir la carence.

  6. ecodistribution des tabanides, glossines et stomoxes le long d'un ...

    African Journals Online (AJOL)

    zinga

    humaine: sérologie IgG4 et PCR nichée. Bulletin de la Société de Pathologie. Exotique, 92: 167-170. Toure FS, Kassambara L, Williams T, Bain O,. Millet P. 1998. Human occult loasis: improvement in diagnostic sensitivity by the use of polymerase chain reaction. American Journal of Tropical Medecine and Hygiene, 59: ...

  7. Displaying Uncertainty: A Comparison Between Submarine Subject Matter Experts

    Science.gov (United States)

    2007-03-01

    known as the “submarine capital of the world” and is the home for many of the schools relating to the submarine service. The administering officer for...and Woods, D. D. (1988). Aiding Human Performance: I. Cognitive Analysis, Le Travail Humain 51(1), 39-64. Roth, E. M., Patterson, E. S., and Mumaw

  8. Impact of Advanced Avionics Technology on Ground Attack Weapon Systems.

    Science.gov (United States)

    1982-02-01

    notation, small letters will be used to denote electro-magnetic wave complex amplitudes in the input and output planes whilst capital letters will...de lordre de 20 mn 4 eat possible sans intervention humaine particuliare. Une redondance tras utile peut atre ajoutge sans addition notable de

  9. An Approach to Embedded Training for Future Leaders and Staff

    Science.gov (United States)

    2009-10-01

    13. SUPPLEMENTARY NOTES See also ADA562526. RTO-MP-HFM-169 Human Dimensions in Embedded Virtual Simulation (Les dimensions humaines dans la...order to better capitalize on follow-on operations. 4.10 Theme 7: Sustain Unit Operations Theme 7 is defined as the ability of Soldiers and

  10. A Task-Based Analysis of Information Requirements of Tactical Maps

    Science.gov (United States)

    1979-08-01

    work began with the precept that military maps are primarily intended to serve users in the performance of functional tasks. By capitalizing on the task...Recherche Des Facteurs, Humaine de la Defense Natimla Onissels 2 Canadian ,losir Stall Washtington 1 C/Air Staff. Royal Canadian AF, ATTN: Pars Slid

  11. Function Flow Analysis and Comparison of Doctrinal and Applied Operations Planning Process

    Science.gov (United States)

    2005-05-16

    décision humaine est intuitive, c’est-à-dire qu’elle s’effectue selon un processus moins analytique, moins formel. Cela suppose qu’il peut y avoir une...Tactical System. The Land Force wants to develop new procedures that capitalize on the strengths of digitization. Project Minerva will focus on the

  12. CIDO 2015 : Des chercheurs tentent de combler le nouveau fossé ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    6 juil. 2015 ... ... pays plus pauvres du capital humain pour transformer des données ouvertes ... pas une croissance récente et une demande accrue de toilettes publiques. ... CIDO 2015 : Présentation du potentiel économique et social des ...

  13. Résultats de recherche | Page 2 | CRDI - Centre de recherches pour ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    ... naturelles 2 Apply Ressources naturelles filter · Économie 2 Apply Économie ... un obstacle important à un développement humain équitable en Amérique latine. ... La croissance rapide de la population, la commercialisation et l'exploitation ... souligne l'importance du capital social positif chez les jeunes marginalisés.

  14. Exploitation Agricole des Berges : Une Strategie D'Adaptation aux ...

    African Journals Online (AJOL)

    et socio-économique. ... dynamique des paysages agraires et son impact sur le capital naturel surtout sur les .... favoriser leur germination et amorcer leur croissance. ..... similaires ont été relevées au Bénin où l'impact humain se traduit par le ...

  15. C:\\Users\\AISA\\Desktop\\M. CAMARA.xps

    African Journals Online (AJOL)

    AISA

    plus rapidement le capital investi dans l'établissement de la ... hydriques conduisent à l'arrêt de croissance puis à la mort des .... les plans humain et financier, afin de mieux cibler les actions de ... Rentabilité économique des techniques.

  16. ÉTUDE DE CAS — Équateur (les pesticides) : L'intoxication par les ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    10 janv. 2011 ... La lutte intégrée est bénéfique à la santé physique et économique Les ... ont largement contribué à la croissance économique de Carchi; on leur attribue ..... ÉTUDE DE CAS — Cuba : Le logement et le capital humain à Cuba.

  17. Direction des Publications

    African Journals Online (AJOL)

    Synthese

    économique des services rendus par les écosystèmes marins. La richesse ... croissance plus rapide que la moyenne de l‟économie ...... services and natural capital. Nature. 387, 253-260. .... d‟interactions où l‟humain est partie prenante. In.

  18. Intégration des services financiers dans les stratégies de la lutte ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Tambi Samuel KABORE

    8 déc. 2009 ... sur la croissance, Fronde sociale sur les effets sociaux de l'ajustement. • En 1995 ... environnementales, macro-économiques afin de promouvoir des ... C. D. E. F. Croissance. Investissement, capital physique et humain,.

  19. miques locaux, région du Menabe Ce

    African Journals Online (AJOL)

    1 juin 2014 ... sur le long terme répondrait aux nécessités socio-économiques .... de développement humain. ... forte croissance et migration des populations, sont les princi- ... pression importante sur l'intégrité des forêts, il est capital.

  20. À la fois travailleuses et responsables des soins: Les échanges ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Puisque l'économie des soins n'a pas évolué au même rythme que le ... pu saisir les nouvelles occasions d'emploi rémunéré ou de croissance du revenu. ... de la famille et à la consolidation du capital humain de la future population active.