How and why does the areole meristem move in Echinocereus (Cactaceae)?

Science.gov (United States)

Sánchez, Daniel; Grego-Valencia, Dalia; Terrazas, Teresa; Arias, Salvador

2015-01-01

In Cactaceae, the areole is the organ that forms the leaves, spines and buds. Apparently, the genus Echinocereus develops enclosed buds that break through the epidermis of the stem adjacent to the areole; this trait most likely represents a synapomorphy of Echinocereus. The development of the areole is investigated here in order to understand the anatomical modifications that lead to internal bud development and to supplement anatomical knowledge of plants that do not behave according to classical shoot theory. The external morphology of the areole was documented and the anatomy was studied using tissue clearing, scanning electron microscopy and light microscopy for 50 species that represent the recognized clades and sections of the traditional classification of the genus, including Morangaya pensilis (Echinocereus pensilis). In Echinocereus, the areole is sealed by the periderm, and the areole meristem is moved and enclosed by the differential growth of the epidermis and surrounding cortex. The enclosed areole meristem is differentiated in a vegetative or floral bud, which develops internally and breaks through the epidermis of the stem. In Morangaya pensilis, the areole is not sealed by the periderm and the areole meristem is not enclosed. The enclosed areole meristem and internal bud development are understood to be an adaptation to protect the meristem and the bud from low temperatures. The anatomical evidence supports the hypothesis that the enclosed bud represents one synapomorphy for Echinocereus and also supports the exclusion of Morangaya from Echinocereus. © The Author 2014. Published by Oxford University Press on behalf of the Annals of Botany Company. All rights reserved. For Permissions, please email: journals.permissions@oup.com.

Simulation of organ patterning on the floral meristem using a polar auxin transport model.

Directory of Open Access Journals (Sweden)

Simon van Mourik

Full Text Available An intriguing phenomenon in plant development is the timing and positioning of lateral organ initiation, which is a fundamental aspect of plant architecture. Although important progress has been made in elucidating the role of auxin transport in the vegetative shoot to explain the phyllotaxis of leaf formation in a spiral fashion, a model study of the role of auxin transport in whorled organ patterning in the expanding floral meristem is not available yet. We present an initial simulation approach to study the mechanisms that are expected to play an important role. Starting point is a confocal imaging study of Arabidopsis floral meristems at consecutive time points during flower development. These images reveal auxin accumulation patterns at the positions of the organs, which strongly suggests that the role of auxin in the floral meristem is similar to the role it plays in the shoot apical meristem. This is the basis for a simulation study of auxin transport through a growing floral meristem, which may answer the question whether auxin transport can in itself be responsible for the typical whorled floral pattern. We combined a cellular growth model for the meristem with a polar auxin transport model. The model predicts that sepals are initiated by auxin maxima arising early during meristem outgrowth. These form a pre-pattern relative to which a series of smaller auxin maxima are positioned, which partially overlap with the anlagen of petals, stamens, and carpels. We adjusted the model parameters corresponding to properties of floral mutants and found that the model predictions agree with the observed mutant patterns. The predicted timing of the primordia outgrowth and the timing and positioning of the sepal primordia show remarkable similarities with a developing flower in nature.

Meristem micropropagation of cassava (Manihot esculenta evokes genome-wide changes in DNA methylation

Directory of Open Access Journals (Sweden)

Shedrack Reuben Kitimu

2015-08-01

Full Text Available There is great interest in the phenotypic, genetic and epigenetic changes associated with plant in vitro culture known as somaclonal variation. In vitro propagation systems that are based on the use of microcuttings or meristem cultures are considered analogous to clonal cuttings and so widely viewed to be largely free from such somaclonal effects. In this study, we surveyed for epigenetic changes during propagation by meristem culture and by field cuttings in five cassava (Manihot esculenta cultivars. Principal Co-ordinate Analysis of profiles generated by Methylation Sensitive Amplified Polymorphism (MSAP revealed clear divergence between samples taken from field-grown cuttings and those recovered from meristem culture. There was also good separation between the tissues of field samples but this effect was less distinct among the meristem culture materials. Application of methylation-sensitive Genotype By Sequencing (msGBS identified 105 candidate epimarks that distinguish between field cutting and meristem culture samples. Cross referencing the sequences of these epimarks to the draft cassava genome revealed 102 sites associated with genes whose homologues have been implicated in a range of fundamental biological processes including cell differentiation, development, sugar metabolism, DNA methylation, stress response, photosynthesis, and transposon activation. We explore the relevance of these findings for the selection of micropropagation systems for use on this and other crops.

The FANTASTIC FOUR proteins influence shoot meristem size in Arabidopsis thaliana

OpenAIRE

Wahl, Vanessa; Brand, Luise H; Guo, Ya-Long; Schmid, Markus

2010-01-01

Abstract Background Throughout their lives plants produce new organs from groups of pluripotent cells called meristems, located at the tips of the shoot and the root. The size of the shoot meristem is tightly controlled by a feedback loop, which involves the homeodomain transcription factor WUSCHEL (WUS) and the CLAVATA (CLV) proteins. This regulatory circuit is further fine-tuned by morphogenic signals such as hormones and sugars. Results Here we show that a family of four plant-specific pro...

An activated form of UFO alters leaf development and produces ectopic floral and inflorescence meristems.

Directory of Open Access Journals (Sweden)

Eddy Risseeuw

Full Text Available Plants are unique in their ability to continuously produce new meristems and organ primordia. In Arabidopsis, the transcription factor LEAFY (LFY functions as a master regulator of a gene network that is important for floral meristem and organ specification. UNUSUAL FLORAL ORGANS (UFO is a co-activator of LEAFY and is required for proper activation of APETALA3 in the floral meristem during the specification of stamens and petals. The ufo mutants display defects in other parts of the flower and the inflorescence, suggestive of additional roles. Here we show that the normal determinacy of the developing Arabidopsis leaves is affected by the expression of a gain-of-function UFO fusion protein with the VP16 transcriptional activator domain. In these lines, the rosette and cauline leaf primordia exhibit reiterated serration, and upon flowering produce ectopic meristems that develop into flowers, bract leaves and inflorescences. These striking phenotypes reveal that developing leaves maintain the competency to initiate flower and inflorescence programs. Furthermore, the gain-of-function phenotypes are dependent on LFY and the SEPALLATA (SEP MADS-box transcription factors, indicative of their functional interactions with UFO. The findings of this study also suggest that UFO promotes the establishment of the lateral meristems and primordia in the peripheral zone of the apical and floral meristems by enhancing the activity of LFY. These novel phenotypes along with the mutant phenotypes of UFO orthologs in other plant species suggest a broader function for UFO in plants.

An activated form of UFO alters leaf development and produces ectopic floral and inflorescence meristems.

Science.gov (United States)

Risseeuw, Eddy; Venglat, Prakash; Xiang, Daoquan; Komendant, Kristina; Daskalchuk, Tim; Babic, Vivijan; Crosby, William; Datla, Raju

2013-01-01

Plants are unique in their ability to continuously produce new meristems and organ primordia. In Arabidopsis, the transcription factor LEAFY (LFY) functions as a master regulator of a gene network that is important for floral meristem and organ specification. UNUSUAL FLORAL ORGANS (UFO) is a co-activator of LEAFY and is required for proper activation of APETALA3 in the floral meristem during the specification of stamens and petals. The ufo mutants display defects in other parts of the flower and the inflorescence, suggestive of additional roles. Here we show that the normal determinacy of the developing Arabidopsis leaves is affected by the expression of a gain-of-function UFO fusion protein with the VP16 transcriptional activator domain. In these lines, the rosette and cauline leaf primordia exhibit reiterated serration, and upon flowering produce ectopic meristems that develop into flowers, bract leaves and inflorescences. These striking phenotypes reveal that developing leaves maintain the competency to initiate flower and inflorescence programs. Furthermore, the gain-of-function phenotypes are dependent on LFY and the SEPALLATA (SEP) MADS-box transcription factors, indicative of their functional interactions with UFO. The findings of this study also suggest that UFO promotes the establishment of the lateral meristems and primordia in the peripheral zone of the apical and floral meristems by enhancing the activity of LFY. These novel phenotypes along with the mutant phenotypes of UFO orthologs in other plant species suggest a broader function for UFO in plants.

Meristem culture and subsequent micropropagation of Chilean strawberry (Fragaria chiloensis (L.) Duch.).

Science.gov (United States)

Quiroz, Karla A; Berríos, Miguel; Carrasco, Basilio; Retamales, Jorge B; Caligari, Peter D S; García-Gonzáles, Rolando

2017-06-02

Vegetative propagation of Fragaria sp. is traditionally carried out using stolons. This system of propagation, in addition to being slow, can spread plant diseases, particularly serious being viral. In vitro culture of meristems and the establishment of micropropagation protocols are important tools for solving these problems. In recent years, considerable effort has been made to develop in vitro propagation of the commercial strawberry in order to produce virus-free plants of high quality. These previous results can serve as the basis for developing in vitro-based propagation technologies in the less studied species Fragaria chiloensis. In this context, we studied the cultivation of meristems and establishment of a micropropagation protocol for F. chiloensis. The addition of polyvinylpyrrolidone (PVP) improved the meristem regeneration efficiency of F. chiloensis accessions. Similarly, the use of 6-benzylaminopurine (BAP) in the culture media increased the average rate of multiplication to 3-6 shoots per plant. In addition, the use of 6-benzylaminopurine (BAP), had low levels (near zero) of explant losses due to oxidation. However, plant height as well as number of leaves and roots were higher in media without growth regulators, with average values of 0.5 cm, 9 leaves and 4 roots per plant. For the first time in Chilean strawberry, meristem culture demonstrated to be an efficient tool for eliminating virus from infected plants, giving the possibility to produce disease free propagation material. Also, the addition of PVP into the basal MS medium improved the efficiency of plant recovery from isolated meristems. Farmers can now access to high quality plant material produced by biotech tools which will improve their technological practices.

SHOEBOX Modulates Root Meristem Size in Rice through Dose-Dependent Effects of Gibberellins on Cell Elongation and Proliferation.

Science.gov (United States)

Li, Jintao; Zhao, Yu; Chu, Huangwei; Wang, Likai; Fu, Yanru; Liu, Ping; Upadhyaya, Narayana; Chen, Chunli; Mou, Tongmin; Feng, Yuqi; Kumar, Prakash; Xu, Jian

2015-08-01

Little is known about how the size of meristem cells is regulated and whether it participates in the control of meristem size in plants. Here, we report our findings on shoebox (shb), a mild gibberellin (GA) deficient rice mutant that has a short root meristem size. Quantitative analysis of cortical cell length and number indicates that shb has shorter, rather than fewer, cells in the root meristem until around the fifth day after sowing, from which the number of cortical cells is also reduced. These defects can be either corrected by exogenous application of bioactive GA or induced in wild-type roots by a dose-dependent inhibitory effect of paclobutrazol on GA biosynthesis, suggesting that GA deficiency is the primary cause of shb mutant phenotypes. SHB encodes an AP2/ERF transcription factor that directly activates transcription of the GA biosynthesis gene KS1. Thus, root meristem size in rice is modulated by SHB-mediated GA biosynthesis that regulates the elongation and proliferation of meristem cells in a developmental stage-specific manner.

SHOEBOX Modulates Root Meristem Size in Rice through Dose-Dependent Effects of Gibberellins on Cell Elongation and Proliferation.

Directory of Open Access Journals (Sweden)

Jintao Li

2015-08-01

Full Text Available Little is known about how the size of meristem cells is regulated and whether it participates in the control of meristem size in plants. Here, we report our findings on shoebox (shb, a mild gibberellin (GA deficient rice mutant that has a short root meristem size. Quantitative analysis of cortical cell length and number indicates that shb has shorter, rather than fewer, cells in the root meristem until around the fifth day after sowing, from which the number of cortical cells is also reduced. These defects can be either corrected by exogenous application of bioactive GA or induced in wild-type roots by a dose-dependent inhibitory effect of paclobutrazol on GA biosynthesis, suggesting that GA deficiency is the primary cause of shb mutant phenotypes. SHB encodes an AP2/ERF transcription factor that directly activates transcription of the GA biosynthesis gene KS1. Thus, root meristem size in rice is modulated by SHB-mediated GA biosynthesis that regulates the elongation and proliferation of meristem cells in a developmental stage-specific manner.

Comparative evaluation of total RNA extraction methods in Theobroma cacao using shoot apical meristems.

Science.gov (United States)

Silva, D V; Branco, S M J; Holanda, I S A; Royaert, S; Motamayor, J C; Marelli, J P; Corrêa, R X

2016-03-04

Theobroma cacao is a species of great economic importance with its beans used for chocolate production. The tree has been a target of various molecular studies. It contains many polyphenols, which complicate the extraction of nucleic acids with the extraction protocols requiring a large amount of plant material. These issues, therefore, necessitate the optimization of the protocols. The aim of the present study was to evaluate different methods for extraction of total RNA from shoot apical meristems of T. cacao 'CCN 51' and to assess the influence of storage conditions for the meristems on the extraction. The study also aimed to identify the most efficient protocol for RNA extraction using a small amount of plant material. Four different protocols were evaluated for RNA extraction using one shoot apical meristem per sample. Among these protocols, one that was more efficient was then tested to extract RNA using four different numbers of shoot apical meristems, subjected to three different storage conditions. The best protocol was tested for cDNA amplification using reverse transcription-polymerase chain reaction; the cDNA quality was determined to be satisfactory for molecular analyses. The study revealed that with the best RNA extraction protocol, one shoot apical meristem was sufficient for extraction of high-quality total RNA. The results obtained might enable advances in genetic analyses and molecular studies using reduced amount of plant material.

The founder-cell transcriptome in the Arabidopsis apetala1 cauliflower inflorescence meristem.

Science.gov (United States)

Frerichs, Anneke; Thoma, Rahere; Abdallah, Ali Taleb; Frommolt, Peter; Werr, Wolfgang; Chandler, John William

2016-11-03

Although the pattern of lateral organ formation from apical meristems establishes species-specific plant architecture, the positional information that confers cell fate to cells as they transit to the meristem flanks where they differentiate, remains largely unknown. We have combined fluorescence-activated cell sorting and RNA-seq to characterise the cell-type-specific transcriptome at the earliest developmental time-point of lateral organ formation using DORNRÖSCHEN-LIKE::GFP to mark founder-cell populations at the periphery of the inflorescence meristem (IM) in apetala1 cauliflower double mutants, which overproliferate IMs. Within the lateral organ founder-cell population at the inflorescence meristem, floral primordium identity genes are upregulated and stem-cell identity markers are downregulated. Additional differentially expressed transcripts are involved in polarity generation and boundary formation, and in epigenetic and post-translational changes. However, only subtle transcriptional reprogramming within the global auxin network was observed. The transcriptional network of differentially expressed genes supports the hypothesis that lateral organ founder-cell specification involves the creation of polarity from the centre to the periphery of the IM and the establishment of a boundary from surrounding cells, consistent with bract initiation. However, contrary to the established paradigm that sites of auxin response maxima pre-pattern lateral organ initiation in the IM, auxin response might play a minor role in the earliest stages of lateral floral initiation.

Live Imaging of Shoot Meristems on an Inverted Confocal Microscope Using an Objective Lens Inverter Attachment

Science.gov (United States)

Nimchuk, Zachary L.; Perdue, Tony D.

2017-01-01

Live imaging of above ground meristems can lead to new insights in plant development not possible from static imaging of fixed tissue. The use of an upright confocal microscope offers several technical and biological advantages for live imaging floral or shoot meristems. However, many departments and core facilities possess only inverted confocal microscopes and lack the funding for an additional upright confocal microscope. Here we show that imaging of living apical meristems can be performed on existing inverted confocal microscopes with the use of an affordable and detachable InverterScope accessory. PMID:28579995

Live Imaging of Shoot Meristems on an Inverted Confocal Microscope Using an Objective Lens Inverter Attachment.

Science.gov (United States)

Nimchuk, Zachary L; Perdue, Tony D

2017-01-01

Live imaging of above ground meristems can lead to new insights in plant development not possible from static imaging of fixed tissue. The use of an upright confocal microscope offers several technical and biological advantages for live imaging floral or shoot meristems. However, many departments and core facilities possess only inverted confocal microscopes and lack the funding for an additional upright confocal microscope. Here we show that imaging of living apical meristems can be performed on existing inverted confocal microscopes with the use of an affordable and detachable InverterScope accessory.

Meristem micropropagation of cassava (Manihot esculenta) evokes genome-wide changes in DNA methylation

OpenAIRE

Shedrack Reuben Kitimu; Shedrack Reuben Kitimu; Julian eTaylor; Timothy J March; Fred eTairo; Mike J Wilkinson; Carlos Marcelino Rodriguez Lopez

2015-01-01

There is great interest in the phenotypic, genetic and epigenetic changes associated with plant in vitro culture known as somaclonal variation. In vitro propagation systems that are based on the use of microcuttings or meristem cultures are considered analogous to clonal cuttings and so widely viewed to be largely free from such somaclonal effects. In this study, we surveyed for epigenetic changes during propagation by meristem culture and by field cuttings in five cassava (Manihot esculenta...

Cytokinin-induced promotion of root meristem size in the fern Azolla supports a shoot-like origin of euphyllophyte roots.

Science.gov (United States)

de Vries, Jan; Fischer, Angela Melanie; Roettger, Mayo; Rommel, Sophie; Schluepmann, Henriette; Bräutigam, Andrea; Carlsbecker, Annelie; Gould, Sven Bernhard

2016-01-01

The phytohormones cytokinin and auxin orchestrate the root meristem development in angiosperms by determining embryonic bipolarity. Ferns, having the most basal euphyllophyte root, form neither bipolar embryos nor permanent embryonic primary roots but rather an adventitious root system. This raises the questions of how auxin and cytokinin govern fern root system architecture and whether this can tell us something about the origin of that root. Using Azolla filiculoides, we characterized the influence of IAA and zeatin on adventitious fern root meristems and vasculature by Nomarski microscopy. Simultaneously, RNAseq analyses, yielding 36,091 contigs, were used to uncover how the phytohormones affect root tip gene expression. We show that auxin restricts Azolla root meristem development, while cytokinin promotes it; it is the opposite effect of what is observed in Arabidopsis. Global gene expression profiling uncovered 145 genes significantly regulated by cytokinin or auxin, including cell wall modulators, cell division regulators and lateral root formation coordinators. Our data illuminate both evolution and development of fern roots. Promotion of meristem size through cytokinin supports the idea that root meristems of euphyllophytes evolved from shoot meristems. The foundation of these roots was laid in a postembryonically branching shoot system. © 2015 The Authors. New Phytologist © 2015 New Phytologist Trust.

Plant-specific Histone Deacetylases HDT½ Regulate GIBBERELLIN 2-OXIDASE 2 Expression to Control Arabidopsis Root Meristem Cell Number

KAUST Repository

Li, Huchen; Torres-Garcia, Jesus; latrasse, David; Benhamed, Moussa; Schilderink, Stefan; Zhou, Wenkun; Kulikova, Olga; Hirt, Heribert; Bisseling, Ton

2017-01-01

Root growth is modulated by environmental factors and depends on cell production in the root meristem (RM). New cells in the meristem are generated by stem cells and transit-amplifying cells, which together determine RM cell number. Transcription

Mechanically, the shoot apical meristem of Arabidopsis behaves like a shell inflated by a pressure of about 1 MPa

Directory of Open Access Journals (Sweden)

Léna eBeauzamy

2015-11-01

Full Text Available In plants, the shoot apical meristem contains the stem cells and is responsible for the generation of all aerial organs. Mechanistically, organogenesis is associated with an auxin-dependent local softening of the epidermis. This has been proposed to be sufficient to trigger outgrowth, because the epidermis is thought to be under tension and stiffer than internal tissues in all the aerial part of the plant. However, this has not been directly demonstrated in the shoot apical meristem. Here we tested this hypothesis in Arabidopsis using indentation methods and modeling. We considered two possible scenarios: either the epidermis does not have unique properties and the meristem behaves as a homogeneous linearly-elastic tissue, or the epidermis is under tension and the meristem exhibits the response of a shell under pressure. Large indentation depths measurements with a large tip (~size of the meristem were consistent with a shell-like behavior. This also allowed us to deduce a value of turgor pressure, estimated at 0.82 ± 0.16 MPa. Indentation with atomic force microscopy provided local measurements of pressure in the epidermis, further confirming the values obtained from large deformations. Altogether, our data demonstrate that the Arabidopsis shoot apical meristem behaves like a shell under a MPa range pressure and support a key role for the epidermis in shaping the shoot apex.

UFO in the Arabidopsis inflorescence apex is required for floral-meristem identity and bract suppression.

Science.gov (United States)

Hepworth, Shelley R; Klenz, Jennifer E; Haughn, George W

2006-03-01

The UNUSUAL FLORAL ORGANS (UFO) gene of Arabidopsis encodes an F-box protein required for the determination of floral-organ and floral-meristem identity. Mutation of UFO leads to dramatic changes in floral-organ type which are well-characterized whereas inflorescence defects are more subtle and less understood. These defects include an increase in the number of secondary inflorescences, nodes that alternate between forming flowers and secondary inflorescences, and nodes in which a single flower is subtended by a bract. Here, we show how inflorescence defects correlate with the abnormal development of floral primordia and establish a temporal requirement for UFO in this process. At the inflorescence apex of ufo mutants, newly formed primordia are initially bract-like. Expression of the floral-meristem identity genes LFY and AP1 are confined to a relatively small adaxial region of these primordia with expression of the bract-identity marker FIL observed in cells that comprise the balance of the primordia. Proliferation of cells in the adaxial region of these early primordia is delayed by several nodes such that primordia appear "chimeric" at several nodes, having visible floral and bract components. However, by late stage 2 of floral development, growth of the bract generally ceases and is overtaken by development of the floral primordium. This abnormal pattern of floral meristem development is not rescued by expression of UFO from the AP1 promoter, indicating that UFO is required prior to AP1 activation for normal development of floral primordia. We propose that UFO and LFY are jointly required in the inflorescence meristem to both promote floral meristem development and inhibit, in a non-cell autonomous manner, growth of the bract.

Evolutionary Co-Option of Floral Meristem Identity Genes for Patterning of the Flower-Like Asteraceae Inflorescence.

Science.gov (United States)

Zhao, Yafei; Zhang, Teng; Broholm, Suvi K; Tähtiharju, Sari; Mouhu, Katriina; Albert, Victor A; Teeri, Teemu H; Elomaa, Paula

2016-09-01

The evolutionary success of Asteraceae, the largest family of flowering plants, has been attributed to the unique inflorescence architecture of the family, which superficially resembles an individual flower. Here, we show that Asteraceae inflorescences (flower heads, or capitula) resemble solitary flowers not only morphologically but also at the molecular level. By conducting functional analyses for orthologs of the flower meristem identity genes LEAFY (LFY) and UNUSUAL FLORAL ORGANS (UFO) in Gerbera hybrida, we show that GhUFO is the master regulator of flower meristem identity, while GhLFY has evolved a novel, homeotic function during the evolution of head-like inflorescences. Resembling LFY expression in a single flower meristem, uniform expression of GhLFY in the inflorescence meristem defines the capitulum as a determinate structure that can assume floral fate upon ectopic GhUFO expression. We also show that GhLFY uniquely regulates the ontogeny of outer, expanded ray flowers but not inner, compact disc flowers, indicating that the distinction of different flower types in Asteraceae is connected with their independent evolutionary origins from separate branching systems. © 2016 American Society of Plant Biologists. All rights reserved.

Ethylene Inhibits Cell Proliferation of the Arabidopsis Root Meristem1[OPEN

Science.gov (United States)

Street, Ian H.; Aman, Sitwat; Zubo, Yan; Ramzan, Aleena; Wang, Xiaomin; Shakeel, Samina N.; Kieber, Joseph J.; Schaller, G. Eric

2015-01-01

The root system of plants plays a critical role in plant growth and survival, with root growth being dependent on both cell proliferation and cell elongation. Multiple phytohormones interact to control root growth, including ethylene, which is primarily known for its role in controlling root cell elongation. We find that ethylene also negatively regulates cell proliferation at the root meristem of Arabidopsis (Arabidopsis thaliana). Genetic analysis indicates that the inhibition of cell proliferation involves two pathways operating downstream of the ethylene receptors. The major pathway is the canonical ethylene signal transduction pathway that incorporates CONSTITUTIVE TRIPLE RESPONSE1, ETHYLENE INSENSITIVE2, and the ETHYLENE INSENSITIVE3 family of transcription factors. The secondary pathway is a phosphorelay based on genetic analysis of receptor histidine kinase activity and mutants involving the type B response regulators. Analysis of ethylene-dependent gene expression and genetic analysis supports SHORT HYPOCOTYL2, a repressor of auxin signaling, as one mediator of the ethylene response and furthermore, indicates that SHORT HYPOCOTYL2 is a point of convergence for both ethylene and cytokinin in negatively regulating cell proliferation. Additional analysis indicates that ethylene signaling contributes but is not required for cytokinin to inhibit activity of the root meristem. These results identify key elements, along with points of cross talk with cytokinin and auxin, by which ethylene negatively regulates cell proliferation at the root apical meristem. PMID:26149574

Evolutionary Co-Option of Floral Meristem Identity Genes for Patterning of the Flower-Like Asteraceae Inflorescence1

Science.gov (United States)

Broholm, Suvi K.; Tähtiharju, Sari

2016-01-01

The evolutionary success of Asteraceae, the largest family of flowering plants, has been attributed to the unique inflorescence architecture of the family, which superficially resembles an individual flower. Here, we show that Asteraceae inflorescences (flower heads, or capitula) resemble solitary flowers not only morphologically but also at the molecular level. By conducting functional analyses for orthologs of the flower meristem identity genes LEAFY (LFY) and UNUSUAL FLORAL ORGANS (UFO) in Gerbera hybrida, we show that GhUFO is the master regulator of flower meristem identity, while GhLFY has evolved a novel, homeotic function during the evolution of head-like inflorescences. Resembling LFY expression in a single flower meristem, uniform expression of GhLFY in the inflorescence meristem defines the capitulum as a determinate structure that can assume floral fate upon ectopic GhUFO expression. We also show that GhLFY uniquely regulates the ontogeny of outer, expanded ray flowers but not inner, compact disc flowers, indicating that the distinction of different flower types in Asteraceae is connected with their independent evolutionary origins from separate branching systems. PMID:27382139

Flux-based transport enhancement as a plausible unifying mechanism for auxin transport in meristem development.

Directory of Open Access Journals (Sweden)

Szymon Stoma

2008-10-01

Full Text Available Plants continuously generate new organs through the activity of populations of stem cells called meristems. The shoot apical meristem initiates leaves, flowers, and lateral meristems in highly ordered, spiralled, or whorled patterns via a process called phyllotaxis. It is commonly accepted that the active transport of the plant hormone auxin plays a major role in this process. Current hypotheses propose that cellular hormone transporters of the PIN family would create local auxin maxima at precise positions, which in turn would lead to organ initiation. To explain how auxin transporters could create hormone fluxes to distinct regions within the plant, different concepts have been proposed. A major hypothesis, canalization, proposes that the auxin transporters act by amplifying and stabilizing existing fluxes, which could be initiated, for example, by local diffusion. This convincingly explains the organised auxin fluxes during vein formation, but for the shoot apical meristem a second hypothesis was proposed, where the hormone would be systematically transported towards the areas with the highest concentrations. This implies the coexistence of two radically different mechanisms for PIN allocation in the membrane, one based on flux sensing and the other on local concentration sensing. Because these patterning processes require the interaction of hundreds of cells, it is impossible to estimate on a purely intuitive basis if a particular scenario is plausible or not. Therefore, computational modelling provides a powerful means to test this type of complex hypothesis. Here, using a dedicated computer simulation tool, we show that a flux-based polarization hypothesis is able to explain auxin transport at the shoot meristem as well, thus providing a unifying concept for the control of auxin distribution in the plant. Further experiments are now required to distinguish between flux-based polarization and other hypotheses.

Cell radiosensitivity variation in synchronously-dividing root meristems of Pisum sativum L. and Zea mays L. during the mitotic cycle

International Nuclear Information System (INIS)

Gudkov, I.N.; Grodzinsky, D.M.

1982-01-01

The cell divisions in pea and maize seedling root meristems were synchronized by treatment with 0.03 per cent hydroxyurea for 24 hours. At different times after block cessation (removing seedlings from hydroxyurea), i.e. according to certain phases and subphases of the mitotic cycle, the seedlings were treated with 60 Co γ-radiation at doses from 3 to 32 Gy. Evaluation of seedling radioresistance by the survival of the main root meristem on the tenth day after irradiation led to the following sequence of cell stages in order of increasing resistance. For the pea root meristem: G 2 , M, late G 1 , early S, late S, middle S and early G 1 . For the maize root meristem: late G 2 , M, G 1 , early S, early G 2 , late S and middle S. (author)

Cell radiosensitivity variation in synchronously-dividing root meristems of Pisum sativum L. and Zea mays L. during the mitotic cycle

Energy Technology Data Exchange (ETDEWEB)

Gudkov, I.N.; Grodzinsky, D.M. (AN Ukrainskoj SSR, Kiev. Inst. Fiziologii Rastenij)

1982-04-01

The cell divisions in pea and maize seedling root meristems were synchronized by treatment with 0.03 per cent hydroxyurea for 24 hours. At different times after block cessation (removing seedlings from hydroxyurea), i.e. according to certain phases and subphases of the mitotic cycle, the seedlings were treated with /sup 60/Co ..gamma..-radiation at doses from 3 to 32 Gy. Evaluation of seedling radioresistance by the survival of the main root meristem on the tenth day after irradiation led to the following sequence of cell stages in order of increasing resistance. For the pea root meristem: G/sub 2/, M, late G/sub 1/, early S, late S, middle S and early G/sub 1/. For the maize root meristem: late G/sub 2/, M, G/sub 1/, early S, early G/sub 2/, late S and middle S.

Comparison of Meristem Culture and Heat Therapy to Clean Garlic ...

African Journals Online (AJOL)

(meristem culture) እንዱሁም ከሶስቱም ዝርያዎች በቫይረስ የተበከለ ኮረቶችን በሙቀት ... Eastern and Central Africa-International Livestock Research Institute Hub ...

Repression of Lateral Organ Boundary Genes by PENNYWISE and POUND-FOOLISH Is Essential for Meristem Maintenance and Flowering in Arabidopsis

NARCIS (Netherlands)

Khan, Madiha; Ragni, Laura; Tabb, Paul; Salasini, Brenda C; Chatfield, Steven; Datla, Raju; Lock, John; Kuai, Xiahezi; Després, Charles; Proveniers, Marcel; Yongguo, Cao; Xiang, Daoquan; Morin, Halima; Rullière, Jean-Pierre; Citerne, Sylvie; Hepworth, Shelley R; Pautot, Véronique

2015-01-01

In the model plant Arabidopsis (Arabidopsis thaliana), endogenous and environmental signals acting on the shoot apical meristem cause acquisition of inflorescence meristem fate. This results in changed patterns of aerial development seen as the transition from making leaves to the production of

Gene expression polymorphisms and ESTs associated with gravitropic response of subterranean branch meristems and growth habit in Leymus wildryes

Science.gov (United States)

Parminder Kaur; Ivan W. Mott; Steven R. Larson; B. Shaun Bushman; Alvaro G. Hernandez; W. Ryan Kim; Lei Liu; Mark A. Mikel

2008-01-01

Negatively orthogeotropic (NOGT) tiller and diageotropic (DGT) rhizome meristems develop from the same type of lateral axillary meristems and phytomer structure. Although subterranean NOGT and DGT buds appear similar, they display different responses to gravity and perhaps other cues governing branch angle and overall growth habit (GH). Leymus wildryes show remarkable...

FON2 SPARE1 redundantly regulates floral meristem maintenance with FLORAL ORGAN NUMBER2 in rice.

Directory of Open Access Journals (Sweden)

Takuya Suzaki

2009-10-01

Full Text Available CLAVATA signaling restricts stem cell identity in the shoot apical meristem (SAM in Arabidopsis thaliana. In rice (Oryza sativa, FLORAL ORGAN NUMBER2 (FON2, closely related to CLV3, is involved as a signaling molecule in a similar pathway to negatively regulate stem cell proliferation in the floral meristem (FM. Here we show that the FON2 SPARE1 (FOS1 gene encoding a CLE protein functions along with FON2 in maintenance of the FM. In addition, FOS1 appears to be involved in maintenance of the SAM in the vegetative phase, because constitutive expression of FOS1 caused termination of the vegetative SAM. Genetic analysis revealed that FOS1 does not need FON1, the putative receptor of FON2, for its action, suggesting that FOS1 and FON2 may function in meristem maintenance as signaling molecules in independent pathways. Initially, we identified FOS1 as a suppressor that originates from O. sativa indica and suppresses the fon2 mutation in O. sativa japonica. FOS1 function in japonica appears to be compromised by a functional nucleotide polymorphism (FNP at the putative processing site of the signal peptide. Sequence comparison of FOS1 in about 150 domesticated rice and wild rice species indicates that this FNP is present only in japonica, suggesting that redundant regulation by FOS1 and FON2 is commonplace in species in the Oryza genus. Distribution of the FNP also suggests that this mutation may have occurred during the divergence of japonica from its wild ancestor. Stem cell maintenance may be regulated by at least three negative pathways in rice, and each pathway may contribute differently to this regulation depending on the type of the meristem. This situation contrasts with that in Arabidopsis, where CLV signaling is the major single pathway in all meristems.

Plant-specific histone deacetylases HDT1/2 regulate GIBBERELLIN 2-OXIDASE2 expression to control arabidopsis root meristem cell number

NARCIS (Netherlands)

Li, Huchen; Torres-Garcia, Jesus; Latrasse, David; Benhamed, Moussa; Schilderink, Stefan; Zhou, Wenkun; Kulikova, Olga; Hirt, Heribert; Bisseling, Ton

2017-01-01

Root growth is modulated by environmental factors and depends on cell production in the root meristem (RM). New cells in the meristem are generated by stem cells and transit-amplifying cells, which together determine RM cell number. Transcription factors and chromatin-remodeling factors have been

Optimization of a protocol for direct organogenesis of red clover (Trifolium pratense L. meristems for breeding purposes

Directory of Open Access Journals (Sweden)

JUAN C CARRILLO

2004-01-01

Full Text Available A series of experiments were carried out in order to optimize a protocol for the direct organogenesis of Chilean red clover germplasm. A range of cultivars were used to analyze the effect of explant source (crown or stem meristems of vegetative plants, culture media and plant growth regulators. Our findings showed that stem meristems were easier to obtain, presented lower levels of contamination and a better development than crown meristems. The L2 medium showed better results than B5 and MS media for the cultivars and experimental lines studied. L2 medium supplemented with 0.003 mg/l of 4-amino-3,5,6-trichloropicolinic acid and 1.0 mg/l of 6-benzylaminopurine gave consistently better results and will be applied in our breeding program to propagate, maintain and eliminate viruses from elite red clover clones.

The QTL GNP1 Encodes GA20ox1, Which Increases Grain Number and Yield by Increasing Cytokinin Activity in Rice Panicle Meristems.

Science.gov (United States)

Wu, Yuan; Wang, Yun; Mi, Xue-Fei; Shan, Jun-Xiang; Li, Xin-Min; Xu, Jian-Long; Lin, Hong-Xuan

2016-10-01

Cytokinins and gibberellins (GAs) play antagonistic roles in regulating reproductive meristem activity. Cytokinins have positive effects on meristem activity and maintenance. During inflorescence meristem development, cytokinin biosynthesis is activated via a KNOX-mediated pathway. Increased cytokinin activity leads to higher grain number, whereas GAs negatively affect meristem activity. The GA biosynthesis genes GA20oxs are negatively regulated by KNOX proteins. KNOX proteins function as modulators, balancing cytokinin and GA activity in the meristem. However, little is known about the crosstalk among cytokinin and GA regulators together with KNOX proteins and how KNOX-mediated dynamic balancing of hormonal activity functions. Through map-based cloning of QTLs, we cloned a GA biosynthesis gene, Grain Number per Panicle1 (GNP1), which encodes rice GA20ox1. The grain number and yield of NIL-GNP1TQ were significantly higher than those of isogenic control (Lemont). Sequence variations in its promoter region increased the levels of GNP1 transcripts, which were enriched in the apical regions of inflorescence meristems in NIL-GNP1TQ. We propose that cytokinin activity increased due to a KNOX-mediated transcriptional feedback loop resulting from the higher GNP1 transcript levels, in turn leading to increased expression of the GA catabolism genes GA2oxs and reduced GA1 and GA3 accumulation. This rebalancing process increased cytokinin activity, thereby increasing grain number and grain yield in rice. These findings uncover important, novel roles of GAs in rice florescence meristem development and provide new insights into the crosstalk between cytokinin and GA underlying development process.

Single-cell telomere-length quantification couples telomere length to meristem activity and stem cell development in Arabidopsis.

Science.gov (United States)

González-García, Mary-Paz; Pavelescu, Irina; Canela, Andrés; Sevillano, Xavier; Leehy, Katherine A; Nelson, Andrew D L; Ibañes, Marta; Shippen, Dorothy E; Blasco, Maria A; Caño-Delgado, Ana I

2015-05-12

Telomeres are specialized nucleoprotein caps that protect chromosome ends assuring cell division. Single-cell telomere quantification in animals established a critical role for telomerase in stem cells, yet, in plants, telomere-length quantification has been reported only at the organ level. Here, a quantitative analysis of telomere length of single cells in Arabidopsis root apex uncovered a heterogeneous telomere-length distribution of different cell lineages showing the longest telomeres at the stem cells. The defects in meristem and stem cell renewal observed in tert mutants demonstrate that telomere lengthening by TERT sets a replicative limit in the root meristem. Conversely, the long telomeres of the columella cells and the premature stem cell differentiation plt1,2 mutants suggest that differentiation can prevent telomere erosion. Overall, our results indicate that telomere dynamics are coupled to meristem activity and continuous growth, disclosing a critical association between telomere length, stem cell function, and the extended lifespan of plants. Copyright © 2015 The Authors. Published by Elsevier Inc. All rights reserved.

Ds tagging of BRANCHED FLORETLESS 1 (BFL1 that mediates the transition from spikelet to floret meristem in rice (Oryza sativa L

Directory of Open Access Journals (Sweden)

Hoque Mohammad

2003-09-01

Full Text Available Abstract Background The genetics of spikelet formation, a feature unique to grasses such as rice and maize, is yet to be fully understood, although a number of meristem and organ identity mutants have been isolated and investigated in Arabidopsis and maize. Using a two-element Ac/Ds transposon tagging system we have isolated a rice mutant, designated branched floretless 1 (bfl1 which is defective in the transition from spikelet meristem to floret meristem. Results The bfl1 mutant shows normal differentiation of the primary rachis-branches leading to initial spikelet meristem (bract-like structure equivalent to rudimentary glumes formation but fails to develop empty glumes and florets. Instead, axillary meristems in the bract-like structure produce sequential alternate branching, thus resulting in a coral shaped morphology of the branches in the developing panicle. The bfl1 mutant harbours a single Ds insertion in the upstream region of the BFL1 gene on chromosome 7 corresponding to PAC clone P0625E02 (GenBank Acc No. message URL http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?cmd=Retrieve&db=nucleotide&list_uids=34395191&dopt=GenBank&term=ap004570AP004570. RT-PCR analyses revealed a drastic reduction of BFL1 transcript levels in the bfl1 mutant compared to that in the wild-type. In each of the normal panicle-bearing progeny plants, from occasional revertant seeds of the vegetatively-propagated mutant plant, Ds was shown to be excised from the bfl1 locus. BFL1 contains an EREBP/AP2 domain and is most likely an ortholog of the maize transcription factor gene BRANCHED SILKLESS1 (BD1. Conclusions bfl1 is a Ds-tagged rice mutant defective in the transition from spikelet meristem (SM to floret meristem (FM. BFL1 is most probably a rice ortholog of the maize ERF (EREBP/AP2 transcription factor gene BD1. Based on the similarities in mutant phenotypes bfl1 is likely to be an allele of the previously reported frizzy panicle locus.

Cell lineage patterns in the shoot meristem of the sunflower embryo in the dry seed

International Nuclear Information System (INIS)

Jegla, D.E.; Sussex, I.M.

1989-01-01

We mapped the fate of cells in the shoot meristem of the dry-seed embryo of sunflower, Helianthus annuus L. cv. Peredovic, using irradiation-induced somatic sectors. We analyzed 249 chlorophyll-deficient or glabrous (hairless) sectors generated in 236 plants. Most sectors observed in the inflorescence extended into vegetative nodes. Thus cell lineages that ultimately gave rise to reproductive structures also contributed to vegetative structures. No single sector extended the entire length of the shoot. Thus the shoot is not derived from one or a few apical initials. Rather, the position, vertical extent, and width of the sectors at different levels of the shoot suggest that the shoot is derived from three to four circumferential populations of cells in each of three cell layers of the embryo meristem. Sectors had no common boundaries even in plants with two or three independent sectors, but varied in extent and overlapped along the length of the shoot. Thus individual cells in a single circumferential population behaved independently to contribute lineages of different vertical extents to the growing shoot. The predicted number of circumferential populations of cells as well as the apparent cell number in each population was consistent with the actual number of cells in the embryo meristem observed in histological sections

Regeneration of three sweet potato (Ipomea batatas (L.)) accessions via meristem, Nodal and callus induction

International Nuclear Information System (INIS)

Addae-Frimpomaah, F.

2012-11-01

In vitro regeneration of three sweet potato accessions UE007, UK-BNARI and SA-BNARI using meristem, nodal cuttings or callus induction was studied. Meristematic explants cultured on Murashige and Skoog (1962) basal medium supplemented with low concentration of benzylaminopurine (BAP) or kinetin resulted in callus with or without shoot development which delayed shoot emergence. The degree of callus development increased as the concentration of the cytokinin in the culture medium increased. Although, callus development was comparatively lower on kinetin amended medium than BAP amended medium, Murashige and Skoog medium supplemented with 0.25mg/1BAP had the highest shoot induction (80%). For further differentiation of callus or shoots into distinct stem and leaves, the culture were transferred into fresh MS medium supplemented with 0.25mg/1 BAP, 0.1 mg/1 NAA and 0.1 mg/1 Gibberellic acid (GA 3 . To overcome the delay in shoot initiation using meristem culture, nodal cuttings of sweet potato were used as explants and cultured on MS medium amended with 0.3 - 0.9mg/1 BAP. All explants cultured on 0.3 or 0.6mg/1 BAP developed shoots. Furthermore, liquid MS medium amended with 0.25mg/1 BAP, 0.1mg/I NAA, and 0.1mg/1 GA 3 also enhanced early shoot development from nodal cutting explants compared to solid culture. Post flask acclimatisation of meristem or nodal cutting-derived plantlets showed that meristem derived plantlets were better acclimatised than nodal cutting plants due to vigorous root development leading to higher percentage survival in pots and subsequent tuber production. Callusogenesis was achieved when leaf lobe explants were cultured on CLC/ Ipomoea medium supplemented with 1.0 - 4.0mg/1 2,4-D with 4.0mg/1 2,4-D being the optimal concentration. However, the calli were non-embryogenic and therefore could not produce embryos when transferred to 0.1mg/1 BAP amended medium but rather produced either single or multiple shoots. The highest percentage shoot (83

Cadmium cytotoxity: study of Allium sativum L. root meristems

Energy Technology Data Exchange (ETDEWEB)

Clain, E.; Deysson, G.

1976-01-01

Three cadmium salts, CdSO/sub 4/, Cd(NO/sub 3/)/sub 2/, and Cd(OAc)/sub 2/ were tested on garlic root meristems. CdSO/sub 4/ was the most toxic of the three; when 10/sup -7/ mol/ml was used, mitostasis resulted within 24 hours and cellular death after forty-eight hours. Cd(NO/sub 3/)/sub 2/ and Cd(OAc)/sub 2/ were lethal at 5 x 10/sup -7/ mol/ml. 1 figure, 1 table.

Improved and Reproducible Flow Cytometry Methodology for Nuclei Isolation from Single Root Meristem

Directory of Open Access Journals (Sweden)

Thaís Cristina Ribeiro Silva

2010-01-01

Full Text Available Root meristems have increasingly been target of cell cycle studies by flow cytometric DNA content quantification. Moreover, roots can be an alternative source of nuclear suspension when leaves become unfeasible and for chromosome analysis and sorting. In the present paper, a protocol for intact nuclei isolation from a single root meristem was developed. This proceeding was based on excision of the meristematic region using a prototypical slide, followed by short enzymatic digestion and mechanical isolation of nuclei during homogenization with a hand mixer. Such parameters were optimized for reaching better results. Satisfactory nuclei amounts were extracted and analyzed by flow cytometry, producing histograms with reduced background noise and CVs between 3.2 and 4.1%. This improved and reproducible technique was shown to be rapid, inexpensive, and simple for nuclear extraction from a single root tip, and can be adapted for other plants and purposes.

Requirement of B2-Type Cyclin-Dependent Kinases for Meristem Integrity in Arabidopsis thaliana

Czech Academy of Sciences Publication Activity Database

Andersen, S.U.; Buechel, S.; Zhao, Z.; Ljung, K.; Novák, Ondřej; Busch, W.; Schuster, Ch.; Lohmann, J.U.

2008-01-01

Roč. 20, č. 1 (2008), s. 88-100 ISSN 1040-4651 Institutional research plan: CEZ:AV0Z50380511 Keywords : SHOOT APICAL MERISTEM * CELL-CYCLE * PLANT DEVELOPMENT Subject RIV: CE - Biochemistry Impact factor: 9.296, year: 2008

Cell walls as a stage for intercellular communication regulating shoot meristem development

Directory of Open Access Journals (Sweden)

Toshiaki eTameshige

2015-05-01

Full Text Available Aboveground organs of plants are ultimately derived/generated from the shoot apical meristem (SAM, which is the proliferative tissue located at the apex of the stem. The SAM contains a population of stem cells that provide new cells for organ/tissue formation. The SAM is composed of distinct cell layers and zones with different properties. Primordia of lateral organs develop at the periphery of the SAM. The shoot apex is a dynamic and complex tissue, and as such intercellular communications among cells, layers and zones play significant roles in the coordination of cell proliferation, growth and differentiation to achieve elaborate morphogenesis. Recent findings have highlighted the importance of a number of singling molecules acting in the cell wall space for the intercellular communication, including classic phytohormones and secretory peptides. Moreover, accumulating evidences reveal that cell wall properties and their modifying enzymes modulate hormone actions. In this review, we overview how behaviors of singling molecules and changes of cell wall properties are integrated for the shoot meristem regulation.

UFO: an Arabidopsis gene involved in both floral meristem and floral organ development.

Science.gov (United States)

Levin, J Z; Meyerowitz, E M

1995-05-01

We describe the role of the UNUSUAL FLORAL ORGANS (UFO) gene in Arabidopsis floral development based on a genetic and molecular characterization of the phenotypes of nine ufo alleles. UFO is required for the proper identity of the floral meristem and acts in three different aspects of the process that distinguishes flowers from shoots. UFO is involved in establishing the whorled pattern of floral organs, controlling the determinacy of the floral meristem, and activating the APETALA3 and PISTILLATA genes required for petal and stamen identity. In many respects, UFO acts in a manner similar to LEAFY, but the ufo mutant phenotype also suggests an additional role for UFO in defining boundaries within the floral primordia or controlling cell proliferation during floral organ growth. Finally, genetic interactions that prevent flower formation and lead to the generation of filamentous structures implicate UFO as a member of a new, large, and diverse class of genes in Arabidopsis necessary for flower formation.

Inhibition of tobacco mosaic virus replication in lateral roots is dependent on an activated meristem-derived signal.

Science.gov (United States)

Valentine, T A; Roberts, I M; Oparka, K J

2002-05-01

Viral invasion of the root system of Nicotiana benthamiana was studied noninvasively with a tobacco mosaic virus (TMV) vector expressing the green-fluorescent protein (GFP). Lateral root primordia, which developed from the pericycle of primary roots, became heavily infected as they emerged from the root cortex. However, following emergence, a progressive wave of viral inhibition occurred that originated in the lateral-root meristem and progressed towards its base. Excision of source and sink tissues suggested that the inhibition of virus replication was brought about by the basipetal movement of a root meristem signal. When infected plants were inoculated with tobacco rattle virus (TRV) expressing the red-fluorescent protein, DsRed, TRV entered the lateral roots and suppressed the host response, leading to a reestablishment of TMV infection in lateral roots. By infecting GFP-expressing transgenic plants with TMV carrying the complementary GFP sequence it was possible to silence the host GFP, leading to the complete loss of fluorescence in lateral roots. The data suggest that viral inhibition in lateral roots occurs by a gene-silencing-like mechanism that is dependent on the activation of a lateral-root meristem.

Elimination of PPV and PNRSV through thermotherapy and meristem-tip culture in nectarine.

Science.gov (United States)

Manganaris, G A; Economou, A S; Boubourakas, I N; Katis, N I

2003-10-01

The plum pox virus (PPV) and prunus necrotic ringspot virus (PNRSV) cause serious disease problems in stone-fruit trees. In this work, the possibility of obtaining plant material free from these viruses through thermotherapy and meristem-tip culture from infected nectarine shoots (Prunus persica var. nectarina Max, cv. 'Arm King') was studied. In addition, the detection of these viruses in in vitro cultures and young acclimatized plantlets with double antibody sandwich-enzyme-linked immunosorbent assay (DAS-ELISA) and multiplex reverse transcriptase-polymerase chain reaction (RT-PCR) was studied. Meristem-tip explants (0.8-1.3 mm) derived from sprouted buds of winter wood and spring shoots from field grown plants had a 2-5% regeneration response. However, application of thermotherapy to potted nectarine trees (3 weeks at a maximum temperature of 35 degrees C) facilitated excision of longer meristem tips (1.3-2.0 mm) that resulted in a significantly higher regeneration response (38%) in woody plant medium (WPM) without plant growth regulators. Such explants formed multiple shoots with the addition of 8 microM benzylaminopurine and 0.8 microM indoleacetic acid. When they were tested for the presence of PPV and PNRSV, 86% and 81% were found to be virus-free as detected by DAS-ELISA and multiplex RT-PCR, respectively. Individual shoots excised from virus-free cultures readily rooted in vitro (half-strength WPM plus 2 microM indolebutyric acid) and grew to plantlets. The combination of an efficient protocol for virus elimination and the establishment of highly sensitive diagnostics resulted in the production of nectarine plants free from PPV and PNRSV.

Agave tequilana MADS genes show novel expression patterns in meristems, developing bulbils and floral organs.

Science.gov (United States)

Delgado Sandoval, Silvia del Carmen; Abraham Juárez, María Jazmín; Simpson, June

2012-03-01

Agave tequilana is a monocarpic perennial species that flowers after 5-8 years of vegetative growth signaling the end of the plant's life cycle. When fertilization is unsuccessful, vegetative bulbils are induced on the umbels of the inflorescence near the bracteoles from newly formed meristems. Although the regulation of inflorescence and flower development has been described in detail for monocarpic annuals and polycarpic species, little is known at the molecular level for these processes in monocarpic perennials, and few studies have been carried out on bulbils. Histological samples revealed the early induction of umbel meristems soon after the initiation of the vegetative to inflorescence transition in A. tequilana. To identify candidate genes involved in the regulation of floral induction, a search for MADS-box transcription factor ESTs was conducted using an A. tequilana transcriptome database. Seven different MIKC MADS genes classified into 6 different types were identified based on previously characterized A. thaliana and O. sativa MADS genes and sequences from non-grass monocotyledons. Quantitative real-time PCR analysis of the seven candidate MADS genes in vegetative, inflorescence, bulbil and floral tissues uncovered novel patterns of expression for some of the genes in comparison with orthologous genes characterized in other species. In situ hybridization studies using two different genes showed expression in specific tissues of vegetative meristems and floral buds. Distinct MADS gene regulatory patterns in A. tequilana may be related to the specific reproductive strategies employed by this species.

Alteration of plant meristem function by manipulation of the Retinoblastoma-like plant RRB gene

Science.gov (United States)

Durfee, Tim [Madison, WI; Feiler, Heidi [Albany, CA; Gruissem, Wilhelm [Forch, CH; Jenkins, Susan [Martinez, CA; Roe, Judith [Manhattan, KS; Zambryski, Patricia [Berkeley, CA

2007-01-16

This invention provides methods and compositions for altering the growth, organization, and differentiation of plant tissues. The invention is based on the discovery that, in plants, genetically altering the levels of Retinoblastoma-related gene (RRB) activity produces dramatic effects on the growth, proliferation, organization, and differentiation of plant meristem.

Nitrate modulates stem cell dynamics in Arabidopsis shoot meristems through cytokinins

OpenAIRE

Jonsson, Sten Henrik; Meyerowitz,; Landrein, Benoit Pierre; Formosa-Jordan,; Malivert,; Schuster, C; Melnyk, CW; Yang, W; Turnbull,; Locke, James Charles

2018-01-01

The shoot apical meristem (SAM) is responsible for the generation of all of the aerial parts of plants. Given its critical role, dynamical changes in SAM activity should play a central role in the adaptation of plant architecture to the environment. Using quantitative microscopy, grafting experiments and genetic perturbations, we connect the plant environment to the SAM, by describing the molecular mechanism by which cytokinins signal the level of nutrient availability to the SAM. We show tha...

Analysis of the Arabidopsis superman allelic series and the interactions with other genes demonstrate developmental robustness and joint specification of male-female boundary, flower meristem termination and carpel compartmentalization.

Science.gov (United States)

Breuil-Broyer, Stéphanie; Trehin, Christophe; Morel, Patrice; Boltz, Véronique; Sun, Bo; Chambrier, Pierre; Ito, Toshiro; Negrutiu, Ioan

2016-04-01

SUPERMAN is a cadastral gene controlling the sexual boundary in the flower. The gene's functions and role in flower development and evolution have remained elusive. The analysis of a contrasting SUP allelic series (for which the names superman, superwoman and supersex have been coined) makes it possible to distinguish early vs. late regulatory processes at the flower meristem centre to which SUP is an important contributor. Their understanding is essential in further addressing evolutionary questions linking bisexuality and flower meristem homeostasis. Inter-allelic comparisons were carried out and SUP interactions with other boundary factors and flower meristem patterning and homeostasis regulators (such as CLV, WUS, PAN, CUC, KNU, AG, AP3/PI, CRC and SPT) have been evaluated at genetic, molecular, morphological and histological levels. Early SUP functions include mechanisms of male-female (sexual) boundary specification, flower mersitem termination and control of stamen number. A SUP-dependent flower meristem termination pathway is identified and analysed. Late SUP functions play a role in organ morphogenesis by controlling intra-whorl organ separation and carpel medial region formation. By integrating early and late SUP functions, and by analyzing in one single experiment a series of SUP genetic interactions, the concept of meristematic 'transference' (cascade) - a regulatory bridging process redundantly and sequentially co-ordinating the triggering and completion of flower meristem termination, and carpel margin meristem and placenta patterning - is proposed. Taken together, the results strongly support the view that SUP(-type) function(s) have been instrumental in resolving male/female gradients into sharp male and female identities (whorls, organs) and in enforcing flower homeostasis during evolution. This has probably been achieved by incorporating the meristem patterning system of the floral axis into the female/carpel programme. © The Author 2016

CYCP2;1 integrates genetic and nutritional information to promote meristem cell division in Arabidopsis

Czech Academy of Sciences Publication Activity Database

Peng, L.; Skylar, A.; Chang, P.L.; Bišová, Kateřina; Wu, X.

2014-01-01

Roč. 393, č. 2 (2014), s. 160-170 ISSN 0012-1606 R&D Projects: GA AV ČR M200201205 Grant - others:NSF(US) MCB-1122213 Institutional support: RVO:61388971 Keywords : cell cycle * arabidopsis * meristem Subject RIV: EE - Microbiology, Virology Impact factor: 3.547, year: 2014

Effect of the gamma radiation in the metabolic activity of the apical meristem of asparagus (Asparagus officinalis)

International Nuclear Information System (INIS)

Sanchez E, A.; Orozco A, J.A.; Troncoso R, R.; Ojeda C, A.J.; Mercado R, J.N.; Gardea B, A.; Tiznado H, M.E.; Melendrez A, R.

2007-01-01

The asparagus (Asparagus officinalis) is an agricultural product whose production generates a great quantity of wages as well as foreign currencies for the country because a great part of its production is exported to international markets. In direct reason to the high metabolic activity of the apical meristem, this product it possesses a short shelf life under good conditions of commercialization. Due to the above mentioned, the present work had as objective to evaluate the effect of the gamma radiation in the metabolic activity of the apical meristem of turions of asparagus during the postharvest. Turions of asparagus variety Brock of standard quality was treated with gamma radiation to absorbed dose of 1.0, 1.5, 2.0, 2.5 and 3.0 kGy using an irradiator of 60 Co and stored in one controlled temperature camera maintained at 2 C during 8 days. During the experiment, the camera stayed in darkness and under conditions of high relative humidity by means of the water aspersion. Immediately before the one treatment and after 1, 2, 4 and 8 days of storage, the asparagus were sampled to evaluate the breathing speed (VRCG) by means of gas chromatography and scanning differential calorimetry (VRCDB), ethylene production (PE) by means of gas chromatography and production of metabolic heat of the apical meristem of the asparagus by means of scanning differential calorimetry (Q). Its were not found effects due to the gamma radiation in the variables of VRCG, VRCDB and Q. However, for the PE case, it was found that the doses of 1.5 and 2.5 reduced the PE from the first day of storage, while the 3 kGy dose achievement to eliminate completely the ethylene production from the first day of storage. It was concluded that the gamma radiation at the used levels in the present experiment doesn't reduce the metabolic activity of the apical meristem of the turion of asparagus although it can to improve the postharvest quality from the asparagus when reducing the ethylene production

Reactivation of meristem activity and sprout growth in potato tubers require both cytokinin and gibberellin.

Science.gov (United States)

Hartmann, Anja; Senning, Melanie; Hedden, Peter; Sonnewald, Uwe; Sonnewald, Sophia

2011-02-01

Reactivation of dormant meristems is of central importance for plant fitness and survival. Due to their large meristem size, potato (Solanum tuberosum) tubers serve as a model system to study the underlying molecular processes. The phytohormones cytokinins (CK) and gibberellins (GA) play important roles in releasing potato tuber dormancy and promoting sprouting, but their mode of action in these processes is still obscure. Here, we established an in vitro assay using excised tuber buds to study the dormancy-releasing capacity of GA and CK and show that application of gibberellic acid (GA(3)) is sufficient to induce sprouting. In contrast, treatment with 6-benzylaminopurine induced bud break but did not support further sprout growth unless GA(3) was administered additionally. Transgenic potato plants expressing Arabidopsis (Arabidopsis thaliana) GA 20-oxidase or GA 2-oxidase to modify endogenous GA levels showed the expected phenotypical changes as well as slight effects on tuber sprouting. The isopentenyltransferase (IPT) from Agrobacterium tumefaciens and the Arabidopsis cytokinin oxidase/dehydrogenase1 (CKX) were exploited to modify the amounts of CK in transgenic potato plants. IPT expression promoted earlier sprouting in vitro. Strikingly, CKX-expressing tubers exhibited a prolonged dormancy period and did not respond to GA(3). This supports an essential role of CK in terminating tuber dormancy and indicates that GA is not sufficient to break dormancy in the absence of CK. GA(3)-treated wild-type and CKX-expressing tuber buds were subjected to a transcriptome analysis that revealed transcriptional changes in several functional groups, including cell wall metabolism, cell cycle, and auxin and ethylene signaling, denoting events associated with the reactivation of dormant meristems.

Domestication-driven Gossypium profilin 1 (GhPRF1) gene transduces early flowering phenotype in tobacco by spatial alteration of apical/floral-meristem related gene expression.

Science.gov (United States)

Pandey, Dhananjay K; Chaudhary, Bhupendra

2016-05-13

Plant profilin genes encode core cell-wall structural proteins and are evidenced for their up-regulation under cotton domestication. Notwithstanding striking discoveries in the genetics of cell-wall organization in plants, little is explicit about the manner in which profilin-mediated molecular interplay and corresponding networks are altered, especially during cellular signalling of apical meristem determinacy and flower development. Here we show that the ectopic expression of GhPRF1 gene in tobacco resulted in the hyperactivation of apical meristem and early flowering phenotype with increased flower number in comparison to the control plants. Spatial expression alteration in CLV1, a key meristem-determinacy gene, is induced by the GhPRF1 overexpression in a WUS-dependent manner and mediates cell signalling to promote flowering. But no such expression alterations are recorded in the GhPRF1-RNAi lines. The GhPRF1 transduces key positive flowering regulator AP1 gene via coordinated expression of FT4, SOC1, FLC1 and FT1 genes involved in the apical-to-floral meristem signalling cascade which is consistent with our in silico profilin interaction data. Remarkably, these positive and negative flowering regulators are spatially controlled by the Actin-Related Protein (ARP) genes, specifically ARP4 and ARP6 in proximate association with profilins. This study provides a novel and systematic link between GhPRF1 gene expression and the flower primordium initiation via up-regulation of the ARP genes, and an insight into the functional characterization of GhPRF1 gene acting upstream to the flowering mechanism. Also, the transgenic plants expressing GhPRF1 gene show an increase in the plant height, internode length, leaf size and plant vigor. Overexpression of GhPRF1 gene induced early and increased flowering in tobacco with enhanced plant vigor. During apical meristem determinacy and flower development, the GhPRF1 gene directly influences key flowering regulators through ARP

The CUP-SHAPED COTYLEDON3 gene is required for boundary and shoot meristem formation in Arabidopsis

DEFF Research Database (Denmark)

Vroemen, Casper W; Mordhorst, Andreas P; Albrecht, Cathy

2003-01-01

From an enhancer trap screen for genes expressed in Arabidopsis embryos, we identified a gene expressed from the octant stage onward in the boundary between the two presumptive cotyledons and in a variety of postembryonic organ and meristem boundaries. This gene, CUP-SHAPED COTYLEDON3 (CUC3...

Meristem Plant Cells as a Sustainable Source of Redox Actives for Skin Rejuvenation

Science.gov (United States)

Korkina, Liudmila G.; Mayer, Wolfgang; de Luca, Chiara

2017-01-01

Recently, aggressive advertisement claimed a “magic role” for plant stem cells in human skin rejuvenation. This review aims to shed light on the scientific background suggesting feasibility of using plant cells as a basis of anti-age cosmetics. When meristem cell cultures obtained from medicinal plants are exposed to appropriate elicitors/stressors (ultraviolet, ultrasound ultraviolet (UV), ultrasonic waves, microbial/insect metabolites, heavy metals, organic toxins, nutrient deprivation, etc.), a protective/adaptive response initiates the biosynthesis of secondary metabolites. Highly bioavailable and biocompatible to human cells, low-molecular weight plant secondary metabolites share structural/functional similarities with human non-protein regulatory hormones, neurotransmitters, pigments, polyamines, amino-/fatty acids. Their redox-regulated biosynthesis triggers in turn plant cell antioxidant and detoxification molecular mechanisms resembling human cell pathways. Easily isolated in relatively large quantities from contaminant-free cell cultures, plant metabolites target skin ageing mechanisms, above all redox imbalance. Perfect modulators of cutaneous oxidative state via direct/indirect antioxidant action, free radical scavenging, UV protection, and transition-metal chelation, they are ideal candidates to restore photochemical/redox/immune/metabolic barriers, gradually deteriorating in the ageing skin. The industrial production of plant meristem cell metabolites is toxicologically and ecologically sustainable for fully “biological” anti-age cosmetics. PMID:28498360

Effects of N6-benzylaminopurine and Indole Acetic Acid on In Vitro Shoot Multiplication, Nodule-like Meristem Proliferation and Plant Regeneration of Malaysian Bananas (Musa spp.)

Science.gov (United States)

Sipen, Philip; Davey, Michael R

2012-01-01

Different concentrations of N6-benzylaminopurine (BAP) and indole acetic acid (IAA) in Murashige and Skoog based medium were assessed for their effects on shoot multiplication, nodule-like meristem proliferation and plant regeneration of the Malaysian banana cultivars Pisang Mas, Pisang Nangka, Pisang Berangan and Pisang Awak. BAP at 1–14 mg L−1 with or without 0.2 mg L−1 IAA, or BAP at 7–14 mg L−1 with the same concentration of IAA, was evaluated for shoot multiplication from shoot tips and the proliferation of nodule-like meristems from scalps, respectively. Plant regeneration from scalps was assessed using 1 mg L−1 BAP and 0.2 mg L−1 IAA separately, or a combination of these two growth regulators. Data on shoot multiplication, the proliferation of nodule-like meristems with associated plant regeneration were recorded after 30 days of culture. A maximum of 5 shoots per original shoot tip was achieved on medium supplemented with BAP at 5 mg L−1 (Pisang Nangka), 6 mg L−1 (Pisang Mas and Pisang Berangan), or 7 mg L−1 (Pisang Awak), with 0.2 mg L−1 IAA. BAP at 11 mg L−1 with 0.2 mg L−1 IAA induced the most highly proliferating nodule-like meristems in the four banana cultivars. Plant regeneration from scalps was optimum in all cases on medium containing 1 mg L−1 BAP and 0.2 mg L−1 IAA. This is the first report on the successful induction of highly proliferating nodule-like meristems and plant regeneration from scalps of the Malaysian banana cultivars Pisang Mas, Pisang Nangka, Pisang Berangan and Pisang Awak. PMID:24575235

Autoradiographic study of gamma-ray induced unscheduled DNA synthesis in bean root meristem cells

International Nuclear Information System (INIS)

Liu Zhenshen; Qiu Quanfa; Chen Dongli

1989-01-01

The gamma-ray induced unscheduled DNA synthesis in root meristem cells of Vica faba was studied autoradiographically by calculating the number of cells with different 3H-thymidine labelling degree. It was found that the level of unscheduled synthesis in cells with intermediate dose (500 R) irradiation was higher than that in cells with lower dose (250 R) irradiation; however, higher dose (1000 R) irradiation would inhibit the reparative replication

A plant U-box protein, PUB4, regulates asymmetric cell division and cell proliferation in the root meristem

NARCIS (Netherlands)

Kinoshita, A.; Hove, ten C.A.; Tabata, R.; Yamada, M.; Shimizu, N.; Ishida, T.; Yamaguchi, K.; Shigenobu, S.; Takebayashi, Y.; Luchies, J.; Kobayashi, M.; Kurata, T.; Wada, T.; Seo, M.; Hasebe, M.; Blilou, I.; Fukuda, H.; Scheres, B.; Heidstra, R.; Kamiya, Y.; Sawa, S.

2015-01-01

The root meristem (RM) is a fundamental structure that is responsible for postembryonic root growth. The RM contains the quiescent center (QC), stem cells and frequently dividing meristematic cells, in which the timing and the frequency of cell division are tightly regulated. In Arabidopsis

Arabidopsis BLADE-ON-PETIOLE1 and 2 promote floral meristem fate and determinacy in a previously undefined pathway targeting APETALA1 and AGAMOUS-LIKE24.

Science.gov (United States)

Xu, Mingli; Hu, Tieqiang; McKim, Sarah M; Murmu, Jhadeswar; Haughn, George W; Hepworth, Shelley R

2010-09-01

The transition to flowering is a tightly controlled developmental decision in plants. In Arabidopsis, LEAFY (LFY) and APETALA1 (AP1) are key regulators of this transition and expression of these genes in primordia produced by the inflorescence meristem confers floral fate. Here, we examine the role of architectural regulators BLADE-ON-PETIOLE1 (BOP1) and BOP2 in promotion of floral meristem identity. Loss-of-function bop1 bop2 mutants show subtle defects in inflorescence and floral architecture but in combination with lfy or ap1, synergistic defects in floral meristem fate and determinacy are revealed. The most dramatic changes occur in bop1 bop2 ap1-1 triple mutants where flowers are converted into highly branched inflorescence-like shoots. Our data show that BOP1/2 function distinctly from LFY to upregulate AP1 in floral primordia and that all three activities converge to down-regulate flowering-time regulators including AGAMOUS-LIKE24 in stage 2 floral meristems. Subsequently, BOP1/2 promote A-class floral-organ patterning in parallel with LFY and AP1. Genetic and biochemical evidence support the model that BOP1/2 are recruited to the promoter of AP1 through direct interactions with TGA bZIP transcription factors, including PERIANTHIA. These data reveal an important supporting role for BOP1/2 in remodeling shoot architecture during the floral transition. © 2010 The Authors. Journal compilation © 2010 Blackwell Publishing Ltd.

A dynamic genetic-hormonal regulatory network model explains multiple cellular behaviors of the root apical meristem of Arabidopsis thaliana.

Science.gov (United States)

García-Gómez, Mónica L; Azpeitia, Eugenio; Álvarez-Buylla, Elena R

2017-04-01

The study of the concerted action of hormones and transcription factors is fundamental to understand cell differentiation and pattern formation during organ development. The root apical meristem of Arabidopsis thaliana is a useful model to address this. It has a stem cell niche near its tip conformed of a quiescent organizer and stem or initial cells around it, then a proliferation domain followed by a transition domain, where cells diminish division rate before transiting to the elongation zone; here, cells grow anisotropically prior to their final differentiation towards the plant base. A minimal model of the gene regulatory network that underlies cell-fate specification and patterning at the root stem cell niche was proposed before. In this study, we update and couple such network with both the auxin and cytokinin hormone signaling pathways to address how they collectively give rise to attractors that correspond to the genetic and hormonal activity profiles that are characteristic of different cell types along A. thaliana root apical meristem. We used a Boolean model of the genetic-hormonal regulatory network to integrate known and predicted regulatory interactions into alternative models. Our analyses show that, after adding some putative missing interactions, the model includes the necessary and sufficient components and regulatory interactions to recover attractors characteristic of the root cell types, including the auxin and cytokinin activity profiles that correlate with different cellular behaviors along the root apical meristem. Furthermore, the model predicts the existence of activity configurations that could correspond to the transition domain. The model also provides a possible explanation for apparently paradoxical cellular behaviors in the root meristem. For example, how auxin may induce and at the same time inhibit WOX5 expression. According to the model proposed here the hormonal regulation of WOX5 might depend on the cell type. Our results

A dynamic genetic-hormonal regulatory network model explains multiple cellular behaviors of the root apical meristem of Arabidopsis thaliana.

Directory of Open Access Journals (Sweden)

Mónica L García-Gómez

2017-04-01

Full Text Available The study of the concerted action of hormones and transcription factors is fundamental to understand cell differentiation and pattern formation during organ development. The root apical meristem of Arabidopsis thaliana is a useful model to address this. It has a stem cell niche near its tip conformed of a quiescent organizer and stem or initial cells around it, then a proliferation domain followed by a transition domain, where cells diminish division rate before transiting to the elongation zone; here, cells grow anisotropically prior to their final differentiation towards the plant base. A minimal model of the gene regulatory network that underlies cell-fate specification and patterning at the root stem cell niche was proposed before. In this study, we update and couple such network with both the auxin and cytokinin hormone signaling pathways to address how they collectively give rise to attractors that correspond to the genetic and hormonal activity profiles that are characteristic of different cell types along A. thaliana root apical meristem. We used a Boolean model of the genetic-hormonal regulatory network to integrate known and predicted regulatory interactions into alternative models. Our analyses show that, after adding some putative missing interactions, the model includes the necessary and sufficient components and regulatory interactions to recover attractors characteristic of the root cell types, including the auxin and cytokinin activity profiles that correlate with different cellular behaviors along the root apical meristem. Furthermore, the model predicts the existence of activity configurations that could correspond to the transition domain. The model also provides a possible explanation for apparently paradoxical cellular behaviors in the root meristem. For example, how auxin may induce and at the same time inhibit WOX5 expression. According to the model proposed here the hormonal regulation of WOX5 might depend on the cell

N-MYC down-regulated-like proteins regulate meristem initiation by modulating auxin transport and MAX2 expression.

Science.gov (United States)

Mudgil, Yashwanti; Ghawana, Sanjay; Jones, Alan M

2013-01-01

N-MYC down-regulated-like (NDL) proteins interact with the Gβ subunit (AGB1) of the heterotrimeric G protein complex and play an important role in AGB1-dependent regulation of lateral root formation by affecting root auxin transport, auxin gradients and the steady-state levels of mRNA encoding the PIN-FORMED 2 and AUXIN 1 auxin transport facilitators. Auxin transport in aerial tissue follows different paths and utilizes different transporters than in roots; therefore, in the present study, we analyzed whether NDL proteins play an important role in AGB1-dependent, auxin-mediated meristem development. Expression levels of NDL gene family members need to be tightly regulated, and altered expression (both over-expression and down-regulation) confers ectopic growth. Over-expression of NDL1 disrupts vegetative and reproductive organ development. Reduced expression of the NDL gene family members results in asymmetric leaf emergence, twinning of rosette leaves, defects in leaf formation, and abnormal silique distribution. Reduced expression of the NDL genes in the agb1-2 (null allele) mutant rescues some of the abnormal phenotypes, such as silique morphology, silique distribution, and peduncle angle, suggesting that proper levels of NDL proteins are maintained by AGB1. We found that all of these abnormal aerial phenotypes due to altered NDL expression were associated with increases in basipetal auxin transport, altered auxin maxima and altered MAX2 expression within the inflorescence stem. NDL proteins, together with AGB1, act as positive regulators of meristem initiation and branching. AGB1 and NDL1 positively regulate basipetal inflorescence auxin transport and modulate MAX2 expression in shoots, which in turn regulates organ and lateral meristem formation by the establishment and maintenance of auxin gradients.

N-MYC down-regulated-like proteins regulate meristem initiation by modulating auxin transport and MAX2 expression.

Directory of Open Access Journals (Sweden)

Yashwanti Mudgil

Full Text Available N-MYC down-regulated-like (NDL proteins interact with the Gβ subunit (AGB1 of the heterotrimeric G protein complex and play an important role in AGB1-dependent regulation of lateral root formation by affecting root auxin transport, auxin gradients and the steady-state levels of mRNA encoding the PIN-FORMED 2 and AUXIN 1 auxin transport facilitators. Auxin transport in aerial tissue follows different paths and utilizes different transporters than in roots; therefore, in the present study, we analyzed whether NDL proteins play an important role in AGB1-dependent, auxin-mediated meristem development.Expression levels of NDL gene family members need to be tightly regulated, and altered expression (both over-expression and down-regulation confers ectopic growth. Over-expression of NDL1 disrupts vegetative and reproductive organ development. Reduced expression of the NDL gene family members results in asymmetric leaf emergence, twinning of rosette leaves, defects in leaf formation, and abnormal silique distribution. Reduced expression of the NDL genes in the agb1-2 (null allele mutant rescues some of the abnormal phenotypes, such as silique morphology, silique distribution, and peduncle angle, suggesting that proper levels of NDL proteins are maintained by AGB1. We found that all of these abnormal aerial phenotypes due to altered NDL expression were associated with increases in basipetal auxin transport, altered auxin maxima and altered MAX2 expression within the inflorescence stem.NDL proteins, together with AGB1, act as positive regulators of meristem initiation and branching. AGB1 and NDL1 positively regulate basipetal inflorescence auxin transport and modulate MAX2 expression in shoots, which in turn regulates organ and lateral meristem formation by the establishment and maintenance of auxin gradients.

Optimized Whole-Mount In Situ Immunolocalization for Arabidopsis thaliana Root Meristems and Lateral Root Primordia.

Science.gov (United States)

Karampelias, Michael; Tejos, Ricardo; Friml, Jiří; Vanneste, Steffen

2018-01-01

Immunolocalization is a valuable tool for cell biology research that allows to rapidly determine the localization and expression levels of endogenous proteins. In plants, whole-mount in situ immunolocalization remains a challenging method, especially in tissues protected by waxy layers and complex cell wall carbohydrates. Here, we present a robust method for whole-mount in situ immunolocalization in primary root meristems and lateral root primordia in Arabidopsis thaliana. For good epitope preservation, fixation is done in an alkaline paraformaldehyde/glutaraldehyde mixture. This fixative is suitable for detecting a wide range of proteins, including integral transmembrane proteins and proteins peripherally attached to the plasma membrane. From initiation until emergence from the primary root, lateral root primordia are surrounded by several layers of differentiated tissues with a complex cell wall composition that interferes with the efficient penetration of all buffers. Therefore, immunolocalization in early lateral root primordia requires a modified method, including a strong solvent treatment for removal of hydrophobic barriers and a specific cocktail of cell wall-degrading enzymes. The presented method allows for easy, reliable, and high-quality in situ detection of the subcellular localization of endogenous proteins in primary and lateral root meristems without the need of time-consuming crosses or making translational fusions to fluorescent proteins.

Synchronisms and correlations of spring phenology between apical and lateral meristems in two boreal conifers.

Science.gov (United States)

Antonucci, Serena; Rossi, Sergio; Deslauriers, Annie; Lombardi, Fabio; Marchetti, Marco; Tognetti, Roberto

2015-10-01

Phenological synchronisms between apical and lateral meristems could clarify some aspects related to the physiological relationships among the different organs of trees. This study correlated the phenological phases of bud development and xylem differentiation during spring 2010-14 in balsam fir (Abies balsamea Mill.) and black spruce [(Picea mariana Mill. (BSP)] of the Monts-Valin National Park (Quebec, Canada) by testing the hypothesis that bud development occurs after the reactivation of xylem growth. From May to September, we conducted weekly monitoring of xylem differentiation using microcores and bud development with direct observations on terminal branches. Synchronism between the beginning of bud development and xylem differentiation was found in both species with significant correlations between the phases of bud and xylem phenology. Degree-day sum was more appropriate in assessing the date of bud growth resumption, while thermal thresholds were more suitable for cambium phenology. Our results provide new knowledge on the dynamics of spring phenology and novel information on the synchronisms between two meristems in coniferous trees. The study demonstrates the importance of precisely defining the phases of bud development in order to correctly analyse the relationships with xylem phenology. © The Author 2015. Published by Oxford University Press. All rights reserved. For Permissions, please email: journals.permissions@oup.com.

Molecular cloning, phylogenetic analysis, and expression patterns of LATERAL SUPPRESSOR-LIKE and REGULATOR OF AXILLARY MERISTEM FORMATION-LIKE genes in sunflower (Helianthus annuus L.).

Science.gov (United States)

Fambrini, Marco; Salvini, Mariangela; Pugliesi, Claudio

2017-03-01

The wild sunflower (Helianthus annuus) plants develop a highly branched form with numerous small flowering heads. The origin of a no branched sunflower, producing a single large head, has been a key event in the domestication process of this species. The interaction between hormonal factors and several genes organizes the initiation and outgrowth of axillary meristems (AMs). From sunflower, we have isolated two genes putatively involved in this process, LATERAL SUPPRESSOR (LS)-LIKE (Ha-LSL) and REGULATOR OF AXILLARY MERISTEM FORMATION (ROX)-LIKE (Ha-ROXL), encoding for a GRAS and a bHLH transcription factor (TF), respectively. Typical amino acid residues and phylogenetic analyses suggest that Ha-LSL and Ha-ROXL are the orthologs of the branching regulator LS and ROX/LAX1, involved in the growth habit of both dicot and monocot species. qRT-PCR analyses revealed a high accumulation of Ha-LSL transcripts in roots, vegetative shoots, and inflorescence shoots. By contrast, in internodal stems and young leaves, a lower amount of Ha-LSL transcripts was observed. A comparison of transcription patterns between Ha-LSL and Ha-ROXL revealed some analogies but also remarkable differences; in fact, the gene Ha-ROXL displayed a low expression level in all organs analyzed. In situ hybridization (ISH) analysis showed that Ha-ROXL transcription was strongly restricted to a small domain within the boundary zone separating the shoot apical meristem (SAM) and the leaf primordia and in restricted regions of the inflorescence meristem, beforehand the separation of floral bracts from disc flower primordia. These results suggested that Ha-ROXL may be involved to establish a cell niche for the initiation of AMs as well as flower primordia. The accumulation of Ha-LSL transcripts was not restricted to the boundary zones in vegetative and inflorescence shoots, but the mRNA activity was expanded in other cellular domains of primary shoot apical meristem as well as AMs. In addition, Ha

Repression of Lateral Organ Boundary Genes by PENNYWISE and POUND-FOOLISH Is Essential for Meristem Maintenance and Flowering in Arabidopsis.

Science.gov (United States)

Khan, Madiha; Ragni, Laura; Tabb, Paul; Salasini, Brenda C; Chatfield, Steven; Datla, Raju; Lock, John; Kuai, Xiahezi; Després, Charles; Proveniers, Marcel; Yongguo, Cao; Xiang, Daoquan; Morin, Halima; Rullière, Jean-Pierre; Citerne, Sylvie; Hepworth, Shelley R; Pautot, Véronique

2015-11-01

In the model plant Arabidopsis (Arabidopsis thaliana), endogenous and environmental signals acting on the shoot apical meristem cause acquisition of inflorescence meristem fate. This results in changed patterns of aerial development seen as the transition from making leaves to the production of flowers separated by elongated internodes. Two related BEL1-like homeobox genes, PENNYWISE (PNY) and POUND-FOOLISH (PNF), fulfill this transition. Loss of function of these genes impairs stem cell maintenance and blocks internode elongation and flowering. We show here that pny pnf apices misexpress lateral organ boundary genes BLADE-ON-PETIOLE1/2 (BOP1/2) and KNOTTED-LIKE FROM ARABIDOPSIS THALIANA6 (KNAT6) together with ARABIDOPSIS THALIANA HOMEOBOX GENE1 (ATH1). Inactivation of genes in this module fully rescues pny pnf defects. We further show that BOP1 directly activates ATH1, whereas activation of KNAT6 is indirect. The pny pnf restoration correlates with renewed accumulation of transcripts conferring floral meristem identity, including FD, SQUAMOSA PROMOTER-BINDING PROTEIN LIKE genes, LEAFY, and APETALA1. To gain insight into how this module blocks flowering, we analyzed the transcriptome of BOP1-overexpressing plants. Our data suggest a central role for the microRNA156-SQUAMOSA PROMOTER BINDING PROTEIN-LIKE-microRNA172 module in integrating stress signals conferred in part by promotion of jasmonic acid biosynthesis. These data reveal a potential mechanism by which repression of lateral organ boundary genes by PNY-PNF is essential for flowering. © 2015 American Society of Plant Biologists. All Rights Reserved.

Analysis of Transcriptional Responses of the Inflorescence Meristems in Jatropha curcas Following Gibberellin Treatment

Directory of Open Access Journals (Sweden)

Wen-Kai Hui

2018-02-01

Full Text Available Jatropha curcas L. seeds an oilseed plant with great potential for biodiesel production. However, low seed yield, which was limited by its lower female flowers, was a major drawback for its utilization. Our previous study found that the flower number and female-to-male ratio were increased by gibberellin treatment. Here, we compared the transcriptomic profiles of inflorescence meristem at different time points after gibberellic acid A3 (GA3 treatment. The present study showed that 951 differentially expressed genes were obtained in response to gibberellin treatment, compared with control samples. The 6-h time point was an important phase in the response to exogenous gibberellin. Furthermore, the plant endogenous gibberellin, auxin, ethylene, abscisic acid, and brassinolide-signaling transduction pathways were repressed, whereas the genes associated with cytokinin and jasmonic acid signaling were upregulated for 24-h time point following GA3 treatment. In addition, the floral meristem determinacy genes (JcLFY, JcSOC1 and floral organ identity genes (JcAP3, JcPI, JcSEP1-3 were significantly upregulated, but their negative regulator (JcSVP was downregulated after GA3 treatment. Moreover, the effects of phytohormone, which was induced by exogenous plant growth regulator, mainly acted on the female floral differentiation process. To the best of our knowledge, this data is the first comprehensive analysis of the underlying transcriptional response mechanism of floral differentiation following GA3 treatment in J. curcas, which helps in engineering high-yielding varieties of Jatropha.

Redox Changes During the Cell Cycle in the Embryonic Root Meristem of Arabidopsis thaliana.

Science.gov (United States)

de Simone, Ambra; Hubbard, Rachel; de la Torre, Natanael Viñegra; Velappan, Yazhini; Wilson, Michael; Considine, Michael J; Soppe, Wim J J; Foyer, Christine H

2017-12-20

The aim of this study was to characterize redox changes in the nuclei and cytosol occurring during the mitotic cell cycle in the embryonic roots of germinating Arabidopsis seedlings, and to determine how redox cycling was modified in mutants with a decreased capacity for ascorbate synthesis. Using an in vivo reduction-oxidation (redox) reporter (roGFP2), we show that transient oxidation of the cytosol and the nuclei occurred at G1 in the synchronized dividing cells of the Arabidopsis root apical meristem, with reduction at G2 and mitosis. This redox cycle was absent from low ascorbate mutants in which nuclei were significantly more oxidized than controls. The cell cycle-dependent increase in nuclear size was impaired in the ascorbate-deficient mutants, which had fewer cells per unit area in the root proliferation zone. The transcript profile of the dry seeds and size of the imbibed seeds was strongly influenced by low ascorbate but germination, dormancy release and seed aging characteristics were unaffected. These data demonstrate the presence of a redox cycle within the plant cell cycle and that the redox state of the nuclei is an important factor in cell cycle progression. Controlled oxidation is a key feature of the early stages of the plant cell cycle. However, sustained mild oxidation restricts nuclear functions and impairs progression through the cell cycle leading to fewer cells in the root apical meristem. Antioxid. Redox Signal. 27, 1505-1519.

An auxin responsive CLE gene regulates shoot apical meristem development in Arabidopsis

Directory of Open Access Journals (Sweden)

Hongyan eGuo

2015-05-01

Full Text Available Plant hormone auxin regulates most, if not all aspects of plant growth and development, including lateral root formation, organ pattering, apical dominance and tropisms. Peptide hormones are peptides with hormone activities. Some of the functions of peptide hormones in regulating plant growth and development are similar to that of auxin, however, the relationship between auxin and peptide hormones remains largely unknown. Here we report the identification of OsCLE48, a rice (Oryza sativa CLE (CLAVATA3/ENDOSPERM SURROUNDING REGION gene, as an auxin response gene, and the functional characterization of OsCLE48 in Arabidopsis and rice. OsCLE48 encodes a CLE peptide hormone that is similar to Arabidopsis CLEs. RT-PCR analysis showed that OsCLE48 was induced by exogenously application of IAA (indole-3-acetic acid, a naturally occurred auxin. Expression of integrated OsCLE48p:GUS reporter gene in transgenic Arabidopsis plants was also induced by exogenously IAA treatment. These results indicate that OsCLE48 is an auxin responsive gene. Histochemical staining showed that GUS activity was detected in all the tissue and organs of the OsCLE48p:GUS transgenic Arabidopsis plants. Expression of OsCLE48 under the control of the 35S promoter in Arabidopsis inhibited shoot apical meristem development. Expression of OsCLE48 under the control of the CLV3 native regulatory elements almost completely complemented clv3-2 mutant phenotypes, suggesting that OsCLE48 is functionally similar to CLV3. On the other hand, expression of OsCLE48 under the control of the 35S promoter in Arabidopsis has little, if any effects on root apical meristem development, and transgenic rice plants overexpressing OsCLE48 are morphologically indistinguishable from wild type plants, suggesting that the functions of some CLE peptides may not be fully conserved in Arabidopsis and rice.

Investigation of protective effects of Erythrina velutina extract against MMS induced damages in the root meristem cells of Allium cepa

Directory of Open Access Journals (Sweden)

Deborah S. B. S. Silva

2013-04-01

Full Text Available Erythrina velutina Willd., Fabaceae, is a medicinal plant that can be found in the tropics and subtropics, including in the semi-arid northeastern Brazil. It is commonly used in folk medicine to treat anxiety, agitation and insomnia. E. velutina has been known to present analgesic, anti-inflammatory and antibacterial activities, however, it is unknown if this plant present a protective effect on DNA. We assessed the antigenotoxic effect of E. velutina against the genotoxic effects induced by MMS in the root meristem cells of Allium cepa. Three concentrations of the aqueous extract (100, 200 and 400 mg/L of this medicinal plant were used in three different types of treatment (pre-, post- and simultaneous. The effects of the extracts on the root meristem cells of A. cepa were analyzed at both macroscopic and microscopic levels. Protective effects were observed at higher concentrations in pre-treatment and in simultaneous treatment. The results suggest that E. velutina may present antigenotoxic properties and demonstrate its chemopreventive potential.

Depletion of cellular brassinolide decreases embryo production and disrupts the architecture of the apical meristems in Brassica napus microspore-derived embryos.

Science.gov (United States)

Belmonte, Mark; Elhiti, Mohamed; Waldner, Blaine; Stasolla, Claudio

2010-06-01

Exogenous applications of brassinolide (BL) increased the number and quality of microspore-derived embryos (MDEs) whereas treatments with brassinazole (BrZ), a BL biosynthetic inhibitor, had the opposite effect. At the optimal concentration (4x10(-6) M) BrZ decreased both embryo yield and conversion to less than half the value of control embryos. Metabolic studies revealed that BL levels had profound effects on glutathione and ascorbate metabolism by altering the amounts of their reduced forms (ASC and GSH) and oxidized forms [dehydroascorbate (DHA), ascorbate free radicals (AFRs), and GSSG]. Applications of BL switched the glutathione and ascorbate pools towards the oxidized forms, thereby lowering the ASC/ASC+DHA+AFR and GSH/GSH+GSSG ratios. These changes were ascribed to the ability of BL to increase the activity of ascorbate peroxidase (APX) and decrease that of glutathione reductase (GR). This trend was reversed in a BL-depleted environment, effected by BrZ applications. These metabolic alterations were associated with changes in embryo structure and performance. BL-treated MDEs developed zygotic-like shoot apical meristems (SAMs) whereas embryos treated with BrZ developed abnormal meristems. In the presence of BrZ, embryos either lacked a visible SAM, or formed SAMs in which the meristematic cells showed signs of differentiation, such as vacuolation and storage product accumulation. These abnormalities were accompanied by the lack or misexpression of three meristem marker genes isolated from Brassica napus (denoted as BnSTM, BnCLV1, and BnZLL-1) homologous to the Arabidopsis SHOOTMERISTEMLESS (STM), CLAVATA 1 (CLV1), and ZWILLE (ZLL). The expression of BnSTM and BnCLV1 increased after a few days in cultures in embryos treated with BL whereas an opposite tendency was observed with applications of BrZ. Compared with control embryos where these two genes exhibited abnormal localization patterns, BnSTM and BnCLV1 always localized throughout the subapical domains

Zastosowanie peptonu Peptobak-Bacutil tu hodowli merystematycznej tkanki Cymbidium Sw. [Application of the peptone Peptobak-Bacutil medium in the culture of meristem-tissue of Cymbidium Sw.

Directory of Open Access Journals (Sweden)

K. Kukułczanka

2015-06-01

Full Text Available In was found that peptone of Peptobak-Bacutil brand (produced in Poland fulfills perfectly the requirements in cultures in vitro of the meristem tissues of Cymbidium in the modified Tsuchiya's medium in a concentration of 2 g per 1. A decrease in the concentration to 1 g per 1. affects the growth intensity of the tissue, but an increase of concentration up to 3 g per 1. retards the transformation of protocorms into the plant-stage. Growth of the meristem tissue of Cymbidium in the medium consolidated with agar is weaker and the number of protocorms produced 2,3 times lower than in liquid media.

Meristem maintenance, auxin, jasmonic and abscisic acid pathways as a mechanism for phenotypic plasticity in Antirrhinum majus

Science.gov (United States)

Weiss, Julia; Alcantud-Rodriguez, Raquel; Toksöz, Tugba; Egea-Cortines, Marcos

2016-01-01

Plants grow under climatic changing conditions that cause modifications in vegetative and reproductive development. The degree of changes in organ development i.e. its phenotypic plasticity seems to be determined by the organ identity and the type of environmental cue. We used intraspecific competition and found that Antirrhinum majus behaves as a decoupled species for lateral organ size and number. Crowding causes decreases in leaf size and increased leaf number whereas floral size is robust and floral number is reduced. Genes involved in shoot apical meristem maintenance like ROA and HIRZ, cell cycle (CYCD3a; CYCD3b, HISTONE H4) or organ polarity (GRAM) were not significantly downregulated under crowding conditions. A transcriptomic analysis of inflorescence meristems showed Gene Ontology enriched pathways upregulated including Jasmonic and Abscisic acid synthesis and or signalling. Genes involved in auxin synthesis such as AmTAR2 and signalling AmANT were not affected by crowding. In contrast, AmJAZ1, AmMYB21, AmOPCL1 and AmABA2 were significantly upregulated. Our work provides a mechanistic working hypothesis where a robust SAM and stable auxin signalling enables a homogeneous floral size while changes in JA and ABA signalling maybe responsible for the decreased leaf size and floral number.

Cryopreservation of in vitro grown shoot tips and apical meristems of the forage legume Arachis pintoi.

Science.gov (United States)

Rey, Hebe Y; Faloci, Mirta; Medina, Ricardo; Dolce, Natalia; Mroginski, Luis; Engelmann, Florent

2009-01-01

A cryopreservation protocol using the encapsulation-dehydration procedure was established for shoot tips (2-3 mm in length) and meristems (0.3-0.5 mm) sampled from in vitro plantlets of diploid and triploid cytotypes of Arachis pintoi. The optimal protocol was the following: after dissection, explants were precultured for 24 h on establishment medium (EM), encapsulated in calcium alginate beads and pretreated in liquid EM medium with daily increasing sucrose concentration (0.5, 0.75, 1.0 M) and desiccated to 22-23 percent moisture content (fresh weight basis). Explants were frozen using slow cooling (1 C per min from 25C to -30C followed by direct immersion in liquid nitrogen), thawed rapidly and post-cultured in liquid EM medium enriched with daily decreasing sucrose concentrations (0.75, 0.50, 0.1 M). Explants were then transferred to solid EM medium in order to achieve shoot regeneration, then on Murashige and Skoog medium supplemented with 0.05 microM naphthalene acetic acid to induce rooting of shoots. With this procedure, 53 percent and 56 percent of cryopreserved shoot tips of the diploid and triploid cytotypes, respectively, survived and formed plants. However, only 16 percent of cryopreserved meristems of both cytotypes regenerated plants. Using ten isozyme systems and seven RAPD profiles, no modification induced by cryopreservation could be detected in plantlets regenerated from cryopreserved material.

Establecimiento y multiplicación in vitro de mora de castilla (Rubus glaucus Benth. variedad sin espinas, mediante ápices meristemáticos Stablishment and in vitro multiplication of thornless blackberry (Rubus glaucus Benth. by shoot apical meristems

Directory of Open Access Journals (Sweden)

Alina Katil Sigarroa-Rieche

2011-12-01

Full Text Available Se evaluó una técnica de micropropagación de plantas de mora (Rubus glaucus de la variedad sin espinas, a partir de ápices meristemáticos. En la fase de establecimiento se evaluó un protocolo de desinfección utilizando por 5 min solución de jabón detergente comercial y agua + alcohol 70% por 2 min + hipoclorito 3% con dos tiempos de exposición diferentes: T1 por 5 min y T2 por 10 min. Después de desinfectar las microestacas se extrajeron los ápices meristemáticos y se establecieron in vitro bajo un diseño completamente al azar para evaluar dos medios de cultivo: M1 y M2. A partir de las plántulas desarrolladas se efectuó la multiplicación en los medios de cultivo M1, M3 y M4. Ambos tratamientos de desinfección resultaron efectivos alcanzando 100% de desinfección de los explantes con cada uno de ellos. La siembra de ápices meristemáticos permitió el establecimiento de cultivos asépticos y un adecuado desarrollo de los explantes después de seis semanas de cultivo, con prendimiento de 83.4% para M1 y 66.6% para M2. El análisis de varianza (Anova y la prueba de rangos múltiples mostraron que la multiplicación fue mejor en el medio M1 con una mayor tasa de crecimiento y desarrollo del explante, al obtener coeficientes de multiplicación de 7.5 brotes/plántula y una altura promedio de 1.95 cm.We evaluated a technique of micropropagation in a thornless variety of blackberry (Rubus glaucus from shoot apical meristems. In the establishment phase, we evaluated a disinfection protocol: soapy solution (commercial detergent and water for 5 minutes + 70% alcohol for 2 minutes + 3% hypochlorite with two different exposure times: T1 for 5 minutes and T2 for 10 minutes. When the microcuttings were disinfected, the meristematic shoots were removed and established in vitro in a completely random design to evaluate two cultivation mediums: M1 and M2. From the seedlings developed, the multiplication was performed, which tested three

Organization of the root apical meristem in Linum usitatissimum L. grown at 25°C and 7°C

Directory of Open Access Journals (Sweden)

A. Kadej

2015-01-01

Full Text Available In the first days of intensive growth of the Linum usitatissimum root, the central part of the apical meristem exhibits usually a 4-tier organization. When growth ceases reorganization of the cell arrangement occurs. It starts by periclinal division of the subprotodermal initials, whose derivatives are forming the secondary columella in the central part of the root cap.

Differential spatial expression of A- and B-type CDKs, and distribution of auxins and cytokinins in the open transverse root apical meristem of Cucurbita maxima.

Science.gov (United States)

Chiappetta, Adriana; Bruno, Leonardo; Salimonti, Amelia; Muto, Antonella; Jones, Jessica; Rogers, Hilary J; Francis, Dennis; Bitonti, Maria Beatrice

2011-05-01

Aside from those on Arabidopsis, very few studies have focused on spatial expression of cyclin-dependent kinases (CDKs) in root apical meristems (RAMs), and, indeed, none has been undertaken for open meristems. The extent of interfacing between cell cycle genes and plant growth regulators is also an increasingly important issue in plant cell cycle studies. Here spatial expression/localization of an A-type and B-type CDK, auxin and cytokinins are reported in relation to the hitherto unexplored anatomy of RAMs of Cucurbita maxima. Median longitudinal sections were cut from 1-cm-long primary root tips of C. maxima. Full-length A-type CDKs and a B-type CDK were cloned from C. maxima using degenerate primers, probes of which were localized on sections of RAMs using in situ hybridization. Isopentenyladenine (iPA), trans-zeatin (t-Z) and indole-3yl-acetic acid (IAA) were identified on sections by immunolocalization. The C. cucurbita RAM conformed to an open transverse (OT) meristem typified by an absence of a clear boundary between the eumeristem and root cap columella, but with a distinctive longitudinally thickened epidermis. Cucma;CDKA;1 expression was detected strongly in the longitudinally thickened epidermis, a tissue with mitotic competence that contributes cells radially to the root cap of OT meristems. Cucma;CDKB2 was expressed mainly in proliferative regions of the RAM and in lateral root primordia. iPA and t-Z were mainly distributed in differentiated cells whilst IAA was distributed more uniformly in all tissues of the RAM. Cucma;CDKA;1 was expressed most strongly in cells that have proliferative competence whereas Cucma;CDKB2 was confined mainly to mitotic cells. iPA and t-Z marked differentiated cells in the RAM, consistent with the known effect of cytokinins in promoting differentiation in root systems. iPA/t-Z were distributed in a converse pattern to Cucma;CDKB2 expression whereas IAA was detected in most cells in the RAM regardless of their proliferative

Arabidopsis thaliana gonidialess A/Zuotin related factors (GlsA/ZRF) are essential for maintenance of meristem integrity.

Science.gov (United States)

Guzmán-López, José Alfredo; Abraham-Juárez, María Jazmín; Lozano-Sotomayor, Paulina; de Folter, Stefan; Simpson, June

2016-05-01

Observation of a differential expression pattern, including strong expression in meristematic tissue of an Agave tequilana GlsA/ZRF ortholog suggested an important role for this gene during bulbil formation and developmental changes in this species. In order to better understand this role, the two GlsA/ZFR orthologs present in the genome of Arabidopsis thaliana were functionally characterized by analyzing expression patterns, double mutant phenotypes, promoter-GUS fusions and expression of hormone related or meristem marker genes. Patterns of expression for A. thaliana show that GlsA/ZFR genes are strongly expressed in SAMs and RAMs in mature plants and developing embryos and double mutants showed multiple changes in morphology related to both SAM and RAM tissues. Typical double mutants showed stunted growth of aerial and root tissue, formation of multiple ectopic meristems and effects on cotyledons, leaves and flowers. The KNOX genes STM and BP were overexpressed in double mutants whereas CLV3, WUSCHEL and AS1 were repressed and lack of AtGlsA expression was also associated with changes in localization of auxin and cytokinin. These results suggest that GlsA/ZFR is an essential component of the machinery that maintains the integrity of SAM and RAM tissue and underline the potential to identify new genes or gene functions based on observations in non-model plants.

Cytokinin-Deficient Transgenic Arabidopsis Plants Show Multiple Developmental Alterations Indicating Opposite Functions of Cytokinins in the Regulation of Shoot and Root Meristem Activity

Czech Academy of Sciences Publication Activity Database

Werner, T.; Motyka, Václav; Laucou, V.; Smets, R.; Onckelen, H. V.; Schmülling, T.

2003-01-01

Roč. 15, č. 11 (2003), s. 2532-2550 ISSN 1040-4651 R&D Projects: GA AV ČR IAA6038002 Institutional research plan: CEZ:AV0Z5038910 Keywords : Transgenic Arabidopsis Plants * Cytokinins * Root Meristem Activity Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 10.679, year: 2003

Transcriptomic characterization of a synergistic genetic interaction during carpel margin meristem development in Arabidopsis thaliana.

Directory of Open Access Journals (Sweden)

April N Wynn

Full Text Available In flowering plants the gynoecium is the female reproductive structure. In Arabidopsis thaliana ovules initiate within the developing gynoecium from meristematic tissue located along the margins of the floral carpels. When fertilized the ovules will develop into seeds. SEUSS (SEU and AINTEGUMENTA (ANT encode transcriptional regulators that are critical for the proper formation of ovules from the carpel margin meristem (CMM. The synergistic loss of ovule initiation observed in the seu ant double mutant suggests that SEU and ANT share overlapping functions during CMM development. However the molecular mechanism underlying this synergistic interaction is unknown. Using the ATH1 transcriptomics platform we identified transcripts that were differentially expressed in seu ant double mutant relative to wild type and single mutant gynoecia. In particular we sought to identify transcripts whose expression was dependent on the coordinated activities of the SEU and ANT gene products. Our analysis identifies a diverse set of transcripts that display altered expression in the seu ant double mutant tissues. The analysis of overrepresented Gene Ontology classifications suggests a preponderance of transcriptional regulators including multiple members of the REPRODUCTIVE MERISTEMS (REM and GROWTH-REGULATING FACTOR (GRF families are mis-regulated in the seu ant gynoecia. Our in situ hybridization analyses indicate that many of these genes are preferentially expressed within the developing CMM. This study is the first step toward a detailed description of the transcriptional regulatory hierarchies that control the development of the CMM and ovule initiation. Understanding the regulatory hierarchy controlled by SEU and ANT will clarify the molecular mechanism of the functional redundancy of these two genes and illuminate the developmental and molecular events required for CMM development and ovule initiation.

Establecimiento y multiplicación in vitro de mora de castilla (Rubus glaucus Benth. variedad sin espinas, mediante ápices meristemáticos

Directory of Open Access Journals (Sweden)

Alina Katil Sigarroa-Rieche

2011-12-01

Full Text Available Se evaluó una técnica de micropropagación de plantas de mora (Rubus glaucus de la variedad sin espinas, a partir de ápices meristemáticos. En la fase de establecimiento se evaluó un protocolo de desinfección utilizando por 5 min solución de jabón detergente comercial y agua + alcohol 70% por 2 min + hipoclorito 3% con dos tiempos de exposición diferentes: T1 por 5 min y T2 por 10 min. Después de desinfectar las microestacas se extrajeron los ápices meristemáticos y se establecieron in vitro bajo un diseño completamente al azar para evaluar dos medios de cultivo: M1 y M2. A partir de las plántulas desarrolladas se efectuó la multiplicación en los medios de cultivo M1, M3 y M4. Ambos tratamientos de desinfección resultaron efectivos alcanzando 100% de desinfección de los explantes con cada uno de ellos. La siembra de ápices meristemáticos permitió el establecimiento de cultivos asépticos y un adecuado desarrollo de los explantes después de seis semanas de cultivo, con prendimiento de 83.4% para M1 y 66.6% para M2. El análisis de varianza (Anova y la prueba de rangos múltiples mostraron que la multiplicación fue mejor en el medio M1 con una mayor tasa de crecimiento y desarrollo del explante, al obtener coeficientes de multiplicación de 7.5 brotes/plántula y una altura promedio de 1.95 cm.

Establecimiento y multiplicación in vitro de mora de castilla (Rubus glaucus Benth. variedad sin espinas, mediante ápices meristemáticos

Directory of Open Access Journals (Sweden)

Sigarroa Rieche Alina Katil

2011-12-01

Full Text Available Se evaluó una técnica de micropropagación de plantas de mora (Rubus glaucus de la variedad sin espinas, a partir de ápices meristemáticos. En la fase de establecimiento se evaluó un protocolo de desinfección utilizando por 5 min solución de jabón detergente comercial y agua + alcohol 70% por 2 min + hipoclorito 3% con dos tiempos de exposición diferentes: T₁ por 5 min y T₂ por 10 min. Después de desinfectar las microestacas se extrajeron los ápices meristemáticos y se establecieron in vitro bajo un diseño completamente al azar para evaluar dos medios de cultivo: M1 y M2. A partir de las plántulas desarrolladas se efectuó la multiplicación en los medios de cultivo M1, M3 y M4. Ambos tratamientos de desinfección resultaron efectivos alcanzando 100% de desinfección de los explantes con cada uno de ellos. La siembra de ápices meristemáticos permitió el establecimiento de cultivos asépticos y un adecuado desarrollo de los explantes después de seis semanas de cultivo, con prendimiento de 83.4% para M1 y 66.6% para M2. El análisis de varianza (Anova y la prueba de rangos múltiples mostraron que la multiplicación fue mejor en el medio M1 con una mayor tasa de crecimiento y desarrollo del explante, al obtener coeficientes de multiplicación de 7.5 brotes/plántula y una altura promedio de 1.95 cm.

Heat-shock protein 40 is the key farnesylation target in meristem size control, abscisic acid signaling, and drought resistance.

Science.gov (United States)

Barghetti, Andrea; Sjögren, Lars; Floris, Maïna; Paredes, Esther Botterweg; Wenkel, Stephan; Brodersen, Peter

2017-11-15

Protein farnesylation is central to molecular cell biology. In plants, protein farnesyl transferase mutants are pleiotropic and exhibit defective meristem organization, hypersensitivity to the hormone abscisic acid, and increased drought resistance. The precise functions of protein farnesylation in plants remain incompletely understood because few relevant farnesylated targets have been identified. Here, we show that defective farnesylation of a single factor-heat-shock protein 40 (HSP40), encoded by the J2 and J3 genes-is sufficient to confer ABA hypersensitivity, drought resistance, late flowering, and enlarged meristems, indicating that altered function of chaperone client proteins underlies most farnesyl transferase mutant phenotypes. We also show that expression of an abiotic stress-related microRNA (miRNA) regulon controlled by the transcription factor SPL7 requires HSP40 farnesylation. Expression of a truncated SPL7 form mimicking its activated proteolysis fragment of the membrane-bound SPL7 precursor partially restores accumulation of SPL7-dependent miRNAs in farnesyl transferase mutants. These results implicate the pathway directing SPL7 activation from its membrane-bound precursor as an important target of farnesylated HSP40, consistent with our demonstration that HSP40 farnesylation facilitates its membrane association. The results also suggest that altered gene regulation via select miRNAs contributes to abiotic stress-related phenotypes of farnesyl transferase mutants. © 2017 Barghetti et al.; Published by Cold Spring Harbor Laboratory Press.

Plant-specific Histone Deacetylases HDT½ Regulate GIBBERELLIN 2-OXIDASE 2 Expression to Control Arabidopsis Root Meristem Cell Number

KAUST Repository

Li, Huchen

2017-08-31

Root growth is modulated by environmental factors and depends on cell production in the root meristem (RM). New cells in the meristem are generated by stem cells and transit-amplifying cells, which together determine RM cell number. Transcription factors and chromatin-remodelling factors have been implicated in regulating the switch from stem cells to transit-amplifying cells. Here we show that two Arabidopsis thaliana paralogs encoding plant-specific histone deacetylases, HDT1 and HDT2, regulate a second switch from transit-amplifying cells to expanding cells. Knockdown of HDT½ (hdt1,2i) results in an earlier switch and causes a reduced RM cell number. Our data show that HDT½ negatively regulate the acetylation level of the C19-GIBBERELLIN 2-OXIDASE 2 (GA2ox2) locus and repress the expression of GA2ox2 in the RM and elongation zone. Overexpression of GA2ox2 in the RM phenocopies the hdt1,2i phenotype. Conversely, knockout of GA2ox2 partially rescues the root growth defect of hdt1,2i. These results suggest that by repressing the expression of GA2ox2, HDT½ likely fine-tune gibberellin metabolism and they are crucial for regulating the switch from cell division to expansion to determine RM cell number. We propose that HDT½ function as part of a mechanism that modulates root growth in response to environmental factors.

Revealing the importance of meristems and roots for the development of hypersensitive responses and full foliar resistance to Phytophthora infestans in the resistant potato cultivar Sarpo Mira

DEFF Research Database (Denmark)

Orlowska, Elzbieta Zofia; Basile, Alessio; Kandzia, Izabela

2012-01-01

The defence responses of potato against Phytophthora infestans were studied using the highly resistant Sarpo Mira cultivar. The effects of plant integrity, meristems, and roots on the hypersensitive response (HR), plant resistance, and the regulation of PR genes were analysed. Sarpo Mira shoots a...

Caffeine-Induced Premature Chromosome Condensation Results in the Apoptosis-Like Programmed Cell Death in Root Meristems of Vicia faba.

Directory of Open Access Journals (Sweden)

Dorota Rybaczek

Full Text Available We have demonstrated that the activation of apoptosis-like programmed cell death (AL-PCD was a secondary result of caffeine (CF induced premature chromosome condensation (PCC in hydroxyurea-synchronized Vicia faba root meristem cells. Initiation of the apoptotic-like cell degradation pathway seemed to be the result of DNA damage generated by treatment with hydroxyurea (HU [double-stranded breaks (DSBs mostly] and co-treatment with HU/CF [single-stranded breaks (SSBs mainly]. A single chromosome comet assay was successfully used to study different types of DNA damage (neutral variant-DSBs versus alkaline-DSBs or SSBs. The immunocytochemical detection of H2AXS139Ph and PARP-2 were used as markers for DSBs and SSBs, respectively. Acridine orange and ethidium bromide (AO/EB were applied for quantitative immunofluorescence measurements of dead, dying and living cells. Apoptotic-type DNA fragmentation and positive TUNEL reaction finally proved that CF triggers AL-PCD in stressed V. faba root meristem cells. In addition, the results obtained under transmission electron microscopy (TEM further revealed apoptotic-like features at the ultrastructural level of PCC-type cells: (i extensive vacuolization; (ii abnormal chromatin condensation, its marginalization and concomitant degradation; (iii formation of autophagy-like vesicles (iv protoplast shrinkage (v fragmentation of cell nuclei and (vi extensive degeneration of the cells. The results obtained have been discussed with respect to the vacuolar/autolytic type of plant-specific AL-PCD.

The concept of the eudicot shoot apical meristem as it applies to four Spiraea (Rosaceae), one Mentha (Lamiaceae) and one Euonymus (Celastraceae) cultivars based on chimeric analysis.

Science.gov (United States)

Korn, Robert W

2013-05-01

Eversporting eudicots were sought to see if they behave like gymnosperms. Behaviour of eversporting gymnosperm chimeras indicates a single apical cell is present in SAM and it would be of interest to see if eudicot chimeras have the same behaviour. Four eversporting spireas, the pineapple mint and the Silver King euonymus were inspected for the fate of the yellow (mutant)-green (wild type) chimeras. As with gymnosperms, unstable eudicot chimeras in the four spireas, the pineapple mint and the Silver King euonymus became stable yellow about 80 % or more of the time and 20 % or less became stable green. The statistically significant preponderance of chimeric fates becoming all yellow suggests that a single apical cell resides in the yellow tunica. As with gymnosperms, descendent cells of the yellow replacement corpus cell eventually take over the corpus. Here is the first chimeric set of data to support the hypothesis of a one-celled meristem in eudicots rather than the traditional view of a muticellular meristem.

Cytogenetical and ultrastructural effects of copper on root meristem cells of Allium sativum L.

Science.gov (United States)

Liu, Donghua; Jiang, Wusheng; Meng, Qingmin; Zou, Jin; Gu, Jiegang; Zeng, Muai

2009-04-01

Different copper concentrations, as well as different exposure times, were applied to investigate both cytogenetical and ultrastructural alterations in garlic (Allium sativum L.) meristem cells. Results showed that the mitotic index decreased progressively when either copper concentration or exposure time increased. C-mitosis, anaphase bridges, chromosome stickiness and broken nuclei were observed in the copper treated root tip cells. Some particulates containing the argyrophilic NOR-associated proteins were distributed in the nucleus of the root-tip cells and the amount of this particulate material progressively increased with increasing exposure time. Finally, the nucleolar material was extruded from the nucleus into the cytoplasm. Also, increased dictyosome vesicles in number, formation of cytoplasmic vesicles containing electron dense granules, altered mitochondrial shape, disruption of nuclear membranes, condensation of chromatin material, disintegration of organelles were observed. The mechanisms of detoxification and tolerance of copper are briefly discussed.

3D analysis of mitosis distribution highlights the longitudinal zonation and diarch symmetry in proliferation activity of the Arabidopsis thaliana root meristem.

Science.gov (United States)

Lavrekha, Viktoriya V; Pasternak, Taras; Ivanov, Victor B; Palme, Klaus; Mironova, Victoria V

2017-12-01

To date CYCB1;1 marker and cortex cell lengths have been conventionally used to determine the proliferation activity of the Arabidopsis root meristem. By creating a 3D map of mitosis distribution we showed that these markers overlooked that stele and endodermis save their potency to divide longer than the cortex and epidermis. Cessation of cell divisions is not a random process, so that mitotic activity within the endodermis and stele shows a diarch pattern. Mitotic activity of all root tissues peaked at the same distance from the quiescent center (QC); however, different tissues stopped dividing at different distances, with cells of the protophloem exiting the cell cycle first and the procambial cells being the last. The robust profile of mitotic activity in the root tip defines the longitudinal zonation in the meristem with the proliferation domain, where all cells are able to divide; and the transition domain, where the cell files cease to divide. 3D analysis of cytokinin deficient and cytokinin signaling mutants showed that their proliferation domain is similar to that of the wild type, but the transition domain is much longer. Our data suggest a strong inhibitory effect of cytokinin on anticlinal cell divisions in the stele. © 2017 The Authors The Plant Journal © 2017 John Wiley & Sons Ltd.

Effects of 5-fluorouracil on the mitotic activity of onion root tips apical meristem

Directory of Open Access Journals (Sweden)

Waldemar Lechowicz

2015-01-01

Full Text Available The effects of various concentrations of 5-FU on the mitotic activity of onion root tips apical meristem were investigated during 24-hour incubation in 5-FU and postincubation in water. The incubation in 5-FU caused a reversible inhibition of mitotic activity, and waves of the partially synchronised mitoses were observed during the period of postincubation. The most pronounced synchronisation of mitoses was obtained after incubation in 100 mg/l. 5-FU but the mitotic index of the resumed mitotic activity amounted to only one half of the control value. 5-FU was found to cause some cytological changes in meristematic cells such as enlargement of the nucleoli, change in the interphasic nuclei structure, appearance of subchromatid and chromatid aberrations and micronuclei. The effects of 5-FU on nucleic acids and the cell division cycle ace discussed and compared with the effects of 5-FUdR.

Effect of the gamma radiation in the metabolic activity of the apical meristem of asparagus (Asparagus officinalis); Efecto de la radiacion gamma en la actividad metabolica del meristemo apical de esparrago (Asparagus officinalis)

Energy Technology Data Exchange (ETDEWEB)

Sanchez E, A.; Orozco A, J.A.; Troncoso R, R.; Ojeda C, A.J.; Mercado R, J.N.; Gardea B, A.; Tiznado H, M.E. [Centro de Investigacion en Alimentacion y Desarrollo, A.C. Carretera a la Victoria km. 0.6, A.P. 1735, Hermosillo, Sonora (Mexico); Melendrez A, R. [Universidad de Sonora, A.P. 5-088, Hermosillo, Sonora (Mexico)]. e-mail: aestrada@cascabel.ciad.mx

2007-07-01

The asparagus (Asparagus officinalis) is an agricultural product whose production generates a great quantity of wages as well as foreign currencies for the country because a great part of its production is exported to international markets. In direct reason to the high metabolic activity of the apical meristem, this product it possesses a short shelf life under good conditions of commercialization. Due to the above mentioned, the present work had as objective to evaluate the effect of the gamma radiation in the metabolic activity of the apical meristem of turions of asparagus during the postharvest. Turions of asparagus variety Brock of standard quality was treated with gamma radiation to absorbed dose of 1.0, 1.5, 2.0, 2.5 and 3.0 kGy using an irradiator of {sup 60}Co and stored in one controlled temperature camera maintained at 2 C during 8 days. During the experiment, the camera stayed in darkness and under conditions of high relative humidity by means of the water aspersion. Immediately before the one treatment and after 1, 2, 4 and 8 days of storage, the asparagus were sampled to evaluate the breathing speed (VRCG) by means of gas chromatography and scanning differential calorimetry (VRCDB), ethylene production (PE) by means of gas chromatography and production of metabolic heat of the apical meristem of the asparagus by means of scanning differential calorimetry (Q). Its were not found effects due to the gamma radiation in the variables of VRCG, VRCDB and Q. However, for the PE case, it was found that the doses of 1.5 and 2.5 reduced the PE from the first day of storage, while the 3 kGy dose achievement to eliminate completely the ethylene production from the first day of storage. It was concluded that the gamma radiation at the used levels in the present experiment doesn't reduce the metabolic activity of the apical meristem of the turion of asparagus although it can to improve the postharvest quality from the asparagus when reducing the ethylene

Lateral root initiation and formation within the parental root meristem of Cucurbita pepo: is auxin a key player?

Science.gov (United States)

Ilina, Elena L; Kiryushkin, Alexey S; Semenova, Victoria A; Demchenko, Nikolay P; Pawlowski, Katharina; Demchenko, Kirill N

2018-04-19

In some plant families, including Cucurbitaceae, initiation and development of lateral roots (LRs) occur in the parental root apical meristem. The objective of this study was to identify the general mechanisms underlying LR initiation (LRI). Therefore, the first cellular events leading to LRI as well as the role of auxin in this process were studied in the Cucurbita pepo root apical meristem. Transgenic hairy roots harbouring the auxin-responsive promoter DR5 fused to different reporter genes were used for visualizing of cellular auxin response maxima (ARMs) via confocal laser scanning microscopy and 3-D imaging. The effects of exogenous auxin and auxin transport inhibitors on root branching were analysed. The earliest LRI event involved a group of symmetric anticlinal divisions in pericycle cell files at a distance of 250-350 µm from the initial cells. The visualization of the ARMs enabled the precise detection of cells involved in determining the site of LR primordium formation. A local ARM appeared in sister cells of the pericycle and endodermis files before the first division. Cortical cells contributed to LR development after the anticlinal divisions in the pericycle via the formation of an ARM. Exogenous auxins did not increase the total number of LRs and did not affect the LRI index. Although exogenous auxin transport inhibitors acted in different ways, they all reduced the number of LRs formed. Literature data, as well as results obtained in this study, suggest that the formation of a local ARM before the first anticlinal formative divisions is the common mechanism underlying LRI in flowering plants. We propose that the mechanisms of the regulation of root branching are independent of the position of the LRI site relative to the parental root tip.

Transformation of Inhibitor of Meristem Activity (IMA Gene into Jatropha curcas L.

Directory of Open Access Journals (Sweden)

Asri Pirade Paserang

2015-09-01

Full Text Available Jatropha is one of the many biodiesel plants developed in tropical countries. Efforts to increase its productivity can be done using various methods of breeding. One of the breeding methods is the introduction of genes into the Jatropha plant. The aim of this study is to assess the success of genetic transformation using the Inhibitor of Meristem Activity (IMA gene in Jatropha curcas. The research procedures included inoculation of explants with Agrobacterium tumefaciens, callus induction, screening test of selection media, regeneration, and gene expression analysis using Polymerase Chain Reaction (PCR. IMA is one of the genes that controls flowering genes and ovule development. It was first isolated from tomato plants and has been successfully overexpressed in these plants using the Cauliflower Mosaic Virus (CaMV 35S promoter. In this experiment, plant transformation was performed on J. curcas as the target. Explant callus formation in both the control and treated samples was good, but shoot formation decreased dramatically in the treated explants. PCR analysis indicated that IMA genes can be inserted into J. curcas with the size of the IMA gene is 500 bp.

Transcriptome of the inflorescence meristems of the biofuel plant Jatropha curcas treated with cytokinin.

Science.gov (United States)

Pan, Bang-Zhen; Chen, Mao-Sheng; Ni, Jun; Xu, Zeng-Fu

2014-11-17

Jatropha curcas, whose seed content is approximately 30-40% oil, is an ideal feedstock for producing biodiesel and bio-jet fuels. However, Jatropha plants have a low number of female flowers, which results in low seed yield that cannot meet the needs of the biofuel industry. Thus, increasing the number of female flowers is critical for the improvement of Jatropha seed yield. Our previous findings showed that cytokinin treatment can increase the flower number and female to male ratio and also induce bisexual flowers in Jatropha. The mechanisms underlying the influence of cytokinin on Jatropha flower development and sex determination, however, have not been clarified. This study examined the transcriptional levels of genes involved in the response to cytokinin in Jatropha inflorescence meristems at different time points after cytokinin treatment by 454 sequencing, which gave rise to a total of 294.6 Mb of transcript sequences. Up-regulated and down-regulated annotated and novel genes were identified, and the expression levels of the genes of interest were confirmed by qRT-PCR. The identified transcripts include those encoding genes involved in the biosynthesis, metabolism, and signaling of cytokinin and other plant hormones, flower development and cell division, which may be related to phenotypic changes of Jatropha in response to cytokinin treatment. Our analysis indicated that Jatropha orthologs of the floral organ identity genes known as ABCE model genes, JcAP1,2, JcPI, JcAG, and JcSEP1,2,3, were all significantly repressed, with an exception of one B-function gene JcAP3 that was shown to be up-regulated by BA treatment, indicating different mechanisms to be involved in the floral organ development of unisexual flowers of Jatropha and bisexual flowers of Arabidopsis. Several cell division-related genes, including JcCycA3;2, JcCycD3;1, JcCycD3;2 and JcTSO1, were up-regulated, which may contribute to the increased flower number after cytokinin treatment. This study

Effect of growth regulators in meristem culture of potato (solanum tuberosmum l.)

International Nuclear Information System (INIS)

Batool, A.; Zaidi, S.S.H.

2014-01-01

Two growth regulators, viz., Gibberellic acid (GA3) and Naphthalene acetic acid (NAA) and a combination of both (GA3 and NAA) were evaluated at three different levels (200, 300 and 400 meul) to check the growth rate of root, shoot, number of leaves and nodes of potato plantlets in two potato varieties, namely cardinal and SH-5, grown by meristem culture. Analysis of variance revealed highly significant differences between varieties, hormones and their interaction for all the studied traits. Mean values revealed that among two varieties Cardinal produced root length (0.70 cm), shoot length (2.50 cm), number of leaves (6.96) and number of nodes (8) are better than the SH-5 which produced root length (0.54 cm), shoot length (1.38 cm), number of leaves (4.29) and number of nodes (5.3). The variety cardinal and GA3 at 300 meul followed by 200 meul produced most suitable results. By using the concentration of 300 meul maximum root length of (1.40 cm), shoot length of (3.43 cm), number of leaves (10) and no of nodes (11) was obtained. At 200 meul, though root and shoot length obtained was very similar at 300 meul but produced less number of leaves and nodes. (author)

Brachytic2/ZmABCB1 functions in IAA export from intercalary meristems

Science.gov (United States)

Knöller, Anne Sophie; Richards, Elizabeth L.; Peer, Wendy Ann; Murphy, Angus S.

2010-01-01

Dwarfism traits in Zea mays are regulated by multiple factors including the hormone auxin. Dwarf brachytic2 (br2) mutants harbour lesions in the gene encoding an orthologue of Arabidopsis thaliana ABCB1 which functions in auxin efflux out of meristematic regions in the shoot and root. br2 mesocotyls and coleoptiles exhibit reduced auxin transport. However, the dwarf stature of br2 derives from shortened lower internodes whilst the upper portion of the plant is completely normal. As such, it is counter-intuitive to attribute br2 dwarfism exclusively to reduced auxin export out of the shoot apex. Arabidopsis abcb1 mutants exhibit only minor reductions in auxin transport and plant height unless combined with mutations in the ABCB19 auxin transporter. Phylogenetic modelling analysis excludes the possibility that BR2 is more closely related to ABCB19 which has three more closely related orthologues in maize. BR2 is expressed in nodal meristems, and analyses of auxin transport and content indicate that BR2 function in these grass-specific tissues is analogous to ABCB1 function in the shoot and root apex of Arabidopsis. These results indicate that ABCB1/BR2 function is conserved between dicots and monocots, but also suggests that this function must be understood in the context of the segmental organization of grass plants. PMID:20581123

Assessment of genetic and epigenetic changes in virus-free garlic (Allium sativum L.) plants obtained by meristem culture followed by in vitro propagation.

Science.gov (United States)

Gimenez, Magalí Diana; Yañez-Santos, Anahí Mara; Paz, Rosalía Cristina; Quiroga, Mariana Paola; Marfil, Carlos Federico; Conci, Vilma Cecilia; García-Lampasona, Sandra Claudia

2016-01-01

This is the first report assessing epigenetic variation in garlic. High genetic and epigenetic polymorphism during in vitro culture was detected.Sequencing of MSAP fragments revealed homology with ESTs. Garlic (Allium sativum) is a worldwide crop of economic importance susceptible to viral infections that can cause significant yield losses. Meristem tissue culture is the most employed method to sanitize elite cultivars.Often the virus-free garlic plants obtained are multiplied in vitro (micro propagation). However, it was reported that micro-propagation frequently produces somaclonal variation at the phenotypic level, which is an undesirable trait when breeders are seeking to maintain varietal stability. We employed amplification fragment length polymorphism and methylation sensitive amplified polymorphism (MSAP) methodologies to assess genetic and epigenetic modifications in two culture systems: virus-free plants obtained by meristem culture followed by in vitro multiplication and field culture. Our results suggest that garlic exhibits genetic and epigenetic polymorphism under field growing conditions. However, during in vitro culture system both kinds of polymorphisms intensify indicating that this system induces somaclonal variation. Furthermore, while genetic changes accumulated along the time of in vitro culture, epigenetic polymorphism reached the major variation at 6 months and then stabilize, being demethylation and CG methylation the principal conversions.Cloning and sequencing differentially methylated MSAP fragments allowed us to identify coding and unknown sequences of A. sativum, including sequences belonging to LTR Gypsy retrotransposons. Together, our results highlight that main changes occur in the initial 6 months of micro propagation. For the best of our knowledge, this is the first report on epigenetic assessment in garlic.

Dose rate, mitotic cycle duration, and sensitivity of cell transitions from G1 → S and G2 → M to protracted gamma radiation in root meristems

International Nuclear Information System (INIS)

Evans, L.S.; Hof, J.V.

1975-01-01

Experiments were designed to determine the relative radiosensitivity of the cell transition points of G1 → S and G2 → M in root meristems of several plant species. Label and mitotic indices and microspectrophotometry were used to measure the proportions of cells in each mitotic cycle stage in root meristems after protracted gamma radiation. The criterion of radiosensitivity was the dose rate needed to produce a tissue with less than 1 percent cells in S and none in M after 3 days of continuous exposure. The results show that DNA is the primary radiation target in proliferative root meristems and that the cycle duration stipulates the time interval of vulnerability. In each species, nonrandom reproducible cell proportions were established with 2C:4C:8C amounts of nuclear DNA after 3 days of exposure. Roots of Helianthus annuus, Crepis capillaris, and Tradescantia clone 02 had 80 percent cells with a 2C amount of DNA and 20 percent had a 4C amount of DNA. In these species the transition point of G1 → S was more radiosensitive than G2 → M. Roots of Pisum sativum and Triticum aestivum had cell proportions at 2C:4C:8C amounts of DNA in frequencies of 0.10 to 0.20:0.40 to 0.60:0.30 to 0.40. In these two species 0.30 to 0.40 cells underwent radiation-induced endoreduplication that resulted from a rapid inhibition of cell transit from G2 → M and a slower impairment of G1 → S. Cells increased from 2C to 4C and from 4C to 8C amounts of DNA during irradiation. The proportions of nuclei with 2C:4C:8C amounts of DNA were dependent in part upon the relative radiosensitivity of the G1 → S and G2 → M control points. The data show the relative radiosensitivity of the transition points from G1 → S and from G2 → M was species specific and unrelated to the cycle duration and mean nuclear DNA content of the plant species

Propagación in vitro de Carica papaya var. PTM-331 a partir de meristemos apicales In vitro propagation of Carica papaya var. PTM-331 from apical meristem

Directory of Open Access Journals (Sweden)

Reynaldo Solis L.

2012-02-01

Full Text Available El trabajo consistió en desarrollar un protocolo de propagación in vitro de la variedad de papaya PTM-331 a partir de meristemos apicales, con la finalidad de obtener plántulas vigorosas y libres de enfermedades, empleando la técnica del cultivo de tejidos. Las yemas apicales empleadas fueron obtenidas de plantas cultivadas en invernadero, los cuales fueron usados como explantes para la extracción de meristemos. La mejor diferenciación de meristemos se logró en el medio basal MS suplementado con 0,5 mg.L-1 de BAP, 0,5 mg.L-1 de AIA y 10 mg.L-1 de adenina. La mejor multiplicación se logró con el medio MS suplementado con 0,5 mg.L-1 de BAP, 0,5 mg.L-1 de AIA y 0,3 mg.L-1 de AG3, con un coeficiente de multiplicación de 3,42; mientras que el mejor medio para el enraizamiento fue la combinación del medio MS, 3 mg.L-1 de AIB y 5 mg.L-1 de adenina, donde se obtuvo 83,33% de plantas enraizadas.An in vitro protocol was develop to propagate variety of papaya PTM-331 from apical meristems, with the objective of obtaining vigorous and disease-free seedlings, using tissue culture techniques. Apical buds were obtained from seedlings cultivated in greenhouse and used as explants for meristem dissection. Meristems were cultured on MS basal medium supplemented with 0,5 mg.L-1 of BAP, 0,5 mg.L-1 of AIA and 10 mg.L-1 of adenine for their differentiation. The best multiplication of explants was achieved with the combination of MS medium supplemented with 0,5 mg.L-1 of BAP, 0,5 mg.L-1 of AIA and 0,3 mg.L-1 of AG3, where largest seedlings, with more shoots were obtained. The best medium for rooting was the combination of MS, 3 mg.L-1 of AIB and 5 mg.L-1 of adenine, where 83,33% of rooted plants were obtained.

Use of embryogenic cell suspension and meristem-tip cultures for mutation breeding of apomictic Musa species

International Nuclear Information System (INIS)

Novak, F.J.; Afza, R.; Duren, M. van

1990-01-01

Full text: Breeding by crossing is difficult for banana and plantain. The plants are heterozygous, therefore mutagenic treatment may uncover a recessive allele by mutating or deleting a corresponding dominant allele. Meristem tips were excised from in vitro growing shoots and used for mutation experiments. Induction was carried out by irradiating shoot tips with γ rays and/or by treatment of explants with ethylmethanesulfonate (EMS). Cell suspension was initiated from corm and leaf tissue excised from in vitro grown plantlets. Mutagenised cell suspensions were derived from leaf and corm tissues irradiated with 60 Co γ rays - (10 to 60 Gy, 8 Gy/min). Musa clones exhibited differences in radiosensitivity and post-irradiation recovery. Doses of 20 to 40 Gy seem suitable for mutation induction. The EMS concentration of 25 mM for 4 hours was found effective for isolated shoot tips. Considerable phenotypic variation was observed among plants regenerated from in vitro shoot tips after mutagenic treatment. Leaf and corm explants kept their morphogenic ability in embryogenic cell suspensions after irradiation up to 25 Gy. (author)

Dynamic expression reveals a two-step patterning of WUS and CLV3 during axillary shoot meristem formation in Arabidopsis.

Science.gov (United States)

Xin, Wei; Wang, Zhicai; Liang, Yan; Wang, Yonghong; Hu, Yuxin

2017-07-01

Seed plants have a remarkable capability to produce axillary meristems (AM) in the leaf axils, however, the dynamic establishment of a stem cell niche in AM is largely uncharacterized. We comprehensively examined the dynamic patterning of WUSCHEL (WUS) and CLAVATA3 (CLV3), the two key marker genes defining the shoot stem cell niches, during AM formation in Arabidopsis, and we found that a two-step patterning of WUS and CLV3 occurred during AM stem cell niche establishment. Our further work on the wus and clv3 mutants implicates that such two-step patterning is likely critical for the maintenance of AM progenitor cells and the specification of AM stem cell niche. These data provide a cytological frame for how a stem cell niche is established during AM formation. Copyright © 2017 Elsevier GmbH. All rights reserved.

The effects of γ-ray irradiation on the cellular and subcellular structures of apical meristem in garlic (Allium sativum) and onion (Allium cepal)

International Nuclear Information System (INIS)

Xi Yufang; Qian Dongmei; Bian Qijun; Ying Tiejin

1993-01-01

Electronic microscopic study revealed that 2 ∼ 30 krads of γ-ray irradiation to garlic and onion could cause various damages to cellular and subcellular structures of the shoot apical meristem. Among the various oganelles, the vacuoles showed the highest radio-sensitivity while mitochondria and nucleus seemed to be most resistant to irradiation. The irradiated cells did not show any visible structural damages until the dormancy ended, suggesting that metabolism played an important role in the structural damages. The study also suggested that even after the irradiation which caused intensive subcellular structural damages, the tissues could survive. However, the potency of mitosis in the apex was lost, resulting in the inhibition of sprouting

Clastogenic adaption of Vicia faba root tip meristem cells after consecutive treatments with S-phase dependent and S-phase independent agents

International Nuclear Information System (INIS)

Heindorff, K.; Schubert, I.; Rieger, R.; Michaelis, A.

1987-01-01

Pretreatment of Vicia faba root tip meristems with low doses of S-phase independent clastogens, such as X-rays or bleomycin, prior to a high (challenge) dose of S-phase dependent clastogens, such as alkylating agents (TEM, Trenimon) or the pyridazine derivative MH, led to decreased challenge treatment-induced aberration frequencies, i.e., clastogenic adaptation. Using the inverse treatment sequence bleomycin and MH proved to be able to substitute for each other in provoking clastogenic (cross) adaptation while bleomycin and alkylating agents were unable to do so. The data support the assumption of inducible cellular functions that become triggered by low clastogen doses and additionally describe some particular properties of bleomycin when used for conditioning. Bleomycin proved to be capable to exert protection independent of the agent used for challenge treatment. (author)

AGO6 functions in RNA-mediated transcriptional gene silencing in shoot and root meristems in Arabidopsis thaliana.

Directory of Open Access Journals (Sweden)

Changho Eun

Full Text Available RNA-directed DNA methylation (RdDM is a small interfering RNA (siRNA-mediated epigenetic modification that contributes to transposon silencing in plants. RdDM requires a complex transcriptional machinery that includes specialized RNA polymerases, named Pol IV and Pol V, as well as chromatin remodelling proteins, transcription factors, RNA binding proteins, and other plant-specific proteins whose functions are not yet clarified. In Arabidopsis thaliana, DICER-LIKE3 and members of the ARGONAUTE4 group of ARGONAUTE (AGO proteins are involved, respectively, in generating and using 24-nt siRNAs that trigger methylation and transcriptional gene silencing of homologous promoter sequences. AGO4 is the main AGO protein implicated in the RdDM pathway. Here we report the identification of the related AGO6 in a forward genetic screen for mutants defective in RdDM and transcriptional gene silencing in shoot and root apical meristems in Arabidopsis thaliana. The identification of AGO6, and not AGO4, in our screen is consistent with the primary expression of AGO6 in shoot and root growing points.

lAA and BAP affect protein phosphorylation-dependent processes during sucrose-mediated G1 to S and G2 to M transitions in root meristem cells of Vicia faba

Directory of Open Access Journals (Sweden)

Justyna Teresa Polit

2011-01-01

Full Text Available In carbohydrate-starved root meristems of Vicia faba subsp. minor, the expression of two Principal Control Points located at the final stages of the G1 (PCP1 and G2 (PCP2 phases has been found to be correlated with a marked decrease of protein phosphorylation within cell nuclei, nucleoli and cytoplasm. Adopting the same experimental model in our present studies, monoclonal FITC conjugated antibodies that recognize phosphorylated form of threonine (αTPab-FITC were used to obtain an insight about how the indole-3-acetic acid (IAA, benzyl-6-aminopurine (BAP, and the mixture of both phytohormones influence the time-course changes in an overall protein phosphorylation during sucrose-mediated PCP1→S and PCP2→M transitions. Unsuspectedly, neither IAA, BAP, nor the mixture of both phytohormones supplied in combination with sucrose did up-regulate protein phosphorylation. However using the block-and-release method, it was shown that root meristems of Vicia provided with sucrose alone indicated higher levels of αTPab-FITC. Contrarily, phytohormones supplied in combination with sucrose induced apparent decline in phosphorylation of cell proteins, which - when compared with the influence of sucrose alone - became increasingly evident in time. Thus, it seems probable, that a general decline in the amount of αTPab-FITC labeled epitopes may overlay specific phosphorylations and dephosphorylations governed by the main cell cycle kinases and phosphatases.

Genotoxic Effects of Diuron Contaminated Soil on the Root Meristem Cells of Allium sativum: A Possible Mechanism of Chromosome Damage.

Science.gov (United States)

Saxena, P N; Chauhan, L K S; Chandra, Saurabh; Gupta, S K

2004-01-01

Diuron, a persistant substituted urea herbicide, was tested in the root meristem cells of Allium sativum for the possible cytogenetic effects and to compare the sensitivity with Allium cepa. Test concentrations of diuron 22.5, 45.0, and 90.0 ppm were mixed in soil and the cloves of A. sativum were placed over diuron-contaminated soils. Root meristematic cells were sampled at 48 h to score Mitotic/Chromosomal aberrations and to analyze the effect on mitotic index (MI). Microscopic analyses revealed significant and dose-dependent induction of mitotic as well as chromosomal breaks. The frequency of mitotic aberrations was every time found much higher than that of chromosomal aberrations. Mild percentage of Micronucleated and Binucleated cells was observed, as MI also declined during the analysis. Based on the data of valence charge densities on the atoms of herbicide molecule and spectroscopic studies, a possible mechanism of interaction of diuron with DNA molecule for chromosomal aberrations has been proposed.

Response of antioxidant defense system to laser radiation apical meristem of Isatis indigotica seedlings exposed to UV-B.

Science.gov (United States)

Chen, Yi-Ping

2009-07-01

To determine the response of antioxidant defense system to laser radiation apical meristem of Isatis indigotica seedlings, Isatis indigotica seedlings were subjected to UV-B radiation (10.08 kJ m(-2)) for 8 h day(-1) for 8 days (PAR, 220 micromol m(-2) s(-1)) and then exposed to He-Ne laser radiation (633 nm; 5.23 mW mm(-2); beam diameter: 1.5 mm) for 5 min each day without ambient light radiation. Changes in free radical elimination systems were measured, the results indicate that: (1) UV-B radiation enhanced the concentration of Malondialdahyde (MDA) and decreased the activities of superoxide dismutase (SOD), catalase (CAT) and peroxidase (POD) in seedlings compared with the control. The concentration of MDA was decreased and the activities of SOD, CAT and POD were increased when seedlings were subjected to elevated UV-B damage followed by laser; (2) the concentration of UV absorbing compounds and proline were increased progressively with UV-B irradiation, laser irradiation and He-Ne laser irradiation plus UV-B irradiation compared with the control. These results suggest that laser radiation has an active function in repairing UV-B-induced lesions in seedlings.

miR396 affects mycorrhization and root meristem activity in the legume Medicago truncatula.

Science.gov (United States)

Bazin, Jérémie; Khan, Ghazanfar Abbas; Combier, Jean-Philippe; Bustos-Sanmamed, Pilar; Debernardi, Juan Manuel; Rodriguez, Ramiro; Sorin, Céline; Palatnik, Javier; Hartmann, Caroline; Crespi, Martin; Lelandais-Brière, Christine

2013-06-01

The root system is crucial for acquisition of resources from the soil. In legumes, the efficiency of mineral and water uptake by the roots may be reinforced due to establishment of symbiotic relationships with mycorrhizal fungi and interactions with soil rhizobia. Here, we investigated the role of miR396 in regulating the architecture of the root system and in symbiotic interactions in the model legume Medicago truncatula. Analyses with promoter-GUS fusions suggested that the mtr-miR396a and miR396b genes are highly expressed in root tips, preferentially in the transition zone, and display distinct expression profiles during lateral root and nodule development. Transgenic roots of composite plants that over-express the miR396b precursor showed lower expression of six growth-regulating factor genes (MtGRF) and two bHLH79-like target genes, as well as reduced growth and mycorrhizal associations. miR396 inactivation by mimicry caused contrasting tendencies, with increased target expression, higher root biomass and more efficient colonization by arbuscular mycorrhizal fungi. In contrast to MtbHLH79, repression of three GRF targets by RNA interference severely impaired root growth. Early activation of mtr-miR396b, concomitant with post-transcriptional repression of MtGRF5 expression, was also observed in response to exogenous brassinosteroids. Growth limitation in miR396 over-expressing roots correlated with a reduction in cell-cycle gene expression and the number of dividing cells in the root apical meristem. These results link the miR396 network to the regulation of root growth and mycorrhizal associations in plants. © 2013 The Authors The Plant Journal © 2013 John Wiley & Sons Ltd.

Cytotoxicity of Cheese and Cheddar Cheese food flavorings on Allim cepa L root meristems

Directory of Open Access Journals (Sweden)

A. G. Moura

Full Text Available Abstract Despite their great importance for the food industry, flavorings, in general, raise a number of questions regarding their cytotoxicity, mutagenicity and carcinogenicity, since, in the literature, there are few studies found evaluating the toxicity on the systemic and cellular level, of these chemical compounds. The root meristems of Allium cepa (onion are widely used for the assessment of toxicity of chemical compounds of interest. Thus, this study aimed to evaluate, in A. cepa meristematic cells, individually and in combination at the cellular level, the toxicity of synthetic Cheese and Cheddar Cheese food flavorings, identical to the natural, at doses of 1.0 and 2.0 mL, at exposure times of 24 and 48 hours. In combination we used 0.5 mL of Cheese flavor associated with 0.5 mL of Cheddar flavor; and 1.0 mL of Cheese flavor associated with 1.0 mL of Cheddar flavor, at exposure times of 24 and 48 hours. For these evaluations, we used groups of five onion bulbs, which were first embedded in distilled water and then transferred to their respective doses. The root tips were collected and fixed in acetic acid (3:1 for 24 hours. The slides were prepared by crushing and were stained with 2% acetic orcein. Cells were analyzed throughout the cell cycle, totaling 5,000 for each control and exposure time. The mitotic indices calculated and cellular aberrations observed were subjected to statistical analysis using the chi-square test (p <0.05. No chromosomal abnormalities nor those of mitotic spindle were observed for the treatments performed. The results, both individually and in combination, showed that the flavorings under study significantly reduced the cell division rate of the test system cells used. Therefore, under the conditions studied, the two flavorings were cytotoxic.

Transcriptomics insights into the genetic regulation of root apical meristem exhaustion and determinate primary root growth in Pachycereus pringlei (Cactaceae).

Science.gov (United States)

Rodriguez-Alonso, Gustavo; Matvienko, Marta; López-Valle, Mayra L; Lázaro-Mixteco, Pedro E; Napsucialy-Mendivil, Selene; Dubrovsky, Joseph G; Shishkova, Svetlana

2018-06-04

Many Cactaceae species exhibit determinate growth of the primary root as a consequence of root apical meristem (RAM) exhaustion. The genetic regulation of this growth pattern is unknown. Here, we de novo assembled and annotated the root apex transcriptome of the Pachycereus pringlei primary root at three developmental stages, with active or exhausted RAM. The assembled transcriptome is robust and comprehensive, and was used to infer a transcriptional regulatory network of the primary root apex. Putative orthologues of Arabidopsis regulators of RAM maintenance, as well as putative lineage-specific transcripts were identified. The transcriptome revealed putative orthologues of most proteins involved in housekeeping processes, hormone signalling, and metabolic pathways. Our results suggest that specific transcriptional programs operate in the root apex at specific developmental time points. Moreover, the transcriptional state of the P. pringlei root apex as the RAM becomes exhausted is comparable to the transcriptional state of cells from the meristematic, elongation, and differentiation zones of Arabidopsis roots along the root axis. We suggest that the transcriptional program underlying the drought stress response is induced during Cactaceae root development, and that lineage-specific transcripts could contribute to RAM exhaustion in Cactaceae.

Low- and High-Temperature Tolerance and Acclimation for Chlorenchyma versus Meristem of the Cultivated Cacti Nopalea cochenillifera, Opuntia robusta, and Selenicereus megalanthus

Directory of Open Access Journals (Sweden)

Brian R. Zutta

2011-01-01

Full Text Available Dividing meristematic cells are thought to be more sensitive to extreme temperatures compared to other tissues, such as chlorenchyma. This was examined for low and high temperatures for three widely cultivated cacti: Nopalea cochenillifera, Opuntia robusta, and Selenicereus megalanthus. Temperature tolerances of chlorenchyma and meristem were based on the cellular uptake of the vital stain neutral red for plants at mean day/night air temperatures of 25/20°C and plants maintained at 10/5°C or 45/40°C to examine temperature acclimation. Meristematic cells tolerated 1.8°C lower low temperatures and 4.0°C higher high temperatures than chlorenchyma cells for the three species at 25/20°C. Both tissue types showed acclimation, with a decrease or increase in temperature tolerated at 10/5°C or 45/40°C, respectively. Meristematic cells were more tolerant of extreme temperatures compared to chlorenchyma, contrary to the prevailing belief, and may reflect an additional strategy for cacti to survive extreme temperatures.

Gibberellin mediates daylength-controlled differentiation of vegetative meristems in strawberry (Fragaria × ananassa Duch

Directory of Open Access Journals (Sweden)

Moritz Thomas

2009-02-01

Full Text Available Abstract Background Differentiation of long and short shoots is an important developmental trait in several species of the Rosaceae family. However, the physiological mechanisms controlling this differentiation are largely unknown. We have studied the role of gibberellin (GA in regulation of shoot differentiation in strawberry (Fragaria × ananassa Duch. cv. Korona. In strawberry, differentiation of axillary buds to runners (long shoot or to crown branches (short shoot is promoted by long-day and short-day conditions, respectively. Formation of crown branches is a prerequisite for satisfactory flowering because inflorescences are formed from the apical meristems of the crown. Results We found that both prohexadione-calcium and short photoperiod inhibited runner initiation and consequently led to induction of crown branching. In both cases, this correlated with a similar decline in GA1 level. Exogenous GA3 completely reversed the effect of prohexadione-calcium in a long photoperiod, but was only marginally effective in short-day grown plants. However, transfer of GA3-treated plants from short days to long days restored the normal runner formation. This did not occur in plants that were not treated with GA3. We also studied GA signalling homeostasis and found that the expression levels of several GA biosynthetic, signalling and target genes were similarly affected by prohexadione-calcium and short photoperiod in runner tips and axillary buds, respectively. Conclusion GA is needed for runner initiation in strawberry, and the inhibition of GA biosynthesis leads to the formation of crown branches. Our findings of similar changes in GA levels and in GA signalling homeostasis after prohexadione-calcium and short-day treatments, and photoperiod-dependent responsiveness of the axillary buds to GA indicate that GA plays a role also in the photoperiod-regulated differentiation of axillary buds. We propose that tightly regulated GA activity may control

cDNA-AFLP analysis of gene expression differences between the flower bud and sprout-shoot apical meristem of Angelica sinensis (Oliv. Diels

Directory of Open Access Journals (Sweden)

Yu Guang

2011-01-01

Full Text Available Angelica sinensis (Oliv. Diels (Umbelliferae is a well-known medicinal plant mainly distributed in Gansu Province of China. Its local and global demand is significant because of its food and medicinal applications. However, the early bolting rate of Angelica sinensis (Oliv. Diels reaches 20%-60%, which seriously affects its food and medicinal qualities. Thus, differences in gene expression between the flower bud and sprout-shoot apical meristem underwent analysis, by means of cDNA-amplified restriction fragment length polymorphism, to better understand the flowering mechanism. 64 primer sets, each of which amplified to 60 transcript-derived fragments (TDFs, were used. Among these TDFs, 26 were expressed specifically in the flower bud. After cloning and sequencing, 32 distinct sequences were obtained from these 26 TDFs, and 25 were found with homologous sequences in databases. Confirmation of differential expression of 13 sequences was obtained by semi-quantitative RT-PCR, their showing higher expression levels in flower buds. These homologous sequences encode transposable elements, pentatricopeptide repeat-containing proteins, DNA-binding transcription factors, zinc finger (B-box type family proteins, NADP-dependent sorbitol 6-phosphate dehydrogenase (S6PDH, amongst others.

Determination of the cause of the symptoms on yellow yam (Dioscorea cayenensis Lam.) leaf tissue and their eradication, enriching the culture medium and using techniques of meristem culture, thermo and chemotherapy on in vitro conditions

International Nuclear Information System (INIS)

Brenes Huertas, Mauricio

2010-01-01

Yams (Dioscorea spp) has been cultivated for exportation in Costa Rica, in North Huetar region. In vitro culture technique has been used for multiplying planting material for many advantages. However, cleaning of viruses that affect has been ineffective. Viruses such as: the potyvirus, potexvirus, cucumovirus . Methods like meristem culture, chemotherapy, thermotherapy and combinations of these have been used for the elimination of virus in plant species. The plants were evaluated in indexing assays, observing symptoms, serological methods and electron microscopy, among others. Other problems that have been affecting in vitro plant are deficient culture media in some nutrient. The presence of some abnormal characteristics in leaf tissue was determined whether have been caused by a virus or a nutritional deficiency in the culture medium. The presence of the virus has tried to find using ELISA and electron microscopy. Tests meristem culture, thermotherapy and chemotherapy have been made for the eradication of a possible virus; which have been assessed by observation of symptomatology and ELISA. The efficiency of the culture medium was evaluated to enrich it with nitrogen or excess iron. None of the suspected virus found in ELISA tests. Filaments are presumably viral particles were found through analysis of ultrastructure, as well as alterations in chloroplasts which indicated the presence of a pathogen or toxicity. Thermotherapy and chemotherapy with the concentration of 40 mg/L of ribavirin have been the most effective for the elimination of symptoms in virus eradication treatments. Assessments nutrient concentrations have shown that the differences between the various treatments used were undetectable. The symptoms presented were caused, according to the conclusions, by a virus which should preferably deal with thermotherapy. (author) [es

Infection cycle of Artichoke Italian latent virus in tobacco plants: meristem invasion and recovery from disease symptoms.

Directory of Open Access Journals (Sweden)

Elisa Santovito

Full Text Available Nepoviral infections induce recovery in fully expanded leaves but persist in shoot apical meristem (SAM by a largely unknown mechanism. The dynamics of infection of a grapevine isolate of Artichoke Italian latent virus (AILV-V, genus Nepovirus in tobacco plants, including colonization of SAM, symptom induction and subsequent recovery of mature leaves from symptoms, were characterized. AILV-V moved from the inoculated leaves systemically and invaded SAM in 7 days post-inoculation (dpi, remaining detectable in SAM at least up to 40 dpi. The new top leaves recovered from viral symptoms earliest at 21 dpi. Accumulation of viral RNA to a threshold level was required to trigger the overexpression of RDR6 and DCL4. Consequently, accumulation of viral RNA decreased in the systemically infected leaves, reaching the lowest concentration in the 3rd and 4th leaves at 23 dpi, which was concomitant with recovery of the younger, upper leaves from disease symptoms. No evidence of virus replication was found in the recovered leaves, but they contained infectious virus particles and were protected against re-inoculation with AILV-V. In this study we also showed that AILV-V did not suppress initiation or maintenance of RNA silencing in transgenic plants, but was able to interfere with the cell-to-cell movement of the RNA silencing signal. Our results suggest that AILV-V entrance in SAM and activation of RNA silencing may be distinct processes since the latter is triggered in fully expanded leaves by the accumulation of viral RNA above a threshold level rather than by virus entrance in SAM.

Aberrant cell divisions in root meristeme of maize following exposure to X-rays low doses compared to similar effects of 50 Hz electromagnetic exposure

Directory of Open Access Journals (Sweden)

Luchian T.

2012-04-01

Full Text Available The response of maize to radiation exposure was investigated by two cytogenetic methods considering the importance of the geno-toxic effect for environmental and agricultural purposes. Uniform genophond seeds, freshly germinated, were exposed to relatively low radiation doses using a radiotherapy X-ray applicator from a hospital irradiation device and to a 50 Hz electromagnetic field with about 10 mT magnetic induction (generated within laboratory assembled electromagnetic coils. Radicular meristeme tissue aliquots were prevailed for cytogenetic investigation based on microscopic observations and cell counting. Microscope slides were prepared following a specific procedure (squash technique and Feulgen method based on modified Carr reactive coloration. Mitotic index as well as chromosomal aberration percentage were calculated for more than 30,000 cells taken into account. From a qualitative viewpoint, chromosomal aberrations such as interchromatidian bridges, lagging and expelled chromosomes and multipolar divisions were evidenced - no distinct situation for either ionizing radiation or electromagnetic field being identified. The main quantitative difference consisted in the increased mitotic index for electromagnetic exposure increased times compared with the diminished mitotic index in the case of low X-ray doses.

Auxin-cytokinin synergism in vitro for producing genetically stable plants of Ruta graveolens using shoot tip meristems

Directory of Open Access Journals (Sweden)

Mohammad Faisal

2018-02-01

Full Text Available An efficient micropropagation protocol was developed for Ruta graveolens Linn. using shoot tip meristems derived from a 4-month-old field grown plant. In vitro shoot regeneration and proliferation was accomplished on Murashige and Skoogs (MS semi-solid medium in addition to different doses of cytokinins viz.6- benzyl adenine (BA, Kinetin (Kn or 2-isopetynyl adenine (2iP, singly or in combination with auxins viz. indole-3-acetic acid (IAA, indole-3-butyric acid (IBA or α-naphthalene acetic acid (NAA. Highest regeneration frequency (27.6% was obtained on (MS medium composed of BA (10 µM with maximum number (9.4 of shoots and 4.3 cm shoot length after 4 weeks of incubation. Among various combinations tried best regeneration frequency (71% of multiple shoot formation with highest number (12.6 of shoots per shoot tip explants were achieved in MS medium augmented with a combination BA (10.0 µM and NAA (2.5 µM after 4 weeks of incubation. The optimum frequency (97% of rhizogenesis was achieved on half-strength MS medium having 0.5 µM IBA after 4 weeks of incubation. Tissue culture raised plantlets with 5–7 fully opened leaves with healthy root system were successfully acclimatized off in Soilrite™ with 80% survival rate followed by transportation to normal soil under natural light. Genetic stability among in vitro raised progeny was evaluated by ISSR and RAPD markers. The entire banding pattern revealed from in vitro regenerated plants was monomorphic to the donor. The present protocol provides an alternative option for commercial propagation and fruitful setting up of genetically uniform progeny for sustainable utilization and germplasm preservation.

Testing the ontogenetic base for the transient model of inflorescence development.

Science.gov (United States)

Bull-Hereñu, Kester; Claßen-Bockhoff, Regine

2013-11-01

Current research in plant science has concentrated on revealing ontogenetic processes of key attributes in plant evolution. One recently discussed model is the 'transient model' successful in explaining some types of inflorescence architectures based on two main principles: the decline of the so called 'vegetativeness' (veg) factor and the transient nature of apical meristems in developing inflorescences. This study examines whether both principles find a concrete ontogenetic correlate in inflorescence development. To test the ontogenetic base of veg decline and the transient character of apical meristems the ontogeny of meristematic size in developing inflorescences was investigated under scanning electron microscopy. Early and late inflorescence meristems were measured and compared during inflorescence development in 13 eudicot species from 11 families. The initial size of the inflorescence meristem in closed inflorescences correlates with the number of nodes in the mature inflorescence. Conjunct compound inflorescences (panicles) show a constant decrease of meristematic size from early to late inflorescence meristems, while disjunct compound inflorescences present an enlargement by merging from early inflorescence meristems to late inflorescence meristems, implying a qualitative change of the apical meristems during ontogeny. Partial confirmation was found for the transient model for inflorescence architecture in the ontogeny: the initial size of the apical meristem in closed inflorescences is consistent with the postulated veg decline mechanism regulating the size of the inflorescence. However, the observed biphasic kinetics of the development of the apical meristem in compound racemes offers the primary explanation for their disjunct morphology, contrary to the putative exclusive transient mechanism in lateral axes as expected by the model.

A genetic screen for modifiers of UFO meristem activity identifies three novel FUSED FLORAL ORGANS genes required for early flower development in Arabidopsis.

Science.gov (United States)

Levin, J Z; Fletcher, J C; Chen, X; Meyerowitz, E M

1998-06-01

In a screen to identify novel genes required for early Arabidopsis flower development, we isolated four independent mutations that enhance the Ufo phenotype toward the production of filamentous structures in place of flowers. The mutants fall into three complementation groups, which we have termed FUSED FLORAL ORGANS (FFO) loci. ffo mutants have specific defects in floral organ separation and/or positioning; thus, the FFO genes identify components of a boundary formation mechanism(s) acting between developing floral organ primordia. FFO1 and FFO3 have specific functions in cauline leaf/stem separation and in first- and third-whorl floral organ separation, with FFO3 likely acting to establish and FFO1 to maintain floral organ boundaries. FFO2 acts at early floral stages to regulate floral organ number and positioning and to control organ separation within and between whorls. Plants doubly mutant for two ffo alleles display additive phenotypes, indicating that the FFO genes may act in separate pathways. Plants doubly mutant for an ffo gene and for ufo, lfy, or clv3 reveal that the FFO genes play roles related to those of UFO and LFY in floral meristem initiation and that FFO2 and FFO3 may act to control cell proliferation late in inflorescence development.

Relationship between plant growth and cytological effect in root apical meristem after exposure of wheat dry seeds to carbon ion beams

Energy Technology Data Exchange (ETDEWEB)

Liu, Qingfang [Radiobiology Laboratory, Institute of Modern Physics, Chinese Academy of Sciences, Lanzhou, Gansu Province 730000 (China); University of Chinese Academy of Sciences, Beijing 100049 (China); Wang, Zhuanzi; Zhou, Libin; Qu, Ying; Lu, Dong [Radiobiology Laboratory, Institute of Modern Physics, Chinese Academy of Sciences, Lanzhou, Gansu Province 730000 (China); Yu, Lixia; Du, Yan [Radiobiology Laboratory, Institute of Modern Physics, Chinese Academy of Sciences, Lanzhou, Gansu Province 730000 (China); University of Chinese Academy of Sciences, Beijing 100049 (China); Jin, Wenjie [Radiobiology Laboratory, Institute of Modern Physics, Chinese Academy of Sciences, Lanzhou, Gansu Province 730000 (China); Li, Wenjian, E-mail: wjli@impcas.ac.cn [Radiobiology Laboratory, Institute of Modern Physics, Chinese Academy of Sciences, Lanzhou, Gansu Province 730000 (China)

2013-06-15

In order to analyze the relationship between plant growth and cytological effects, wheat dry seeds were exposed to various doses of {sup 12}C{sup 6+} beams and the biological endpoints reflecting plant growth and root apical meristem (RAM) activities were investigated. The results showed that most of the seeds were able to germinate normally within all dose range, while the plant survival rate descended at higher doses. The seedling growth including root length and seedling height also decreased significantly at higher doses. Mitotic index (MI) in RAM had no changes at 10 and 20 Gy and decreased obviously at higher doses and the proportion of prophase cells had the same trend with MI. These data suggested that RAM cells experienced cell cycle arrest, which should be responsible for the inhibition of root growth after exposure to higher doses irradiation. Moreover, various types of chromosome aberrations (CAs) were observed in the mitotic cells. The frequencies of mitotic cells with lagging chromosomes and these with anaphase bridges peaked around 60 Gy, while the frequencies of these with fragments increased as the irradiation doses increased up to 200 Gy. The total frequencies of mitotic cells with CAs induced by irradiation increased significantly with the increasing doses. The serious damage of mitotic chromosomes maybe caused cell cycle arrest or cell death. These findings suggested that the influences of {sup 12}C{sup 6+} beams irradiation on plant growth were related to the alternation of mitotic activities and the chromosomal damages in RAM.

Overexpression of PhEXPA1 increases cell size, modifies cell wall polymer composition and affects the timing of axillary meristem development in Petunia hybrida.

Science.gov (United States)

Zenoni, Sara; Fasoli, Marianna; Tornielli, Giovanni Battista; Dal Santo, Silvia; Sanson, Andrea; de Groot, Peter; Sordo, Sara; Citterio, Sandra; Monti, Francesca; Pezzotti, Mario

2011-08-01

• Expansins are cell wall proteins required for cell enlargement and cell wall loosening during many developmental processes. The involvement of the Petunia hybrida expansin A1 (PhEXPA1) gene in cell expansion, the control of organ size and cell wall polysaccharide composition was investigated by overexpressing PhEXPA1 in petunia plants. • PhEXPA1 promoter activity was evaluated using a promoter-GUS assay and the protein's subcellular localization was established by expressing a PhEXPA1-GFP fusion protein. PhEXPA1 was overexpressed in transgenic plants using the cauliflower mosaic virus (CaMV) 35S promoter. Fourier transform infrared (FTIR) and chemical analysis were used for the quantitative analysis of cell wall polymers. • The GUS and GFP assays demonstrated that PhEXPA1 is present in the cell walls of expanding tissues. The constitutive overexpression of PhEXPA1 significantly affected expansin activity and organ size, leading to changes in the architecture of petunia plants by initiating premature axillary meristem outgrowth. Moreover, a significant change in cell wall polymer composition in the petal limbs of transgenic plants was observed. • These results support a role for expansins in the determination of organ shape, in lateral branching, and in the variation of cell wall polymer composition, probably reflecting a complex role in cell wall metabolism. © 2011 The Authors. New Phytologist © 2011 New Phytologist Trust.

Screening for sweet potato (Ipomoea batatas (L.)) viruses and their elimination using thermotheraphy-meristem tip culture technique

International Nuclear Information System (INIS)

Arkorful, E.

2012-11-01

Despite its high potential for food security, production of sweet potato is constrained by viruses which reduce yield by 90%. It is therefore essential to screen for, identify and eliminate these viruses in elite clones before dissemination to farmers. In this study, visual symptomatology and PCR-based techniques were used to identify sweet potato viruses. Visual symptomatology revealed virus associated symptoms ranging from vein clearing, interveinal chlorosis, chlorotic spots, upward curling on leaf edges, leaf narrowing and distortion, purpling, blistering, reduction of the leaf blades and general leaf yellowing in all 22 accessions grown on the field. Disease Incidence (DI) significantly (p≤0.05) varied between accessions with US003 having the lowest (20%) while ten accessions had 90% DI at the end of the study. Index of symptom severity of all plants (ISSap) ranged from 1.08±0.09 to 3.67 ±0.11 with VOTCR003 having the lowest suggesting that it is a moderately susceptible accession while VOTCR002 had the highest suggesting that it is susceptible to viral diseases. Contrarily, index of symptom severity of diseased plants (ISSdp) ranged from 2.00±0.25 to 3.75±0.32. The accession VOTCR002 had the highest ISSdp. Visual symptomatology showed that VOTCR002 had the highest DI, ISSap and ISSdp suggesting that it is highly susceptible to viral diseases. Ten severely infected accessions were tested for Sweet Potato leaf curl virus (SPLCV), Sweet Potato chlorotic stunt virus (SPCSV), Sweet potato feathery mottle virus (SPFMV) and Sweet Potato mild mottle virus (SPMMV) using PCR and RT-PCR techniques. RT-PCR did not amplify any of the virus genomes due to prolonged storage enzymes, In contrast, PCR detected SPLCV in 30% of the accessions. Plants infected with SPLCV were grown in the chamber at 35 degrees celsius for 4 weeks followed by meristem top culture. The regenerants were indexed after ten weeks for SPLCV. Fifty two percent (52.385 od the regenerants were

Transition zone cells reach G2 phase before initiating elongation in maize root apex

Directory of Open Access Journals (Sweden)

M. Victoria Alarcón

2017-06-01

Full Text Available Root elongation requires cell divisions in the meristematic zone and cell elongation in the elongation zone. The boundary between dividing and elongating cells is called the transition zone. In the meristem zone, initial cells are continuously dividing, but on the basal side of the meristem cells exit the meristem through the transition zone and enter in the elongation zone, where they stop division and rapidly elongate. Throughout this journey cells are accompanied by changes in cell cycle progression. Flow cytometry analysis showed that meristematic cells are in cycle, but exit when they enter the elongation zone. In addition, the percentage of cells in G2 phase (4C strongly increased from the meristem to the elongation zone. However, we did not observe remarkable changes in the percentage of cells in cell cycle phases along the entire elongation zone. These results suggest that meristematic cells in maize root apex stop the cell cycle in G2 phase after leaving the meristem.

A GRAS-like gene of sunflower (Helianthus annuus L.) alters the gibberellin content and axillary meristem outgrowth in transgenic Arabidopsis plants.

Science.gov (United States)

Fambrini, M; Mariotti, L; Parlanti, S; Salvini, M; Pugliesi, C

2015-11-01

The GRAS proteins belong to a plant transcriptional regulator family that function in the regulation of plant growth and development. Despite their important roles, in sunflower only one GRAS gene (HaDella1) with the DELLA domain has been reported. Here, we provide a functional characterisation of a GRAS-like gene from Helianthus annuus (Ha-GRASL) lacking the DELLA motif. The Ha-GRASL gene contains an intronless open reading frame of 1,743 bp encoding 580 amino acids. Conserved motifs in the GRAS domain are detected, including VHIID, PFYRE, SAW and two LHR motifs. Within the VHII motif, the P-H-N-D-Q-L residues are entirely maintained. Phylogenetic analysis reveals that Ha-GRASL belongs to the SCARECROW LIKE4/7 (SCL4/7) subfamily of the GRAS consensus tree. Accumulation of Ha-GRASL mRNA at the adaxial boundaries from P6/P7 leaf primordia suggests a role of Ha-GRASL in the initiation of median and basal axillary meristems (AMs) of sunflower. When Ha-GRASL is over-expressed in Arabidopsis wild-type plants, the number of lateral bolts increases differently from untransformed plants. However, Ha-GRASL slightly affects the lateral suppressor (las-4-) mutation. Therefore, we hypothesise that Ha-GRASL and LAS are not functionally equivalent. The over-expression of Ha-GRASL reduces metabolic flow of gibberellins (GAs) in Arabidopsis and this modification could be relevant in AM development. Phylogenetic analysis includes LAS and SCL4/7 in the same major clade, suggesting a more recent separation of these genes with respect to other GRAS members. We propose that some features of their ancestor, as well as AM initiation and outgrowth, are partially retained in both LAS and SCL4/7. © 2015 German Botanical Society and The Royal Botanical Society of the Netherlands.

Plantlet regeneration potential from seedling explants of vitegnus (Vitex agnus castus).

Science.gov (United States)

Chamandoosti, F

2007-11-15

In this research a simple and repeatable method for regeneration of a important medicinal plant (Vitex agnus castus) described. Different seedling explants such as hypocotyl, cotyledon, root and apical meristem were cultured in MS basal media with different kinds and concentrations of PGRs. Root and apical meristem explants were the only explants that have regeneration whole plantlets potential. It was interesting that regeneration whole plantlets from root and apical meristem explants have different developmental pathways. Whole plantlets from apical meristem explants regenerated by passing phase callusing whereas regeneration whole plantlets from root was direct and without phase callusing. This subject implies that we can have many manipulation possibilities in order to different objects of tissue culture by selecting different explants in vitegnus.

Why is intracellular ice lethal? A microscopical study showing evidence of programmed cell death in cryo-exposed embryonic axes of recalcitrant seeds of Acer saccharinum

CSIR Research Space (South Africa)

Wesley-Smith, J

2015-10-01

Full Text Available Walters3,*, N. W. Pammenter1 and Patricia Berjak1,‡ 1Plant Germplasm Conservation Research, School of Life Sciences, University of KwaZulu-Natal (Westville Campus), Durban, 4001 South Africa, 2National Centre for Nanostructured Materials, Council.... In roots, regrowth occurred from the ground meristem and procambium, not the distal meristem, which became lethally damaged. Regrowth of shoots occurred from isolated pockets of surviving cells of peripheral and pith meristems. The size of these pockets...

A quantitative and dynamic model for plant stem cell regulation.

Directory of Open Access Journals (Sweden)

Florian Geier

Full Text Available Plants maintain pools of totipotent stem cells throughout their entire life. These stem cells are embedded within specialized tissues called meristems, which form the growing points of the organism. The shoot apical meristem of the reference plant Arabidopsis thaliana is subdivided into several distinct domains, which execute diverse biological functions, such as tissue organization, cell-proliferation and differentiation. The number of cells required for growth and organ formation changes over the course of a plants life, while the structure of the meristem remains remarkably constant. Thus, regulatory systems must be in place, which allow for an adaptation of cell proliferation within the shoot apical meristem, while maintaining the organization at the tissue level. To advance our understanding of this dynamic tissue behavior, we measured domain sizes as well as cell division rates of the shoot apical meristem under various environmental conditions, which cause adaptations in meristem size. Based on our results we developed a mathematical model to explain the observed changes by a cell pool size dependent regulation of cell proliferation and differentiation, which is able to correctly predict CLV3 and WUS over-expression phenotypes. While the model shows stem cell homeostasis under constant growth conditions, it predicts a variation in stem cell number under changing conditions. Consistent with our experimental data this behavior is correlated with variations in cell proliferation. Therefore, we investigate different signaling mechanisms, which could stabilize stem cell number despite variations in cell proliferation. Our results shed light onto the dynamic constraints of stem cell pool maintenance in the shoot apical meristem of Arabidopsis in different environmental conditions and developmental states.

Modification of genetic effect of gamma-irradiation by electric current

International Nuclear Information System (INIS)

Grigor'eva, N.N.; Shakhbazov, V.G.

1983-01-01

The effect of direct current of different polarity on genetic sequels of #betta#-radiation of Vicia faba seedlings is studied. It is established that weak current might modify genetic sequels of #betta#-radiation. Protective current effect on irradiated meristem cells of seedlings manifests at negative polarization of the meristem before radiation and at positive polarization-after radiation. Modifying effect of electric current is brought about at the expense of redistribution of anions and cations between the meristem and other root zones

Irradiation damage and recovery in shoot apices of sweet cherry (Prunus avium L.)

International Nuclear Information System (INIS)

Saamin, S.; Thompson, M.M.

1990-01-01

Full text: Dormant scions of 'Bing' were exposed to fractionated 6kR gamma rays and then grafted. Irradiated and unirradiated main buds were sampled at 3 day intervals for one month. Buds were fixed in FAA, longitudinally sectioned, and stained with hematoxylin. Both random and localised cell damage was observed in irradiated apices. There was evidence of radiosensitivity gradient in the shoot apex. Recovery from irradiation damage was via flank meristem, central meristem, or leaf primordia and axillary meristems. (author)

Plant stem cell niches.

Science.gov (United States)

Stahl, Yvonne; Simon, Rüdiger

2005-01-01

Stem cells are required to support the indeterminate growth style of plants. Meristems are a plants stem cell niches that foster stem cell survival and the production of descendants destined for differentiation. In shoot meristems, stem cell fate is decided at the populational level. The size of the stem cell domain at the meristem tip depends on signals that are exchanged with cells of the organizing centre underneath. In root meristems, individual stem cells are controlled by direct interaction with cells of the quiescent centre that lie in the immediate neighbourhood. Analysis of the interactions and signaling processes in the stem cell niches has delivered some insights into the molecules that are involved and revealed that the two major niches for plant stem cells are more similar than anticipated.

The KNOXI Transcription Factor SHOOT MERISTEMLESS Regulates Floral Fate in Arabidopsis.

Science.gov (United States)

Roth, Ohad; Alvarez, John; Levy, Matan; Bowman, John L; Ori, Naomi; Shani, Eilon

2018-05-09

Plants have evolved a unique and conserved developmental program that enables the conversion of leaves into floral organs. Elegant genetic and molecular work has identified key regulators of flower meristem identity. However, further understanding of flower meristem specification has been hampered by redundancy and by pleiotropic effects. The KNOXI transcription factor SHOOT MERISTEMLESS (STM) is a well-characterized regulator of shoot apical meristem maintenance. Arabidopsis thaliana stm loss-of-function mutants arrest shortly after germination, and therefore the knowledge on later roles of STM in later processes, including flower development, is limited. Here, we uncover a role for STM in the specification of flower meristem identity. Silencing STM in the APETALA1 (AP1) expression domain in the ap1-4 mutant background resulted in a leafy-flower phenotype, and an intermediate stm-2 allele enhanced the flower meristem identity phenotype of ap1-4. Transcriptional profiling of STM perturbation suggested that STM activity affects multiple floral fate genes, among them the F-Box protein-encoding gene UNUSUAL FLORAL ORGANS (UFO). In agreement with this notion, stm-2 enhanced the ufo-2 floral fate phenotype, and ectopic UFO expression rescued the leafy flowers in genetic backgrounds with compromised AP1 and STM activities. This work suggests a genetic mechanism that underlies the activity of STM in the specification of flower meristem identity. © 2018 American Society of Plant Biologists. All rights reserved.

A WUSCHEL-Independent Stem Cell Specification Pathway Is Repressed by PHB, PHV and CNA in Arabidopsis

Science.gov (United States)

Lee, Chunghee; Clark, Steven E.

2015-01-01

The homeostatic maintenance of stem cells that carry out continuous organogenesis at the shoot meristem is crucial for plant development. Key known factors act to signal between the stem cells and an underlying group of cells thought to act as the stem cell niche. In Arabidopsis thaliana the homeodomain transcription factor WUSCHEL (WUS) is essential for stem cell initiation and maintenance at shoot and flower meristems. Recent data suggest that the WUS protein may move from the niche cells directly into the stem cells to maintain stem cell identity. Here we provide evidence for a second, previously unknown, pathway for stem cell specification at shoot and flower meristems that bypasses the requirement for WUS. We demonstrate that this novel stem cell specification pathway is normally repressed by the activity of the HD-zip III transcription factors PHABULOSA (PHB), PHAVOLUTA (PHV) and CORONA (CNA). When de-repressed, this second stem cell pathway leads to an accumulation of stem cells and an enlargement of the stem cell niche. When de-repressed in a wus mutant background, this second stem cell pathway leads to functional meristems with largely normal cell layering and meristem morphology, activation of WUS cis regulatory elements, and extensive, but not indeterminate, organogenesis. Thus, WUS is largely dispensable for stem cell specification and meristem function, suggesting a set of key stem cell specification factors, competitively regulated by WUS and PHB/PHV/CNA, remain unidentified. PMID:26011610

DOAP1 Promotes Flowering in the Orchid Dendrobium Chao Praya Smile.

Science.gov (United States)

Sawettalake, Nunchanoke; Bunnag, Sumontip; Wang, Yanwen; Shen, Lisha; Yu, Hao

2017-01-01

APETALA1 ( AP1 ) encodes a key MADS-box transcription factor that specifies the floral meristem identity on the flank of the inflorescence meristem, and determines the identity of perianth floral organs in the model plant Arabidopsis thaliana . Orchids are members of the Orchidaceae, one of the largest families of angiosperms. Although the expression patterns of a few AP1 -like genes in orchids have been reported, their actual functions in orchid reproductive development are so far largely unknown. In this study, we isolated and characterized an AP1 ortholog, DOAP1 , from Dendrobium Chao Praya Smile. DOAP1 was highly expressed in reproductive tissues, including inflorescence apices and flowers at various developmental stages. Overexpression of DOAP1 resulted in early flowering in Arabidopsis , and was able to rescue the floral organ defects of Arabidopsis ap1 mutants. Moreover, we successfully created transgenic Dendrobium Chao Praya Smile orchids overexpressing DOAP1 , which displayed earlier flowering and earlier termination of inflorescence meristems into floral meristems than wild-type orchids. Our results demonstrate that DOAP1 plays an evolutionarily conserved role in promoting flowering and floral meristem specification in the Orchidaceae family.

A genomic approach to elucidating grass flower development

Directory of Open Access Journals (Sweden)

Dornelas Marcelo C.

2001-01-01

Full Text Available In sugarcane (Saccharum sp as with other species of grass, at a certain moment of its life cycle the vegetative meristem is converted into an inflorescence meristem which has at least two distinct inflorescence branching steps before the spikelet meristem terminates in the production of a flower (floret. In model dicotyledonous species such successive conversions of meristem identities and the concentric arrangement of floral organs in specific whorls have both been shown to be genetically controlled. Using data from the Sugarcane Expressed Sequence Tag (EST Project (SUCEST database, we have identified all sugarcane proteins and genes putatively involved in reproductive meristem and flower development. Sequence comparisons of known flower-related genes have uncovered conserved evolutionary pathways of flower development and flower pattern formation between dicotyledons and monocotyledons, such as some grass species. We have paid special attention to the analysis of the MADS-box multigene family of transcription factors that together with the APETALA2 (AP2 family are the key elements of the transcriptional networks controlling plant reproductive development. Considerations on the evolutionary developmental genetics of grass flowers and their relation to the ABC homeotic gene activity model of flower development are also presented.

DOAP1 Promotes Flowering in the Orchid Dendrobium Chao Praya Smile

Science.gov (United States)

Sawettalake, Nunchanoke; Bunnag, Sumontip; Wang, Yanwen; Shen, Lisha; Yu, Hao

2017-01-01

APETALA1 (AP1) encodes a key MADS-box transcription factor that specifies the floral meristem identity on the flank of the inflorescence meristem, and determines the identity of perianth floral organs in the model plant Arabidopsis thaliana. Orchids are members of the Orchidaceae, one of the largest families of angiosperms. Although the expression patterns of a few AP1-like genes in orchids have been reported, their actual functions in orchid reproductive development are so far largely unknown. In this study, we isolated and characterized an AP1 ortholog, DOAP1, from Dendrobium Chao Praya Smile. DOAP1 was highly expressed in reproductive tissues, including inflorescence apices and flowers at various developmental stages. Overexpression of DOAP1 resulted in early flowering in Arabidopsis, and was able to rescue the floral organ defects of Arabidopsis ap1 mutants. Moreover, we successfully created transgenic Dendrobium Chao Praya Smile orchids overexpressing DOAP1, which displayed earlier flowering and earlier termination of inflorescence meristems into floral meristems than wild-type orchids. Our results demonstrate that DOAP1 plays an evolutionarily conserved role in promoting flowering and floral meristem specification in the Orchidaceae family. PMID:28386268

Conservação in vitro do germoplasma de capim-elefante por meio da micropropagação de meristemas axilares In vitro conservation of elephantgrass germplasm of micropropagation of axillary meristems

Directory of Open Access Journals (Sweden)

Maria Coletta Vidigal

1998-09-01

Full Text Available Na conservação m vitro do capim-elefante foi observado que, ao longo dos subcultivos sucessivos de meristemas picais, ocorre gradual perda de vigor nas plântulas. Essa limitação torna necessária a reintrodução de acessos na coleção, comprometendo a eficiência do processo. Visando solucionar o problema, foi conduzido um estudo com 51 cultivares de capimelefante, onde, na repicagem efetuada a cada 4 a 6 meses, foram inoculados meristemas axilares da plântula, dispostos horizontalmente sobre meio MS, adicionado ou não de ácido naftalenoacético (ANA. Neste ciclo, que durou 45 dias, foram avaliadas as seguintes variáveis: número e comprimento dos explantes, gemas brotadas por explante, início e vigor da brotação, número de brotos desenvolvidos e percentagem de morte. Os resultados sugerem que esse método melhorou o vigor acentuadamente; embora as respostas, com e sem adição de ANA ao meio, tenham sido muito variadas entre cultivares. Apenas a cv. Mercker Comum Pinda não apresentou resposta satisfatória, devendo ser futuramente submetida a outras alternativas para propagação. Com base na produção de brotos, as cvs. Napier e Sem Pêlo apresentaram o melhor desempenho, na presença de ANA. O método mostrou-se promissor também pelo uso mínimo de reguladores do crescimento, reduzindo custos e a possibilidade de mutações.The continuous utiliwtion of explants obtainedfrom cultured apical meristems limits elephantgrass in vitro conservation because of gradual loss of vigor. Such a restriction makes it necessary to periodícally replace accessions in the coilection, reducing the efficiency of the technique. To overcome this problem, a study was carried out with 51 elephantgrass cultivars, where reculturing was conducted every 4 to 6 months using in vitro seediing axiliary meristems, with or without the addition of naphtaleneacetic acid (NAA to the MS culture médium. During this reculturing cycle, which lasted 45 days, the

Identification of cyst nematode B-type CLE peptides and modulation of the vascular stem cell pathway for feeding cell formation

Science.gov (United States)

Stem cells are important in the continuous formation of various tissues during postembryonic organogenesis. Stem cell pools in the SAM (shoot apical meristem), RAM (root apical meristem) and vascular procambium/cambium are regulated by CLE-receptor kinase-WOX signaling modules. Previous data showed ...

Control of plant architecture by the TALE homeobox genes ATH1 and PENNYWISE

NARCIS (Netherlands)

Rutjens, B.P.W.

2007-01-01

In plants, pattern formation is an ongoing process that starts during embryogenesis and lasts the entire life span. Most of the plant adult body is formed post-embryonically by continuous organogenic potential of the root and shoot meristems. Proper shoot apical meristem (SAM) function requires

Epigenetic control of root and nodule development : the role of plant-specific histone deacetylases and LHP1 in root cell reprogramming

NARCIS (Netherlands)

Schilderink, S.

2012-01-01

In plants, unlike in animals, most organs develop post embryonically. These organs originate from clusters of undifferentiated dividing cells that form so-called meristems. Differentiated cells can be re-activated to enter the cell cycle and to ultimately give rise to new meristems. These

Mutations affecting the radial organisation of the Arabidopsis root display specific defects throughout the embryonic axis

NARCIS (Netherlands)

Scheres, B.J.G.; Di Laurenzio, L.; Willemsen, V.; Hauser, M.-T.; Janmaat, K.; Benfey, P.N.

1995-01-01

The primary root of Arabidopsis thaliana has a remarkably uniform cellular organisation. The fixed radial pattern of cell types in the mature root arises from proliferative divisions within the root meristem. The root meristem, in turn, is laid down during embryogenesis. We have analysed six

Leaf ontogeny of Schinus molle L. plants under cadmium contamination: the meristematic origin of leaf structural changes.

Science.gov (United States)

Pereira, Marcio Paulo; Corrêa, Felipe Fogaroli; de Castro, Evaristo Mauro; de Oliveira, Jean Paulo Vitor; Pereira, Fabricio José

2017-11-01

Previous works show the development of thicker leaves on tolerant plants growing under cadmium (Cd 2+ ) contamination. The aim of this study was to evaluate the Cd 2+ effects on the leaf meristems of the tolerant species Schinus molle. Plants were grown in nutrient solution containing 0, 10, and 50 μM of Cd 2+ . Anatomical analysis was performed on leaf primordia sampled at regular time intervals. Under the lowest Cd 2+ level (10 μM), increased ground meristem thickness, diameter of the cells, cell elongation rate, and leaf dry mass were found. However, 50 μM of Cd 2+ reduced all these variables. In addition, the ground meristem cells became larger when exposed to any Cd 2+ level. The epidermis, palisade parenchyma, and vascular tissues developed earlier in Cd 2+ -exposed leaves. The modifications found on the ground meristem may be related to the development of thicker leaves on S. molle plants exposed to low Cd 2+ levels. Furthermore, older leaves showed higher Cd 2+ content when compared to the younger ones, preventing the Cd 2+ toxicity to these leaves. Thus, low Cd 2+ concentrations change the ground meristem structure and function reflecting on the development of thicker and enhanced leaves.

Induction, development, and inhibition of radiation-induced macrobodies

International Nuclear Information System (INIS)

Adam, W.J.; Grunewald, R.

1975-01-01

Coleus shoots were exposed to 100,000 R of γ radiation and the fine structure of the apical meristems was examined. Meristems were fixed at various postirradiation times. An ultrastructural body was found associated with irradiated tissue, bound by a single membrane, containing dense osmiophilic bodies, and usually associated with radiation-induced vacuoles. The development of these new bodies, and the effects of both dose rate and light during the postirradiation period on their development were examined. Reduction of the dose rate by a factor of two inhibited the formation of these macrobodies through the 24 hour postirradiation period. Meristems kept in the dark during the 24 hour postirradiation period had macrobodies similar in form to the macrobodies from the meristems of the 16 hour postirradiation period which were exposed to light. Superlethal doses were used to achieve these results. Similarities between our results and those achieved with lower lethal doses are discussed

The Mutation Frequency in Different Spike Categories in Barley

DEFF Research Database (Denmark)

Frydenberg, O.; Doll, Hans; Sandfær, J.

1964-01-01

After gamma irradiation of barley seeds, a comparison has been made between the chlorophyll-mutant frequencies in X1 spikes that had multicellular bud meristems in the seeds at the time of treatment (denoted as pre-formed spikes) and X1 spikes having no recognizable meristems at the time...

Effects of herbivory on the reproductive effort of 4 prairie perennials

Directory of Open Access Journals (Sweden)

Bradley Kate L

2002-02-01

Full Text Available Abstract Background Herbivory can affect every aspect of a plant's life. Damaged individuals may show decreased survivorship and reproductive output. Additionally, specific plant species (legumes and tissues (flowers are often selectively targeted by herbivores, like deer. These types of herbivory influence a plant's growth and abundance. The objective of this study was to identify the effects of leaf and meristem removal (simulated herbivory within an exclosure on fruit and flower production in four species (Rhus glabra, Rosa arkansana, Lathyrus venosus, and Phlox pilosa which are known targets of deer herbivory. Results Lathyrus never flowered or went to seed, so we were unable to detect any treatment effects. Leaf removal did not affect flower number in the other three species. However, Phlox, Rosa, and Rhus all showed significant negative correlations between seed mass and leaf removal. Meristem removal had a more negative effect than leaf removal on flower number in Phlox and on both flower number and seed mass in Rosa. Conclusions Meristem removal caused a greater response than defoliation alone in both Phlox and Rosa, which suggests that meristem loss has a greater effect on reproduction. The combination of leaf and meristem removal as well as recruitment limitation by deer, which selectively browse for these species, is likely to be one factor contributing to their low abundance in prairies.

Repression of BLADE-ON-PETIOLE genes by KNOX homeodomain protein BREVIPEDICELLUS is essential for differentiation of secondary xylem in Arabidopsis root.

Science.gov (United States)

Woerlen, Natalie; Allam, Gamalat; Popescu, Adina; Corrigan, Laura; Pautot, Véronique; Hepworth, Shelley R

2017-06-01

Repression of boundary genes by KNOTTED1-like homeodomain transcription factor BREVIPEDICELLUS promotes the differentiation of phase II secondary xylem in Arabidopsis roots. Plant growth and development relies on the activity of meristems. Boundaries are domains of restricted growth that separate forming organs and the meristem. Class I KNOX homeodomain transcription factors are important regulators of meristem maintenance. Members of this class including BREVIDICELLUS also called KNOTTED-LIKE FROM ARABIDOPSIS THALIANA1 (BP/KNAT1) fulfill this function in part by spatially regulating boundary genes. The vascular cambium is a lateral meristem that allows for radial expansion of organs during secondary growth. We show here that BP/KNAT1 repression of boundary genes plays a crucial role in root secondary growth. In particular, exclusion of BLADE-ON-PETIOLE1/2 (BOP1/2) and other members of this module from xylem is required for the differentiation of lignified fibers and vessels during the xylem expansion phase of root thickening. These data reveal a previously undiscovered role for boundary genes in the root and shed light on mechanisms controlling wood development in trees.

Low temperature treatment affects concentration and distribution of chrysanthemum stunt viroid in Argyranthemum

Directory of Open Access Journals (Sweden)

Zhibo eZhang

2016-03-01

Full Text Available Chrysanthemum stunt viroid (CSVd can infect Argyranthemum and cause serious economic loss. Low temperature treatment combined with meristem culture has been applied to eradicate viroids from their hosts, but without success in eliminating CSVd from diseased Argyranthemum. The objectives of this work were to investigate 1 the effect of low temperature treatment combined with meristem culture on elimination of CSVd, 2 the effect of low temperature treatment on CSVd distribution pattern in shoot apical meristem (SAM, and 3 CSVd distribution in flowers and stems of two infected Argyranthemum cultivars. After treatment with low temperature combined with meristem tip culture, two CSVd-free plants were found in ‘Border Dark Red’, but none in ‘Yellow Empire’. With the help of in situ hybridization, we found that CSVd distribution patterns in the SAM showed no changes in diseased ‘Yellow Empire’ following 5oC treatment, compared with non-treated plants. However, the CSVd-free area in SAM was enlarged in diseased ‘Border Dark Red’ following prolonged 5oC treatment. Localization of CSVd in the flowers and stems of infected ‘Border Dark Red’ and ‘Yellow Empire’ indicated that seeds could not transmit CSVd in these two cultivars, and CSVd existed in phloem. Results obtained in the study contributed to better understanding of the distribution of CSVd in systemically infected plants and the combination of low temperature treatment and meristem tip culture for production of viroid-free plants.

In vitro propagation of cauliflower using curd microexplants.

Science.gov (United States)

Kieffer, Martin; Fuller, Michael P

2013-01-01

Cauliflower (Brassica oleracea var. botrytis) with its distinctive pre-inflorescence or curd is a remarkable member of the Brassica cabbage group. During curd development, intense and repetitive branching leads to a spectacular increase in size and the accumulation of millions of meristems at its surface. Although destined to produce flowers, most of these meristems are capable of regenerating vegetative shoots in vitro, making curd fragments an excellent material for the micropropagation of cauliflower. Most reported methods using these tissues were devised for the production of small clones of vitroplants as the true potential of curd fragments remained highly underestimated. We describe a technique exploiting fully this abundance of meristems and optimized for the large-scale in vitro propagation of cauliflower. The curd surface is first mechanically disrupted to break up the meristem clusters and generate microexplants carrying 1-3 meristems. These microexplants are then cultured at high density 1:100 (v:v) (microexplants:medium) in liquid medium containing Kinetin and indole-3-butyric acid (IBA) and produce thousands of microshoots in 12 days. After selecting the best quality microshoots on a sucrose pad, they are transferred en masse to a rooting medium supplemented with IBA. Four weeks later, rooted microshoots are carefully acclimatized before transfer to the field. This semi-automated protocol is rapid, cost effective, and well adapted for the production of clones of several thousands of plants by a single worker in a short space of time.

A 3D digital atlas of the Nicotiana tabacum root tip and its use to investigate changes in the root apical meristem induced by the Agrobacterium 6b oncogene.

Science.gov (United States)

Pasternak, Taras; Haser, Thomas; Falk, Thorsten; Ronneberger, Olaf; Palme, Klaus; Otten, Léon

2017-10-01

Using the intrinsic Root Coordinate System (iRoCS) Toolbox, a digital atlas at cellular resolution has been constructed for Nicotiana tabacum roots. Mitotic cells and cells labeled for DNA replication with 5-ethynyl-2'-deoxyuridine (EdU) were mapped. The results demonstrate that iRoCS analysis can be applied to roots that are thicker than those of Arabidopsis thaliana without histological sectioning. A three-dimensional (3-D) analysis of the root tip showed that tobacco roots undergo several irregular periclinal and tangential divisions. Irrespective of cell type, rapid cell elongation starts at the same distance from the quiescent center, however, boundaries between cell proliferation and transition domains are cell-type specific. The data support the existence of a transition domain in tobacco roots. Cell endoreduplication starts in the transition domain and continues into the elongation zone. The tobacco root map was subsequently used to analyse root organization changes caused by the inducible expression of the Agrobacterium 6b oncogene. In tobacco roots that express the 6b gene, the root apical meristem was shorter and radial cell growth was reduced, but the mitotic and DNA replication indexes were not affected. The epidermis of 6b-expressing roots produced less files and underwent abnormal periclinal divisions. The periclinal division leading to mature endodermis and cortex3 cell files was delayed. These findings define additional targets for future studies on the mode of action of the Agrobacterium 6b oncogene. © 2017 The Authors The Plant Journal © 2017 John Wiley & Sons Ltd.

Primary root growth in Arabidopsis thaliana is inhibited by the miR159 mediated repression of MYB33, MYB65 and MYB101.

Science.gov (United States)

Xue, Tao; Liu, Zhenhua; Dai, Xuehuan; Xiang, Fengning

2017-09-01

Organ growth is a fundamental developmental process basing on cell proliferation and differentiation. The growth of the plant root is sustained by the activity of the root meristem, a process controlled in part by various transcription factors. Here, the miR159 has been identified as a post transcriptional repressor of root growth, on the basis that the mir159ab double mutant developed a larger meristem than did the wild type, and that it formed longer roots. In the mutant, the abundance of MYB33, MYB65 and MYB101 transcript was substantially increased. When MYB33, MYB65 and MYB101 were replaced by the miR159-resistant forms mMYB33, mMYB65 and mMYB101 respectively, the root meristem was similarly enlarged and the growth of the primary root enhanced. MYB65 activity promoted cell division in the root meristem by accelerating the cell cycle. The data suggest that miR159 acts as a key repressor of the primary root's growth, acting through its repression of MYB65 and consequent blocking of the cell cycle. Copyright © 2017 Elsevier B.V. All rights reserved.

Transcription Factors Expressed in Lateral Organ Boundaries: Identification of Downstream Targets

Energy Technology Data Exchange (ETDEWEB)

Springer, Patricia S

2010-07-12

The processes of lateral organ initiation and patterning are central to the generation of mature plant form. Characterization of the molecular mechanisms underlying these processes is essential to our understanding of plant development. Communication between the shoot apical meristem and initiating organ primordia is important both for functioning of the meristem and for proper organ patterning, and very little is known about this process. In particular, the boundary between meristem and leaf is emerging as a critical region that is important for SAM maintenance and regulation of organogenesis. The goal of this project was to characterize three boundary-expressed genes that encode predicted transcription factors. Specifically, we have studied LATERAL ORGAN BOUNDARIES (LOB), LATERAL ORGAN FUSION1 (LOF1), and LATERAL ORGAN FUSION2 (LOF2). LOB encodes the founding member of the LOB-DOMAIN (LBD) plant-specific DNA binding transcription factor family and LOF1 and LOF2 encode paralogous MYB-domain transcription factors. We characterized the genetic relationship between these three genes and other boundary and meristem genes. We also used an ectopic inducible expression system to identify direct targets of LOB.

Combined impact of water column oxygen and temperature on internal oxygen status and growth of Zostera marina seedlings and adult shoots

DEFF Research Database (Denmark)

Raun, Ane-Marie Løvendahl; Borum, Jens

2013-01-01

Eelgrass (Zostera marina L.) occasionally experiences severe die-offs during warm summer periods with variable water column oxygen partial pressures (pO). Eelgrass is known to be very intolerant to tissue anoxia with reduced growth and increasing mortality after ≤12h anoxia in the dark...... at temperatures of ≥25°C. In the present study we experimentally examine the impact of combined water column oxygen and temperature on oxygen dynamics in leaf meristems of seedlings and adult shoots to better understand how stressful environmental conditions affect eelgrass oxygen dynamics and subsequent growth...... and mortality. There was a strong interaction between water column oxygen and temperature on meristem pO implying that eelgrass is rather resistant to unfavorable oxygen conditions in winter but becomes increasingly vulnerable in summer, especially at high temperatures. At 25°C meristems became anoxic...

DESFOLHAÇÃO DE PERFILHOS EM PASTO DE CAPIM-BRAQUIÁRIA SOB LOTAÇÃO CONTÍNUA

Directory of Open Access Journals (Sweden)

MANOEL EDUARDO ROZALINO SANTOS

2011-06-01

Full Text Available The objective of this study was to evaluate the number oftillers with different levels of defoliation and theircharacteristics on the Brachiaria decumbens cv. Basilisk pasture. Three different areas on the pasture (undergrazed, with proper grazing and overgrazed and three tiller categories (without defoliation, withdefoliation and without shoot apical meristem were evaluated. Randomized block design with three repetitions was used. The B. decumbens pasture was managed under the continuous stocking system with cattle, and the grass height was kept at about 25cm. Thenumber of tillers showing defoliation was higher (1,333 tillers/m² for the overgrazed area compared to the area with proper grazing and the undergrazed area. Inverse response pattern was observed for the tillers without defoliation. On the other hand, the number of tillerswithout the shoot apical meristem was higher in the areas with proper grazing (395 tillers/m². Tillers without defoliation showed a lower pseudoculm length (10.3cmand a smaller number of dead leaves (0.22 when compared to the other categories. The length of the leafblade did not change for the tiller categories evaluated. The number of grazed leaves was lower for tillers without the shoot apical meristem in relation to the ones showing or not defoliation. Lower leaf area for the tillers that had the shoot apical meristem removed was observed. Tillers without the shoot apical meristem showed a lowerpercentage of green leaf blade (GLB, higher percentages of both live culm (LC and dead leaf blade (DLB as well as a lower relation of the GLB/LC and weight comparing to the tillers showing or not defoliation. Those last ones did not differ regarding their morphological composition. There is indeed spatial variability of the vegetation andtiller diversity with varying levels of defoliation on Brachiaria decumbens cv. Basilisk pastures under continuous grazing.

Differences in proleptic and epicormic shoot structures in relation to water deficit and growth rate in almond trees (Prunus dulcis).

Science.gov (United States)

Negrón, Claudia; Contador, Loreto; Lampinen, Bruce D; Metcalf, Samuel G; Guédon, Yann; Costes, Evelyne; DeJong, Theodore M

2014-02-01

Shoot characteristics differ depending on the meristem tissue that they originate from and environmental conditions during their development. This study focused on the effects of plant water status on axillary meristem fate and flowering patterns along proleptic and epicormic shoots, as well as on shoot growth rates on 'Nonpareil' almond trees (Prunus dulcis). The aims were (1) to characterize the structural differences between proleptic and epicormic shoots, (2) to determine whether water deficits modify shoot structures differently depending on shoot type, and (3) to determine whether shoot structures are related to shoot growth rates. A hidden semi-Markov model of the axillary meristem fate and number of flower buds per node was built for two shoot types growing on trees exposed to three plant water status treatments. The models segmented observed shoots into successive homogeneous zones, which were compared between treatments. Shoot growth rates were calculated from shoot extension measurements made during the growing season. Proleptic shoots had seven successive homogeneous zones while epicormic shoots had five zones. Shoot structures were associated with changes in growth rate over the season. Water deficit (1) affected the occurrence and lengths of the first zones of proleptic shoots, but only the occurrence of the third zone was reduced in epicormic shoots; (2) had a minor effect on zone flowering patterns and did not modify shoot or zone composition of axillary meristem fates; and (3) reduced growth rates, although patterns over the season were similar among treatments. Two meristem types, with different latency durations, produced shoots with different growth rates and distinct structures. Differences between shoot type structure responses to water deficit appeared to reflect their ontogenetic characteristics and/or resource availability for their development. Tree water deficit appeared to stimulate a more rapid progression through ontogenetic states.

Radiobiological research on carnation chimerae Dianthus Caryophyllus L

International Nuclear Information System (INIS)

Pereau-Leroy, Pierre.

1975-01-01

A radiobiological study of periclinal carnation chimerae is carried out by subjecting whole plants and cuttings at different physiological stages to cobalt 60 gamma radiation under different dose and dose rate conditions. The effects of these treatments are observed during cultivation of the treated plants and by microscopic examination of irradiated meristem sections. The destruction of meristem cells in proportions varying with the irradiation conditions leads to structural changes in the chimerae; the more frequent change is the formation of genetically homogeneous stalks from different genotypes existing in the irradiated plant. Treatment by ionizing radiations is thus a practical means of detecting periclinical chimerae which, as in the case of carnations, are very common in plants grown by vegetative propagation. However since more than two independent meristem cell groups are usually present it is not possible by this method alone to define the distribution of the differentent genotypes in these groups; additional genetic studies or cell labelling such as chlorophyll or genoma mutations are then necessary [fr

Efficacy of Tissue Culture in Virus Elimination from Caprifig and Female Fig Varieties (Ficus carica L.

Directory of Open Access Journals (Sweden)

Chokri Bayoudh

2017-06-01

Full Text Available Fig mosaic disease (FMD is a viral disease that spreads in all Tunisian fig (Ficus carica L. orchards. RT-PCR technique was applied to leaf samples of 29 fig accessions of 15 fig varieties from the fig germplasm collection of High Agronomic Institute (I.S.A of Chatt-Mariem, to detect viruses associated to FMD. Analysis results show that 65.5% of the accessions (19/29 and 80.0% (12/15 of the fig varieties are infected by FMD-associated viruses. From all fig accessions, 41.4% of them are with single infection (one virus and 24.1% are with multi-infections (2 virus and more. Viruses infecting fig leaf samples are Fig mosaic virus (FMV (20.7%, Fig milde-mottle-associated virus (FMMaV (17.25%, Fig fleck associated virus (FFkaV (3.45%, and Fig cryptic virus (FCV (55.17%. A reliable protocol for FCV and FMMaV elimination from 4 local fig varieties Zidi (ZDI, Soltani (SNI, Bither Abiadh (BA, and Assafri (ASF via in vitro culture of 3 meristem sizes was established and optimized. With this protocol, global sanitation rates of 79.46%, 65.55%, 68.75%, and 70.83% respectively for ZDI, SNI, BA, and ASF are achieved. For all sanitized varieties, the effectiveness of meristem culture for the elimination of FCV and FMMaV viruses was related to meristem size. Meristem size 0.5 mm provides the highest sanitation rates ranging from 70% to 90%.

Regulation of plant cells, cell walls and development by mechanical signals

Energy Technology Data Exchange (ETDEWEB)

Meyerowitz, Elliot M. [California Inst. of Technology (CalTech), Pasadena, CA (United States)

2016-06-14

The overall goal of the revised scope of work for the final year of funding was to characterize cell wall biosynthesis in developing cotyledons and in the shoot apical meristem of Arabidopsis thaliana, as a way of learning about developmental control of cell wall biosynthesis in plants, and interactions between cell wall biosynthesis and the microtubule cytoskeleton. The proposed work had two parts – to look at the effect of mutation in the SPIRAL2 gene on microtubule organization and reorganization, and to thoroughly characterize the glycosyltransferase genes expressed in shoot apical meristems by RNA-seq experiments, by in situ hybridization of the RNAs expressed in the meristem, and by antibody staining of the products of the glycosyltransferases in meristems. Both parts were completed; the spiral2 mutant was found to speed microtubule reorientation after ablation of adjacent cells, supporting our hypothesis that reorganization correlates with microtubule severing, the rate of which is increased by the mutation. The glycosyltransferase characterization was completed and published as Yang et al. (2016). Among the new things learned was that primary cell wall biosynthesis is strongly controlled both by cell type, and by stage of cell cycle, implying not only that different, even adjacent, cells can have different sugar linkages in their (nonshared) walls, but also that a surprisingly large proportion of glycosyltransferases is regulated in the cell cycle, and therefore that the cell cycle regulates wall maturation to a degree previously unrecognized.

Root nodule structure in Chamaecytisus podolicus

Directory of Open Access Journals (Sweden)

Monika Skawińska

2017-06-01

Full Text Available By means of microscopic analyses, it was shown that root nodules formed by Chamaecytisus podolicus exhibited all structural features typical for indeterminate nodules of temperate genistean shrubs: (i apical nodule meristem composed of infected and non-infected domains, (ii parenchymatous bacteroid-containing tissue with infected cells only resulting from mitotic activity of infected meristematic cells, (iii absence of infection threads, and (iv convoluted bacteroids singly enclosed in a symbiosome membrane. For the first time, it was shown that the nodule meristem is organized into longitudinal files of sister cells.

OsRAMOSA2 Shapes Panicle Architecture through Regulating Pedicel Length

Directory of Open Access Journals (Sweden)

Huan Lu

2017-09-01

Full Text Available The panicle architecture of rice is an important characteristic that influences reproductive success and yield. It is largely determined by the number and length of the primary and secondary branches. The number of panicle branches is defined by the inflorescence meristem state between determinacy and indeterminacy; for example, the maize ramosa2 (ra2 mutant has more branches in its tassel through loss of spikelet determinacy. Some genes and factors influencing the number of primary and secondary branches have been studied, but little is known about the molecular mechanism underlying pedicel development, which also influences panicle architecture. We report here that rice OsRAMOSA2 (OsRA2 gene modifies panicle architecture through regulating pedicel length. Ectopic expression of OsRA2 resulted in a shortened pedicel while inhibition of OsRA2 through RNA interference produced elongated pedicel. In addition, OsRA2 influenced seed morphology. The OsRA2 protein localized to the nucleus and showed transcriptional activation in yeast; in accordance with its function in pedicel development, OsRA2 mRNA was enriched in the anlagen of axillary meristems, such as primary and secondary branch meristems and the spikelet meristems of young panicles. This indicates a conserved role of OsRA2 for shaping the initial steps of inflorescence architecture. Genetic analysis revealed that OsRA2 may control panicle architecture using the same pathway as that of the axillary meristem gene LAX1 (LAX PANICLE1. Moreover, OsRA2 acted downstream of RCN2 in regulating pedicel and branch lengths, but upstream of RCN2 for control of the number of secondary branches, indicating that branch number and length development in the panicle were respectively regulated using parallel pathway. Functional conservation between OsRA2 and AtLOB, and the conservation and diversification of RA2 in maize and rice are also discussed.

Processed fruit juice ready to drink: screening acute toxicity at the cellular level

Directory of Open Access Journals (Sweden)

Erick Leal da Silva

2017-06-01

Full Text Available The present study evaluated the acute toxicity at the cellular level of processed juice ready for consumption Orange and Grape flavors, produced by five companies with significant influence on the food market of South American countries, especially in Brazil. This evaluation was performed in root meristem cells of Allium cepa L., at the exposure times of 24 and 48 hours, directly with marketed liquid preparations. Based on the results, it was found that fruit juices, of all companies considered, promoted significant antiproliferative effect to root meristems at the exposure time of 24 hours and resulted in at both exposure times, statistically significant number of mitotic spindle changes and chromosomal breaks. Therefore, under the study conditions, all juice samples analyzed were cytotoxic, genotoxic and mutagenic to root meristem cells. These results indicate that such beverages have relevant potential to cause cellular disorders and, thus, need to be evaluated more fully in more complex test systems, as those in rodents, and then establish specific toxicity at the cellular level of these juices and ensure the well-being of those who consume them.

Lipid droplet-associated gene expression and chromatin remodelling in LIPASE 5'-upstream region from beginning- to mid-endodormant bud in 'Fuji' apple.

Science.gov (United States)

Saito, Takanori; Wang, Shanshan; Ohkawa, Katsuya; Ohara, Hitoshi; Ikeura, Hiromi; Ogawa, Yukiharu; Kondo, Satoru

2017-11-01

We found that lipid accumulation in the meristem region and the expression of MdLIP2A, which appears to be regulated by chromatin remodeling, coincided with endodormancy induction in the 'Fuji' apple. In deciduous trees, including apples (Malus × domestica Borkh.), lipid accumulation in the meristem region towards endodormancy induction has been thought to be an important process for the acquisition of cold tolerance. In this study, we conducted histological staining of crude lipids in the meristem region of 'Fuji' apples and found that lipid accumulation coincided with endodormancy induction. Since a major component of lipid bodies (triacylglycerol) is esterified fatty acids, we analysed fatty acid-derived volatile compounds and genes encoding fatty acid-modifying enzymes (MdLOX1A and MdHPL2A); the reduction of lipid breakdown also coincided with endodormancy induction. We then characterised the expression patterns of lipid body-regulatory genes MdOLE1 and MdLIP2A during endodormancy induction and found that the expression of MdLIP2A correlated well with lipid accumulation towards endodormancy induction. Based on these results, we conducted chromatin remodelling studies and localized the cis-element in the 5'-upstream region of MdLIP2A to clarify its regulatory mechanism. Finally, we revealed that chromatin was concentrated - 764 to - 862 bp of the 5'-upstream region of MdLIP2A, which harbours the GARE [gibberellin responsive MYB transcription factor binding site] and CArG [MADS-box transcription factor binding site] motifs-meristem development-related protein-binding sites.

Flowering pathway is regulated by bulb size in Lilium longiflorum (Easter lily).

Science.gov (United States)

Lazare, S; Zaccai, M

2016-07-01

Lilium longiflorum (Easter lily) vegetative propagation occurs through production of underground bulbs containing apical and axillary meristems. In addition, sexual reproduction is achieved by flowering of elongated shoots above the bulb. It is generally accepted that L. longiflorum has an obligatory requirement for vernalisation and that long day (LD) regime hastens flowering. However, the effect of bulb size and origin, with respect to axillary or apical meristems on flowering, as well as the interactions between these meristems are largely unknown. The aim of this study was to explore the effect of bulb size, vernalisation and photoperiod on L. longiflorum flowering. To this end, we applied vernalisation and photoperiod treatments to the different bulb sizes and used a system of constant ambient temperature of 25 °C, above vernalisation spectrum, to avoid cold-dependent floral induction during plant growth. Vernalisation and LD hasten flowering in all bulbs. Large, non-vernalised bulbs invariably remained at a vegetative stage. However, small non-vernalised bulbs flowered under LD conditions. These results demonstrate for the first time that cold exposure is not an obligatory prerequisite for L. longiflorum flowering, and that an alternative flowering pathway can bypass vernalisation in small bulbs. We suggest that apical dominance interactions determine the distinct flowering pathways of the apical and axillary meristems. Similar floral induction is achieved in propagated bulblets from scaling. These innovative findings in the field of geophyte floral induction represent valuable applicative knowledge for lily production. © 2016 German Botanical Society and The Royal Botanical Society of the Netherlands.

Use of Tissue Culture Techniques for Producing Virus-Free Plant in Garlic and Their Identification through Real-Time PCR

Directory of Open Access Journals (Sweden)

Hatıra Taşkın

2013-01-01

Full Text Available This study was performed for comparison of meristem culture technique with shoot tip culture technique for obtaining virus-free plant, comparison of micropropagation success of two different nutrient media, and determination of effectiveness of real-time PCR assay for the detection of viruses. Two different garlic species (Allium sativum and Allium tuncelianum and two different nutrient media were used in this experiment. Results showed that Medium 2 was more successful compared to Medium 1 for both A. tuncelianum and A. sativum (Kastamonu garlic clone. In vitro plants obtained via meristem and shoot tip cultures were tested for determination of onion yellow dwarf virus (OYDV and leek yellow stripe virus (LYSV through real-time PCR assay. In garlic plants propagated via meristem culture, we could not detect any virus. OYDV and LYSV viruses were detected in plants obtained via shoot tip culture. OYDV virus was observed in amount of 80% and 73% of tested plants for A. tuncelianum and A. sativum, respectively. LYSV virus was found in amount of 67% of tested plants of A. tuncelianum and in amount of 87% of tested plants of A. sativum in this study.

Radiation damage and induced tetraploidy in mulberry (Morus alba L.)

International Nuclear Information System (INIS)

Katagiri, K.

1976-01-01

Vigorously growing mulberry shoots were exposed to 5 kR of gamma rays at the rate of 0.2 kR/hr and 5.0 kR/hr and successively pruned three times in two growing seasons. The most radiosensitive part of both the apical and axillary meristems was the second cell layer. The younger axillary bud primordia were more sensitive to radiation then the older ones. Recovery from radiation damage was assumed to be from the flank meristem in the shoot apex. The frequency of mutations was much lower than that of tetraploidy. Among the tetraploids 50% were 2-4-4 chimeras. (author)

Meristem Culture of Aloe vera L

International Nuclear Information System (INIS)

Kay Thi Mya; Thida Myint; Myo Han; Khin Maung Sein

2005-10-01

Shoot tips of Aloe vera L were excised and inoculated in basal and modified MS (Murashige and Skoog, 1962) medium. Growth regulators and growth factors were supplemented to the basal medium. Development of explants, initiation of callus and multiplication of shoots in culture were recorded.

ORF Sequence: NC_003070 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_003070 gi|18407972 >gi|18407972|ref|NP_564823.1| no apical meristem (NAM) famil...y protein [Arabidopsis thaliana] MQAEEIICRVSDEEIIENYLRPKINGETSSIPRYVVELAEELYTVEPWLLPRQTAPILNPGEWFYFGKRNRKYSN

Analysis of AtGUS1 and AtGUS2 in Arabidopsis root apex by a highly sensitive TSA-MISH method.

Science.gov (United States)

Bruno, Leonardo; Ronchini, Matteo; Gagliardi, Olimpia; Corinti, Tamara; Chiappetta, Adriana; Gerola, Paolo; Bitonti, Maria B

2015-01-01

A new highly sensitive whole-mount in situ hybridization method, based on tyramide signal amplification (TSA-MISH) was developed and a combined GFP detection and TSA-MISH procedure was applied for the first time in plants, to precisely define the spatial pattern of AtGUS1 and AtGUS2 expression in the root apex. β-glucuronidases (GUSs) belonging to the glycosyl hydrolases (GHs) 79 family, are widely distributed in plants, but their functional role has not yet been fully investigated. In the model system Arabidopsis Thaliana, three different AtGUS genes have been identified which encode proteins with putative different fates. Endogenous GUS expression has been detected in different organs and tissues, but the cyto-histological domains of gene expression remain unclear. The results here reported show co-expression of AtGUS1 and AtGUS2 in different functional zones of the root apex (the cap central zone, the root cap meristem, the staminal cell niche and the cortical cell layers of the proximal meristem), while AtGUS2 is exclusively expressed in the cap peripheral layer and in the epidermis in the elongation zone. Interestingly, both genes are not expressed in the stelar portion of the proximal meristem. A spatial (cortex vs. stele) and temporal (proximal meristem vs. transition zone) regulation of AtGUS1 and AtGUS2 expression is therefore active in the root apex. This expression pattern, although globally consistent with the involvement of GUS activity in both cell proliferation and elongation, clearly indicates that AtGUS1 and AtGUS2 could control distinct downstream process depending on the developmental context and the interaction with other players of root growth control. In the future, the newly developed approaches may well be very useful to dissect such interactions.

Non-linear character of dose dependences of chromosome aberration frequency in radiation-damaged root

International Nuclear Information System (INIS)

Kravets, E.A.; Berezhnaya, V.V.; Sakada, V.I.; Rashidov, N.M.; Grodzinskij, D.M.; Kravets, E.A.; Berezhnaya, V.V.; Sakada, V.I.; Rashidov, N.M.; Grodzinskij, D.M.

2012-01-01

The dose dependences of the aberrant anaphases in the root meristem in 48 hours after the irradiation have non-linear character and a plateau in the region about 6-8 Gy. The plateau indicates the activation of recovery processes. In the plateau range, the level of damages for this genotype is 33% for aberrant anaphases (FAA), 2.3 aberrations per aberrant anaphase (A/AC), and 0.74 aberrations for the total number of anaphases. At 10 Gy, the dose curve forms the exponential region caused by the involvement of the large number of new cells with unrepaired damages in the mutation process. The increase of A/AC to 1.1 indicate the ''criticality'' of the meristem radiation damage.

Obtainment of sugarcane (Saccharum spp. hybrid biotechnological seed of high genetic and phytosanitary quality in Ecuador

Directory of Open Access Journals (Sweden)

Miguel M. Ramos-Leal

2015-01-01

Full Text Available Methods for obtaining healthy plants are mainly based on the combined use of meristem in vitro culture and hydrothermotherapy. This work was carried out in order to obtain free- pathogen plants for using as seeds, emphasizing ratoon stunting disease (RSD of sugarcane. The work was performed using a group of sugarcane cultivars, which was confirmed the variety identification by means of peroxidases isozymes electrophoretic patterns. Plant sanitation was performed in three successive steps by means of hydrothermal treatment at 52 oC during 2h and using the fungicide vitavax, a second hydrothermal treatment at 51 °C during 10 min to the meristem and a third step in which vitroplantlets were propagated in presence of the antibiotic gentamicin. RSD detection was done by using the staining transpiration methods (STM of functional bundles. Results allowed the creation of a germoplasm bank of sugarcane plants free of the most important systemic bacterial pathogens, with high genetic quality, which provided basic seed of excellent quality for establishing seedlings. Conservation included an in vitro-plantlets bank and the creation of a "DNA bank" which allows preserving the genetic fond in laboratory conditions. Finally a methodology for obtaining free-pathogens plants from buds and meristems is included.

Arabidopsis phyllotaxis is controlled by the methyl-esterification status of cell-wall pectins.

Science.gov (United States)

Peaucelle, Alexis; Louvet, Romain; Johansen, Jorunn N; Höfte, Herman; Laufs, Patrick; Pelloux, Jérome; Mouille, Grégory

2008-12-23

Plant organs are produced from meristems in a characteristic pattern. This pattern, referred to as phyllotaxis, is thought to be generated by local gradients of an information molecule, auxin. Some studies propose a key role for the mechanical properties of the cell walls in the control of organ outgrowth. A major cell-wall component is the linear alpha-1-4-linked D-GalAp pectic polysaccharide homogalacturonan (HG), which plays a key role in cell-to-cell cohesion. HG is deposited in the cell wall in a highly (70%-80%) methyl-esterified form and is subsequently de-methyl-esterified by pectin methyl-esterases (PME, EC 3.1.1.11). PME activity is itself regulated by endogenous PME inhibitor (PMEI) proteins. PME action modulates cell-wall-matrix properties and plays a role in the control of cell growth. Here, we show that the formation of flower primordia in the Arabidopsis shoot apical meristem is accompanied by the de-methyl-esterification of pectic polysaccharides in the cell walls. In addition, experimental perturbation of the methyl-esterification status of pectins within the meristem dramatically alters the phyllotactic pattern. These results demonstrate that regulated de-methyl-esterification of pectins is a key event in the outgrowth of primordia and possibly also in phyllotactic patterning.

Cytosolic glyceraldehyde-3-phosphate dehydrogenases play crucial roles in controlling cold-induced sweetening and apical dominance of potato (Solanum tuberosum L.) tubers.

Science.gov (United States)

Liu, Tengfei; Fang, Hui; Liu, Jun; Reid, Stephen; Hou, Juan; Zhou, Tingting; Tian, Zhendong; Song, Botao; Xie, Conghua

2017-12-01

Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) is an important enzyme that functions in producing energy and supplying intermediates for cellular metabolism. Recent researches indicate that GAPDHs have multiple functions beside glycolysis. However, little information is available for functions of GAPDHs in potato. Here, we identified 4 putative cytosolic GAPDH genes in potato genome and demonstrated that the StGAPC1, StGAPC2, and StGAPC3, which are constitutively expressed in potato tissues and cold inducible in tubers, encode active cytosolic GAPDHs. Cosuppression of these 3 GAPC genes resulted in low tuber GAPDH activity, consequently the accumulation of reducing sugars in cold stored tubers by altering the tuber metabolite pool sizes favoring the sucrose pathway. Furthermore, GAPCs-silenced tubers exhibited a loss of apical dominance dependent on cell death of tuber apical bud meristem (TAB-meristem). It was also confirmed that StGAPC1, StGAPC2, and StGAPC3 interacted with the autophagy-related protein 3 (ATG3), implying that the occurrence of cell death in TAB-meristem could be induced by ATG3 associated events. Collectively, the present research evidences first that the GAPC genes play crucial roles in diverse physiological and developmental processes in potato tubers. © 2017 John Wiley & Sons Ltd.

Agricultural biotechnology research and development in Ethiopia

African Journals Online (AJOL)

PRECIOUS

2009-12-29

Dec 29, 2009 ... Review. Agricultural biotechnology research and development in Ethiopia ... seed micropropagation, virus-cleaning ongoing, good progress. Garlic meristem ... large quantities of disease-free planting materials in short time.

Building A NGS Genomic Resource: Towards Molecular Breeding In L. Perenne

DEFF Research Database (Denmark)

Ruttink, Tom; Roldán-Ruiz, Isabel; Asp, Torben

To advance the application of molecular breeding in Lolium perenne, we have generated a sequence resource to facilitate gene discovery and SNP marker development. Illumina GAII transcriptome sequencing was performed on meristem-enriched samples of 14 Lolium genotypes. De novo assemblies for indiv......To advance the application of molecular breeding in Lolium perenne, we have generated a sequence resource to facilitate gene discovery and SNP marker development. Illumina GAII transcriptome sequencing was performed on meristem-enriched samples of 14 Lolium genotypes. De novo assemblies...... of SNP markers in selected candidate genes. In parallel, a germplasm collection of 602 Lolium genotypes was established and is being phenotyped for plant architecture, reproductive characteristics, flowering time, and forage quality traits. We will test through association genetics whether phenotypic...

Cytokinin response factors regulate PIN-FORMED auxin transporters

Czech Academy of Sciences Publication Activity Database

Šimášková, M.; O'Brien, J.A.; Khan, M.; Van Noorden, G.; Ötvös, K.; Vieten, A.; De Clercq, E.; Van Haperen, J.M.A.; Cuesta, C.; Hoyerová, Klára; Vanneste, S.; Marhavý, P.; Wabnik, K.; Van Breusegem, F.; Nowack, M.; Murphy, A.; Friml, J.; Weijers, D.; Beeckman, T.; Benková, E.

2015-01-01

Roč. 6, NOV (2015), s. 8717 ISSN 2041-1723 Institutional support: RVO:61389030 Keywords : ARABIDOPSIS -THALIANA * ROOT-MERISTEM * TRANSCRIPTION FACTORS Subject RIV: ED - Physiology Impact factor: 11.329, year: 2015

In vitro propagation of chungah (caralluma tuberculata n.e. brown)

International Nuclear Information System (INIS)

Rehman, R.

2014-01-01

In vitro propagation of Caralluma tuberculata (Chungah) was developed from shoot tip and meristem explants. C. tuberculata is an imperative medicinal plant comprising antidiabetic and anticancer properties. The explants were inoculated on Murashige and Skoog (MS) medium containing different plant growth regulators. Presence of BA or Kin alone in the MS medium did not favor regeneration of shoot from both explants. However, addition of 2,4-dichlorophenoxy acetic acid (2,4-D), gibberellic acid (GA3) and thidiazuron (TDZ) along with 6-benzyl amino purine (BA) or kinetin (Kin) in the medium exhibited significant percentage response, number of shoots per explant and shoot length. Maximum shooting response (53.3+-5.77% from meristem and shoot tip explants each) with highest number of shoots per explant (5.33+-2.08 and 5.6+-2.52 from meristem and shoot tip explants, respectively) were observed at 13.32 micro mol BA along with 2.26 micro mol 2,4-D, 2.89 micro mol GA3 and 9.08*10-3 micro mol TDZ. Replacing BA with kin showed less shoot regeneration response and number of shoots per explant, however, shoots length markedly increased in the presence of Kin. The regenerated plants were successfully rooted and acclimatized in ex vitro condition. The protocol described here can be used for fast multiplication of this endangered herb and genetic transformation. (author)

The milkweed pod1 Gene Encodes a KANADI Protein That Is Required for Abaxial/Adaxial Patterning in Maize Leaves[W

Science.gov (United States)

Candela, Héctor; Johnston, Robyn; Gerhold, Abigail; Foster, Toshi; Hake, Sarah

2008-01-01

Leaf primordia initiate from the shoot apical meristem with inherent polarity; the adaxial side faces the meristem, while the abaxial side faces away from the meristem. Adaxial/abaxial polarity is thought to be necessary for laminar growth of leaves, as mutants lacking either adaxial or abaxial cell types often develop radially symmetric lateral organs. The milkweed pod1 (mwp1) mutant of maize (Zea mays) has adaxialized sectors in the sheath, the proximal part of the leaf. Ectopic leaf flaps develop where adaxial and abaxial cell types juxtapose. Ectopic expression of the HD-ZIPIII gene rolled leaf1 (rld1) correlates with the adaxialized regions. Cloning of mwp1 showed that it encodes a KANADI transcription factor. Double mutants of mwp1-R with a microRNA-resistant allele of rld1, Rld1-N1990, show a synergistic phenotype with polarity defects in sheath and blade and a failure to differentiate vascular and photosynthetic cell types in the adaxialized sectors. The sectored phenotype and timing of the defect suggest that mwp1 is required late in leaf development to maintain abaxial cell fate. The phenotype of mwp1; Rld1 double mutants shows that both genes are also required early in leaf development to delineate leaf margins as well as to initiate vascular and photosynthetic tissues. PMID:18757553

The milkweed pod1 gene encodes a KANADI protein that is required for abaxial/adaxial patterning in maize leaves.

Science.gov (United States)

Candela, Héctor; Johnston, Robyn; Gerhold, Abigail; Foster, Toshi; Hake, Sarah

2008-08-01

Leaf primordia initiate from the shoot apical meristem with inherent polarity; the adaxial side faces the meristem, while the abaxial side faces away from the meristem. Adaxial/abaxial polarity is thought to be necessary for laminar growth of leaves, as mutants lacking either adaxial or abaxial cell types often develop radially symmetric lateral organs. The milkweed pod1 (mwp1) mutant of maize (Zea mays) has adaxialized sectors in the sheath, the proximal part of the leaf. Ectopic leaf flaps develop where adaxial and abaxial cell types juxtapose. Ectopic expression of the HD-ZIPIII gene rolled leaf1 (rld1) correlates with the adaxialized regions. Cloning of mwp1 showed that it encodes a KANADI transcription factor. Double mutants of mwp1-R with a microRNA-resistant allele of rld1, Rld1-N1990, show a synergistic phenotype with polarity defects in sheath and blade and a failure to differentiate vascular and photosynthetic cell types in the adaxialized sectors. The sectored phenotype and timing of the defect suggest that mwp1 is required late in leaf development to maintain abaxial cell fate. The phenotype of mwp1; Rld1 double mutants shows that both genes are also required early in leaf development to delineate leaf margins as well as to initiate vascular and photosynthetic tissues.

Effects of PEG-Induced Water Deficit in Solanum nigrum on Zn and Ni Uptake and Translocation in Split Root Systems

Directory of Open Access Journals (Sweden)

Urs Feller

2015-06-01

Full Text Available Drought strongly influences root activities in crop plants and weeds. This paper is focused on the performance of the heavy metal accumulator Solanum nigrum, a plant which might be helpful for phytoremediation. The water potential in a split root system was decreased by the addition of polyethylene glycol (PEG 6000. Rubidium, strontium and radionuclides of heavy metals were used as markers to investigate the uptake into roots, the release to the shoot via the xylem, and finally the basipetal transport via the phloem to unlabeled roots. The uptake into the roots (total contents in the plant was for most makers more severely decreased than the transport to the shoot or the export from the shoot to the unlabeled roots via the phloem. Regardless of the water potential in the labeling solution, 63Ni and 65Zn were selectively redistributed within the plant. From autoradiographs, it became evident that 65Zn accumulated in root tips, in the apical shoot meristem and in axillary buds, while 63Ni accumulated in young expanded leaves and roots but not in the meristems. Since both radionuclides are mobile in the phloem and are, therefore, well redistributed within the plant, the unequal transfer to shoot and root apical meristems is most likely caused by differences in the cell-to-cell transport in differentiation zones without functional phloem (immature sieve tubes.

Cytogenetic and identification of the nucleolus organizer region in Heliconia bihai (L. L.

Directory of Open Access Journals (Sweden)

Heloisa Rocha do Nascimento

2014-08-01

Full Text Available The genus Heliconia is not much studied and the number of existing species in this genus is still uncertain. It is known that this number relies between 150 to 250 species. In Brazil, about 40 species are native and known by many different names. The objective of this paper was to characterize morphometrically and to identify the NOR (active nucleolus organizer regions by Ag-NOR banding of chromosomes of Heliconia bihai (L L. Root meristems were submitted to blocking treatment in an amiprofos-methyl (APM solution, fixed in methanol-acetic acid solution for 24 hours, at least. The meristems were washed in distilled water and submitted to enzymatic digestion with pectinase enzyme. The slides were prepared by dissociation of the root meristem, dried in the air and also on hot plate at 50°C. Subsequently, some slides were submitted to 5% Giemsa stain for karyotype construction and to a solution of silver nitrate (AgNO3 50% for Ag-NOR banding. The species H. bihai has 2n = 22 chromosomes, 4 pairs of submetacentric chromosomes and 7 pairs of metacentric chromosomes, and graded medium to short (3.96 to 0.67 μM, with the presence of active NOR in pairs 1 and 2 and interphase cells with 2 nucleoli. These are the features of a diploid species.

Antiproliferative and genotoxic effects of nature identical and artificial synthetic food additives of aroma and flavor

Directory of Open Access Journals (Sweden)

R. D. M. Nunes

Full Text Available Abstract This study aimed to analyze the antiproliferative and genotoxic potential of synthetic food flavorings, nature identical passion fruit and artificial vanilla. This assessment used root meristem cells of Allium cepa L., in exposure times of 24 and 48 hours and using doses of 0.2; 0.4 and 0.6 mL. Roots were fixed in Carnoy’s solution, hydrolyzed in hydrochloric acid, stained with acetic orcein and analyzed with optical microscope at 400× magnification, 5,000 cells for each treatment. For data analysis, it was used Chi-square test at 5%. Doses of 0.2 mL at ET 48 h; 0.4 and 0.6 mL at ET 24 and 48 h of passion fruit flavor, and the three doses of the vanilla flavor at ET 24 and 48 h significantly reduced the cell division rate in the meristems of roots, proving to be cytotoxic. Doses of 0.2; 0.4 and 0.6 mL of the passion fruit additive, and the three doses of vanilla tested, in the two exposure times, induced mitotic spindle changes and micronuclei formation in the cells of the test organism used, proving to be genotoxic. Therefore, under the studied conditions, flavoring solutions of vanilla and passion fruit, marketed nationally and internationally, significantly altered the functioning of the cell cycle in root meristem cells of A. cepa.

Capsicum annuum S (CaS) promotes reproductive transition and is required for flower formation in pepper (Capsicum annuum).

Science.gov (United States)

Cohen, Oded; Borovsky, Yelena; David-Schwartz, Rakefet; Paran, Ilan

2014-05-01

The genetic control of the transition to flowering has mainly been studied in model species, while few data are available in crop species such as pepper (Capsicum spp.). To elucidate the genetic control of the transition to flowering in pepper, mutants that lack flowers were isolated and characterized. Genetic mapping and sequencing allowed the identification of the gene disrupted in the mutants. Double mutants and expression analyses were used to characterize the relationships between the mutated gene and other genes controlling the transition to flowering and flower differentiation. The mutants were characterized by a delay in the initiation of sympodial growth, a delay in the termination of sympodial meristems and complete inhibition of flower formation. Capsicum annuum S (CaS), the pepper (Capsicum annuum) ortholog of tomato (Solanum lycopersicum) COMPOUND INFLORESCENCE and petunia (Petunia hybrida) EVERGREEN, was found to govern the mutant phenotype. CaS is required for the activity of the flower meristem identity gene Ca-ANANTHA and does not affect the expression of CaLEAFY. CaS is epistatic over other genes controlling the transition to flowering with respect to flower formation. Comparative homologous mutants in the Solanaceae indicate that CaS has uniquely evolved to have a critical role in flower formation, while its role in meristem maturation is conserved in pepper, tomato and petunia. © 2014 The Authors. New Phytologist © 2014 New Phytologist Trust.

Micropropagation of Plectranthus edulis (Vatke) Agnew from ...

African Journals Online (AJOL)

SAM

2014-09-03

Sep 3, 2014 ... Key words: In vitro propagation, meristem culture, micropropagation, Plectranthus edulis (Vatke) Agnew, shoots multiplication. ... P. edulis showed the occurrence of diseases (Taye,. 2008). ..... Asian J. Plant Sci. 2:616-622.

Meristematic activity of the Endodermis and the Pericycle in the primary thickening in monocotyledons: considerations on the "PTM"

Directory of Open Access Journals (Sweden)

Nanuza L. de Menezes

2005-06-01

Full Text Available This paper proposes a new interpretation for primary thickening in monocotyledons. The anatomy of the vegetative organs of the following species was examined: Cephalostemon riedelianus (Rapataceae, Cyperus papyrus (Cyperaceae, Lagenocarpus rigidus, L. junciformis (Cyperaceae, Echinodorus paniculatus (Alismataceae and Zingiber officinale (Zingiberaceae. The endodermis with meristematic activity was observed in the root of all the species, in the stem of Cyperus, Cephalostemum and Lagenocarpus rigidus, and in the leaf trace of Cyperus and leaf of Echinodorus. Considering the continuity of tissues through the root, stem and leaf, the authors conclude that in the stem the pericycle remains active throughout the life of the plant as the generator of the vascular tissue. The "Primary Thickening Meristem" is in fact the pericycle plus the endodermis and its derivatives (or only the pericycle. Close to the stem apex, the assemblage of seems to be a unique meristem, giving rise to the inner cortex and vascular tissues.A proposta deste trabalho é mostrar uma nova interpretação do meristema de espessamento primário em monocotiledôneas. Anatomia dos órgãos vegetativos das seguintes espécies foi examinada: Cephalostemon riedelianus (Rapataceae, Cyperus papyrus (Cyperaceae, Lagenocarpus rigidus, L. Junciformis (Cyperaceae, Echinodorus paniculatus (Alismataceae and Zingiberofficinale (Zingiberaceae. A atividade meristemática da endoderme foi observada nas raizes de todas as espécies, no caule de Cyperus, Cephalostemum e Lagenocarpus rigidus, e no traço foliar de Cyperus e folha de Echinodorus. Considerando a continuidade dos tecidos através da raiz, caule e folha, as autoras concluem que no caule o periciclo permanece ativo durante a vida da planta, como um gerador de tecidos vasculares. O "Meristema de Espessamento Primário" é o periciclo em fase meristemática, juntamente com a endoderme e suas derivadas (ou apenas o periciclo. Próximo ao �

Plant regeneration of natural tetraploid Trifolium  Hum pratense L

Directory of Open Access Journals (Sweden)

HATICE ÇÖLGEÇEN

2008-01-01

Full Text Available The regeneration of natural tetraploid T. pratense, originated from Erzurum-Turkey, is reported in this study. This plant has low seed setting and hard seed problems due to polyploidy. Hypocotyl, cotyledon, apical meristems, epicotyl and young primary leaves were inoculated on MS and PC-L2 media containing different concentrations of BAP and NAA as growth regulators. The best shoot formation has been observed on explants initiated from apical meristem placed on PC-L2 medium that includes 2 mg dm-3 BAP and 1 mg dm-3 NAA. 94.4% of the shoots originated from calli were rooted on PC-L2 medium with 1 mg dm-3 NAA. In vitro organogénesis has been accomplished in the natural tetraploid T. pratense regenerated plants successively transferred to the field

VEGETATIVE1 is essential for development of the compound inflorescence in pea

DEFF Research Database (Denmark)

Berbel, Ana; Ferrandiz, Cristina; Hecht, Valerie

2012-01-01

Unravelling the basis of variation in inflorescence architecture is important to understanding how the huge diversity in plant form has been generated. Inflorescences are divided between simple, as in Arabidopsis, with flowers directly formed at the main primary inflorescence axis, and compound......, as in legumes, where they are formed at secondary or even higher order axes. The formation of secondary inflorescences predicts a novel genetic function in the development of the compound inflorescences. Here we show that in pea this function is controlled by VEGETATIVE1 (VEG1), whose mutation replaces...... secondary inflorescences by vegetative branches. We identify VEG1 as an AGL79-like MADS-box gene that specifies secondary inflorescence meristem identity. VEG1 misexpression in meristem identity mutants causes ectopic secondary inflorescence formation, suggesting a model for compound inflorescence...

Uses of in vitro propagation for crop improvement

International Nuclear Information System (INIS)

Lazarte, J.E.

1984-01-01

For crop improvement the uses of tissue culture are multiple; tissue culture alone is important in clonal propagation and for developing new genotypes. Together with other techniques such as the ones used in mutation breeding, tissue culture will increase the chance for mutations to occur by increasing the number of meristems per area of treatment. With this combination of techniques there is the possibility of developing better crops in a shorter period, thus complementing the work done by nature and by traditional breeding methodology. This is important since world population is expected to double by the year 2000, which is only 18 years away. Tissue culture is a general term used to describe any method of aseptic culture, i.e. meristem, callus, cell, shoot tip, anther culture, etc

Histology study of the somatic embryogenesis in Agave fourcroydes Lem.

Directory of Open Access Journals (Sweden)

Silvia Alemán García

2002-01-01

Full Text Available A histological study of the structures embryogenic formed from meristem of Agave fourcroydes, with the objective of observing the behavior of the somatic embryogenesis from the induction until the formation of the embryo was carried out. The meristem cultivated in vitro was subculture in modified MS medium the induction. The samples to be included intheresinJB–4weretakenperiodically.Thehistologicalscutsof5-10µmwerecarriedoutwithrotatorymicrotome and strained in 2% toluidine blue. The sections were observed and photographed in light microscopy Axioplan Zeiis with increases of 20X. The results show to the 60 days of culture the presence of cells meristematic pre-embrygenic. Embryos in different phases of formation globular and scutellum were observed in all the mass of the callus in the following subculture. Key words: Agavaceae, in vitro culture, embryo, histology

Reference: 278 [Arabidopsis Phenome Database[Archive

Lifescience Database Archive (English)

Full Text Available functional ERA1 gene, which encodes the beta-subunit of protein farnesyltransferase (PFT), exhibit pleiotropic effects...gnaling and meristem development. Here, we report the effects of T-DNA insertion mutations in the Arabidopsi

Youth empowerment through urban agriculture: Red Hook Community Farm

Science.gov (United States)

Ian Marvy

2009-01-01

One of 18 articles inspired by the Meristem 2007 Forum, "Restorative Commons for Community Health." The articles include interviews, case studies, thought pieces, and interdisciplinary theoretical works that explore the relationship between human health and the urban...

Effect of different combinations of 6-benzyl amino purine and ...

African Journals Online (AJOL)

SNAP CUSTOMER

2013-02-13

Feb 13, 2013 ... The culture meristem grew into callus after 28 days then adventitious plantlets ... plantain is greatly reduced by virus disease (Lepoivre,. 2000). ..... for Production of Quality Banana Planting Material in Asia-Pacific. Asia-Pacific ...

Adapting the botanical garden into a sustainable, multicultural resource

Science.gov (United States)

Susan Lacerte

2009-01-01

One of 18 articles inspired by the Meristem 2007 Forum, "Restorative Commons for Community Health." The articles include interviews, case studies, thought pieces, and interdisciplinary theoretical works that explore the relationship between human health and the urban...

Genomewide association analysis for awn length linked to the seed ...

Indian Academy of Sciences (India)

Awn is one of the most important domesticated traits in rice (Oryza sativa). Understanding the genetic .... sive rice germplasm in two different environments using the. LMM method. ..... of meristem organization in the rice spikelet. Plant Cell 24,.

Creative uncertainty

Science.gov (United States)

Victoria Marshall; Dil Hoda

2009-01-01

One of 18 articles inspired by the Meristem 2007 Forum, "Restorative Commons for Community Health." The articles include interviews, case studies, thought pieces, and interdisciplinary theoretical works that explore the relationship between human health and the urban...

Re-naturing the city: a role for sustainable infrastructure and buildings

Science.gov (United States)

Hillary Brown

2009-01-01

One of 18 articles inspired by the Meristem 2007 Forum, "Restorative Commons for Community Health." The articles include interviews, case studies, thought pieces, and interdisciplinary theoretical works that explore the relationship between human health and the urban...

Urban gardens: catalysts for restorative commons infrastructure

Science.gov (United States)

John Seitz

2009-01-01

One of 18 articles inspired by the Meristem 2007 Forum, "Restorative Commons for Community Health." The articles include interviews, case studies, thought pieces, and interdisciplinary theoretical works that explore the relationship between human health and the urban...

The benefits of community-managed open space: community gardening in New York City

Science.gov (United States)

Edie Stone

2009-01-01

One of 18 articles inspired by the Meristem 2007 Forum, "Restorative Commons for Community Health." The articles include interviews, case studies, thought pieces, and interdisciplinary theoretical works that explore the relationship between human health and the urban...

Micropropagation of ornamental Prunus spp. and GF305 peach, a Prunus viral indicator.

Science.gov (United States)

Kalinina, Anna; Brown, Daniel C W

2007-07-01

A micropropagation approach was developed for nine ornamental Prunus species, P. americana, P. cistena, P. glandulosa, P. serrulata 'Kwanzan', P. laurocerasus, P. sargentii, P. tomentosa, P. triloba, P. virginiana 'Schubert', commercially important in North America, and GF305 peach, commonly used for Prunus virus indexing. The micropropagation cycle based on proliferation of vegetative tissues includes establishment of tissue culture through introduction of shoot meristems in vitro, shoot proliferation, root induction and plant acclimatization steps and can be completed in 5 months. A meristem sterilization protocol minimized bacterial and fungal contamination. Multiple shoot formation in ornamental Prunus was obtained through the use of 1 mg l(-1) 6-benzyladenine. For GF305 peach, alteration in the sugar composition, fructose instead of sucrose, and addition of 1 mg l(-1 )ferulic acid had a significant impact on the shoot proliferation rate and maintenance of long-term in vitro culture. Rooting and plant acclimatization conditions were improved using a two-step protocol with a 4-day root induction in indole-3-butiric acid (IBA)-containing media with consequent 3-week root elongation in IBA-free media. One-month incubation of rooted shoots in a vermiculite-based medium resulted in additional shoot and root growth and provided better acclimatization and plant recovery. The micropropagation approach can be used for maintenance of the clonal properties for Prunus spp. as well as a protocol to support meristem therapy against viral infection.

Final Scientific/Technical report for "ABI8: Prototype of a novel signaling factor"

Energy Technology Data Exchange (ETDEWEB)

Finkelstein, Ruth R. [Univ. of California, Santa Barbara, CA (United States)

2013-02-21

The Arabidopsis thaliana ABSCISIC ACID-INSENSITIVE8 locus encodes a highly conserved plant-specific protein that mediates abscisic acid (ABA) and sugar responses essential for growth. Although initial database comparisons revealed no domains of predictable function, it has recently been re-annotated as a member of the Glycosyltransferase family A. However, this function has not been demonstrated experimentally and no specific substrates have been identified. Mutations affecting ABI8 are near-lethal due to pleiotropic yet specific effects including altered ABA signaling, sugar transport, cell wall synthesis, root meristem maintenance, vascular patterning, and male sterility. Because the predicted sequence initially provided no clues, we used a guilt by association strategy to address function of this protein by determining its subcellular localization and identifying interacting proteins. Our studies showed that ABI8 is localized to the endomembrane system and may interact with proteins implicated in Golgi trafficking, lignification, and stress signaling. We found that the root meristem arrest reflects decreased auxin accumulation and resulting decreases in regulators required for meristem identity, all of which can be rescued by added glucose. Further studies showed that this glucose-dependence reflects reduced glucose uptake as well as the decreased expression of sugar-mobilizing enzymes. This work suggests that ABI8 may regulate trafficking of membrane proteins such as auxin transporters and cellulose synthase, but this hypothesis has not yet been tested. The altered gene expression is likely to be a secondary or later effect of this pleiotropic mutation.

Reference: 623 [Arabidopsis Phenome Database[Archive

Lifescience Database Archive (English)

Full Text Available ambium and procambium, even though these meristems are the source of woody tissue and therefore generate the majority of plant biomas...s. Although biomass may represent a novel source of renewable energy, little is kno

Physicochemical processes in embryonic plant tissue during the transition to the state of cold anabiosis and storage at liquid nitrogen temperature

Science.gov (United States)

Khodko, A. T.; Lysak, Yu. S.

2017-10-01

Critical opalescence phenomenon was observed in the cytoplasm of garlic embryonic tissue—meristem—upon cooling in liquid nitrogen vapor, indicating liquid-liquid phase transition in the system. It was established that cells of the meristem tissue survive the cooling-thawing cycle. We suggest that the transition of meristem tissue to the state of anabiosis is mainly due to a drastic slowing of the diffusion in the cytoplasm caused by the passage of the solution through the critical point, followed by the formation of a dispersed system—a highly concentrated emulsion—as a result of a liquid-liquid phase transition. This macrophase separation is characteristic of polymer-solvent systems. We established the regime of cooling down to liquid nitrogen temperature and subsequent thawing in the cryopreservation cycle for the biological object under study, which ensures the preservation of tissue viability.

Sincronização do ciclo celular em meristema radicular de baru (Dipteryx alata Vog. Sinchronization of cell cycle in root meristem of baru (Dipteryx alata Vog.

Directory of Open Access Journals (Sweden)

Giovana Augusta Torres

2003-04-01

Full Text Available Uma das dificuldades de se conduzir estudos citogenéticos em espécies vegetais nativas do cerrado é a ocorrência de baixos índices metafásicos no meristema radicular. O incremento dos índices mitótico e metafásico em células de pontas de raiz tem sido obtido em várias espécies com a sincronização do ciclo celular por meio de hidroxiuréia (HU. Neste trabalho foram determinadas as condições ótimas para a sincronização eficiente do ciclo em células meristemáticas de raízes de baru (Dipteryx alata Vog.. Foram testadas quatro concentrações de HU (0,00; 1,25; 2,50; 5,00 e 10,00 mM, três tempos de exposição das raízes (10, 15 e 20 h e dois tempos de recuperação do ciclo (5 e 10 h. As melhores respostas foram obtidas com exposição das raízes, de cerca de 1 cm, à solução de HU 3,5 mM, por 20 horas, com posterior recuperação do ciclo em água destilada por 5 horas. O índice de 45% de células em divisão representou um incremento de cerca de 5 vezes em relação à testemunha, ao passo que para células em metáfases, o índice de 22,6% foi cerca de 10 vezes superior. Portanto, o uso dessa estratégia mostrou-se bastante eficiente para a obtenção de grande quantidade de cromossomos para análise citogenética do baru.A major difficulty in cytogenetic studies of plant species from "cerrado" is the low metaphasic index in root tip cells. Cell cycle synchronization, by using hydroxyurea (HU, has been successfully used in order to obtain high mitotic and metaphasic index in several species. The goal of this work was to optimize conditions for efficient synchronization of Dipteryx alata root tip meristematic cells. Different levels of hydroxyurea (0, 1.25, 2.50, 5.00, and 10.00 mM, periods of treatment (10, 15, and 20 h and periods of cell cycle recovery (5 and 10 h were tested. Best results were achieved by treating 10-mm long roots with 3.5 mM hydroxyurea, for 20 h and incubating for 5 h in distilled water. The

Primary root protophloem differentiation requires balanced phosphatidylinositol-4,5-biphosphate levels and systemically affects root branching.

NARCIS (Netherlands)

Rodriguez-Villalon, A.; Gujas, B.; van Wijk, R.; Munnik, T.; Hardtke, C.S.

2015-01-01

Protophloem is a specialized vascular tissue in growing plant organs, such as root meristems. In Arabidopsis mutants with impaired primary root protophloem differentiation, brevis radix (brx) and octopus (ops), meristematic activity and consequently overall root growth are strongly reduced. Second

A mutually inhibitory interaction between auxin and cytokinin specifies vascular pattern in roots.

NARCIS (Netherlands)

Bishopp, A.; Help, H.; El-Showk, S.; Weijers, D.; Scheres, B.J.G.; Friml, J.; Benkova, E.; Pekka Mahonen, A.; Helariutta, Y.

2011-01-01

Background Whereas the majority of animals develop toward a predetermined body plan, plants show iterative growth and continually produce new organs and structures from actively dividing meristems. This raises an intriguing question: How are these newly developed organs patterned? In Arabidopsis

RIMA-dependent nuclear accumulation of IYO triggers auxin-irreversible cell differentiation in arabidopsis

NARCIS (Netherlands)

Muñoz, Alfonso; Mangano, Silvina; González-García, Mary Paz; Contreras, Ramón; Sauer, Michael; Rybel, De Bert; Weijers, Dolf; Sánchez-Serrano, José Juan; Sanmartín, Maite; Rojo, Enrique

2017-01-01

The transcriptional regulator MINIYO (IYO) is essential and rate-limiting for initiating cell differentiation in Arabidopsis thaliana. Moreover, IYO moves from the cytosol into the nucleus in cells at the meristem periphery, possibly triggering their differentiation. However, the genetic mechanisms

Changes in cis-regulatory elements of a key floral regulator are associated with divergence of inflorescence architectures

NARCIS (Netherlands)

Kusters, E.; Della Pina, S.; Castel, R.; Souer, E.; Koes, R.

2015-01-01

Higher plant species diverged extensively with regard to the moment (flowering time) and position (inflorescence architecture) at which flowers are formed. This seems largely caused by variation in the expression patterns of conserved genes that specify floral meristem identity (FMI), rather than

Patterning of Inflorescences and Flowers by the F-Box Protein DOUBLE TOP and the LEAFY Homolog ABERRANT LEAF AND FLOWER of Petunia.

NARCIS (Netherlands)

Souer, E.J.; Bliek, M.; Koes, R.E.; Kusters, E.; Bruin de, R.A.

2008-01-01

Angiosperms display a wide variety of inflorescence architectures differing in the positions where flowers or branches arise. The expression of floral meristem identity (FMI) genes determines when and where flowers are formed. In Arabidopsis thaliana, this is regulated via transcription of LEAFY

Changes in cis-regulatory elements of a key floral regulator are associated with divergence of inflorescence architectures.

NARCIS (Netherlands)

Kusters, E.; Della Pina, S.; Castel, R.; Souer, E.J.; Koes, R.E.

2015-01-01

Higher plant species diverged extensively with regard to the moment (flowering time) and position (inflorescence architecture) at which flowers are formed. This seems largely caused by variation in the expression patterns of conserved genes that specify floral meristem identity (FMI), rather than

Modulation of the hormone setting by Rhodococcus fascians results in ectopic KNOX activation in Arabidopsis

Czech Academy of Sciences Publication Activity Database

Depuydt, S.; Doležal, Karel; Van Lijsebettens, M.; Moritz, T.; Holsters, M.; Vereecke, D.

2008-01-01

Roč. 146, č. 3 (2008), s. 1267-1281 ISSN 0032-0889 Institutional research plan: CEZ:AV0Z50380511 Keywords : KNOTTED1-LIKE HOMEOBOX GENE * CYTOKININ BIOSYNTHESIS * MERISTEM ACTIVITY Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 6.110, year: 2008

Estimation of paddy water temperature during crop development

International Nuclear Information System (INIS)

Centeno, H.G.S.; Horie, T.

1996-01-01

The crop meristem is in direct contact with paddy water during crop's vegetative stage. Ambient air temperature becomes an important factor in crop development only when internodes elongate sufficiently for the meristem to rise above the water surface. This does not occur until after panicle initiation. Crop growth at vegetative stage is affected more by water temperature than the most commonly measured air temperature. During transplanting in 1992 dry season, the maximum paddy water temperature was 10 deg C higher than the maximum air temperature. For rice crop models, the development of a submodel to estimate water temperature is important to account the effect of paddy water temperature on plant growth. Paddy water temperature is estimated from mean air temperature, solar radiation, and crop canopy. The parameters of the model were derived using the simplex method on data from the 1993 wet- and dry-season field experiments at IRRI

Diploidization of cucumber (Cucumis sativus L. haploids by colchicine treatment

Directory of Open Access Journals (Sweden)

Vesselina Nikolova

2014-01-01

Full Text Available Haploid cucumber plants are totally infertile and do not undergo spontaneous diploidization. The use of haploids depends on the possibility of doubling the chromosome number and the obtaining of stable doubled haploids (DH. Four haploids of different genotypes propagated vegetatively were treated with colchicine in order to obtain DH. The following procedures were used: 1 apical shoot meristem treatment, 2 soaking of shoot explants, 3 placing of shoot explants on medium with colchicine. Plants of the C1 generation were evaluated in respect to morphological and cytological characters and fertility. The best result of 20.9% DH was obtained after repeated treatment of the meristem with colchicine. A large group of chimeras (28.5% was also distinguished as were haploids and tetraploids. DH plants were fertile and gave uniform progeny. Chimeras had a decreased fertility and showed disturbances in meiotic divisions.

Early inflorescence development in the grasses (Poaceae

Directory of Open Access Journals (Sweden)

Elizabeth A. Kellogg

2013-07-01

Full Text Available The shoot apical meristem of grasses produces the primary branches of the inflorescence, controlling inflorescence architecture and hence seed production. Whereas leaves are produced in a distichous pattern, with the primordia separated from each other by an angle of 180o, inflorescence branches are produced in a spiral in most species. The morphology and developmental genetics of the shift in phyllotaxis have been studied extensively in maize and rice. However, in wheat, Brachypodium, and oats, all in the grass subfamily Pooideae, the change in phyllotaxis does not occur; primary inflorescence branches are produced distichously. It is unknown whether the distichous inflorescence originated at the base of Pooideae, or whether it appeared several times independently. In this study, we show that Brachyelytrum, the genus sister to all other Pooideae has spiral phyllotaxis in the inflorescence, but that in the remaining 3000+ species of Pooideae, the phyllotaxis is two-ranked. These two-ranked inflorescences are not perfectly symmetrical, and have a clear front and back; this developmental axis has never been described in the literature and it is unclear what establishes its polarity. Strictly distichous inflorescences appear somewhat later in the evolution of the subfamily. Two-ranked inflorescences also appear in a few grass outgroups and sporadically elsewhere in the family, but unlike in Pooideae do not generally correlate with a major radiation of species. After production of branches, the inflorescence meristem may be converted to a spikelet meristem or may simply abort; this developmental decision appears to be independent of the branching pattern.

Role of Tulipa gesneriana TEOSINTE BRANCHED1 (TgTB1) in the control of axillary bud outgrowth in bulbs.

Science.gov (United States)

Moreno-Pachon, Natalia M; Mutimawurugo, Marie-Chantal; Heynen, Eveline; Sergeeva, Lidiya; Benders, Anne; Blilou, Ikram; Hilhorst, Henk W M; Immink, Richard G H

2018-06-01

Tulip vegetative reproduction. Tulips reproduce asexually by the outgrowth of their axillary meristems located in the axil of each bulb scale. The number of axillary meristems in one bulb is low, and not all of them grow out during the yearly growth cycle of the bulb. Since the degree of axillary bud outgrowth in tulip determines the success of their vegetative propagation, this study aimed at understanding the mechanism controlling the differential axillary bud activity. We used a combined physiological and "bottom-up" molecular approach to shed light on this process and found that first two inner located buds do not seem to experience dormancy during the growth cycle, while mid-located buds enter dormancy by the end of the growing season. Dormancy was assessed by weight increase and TgTB1 expression levels, a conserved TCP transcription factor and well-known master integrator of environmental and endogenous signals influencing axillary meristem outgrowth in plants. We showed that TgTB1 expression in tulip bulbs can be modulated by sucrose, cytokinin and strigolactone, just as it has been reported for other species. However, the limited growth of mid-located buds, even when their TgTB1 expression is downregulated, points at other factors, probably physical, inhibiting their growth. We conclude that the time of axillary bud initiation determines the degree of dormancy and the sink strength of the bud. Thus, development, apical dominance, sink strength, hormonal cross-talk, expression of TgTB1 and other possibly physical but unidentified players, all converge to determine the growth capacity of tulip axillary buds.

Evolutionary, interaction and expression analysis of floral meristem ...

Indian Academy of Sciences (India)

RONGRONG GUO

2018-05-19

May 19, 2018 ... 3Agricultural College, Guangxi University, Nanning 530004, People's Republic of China ... Received 25 January 2017; revised 12 September 2017; accepted 21 September 2017; published online ...... Lee H., Suh S. S., Park E., Cho E., Ahn J. H., Kim S. G. et ... Cambridge University Press, Cambridge, UK.

Plant integrity: an important factor in plant-pathogen interactions

DEFF Research Database (Denmark)

Orlowska, Elzbieta Zofia; Llorente, Briardo; Cvitanich, Cristina

2013-01-01

the hemibiotrophic oomycete pathogen Phytophthora infestans. Furthermore, in the Sarpo Mira–P. infestans interactions, the plant’s meristems, the stalks or both, seem to be associated with the development of the hypersensitive response and both the plant’s roots and shoots contain antimicrobial compounds when...

Coordination of growth in root and shoot apices by AIL/PLT transcription factors

NARCIS (Netherlands)

Scheres, Ben; Krizek, Beth A.

2018-01-01

Growth at the root tip and organ generation at the shoot tip depend on the proper functioning of apical meristems and the transitioning of meristematic cell descendants from a proliferating state to cell elongation and differentiation. Members of the AINTEGUMENTA-LIKE/PLETHORA (AIL/PLT)

Control of plant virus diseases in sub-Saharan Africa: the possibility ...

African Journals Online (AJOL)

Chemotherapy, thermotherapy and meristem-tip culture can be successful, but they cannot be used on a large scale. ... This paper considers the advantages of an integrated approach and provides selected examples from experience with several important African diseases, including cocoa swollen shoot, cassava mosaic ...

Organizer-Derived WOX5 Signal Maintains Root Columella Stem Cells through Chromatin-Mediated Repression of CDF4 Expression.

NARCIS (Netherlands)

Pi, L.; Graaff, van der E.; Llavata Peris, C.I.; Weijers, D.; Henning, L.; Groot, de E.; Laux, T.

2015-01-01

Stem cells in plants and animals are maintained pluripotent by signals from adjacent niche cells. In plants, WUSCHEL HOMEOBOX (WOX) transcription factors are central regulators of stem cell maintenance in different meristem types, yet their molecular mode of action has remained elusive. Here we show

Agrobacterium-mediated transformation of Easter lily (Lilium longiflorum cv. Nellie White)

Science.gov (United States)

Conditions were optimized for transient transformation of Lilium longiflorum cv. Nellie White using Agrobacterium tumefaciens. Bulb scale and basal meristem explants were inoculated with A. tumefaciens strain AGL1 containing the binary vector pCAMBIA 2301 which has the uidA gene that codes for ß-gl...

Isolation and characterization of a floral homeotic gene in Fraxinus nigra causing earlier flowering and homeotic alterations in transgenic Arabidopsis

Science.gov (United States)

Jun Hyung Lee; Paula M. Pijut

2017-01-01

Reproductive sterility, which can be obtained by manipulating floral organ identity genes, is an important tool for gene containment of genetically engineered trees. In Arabidopsis, AGAMOUS (AG) is the only C-class gene responsible for both floral meristem determinacy and floral organ identity, and its mutations produce...

Comparative study of the sensitivities of onion and broad bean root ...

African Journals Online (AJOL)

Chemicals which cause chromosomal aberration (CA) in plant cells frequently produce identical CA in cultured animal cells. Plant species however, differ in sensitivities. Onion and broad bean (BB) root meristem cells were compared for sensitivity to chlorpyrifos (CPF), mercury chloride (HgCl2), ethyl methanesulphonate ...

The SHORT-ROOT-like gene PtSHR2B is involved in Populus phellogen activity

Czech Academy of Sciences Publication Activity Database

Miguel, A.; Milhinhos, A.; Novák, Ondřej; Jones, B.; Miguel, C.M.

2016-01-01

Roč. 67, č. 5 (2016), s. 1545-1555 ISSN 0022-0957 R&D Projects: GA MŠk(CZ) LO1204; GA MŠk LK21306 Institutional support: RVO:61389030 Keywords : Cytokinin * lateral meristem * phellogen Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 5.830, year: 2016

[Cytogenetic effects in Koeleria gracilis Pers. populations from the Semipalatinsk proving ground].

Science.gov (United States)

Geras'kin, S A; Mozolin, E M; Dikarev, V G; Udalova, A A; Dikareva, N S; Spiridonov, S I; Teten'kin, V L

2009-01-01

The proliferative activity and the frequency of cytogenetic disturbances in apical meristem of coleoptile sprouts at germination of seeds collected from crested hairgrass populations inhabiting contrast in level of radioactive contamination sites of the Semipalatinsk test site (Kazakhstan) are studied. Sampling of biological material and soil was carrying out during three years (2005-2007). The absorbed dose to critical organs of crested hairgrass vary depending on a site from 2.8 up to 262.2 mGy/year. A sognificant correlation between the frequency of cytogenetic disturbances in apical meristem and dose absorbed in crested hairgrass critical organs is found. Devere aberrations such as single and double bridges make the main contribution to spectrum of structural mutations as well as lagging chromosomes. In spite of the fact that the crested hairgrass populations have occupied the sites with a high level of radioactive contamination for a long time, the data analysis fails to reveal radio-adaptation effect.

Energy related germination and survival rates of water-imbibed Arabidopsis seeds irradiated with protons

International Nuclear Information System (INIS)

Qin, H.L.; Xue, J.M.; Lai, J.N.; Wang, J.Y.; Zhang, W.M.; Miao, Q.; Yan, S.; Zhao, W.J.; He, F.; Gu, H.Y.; Wang, Y.G.

2006-01-01

In order to investigate the influence of ion energy on the germination and survival rates, water-imbibed Arabidopsis seeds were irradiated with protons in atmosphere. The ion fluence used in this experiment was in the range of 4 x 10 9 -1 x 10 14 ions/cm 2 . The ion energy is from 1.1 MeV to 6.5 MeV. According to the structure of the seed and TRIM simulation, the ions with the energy of 6.5 MeV can irradiate the shoot apical meristem directly whereas the ions with the energy of 1.1 MeV cannot. The results showed that both the germination and survival rates decrease while increasing the ion fluence, and the fluence-respond curve for each energy has different character. Besides the shoot apical meristem (SAM), which is generally considered as the main radiobiological target, the existence of a secondary target around SAM is proposed in this paper

Cutting weeds with a CO2 laser

DEFF Research Database (Denmark)

Heisel, T.; Schou, Jørgen; Christensen, S.

2001-01-01

Stems of Chenopodium album. and Sinapis arvensis. and leaves of Lolium perenne. were cut with a CO2 laser or with a pair of scissors. Treatments were carried out on greenhouse-grown pot plants at three different growth stages and at two heights. Plant dry matter was measured 2 to 5 weeks after...... treatment. The relationship between dry weight and laser energy was analysed using a non-linear dose-response regression model. The regression parameters differed significantly between the weed species. At all growth stages and heights S. arvensis was more difficult to cut with a CO2 laser than C. album....... When stems were cut below the meristems, 0.9 and 2.3 J mm(-1) of CO2 laser energy dose was sufficient to reduce by 90% the biomass of C. album and S. arvensis respectively. Regrowth appeared when dicotyledonous plant stems were cut above meristems, indicating that it is important to cut close...

Energy related germination and survival rates of water-imbibed Arabidopsis seeds irradiated with protons

Energy Technology Data Exchange (ETDEWEB)

Qin, H.L. [Key Laboratory of Heavy Ion Physics, MOE, Peking University, Beijing 100871 (China); Xue, J.M. [Key Laboratory of Heavy Ion Physics, MOE, Peking University, Beijing 100871 (China); Lai, J.N. [Key Laboratory of Heavy Ion Physics, MOE, Peking University, Beijing 100871 (China); Wang, J.Y. [Key Laboratory of Heavy Ion Physics, MOE, Peking University, Beijing 100871 (China); Zhang, W.M. [Key Laboratory of Heavy Ion Physics, MOE, Peking University, Beijing 100871 (China); Miao, Q. [Key Laboratory of Heavy Ion Physics, MOE, Peking University, Beijing 100871 (China); Yan, S. [Key Laboratory of Heavy Ion Physics, MOE, Peking University, Beijing 100871 (China); Zhao, W.J. [Key Laboratory of Heavy Ion Physics, MOE, Peking University, Beijing 100871 (China); He, F. [School of Life Science, Peking University, Beijing 100871 (China); Gu, H.Y. [School of Life Science, Peking University, Beijing 100871 (China); Wang, Y.G. [Key Laboratory of Heavy Ion Physics, MOE, Peking University, Beijing 100871 (China)]. E-mail: ygwang@pku.edu.cn

2006-04-15

In order to investigate the influence of ion energy on the germination and survival rates, water-imbibed Arabidopsis seeds were irradiated with protons in atmosphere. The ion fluence used in this experiment was in the range of 4 x 10{sup 9}-1 x 10{sup 14} ions/cm{sup 2}. The ion energy is from 1.1 MeV to 6.5 MeV. According to the structure of the seed and TRIM simulation, the ions with the energy of 6.5 MeV can irradiate the shoot apical meristem directly whereas the ions with the energy of 1.1 MeV cannot. The results showed that both the germination and survival rates decrease while increasing the ion fluence, and the fluence-respond curve for each energy has different character. Besides the shoot apical meristem (SAM), which is generally considered as the main radiobiological target, the existence of a secondary target around SAM is proposed in this paper.

Gain-of-function mutants of the cytokinin receptors AHK2 and AHK3 regulate plant organ size, flowering time and plant longevity

Czech Academy of Sciences Publication Activity Database

Bartrina, I.; Jensen, H.; Novák, Ondřej; Strnad, Miroslav; Werner, T.; Schmülling, T.

2017-01-01

Roč. 173, č. 3 (2017), s. 1783-1797 ISSN 0032-0889 R&D Projects: GA ČR GA15-22322S Institutional support: RVO:61389030 Keywords : SHOOT APICAL MERISTEM * ARABIDOPSIS-THALIANA * HISTIDINE KINASE Subject RIV: CE - Biochemistry OBOR OECD: Plant sciences, botany Impact factor: 6.456, year: 2016

Genetic transformation of peanut (Arachis hypogaea L.) using ...

Indian Academy of Sciences (India)

Madhu

tissue culture response and plant regeneration has driven researchers to develop alternate transformation systems that target axillary meristem in the cotyledonary nodes (Somers et al 2003). We report here for the first time the mode of genetic transformation using cotyledonary node (CN) as an explant in peanut mediated ...

Molecular basis of development in petaloid monocot flowers

DEFF Research Database (Denmark)

Johansen, Bo; Frederiksen, Signe; Skipper, Martin

2006-01-01

-class genes apparently are expressed in meristems of both flower and inflorescence. Morphologically petaloid stamens and styles are well known within the petaloid monocots, whereas the phenomenon is rare in core eudicots. A simple model based on the extra copies of B-class genes can explain the molecular...

A Simplified Experimental Scheme for the Study of Mitosis.

Science.gov (United States)

Gill, John

1980-01-01

A procedure is described for providing preparations of dividing cells from root apical meristems, requiring only inexpensive equipment and minimal experimental skill, and using 8-Hydroxyquinoline and Toluidene-blue as a chromosome stain. The method has been sucessfully tested in schools and yields permanent preparations of adequate quality for…

In planta transformation of sorghum (Sorghum bicolor (L.) Moench)

Indian Academy of Sciences (India)

An in planta transformation protocol for sorghum (Sorghum bicolor (L.) Moench) using shoot apical meristem of germinating seedlings is reported in this study. Agrobacterium tumefaciens strain, LBA4404 with pCAMBIA1303 vector and construct pCAMBIA1303TPS1 were individually used for transformation. Since, the ...

effects of magnetically treated water on germination and growth

African Journals Online (AJOL)

Toshiba

This study was conducted to evaluate the effect of magnetically treated water on the survival ... density used was 719 gauss (G) measured inside the pipe. ... of the meristem cells and chlorophyll were ..... Table 4 Tomato stem girth irrigated with magnetically and non–magnetically treated .... Electrical Separation, 7: 77-107.

New evidence for primordial action site of Fluazifop-P-butyl on Acanthospermum hispidum seedlings: From the effects on chlorophyll fluorescence characteristics and histological observation.

Science.gov (United States)

Shang, Yuhong; Yang, Congjun; Liu, Zhihang; Song, Jiqing; Li, Pingliang; Li, Lingxu; Zhou, Fei; Xin, Hua; Wan, Fanghao; Matsumoto, Hiroshi; Luo, Xiaoyong

2017-10-01

Acanthospermum hispidum DC, an Asteraceae weed species, was very susceptible to fluazifop-P-butyl, but tolerant to other aryloxyphenoxypropionate herbicides, such as haloxyfop-P-methyl. However, other Asteraceae weeds including Bidens pilosa were all tolerant to fluazifop-P-butyl. Membrane lipid peroxidation by increasing the levels of reactive oxygen species (ROS) was proposed as an action mechanism of fluazifop-P-butyl in A. hispidum. To further clarify the primordial action site of fluazifop-P-butyl in this species, the effects on chlorophyll fluorescence characteristics and cytohistology of apical meristems were studied. Chlorophyll fluorescence characteristics (CFC) in sensitive A. hispidum seedlings were markedly affected by 10μM fluazifop-P-butyl, with the dark fluorescence yield (Fo), maximal fluorescence yield (Fm), maximal PS II quantum yield (Fv/Fm), effective photosystem II (PS II) quantum yield [Y(II)], and quantum yield of regulated energy dissipation [Y(NPQ)] declining, quantum yield of nonregulated energy dissipation [Y(NO)] rising, but these measures were not affected in Bidens pilosa. The effects of fluazifop-P-butyl on chlorophyll fluorescence properties were observed on the growing point before the mature leaves by about 4-6h. Haloxyfop-P-methyl, a control herbicide, had no effects on CFC of either A. hispidum or B. pilosa. In addition, damage to apical meristem cells of A. hispidum was observed at 6 HAT prior to changes in chlorophyll fluorescence parameters suggesting that the primary action site of fluazifop-P-butyl in this species is in the apical meristem and the effects on CFC may be the results of secondary action. Copyright © 2017 Elsevier Inc. All rights reserved.

Identification of cyst nematode B-type CLE peptides and modulation of the vascular stem cell pathway for feeding cell formation.

Directory of Open Access Journals (Sweden)

Xiaoli Guo

2017-02-01

Full Text Available Stem cell pools in the SAM (shoot apical meristem, RAM (root apical meristem and vascular procambium/cambium are regulated by CLE-receptor kinase-WOX signaling modules. Previous data showed that cyst nematode CLE-like effector proteins delivered into host cells through a stylet, act as ligand mimics of plant A-type CLE peptides and are pivotal for successful parasitism. Here we report the identification of a new class of CLE peptides from cyst nematodes with functional similarity to the B-type CLE peptide TDIF (tracheary element differentiation inhibitory factor encoded by the CLE41 and CLE44 genes in Arabidopsis. We further demonstrate that the TDIF-TDR (TDIF receptor-WOX4 pathway, which promotes procambial meristem cell proliferation, is involved in beet cyst nematode Heterodera schachtii parasitism. We observed activation of the TDIF pathway in developing feeding sites, reduced nematode infection in cle41 and tdr-1 wox4-1 mutants, and compromised syncytium size in cle41, tdr-1, wox4-1 and tdr-1 wox4-1 mutants. By qRT-PCR and promoter:GUS analyses, we showed that the expression of WOX4 is decreased in a clv1-101 clv2-101 rpk2-5 mutant, suggesting that WOX4 is a potential downstream target of nematode CLEs. Exogenous treatment with both nematode A-type and B-type CLE peptides induced massive cell proliferation in wild type roots, suggesting that the two types of CLEs may regulate cell proliferation during feeding site formation. These findings highlight an important role of the procambial cell proliferation pathway in cyst nematode feeding site formation.

Regulation, overexpression, and target gene identification of Potato Homeobox 15 (POTH15) – a class-I KNOX gene in potato

Science.gov (United States)

Mahajan, Ameya S.; Kondhare, Kirtikumar R.; Rajabhoj, Mohit P.; Kumar, Amit; Ghate, Tejashree; Ravindran, Nevedha; Habib, Farhat; Siddappa, Sundaresha; Banerjee, Anjan K.

2016-01-01

Potato Homeobox 15 (POTH15) is a KNOX-I (Knotted1-like homeobox) family gene in potato that is orthologous to Shoot Meristemless (STM) in Arabidopsis. Despite numerous reports on KNOX genes from different species, studies in potato are limited. Here, we describe photoperiodic regulation of POTH15, its overexpression phenotype, and identification of its potential targets in potato (Solanum tuberosum ssp. andigena). qRT-PCR analysis showed a higher abundance of POTH15 mRNA in shoot tips and stolons under tuber-inducing short-day conditions. POTH15 promoter activity was detected in apical and axillary meristems, stolon tips, tuber eyes, and meristems of tuber sprouts, indicating its role in meristem maintenance and leaf development. POTH15 overexpression altered multiple morphological traits including leaf and stem development, leaflet number, and number of nodes and branches. In particular, the rachis of the leaf was completely reduced and leaves appeared as a bouquet of leaflets. Comparative transcriptomic analysis of 35S::GUS and two POTH15 overexpression lines identified more than 6000 differentially expressed genes, including 2014 common genes between the two overexpression lines. Functional analysis of these genes revealed their involvement in responses to hormones, biotic/abiotic stresses, transcription regulation, and signal transduction. qRT-PCR of selected candidate target genes validated their differential expression in both overexpression lines. Out of 200 randomly chosen POTH15 targets, 173 were found to have at least one tandem TGAC core motif, characteristic of KNOX interaction, within 3.0kb in the upstream sequence of the transcription start site. Overall, this study provides insights to the role of POTH15 in controlling diverse developmental processes in potato. PMID:27217546

Unique morphological changes in plant pathogenic phytoplasma-infected petunia flowers are related to transcriptional regulation of floral homeotic genes in an organ-specific manner.

Science.gov (United States)

Himeno, Misako; Neriya, Yutaro; Minato, Nami; Miura, Chihiro; Sugawara, Kyoko; Ishii, Yoshiko; Yamaji, Yasuyuki; Kakizawa, Shigeyuki; Oshima, Kenro; Namba, Shigetou

2011-09-01

Abnormal flowers are often induced by infection of certain plant pathogens, e.g. phytoplasma, but the molecular mechanisms underlying these malformations have remained poorly understood. Here, we show that infection with OY-W phytoplasma (Candidatus Phytoplasma asteris, onion yellows phytoplasma strain, line OY-W) affects the expression of the floral homeotic genes of petunia plants in an organ-specific manner. Upon infection with OY-W phytoplasma, floral morphological changes, including conversion to leaf-like structures, were observed in sepals, petals and pistils, but not in stamens. As the expression levels of homeotic genes differ greatly between floral organs, we examined the expression levels of homeotic genes in each floral organ infected by OY-W phytoplasma, compared with healthy plants. The expression levels of several homeotic genes required for organ development, such as PFG, PhGLO1 and FBP7, were significantly downregulated by the phytoplasma infection in floral organs, except the stamens, suggesting that the unique morphological changes caused by the phytoplasma infection might result from the significant decrease in expression of some crucial homeotic genes. Moreover, the expression levels of TER, ALF and DOT genes, which are known to participate in floral meristem identity, were significantly downregulated in the phytoplasma-infected petunia meristems, implying that phytoplasma would affect an upstream signaling pathway of floral meristem identity. Our results suggest that phytoplasma infection may have complex effects on floral development, resulting in the unique phenotypes that were clearly distinct from the mutant flower phenotypes produced by the knock-out or the overexpression of certain homeotic genes. © 2011 The Authors. The Plant Journal © 2011 Blackwell Publishing Ltd.

Dehydration and osmotic adjustment in apple stem tissue during winter as it relates to the frost resistance of buds.

Science.gov (United States)

Pramsohler, Manuel; Neuner, Gilbert

2013-08-01

In deciduous trees, measurement of stem water potential can be difficult during the leafless period in winter. By using thermocouple psychrometry, osmotic water potentials (Ψo; actual Ψo: Ψo(act); Ψo at full saturation: Ψo(sat)) of expressed sap of bark and bud tissue were measured in order to test if the severity of winter desiccation in apple stems could be sufficiently assessed with Ψo. Water potentials were related to frost resistance and freezing behaviour of buds. The determination of Ψo reliably allowed winter desiccation and osmotic adjustments in apple stem tissue to be assessed. In winter in bark tissue, a pronounced decrease in Ψo(act) and Ψo(sat) was found. Decreased Ψo(sat) indicates active osmotic adjustment in the bark as observed earlier in the leaves of evergreen woody plants. In terminal bud meristems, no significant osmotic adjustments occurred and dehydration during winter was much less. Osmotic water potentials, Ψo(act) and Ψo(sat), of bud tissue were always less negative than in the bark. To prevent water movement and dehydration of the bud tissue via this osmotic gradient, it must be compensated for either by a sufficiently high turgor pressure (Ψp) in bark tissue or by the isolation of the bud tissue from the bark during midwinter. During freezing of apple buds, freeze dehydration and extra-organ freezing could be demonstrated by significantly reduced Ψo(act) values of bud meristems that had been excised in the frozen state. Infrared video thermography was used to monitor freezing patterns in apple twigs. During extracellular freezing of intact and longitudinally dissected stems, infrared differential thermal analysis (IDTA) images showed that the bud meristem remains ice free. Even if cooled to temperatures below the frost-killing temperature, no freezing event could be detected in bud meristems during winter. In contrast, after bud break, terminal buds showed a second freezing at the frost-killing temperature that indicates

Detection of somaclonal variation in micropropagated Hibiscus ...

African Journals Online (AJOL)

The main objective of micropropagation is to produce clones i.e. plants which are phenotypically and genetically identical to the mother plants. The culture of organized meristems usually guarantees the production of true-to-type plants but variations in the progenies have been widely reported. Hibiscus sabdariffa L. plants ...

Proteome Analysis in Arabidopsis Reveals Shoot- and Root-Specific Targets of Cytokinin Action and Differential Regulation of Hormonal Homeostasis

Czech Academy of Sciences Publication Activity Database

Žďárská, M.; Zatloukalová, P.; Benítez, M.; Šedo, O.; Potěšil, D.; Novák, Ondřej; Svačinová, Jana; Pešek, Bedřich; Malbeck, Jiří; Vašíčková, J.; Zdráhal, Z.; Hejátko, J.

2013-01-01

Roč. 161, č. 2 (2013), s. 918-930 ISSN 0032-0889 Grant - others:GA ČR(CZ) GAP501/11/1150 Program:GA Institutional research plan: CEZ:AV0Z50380511 Keywords : ABSCISIC-ACID * CIS-ZEATIN * MERISTEM ACTIVITY Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 7.394, year: 2013

Karyological investigations on Erigeron canadensis L. and E. annuus (L. Pers. from natural stands in Poland

Directory of Open Access Journals (Sweden)

K. Bijok

2015-01-01

Full Text Available The number of chromosomes in metaphases root meristems of Erigeron canadensis L. (2n= 18 and E. annuus (L. Pers. (2n=27 was determined. The chromosomes of both species showed a morphological differentiation - they were heterobrachial or isobrachial; E. annuus had an additional unpaired isobrachial chromosome.

Rozwój Narcissus poeticus L. [Development of Narcissus poeticus L.

Directory of Open Access Journals (Sweden)

B. Jamiołowska

2015-06-01

Full Text Available One generation of Narcissus poeticus develops during three seasons. The vegetative stage of the meristem lasts 11 months. It changes to a floral apex in the second year and initiates all the flower elements from the first days of June to mid August. The plants bloom in the third year.

Bud banks and their role in vegetative regeneration - a literature review and proposal for simple classification and assessment

Czech Academy of Sciences Publication Activity Database

Klimešová, Jitka; Klimeš, Leoš

2007-01-01

Roč. 8, - (2007), s. 115-129 ISSN 1433-8319 R&D Projects: GA ČR GA206/01/1039; GA ČR(CZ) GA206/01/1037 Institutional research plan: CEZ:AV0Z60050516 Keywords : bud bank * vegetative regeneration * reserve meristems Subject RIV: EF - Botanics Impact factor: 3.043, year: 2007

Identification of novel miRNAs and miRNA dependent developmental shifts of gene expression in Arabidopsis thaliana.

Directory of Open Access Journals (Sweden)

Shuhua Zhan

Full Text Available microRNAs (miRNAs are small, endogenous RNAs of 20 approximately 25 nucleotides, processed from stem-loop regions of longer RNA precursors. Plant miRNAs act as negative regulators of target mRNAs predominately by slicing target transcripts, and a number of miRNAs play important roles in development. We analyzed a number of published datasets from Arabidopsis thaliana to characterize novel miRNAs, novel miRNA targets, and miRNA-regulated developmental changes in gene expression. These data include microarray profiling data and small RNA (sRNA deep sequencing data derived from miRNA biogenesis/transport mutants, microarray profiling data of mRNAs in a developmental series, and computational predictions of conserved genomic stem-loop structures. Our conservative analyses identified five novel mature miRNAs and seven miRNA targets, including one novel target gene. Two complementary miRNAs that target distinct mRNAs were encoded by one gene. We found that genes targeted by known miRNAs, and genes up-regulated or down-regulated in miRNA mutant inflorescences, are highly expressed in the wild type inflorescence. In addition, transcripts upregulated within the mutant inflorescences were abundant in wild type leaves and shoot meristems and low in pollen and seed. Downregulated transcripts were abundant in wild type pollen and seed and low in shoot meristems, roots and leaves. Thus, disrupting miRNA function causes the inflorescence transcriptome to resemble the leaf and meristem and to differ from pollen and seed. Applications of our computational approach to other species and the use of more liberal criteria than reported here will further expand the number of identified miRNAs and miRNA targets. Our findings suggest that miRNAs have a global role in promoting vegetative to reproductive transitions in A. thaliana.

Expression Studies of Gibberellin Oxidases in Developing Pumpkin Seeds1

Science.gov (United States)

Frisse, Andrea; Pimenta, Maria João; Lange, Theo

2003-01-01

Two cDNA clones, 3-ox and 2-ox, have been isolated from developing pumpkin (Cucurbita maxima) embryos that show significant amino acid homology to gibberellin (GA) 3-oxidases and 2-oxidases, respectively. Recombinant fusion protein of clone 3-ox converted GA12-aldehyde, GA12, GA15, GA24, GA25, and GA9 to GA14-aldehyde, GA14, GA37, GA36, GA13, and GA4, respectively. Recombinant 2-ox protein oxidized GA9, GA4, and GA1 to GA51, GA34, and GA8, respectively. Previously cloned GA 7-oxidase revealed additional 3β-hydroxylation activity of GA12. Transcripts of this gene were identified in endosperm and embryo of the developing seed by quantitative reverse transcriptase-polymerase chain reaction and localized in protoderm, root apical meristem, and quiescent center by in situ hybridization. mRNA of the previously cloned GA 20-oxidase from pumpkin seeds was localized in endosperm and in tissues of protoderm, ground meristem, and cotyledons of the embryo. However, transcripts of the recently cloned GA 20-oxidase from pumpkin seedlings were found all over the embryo, and in tissues of the inner seed coat at the micropylar end. Previously cloned GA 2β,3β-hydroxylase mRNA molecules were specifically identified in endosperm tissue. Finally, mRNA molecules of the 3-ox and 2-ox genes were found in the embryo only. 3-ox transcripts were localized in tissues of cotyledons, protoderm, and inner cell layers of the root apical meristem, and 2-ox transcripts were found in all tissues of the embryo except the root tips. These results indicate tissue-specific GA-biosynthetic pathways operating within the developing seed. PMID:12644672

[ipomoea batatas (l.) lam] by meristem culture and thermotherapy

African Journals Online (AJOL)

Preferred Customer

infection, Hawassa Agricultural Research Centre ... personal communication). ... Production of disease-free planting material by ... into sterile Magenta boxes for multiplication and ... added to MS medium (E) and multiple shoot growth of Awassa-83 in 2 mg/l BAP added to MS ..... Africa. DFID crop protection program, a paper.

Genotoxic effects of industrial wastewater on Allium cepa L.

African Journals Online (AJOL)

STORAGESEVER

2009-05-04

May 4, 2009 ... However, such tests take too much time and cost a lot of money. ... and cadmium on apical meristem cells of the A. cepa. The effect of the waste .... through respiration is accumulated as organic com- pounds and ... to occur in the cells. ... is naturally likely to influence the cellular energetic events adversely.

Prescribed fire, soil inorganic nitrogen dynamics, and plant responses in a semiarid grassland

Science.gov (United States)

David J. Augustine; Paul Brewer; Dana M. Blumenthal; Justin D. Derner; Joseph C. von Fischer

2014-01-01

In arid and semiarid ecosystems, fire can potentially affect ecosystem dynamics through changes in soil moisture, temperature, and nitrogen cycling, as well as through direct effects on plant meristem mortality. We examined effects of annual and triennial prescribed fires conducted in early spring on soil moisture, temperature, and N, plant growth, and plant N content...

The flux-based PIN allocation mechanism can generate either canalyzed or diffuse distribution patterns depending on geometry and boundary conditions.

Directory of Open Access Journals (Sweden)

Michael Luke Walker

Full Text Available Growth and morphogenesis in plants require controlled transport of the plant hormone auxin. An important participant is the auxin effluxing protein PIN, whose polarized subcellular localization allows it to effectively transport auxin large distances through tissues. The flux-based model, in which auxin flux through a wall stimulates PIN allocation to that wall, is a dominant contender among models determining where and in what quantity PIN is allocated to cell walls. In this paper we characterise the behaviour of flux-based PIN allocation models in various tissues of the shoot apical meristem. Arguing from both mathematical analysis and computer simulations, we describe the natural behaviours of this class of models under various circumstances. In particular, we demonstrate the important dichotomy between sink- and source- driven systems, and show that both diffuse and canalized PIN distributions can be generated simultaneously in the same tissue, without model hybridization or variation of PIN-related parameters. This work is performed in the context of the shoot apical and floral meristems and is applicable to the construction of a unified PIN allocation model.

Control of sweet potato virus diseases.

Science.gov (United States)

Loebenstein, Gad

2015-01-01

Sweet potato (Ipomoea batatas) is ranked seventh in global food crop production and is the third most important root crop after potato and cassava. Sweet potatoes are vegetative propagated from vines, root slips (sprouts), or tubers. Therefore, virus diseases can be a major constrain, reducing yields markedly, often more than 50%. The main viruses worldwide are Sweet potato feathery mottle virus (SPFMV) and Sweet potato chlorotic stunt virus (SPCSV). Effects on yields by SPFMV or SPCSV alone are minor, or but in complex infection by the two or other viruses yield losses of 50%. The orthodox way of controlling viruses in vegetative propagated crops is by supplying the growers with virus-tested planting material. High-yielding plants are tested for freedom of viruses by PCR, serology, and grafting to sweet potato virus indicator plants. After this, meristem tips are taken from those plants that reacted negative. The meristems were grown into plants which were kept under insect-proof conditions and away from other sweet potato material for distribution to farmers after another cycle of reproduction. © 2015 Elsevier Inc. All rights reserved.

Change of mitotic behavior and ultra structure of 'Fuju' (Citrus reticulata Blanco) stem-apex clones after space flight

International Nuclear Information System (INIS)

Wu Rujian; Huang Jinghao; Wen Shouxing; Cai Zijian; Luo Tuyan; Chen Liangfeng; Wang Zhouwen

2011-01-01

By using conventional squash stain technique and ultrathin sectioning technique, the effects of space flight on mitotic behavior and ultrastructure were studied in the shoot apical meristem of 'Fuju' (Citrus reticulata Blanco), which had been carried by China's seed-breeding satellite, Shijian-8. The results showed that space flight had effect on the mutagenesis of stem-apical meristem. Abnormal mitosis with various degrees had been detected in 13 mutant clones, of which mitotic aberrations in clone '08004' were significantly higher than the others. The aberration rate of numerical abnormalities of chromosomes at metaphase, lagging chromosome, micronucleus, C-spindle, S-spindle and polyarch spindle in the clone '08004' was 0.34%, 0.669%, 0.86%, 0.17%, 1.20% and 1.03%, respectively. The ultrastructure of mesophyll cell in most clones was unchanged, but nucleus chromatin agglutination, chloroplast thylakoid disintegrated, autophagosome appeared, cell vacuolated, plasmolysis and the formation of apoptotic body were found in the clone '08004', suggesting that programmed cell death (PCD) Nevertheless, no change in the mitochondrial structure was observed until terminal phase of PCD. (authors)

Regeneration of roots from callus reveals stability of the developmental program for determinate root growth in Sonoran Desert Cactaceae.

Science.gov (United States)

Shishkova, Svetlana; García-Mendoza, Edith; Castillo-Díaz, Vicente; Moreno, Norma E; Arellano, Jesús; Dubrovsky, Joseph G

2007-05-01

In some Sonoran Desert Cactaceae the primary root has a determinate root growth: the cells of the root apical meristem undergo only a few cell division cycles and then differentiate. The determinate growth of primary roots in Cactaceae was found in plants cultivated under various growth conditions, and could not be reverted by any treatment tested. The mechanisms involved in root meristem maintenance and determinate root growth in plants remain poorly understood. In this study, we have shown that roots regenerated from the callus of two Cactaceae species, Stenocereus gummosus and Ferocactus peninsulae, have a determinate growth pattern, similar to that of the primary root. To demonstrate this, a protocol for root regeneration from callus was established. The determinate growth pattern of roots regenerated from callus suggests that the program of root development is very stable in these species. These findings will permit future analysis of the role of certain Cactaceae genes in the determinate pattern of root growth via the regeneration of transgenic roots from transformed calli.

Phyllotactic pattern and stem cell fate are determined by the Arabidopsis homeobox gene BELLRINGER

Science.gov (United States)

Mary E. Byrne; Andrew T. Groover; Joseph R. Fontana; Robert A. Martienssen

2003-01-01

Lateral organs in plants arise from the meristem in a stereotypical pattern known as phyllotaxy. Spiral patterns result from initiation of successive organs at a fixed angle of divergence but variable patterns of physical contact. Such patterns ultimately give rise to individual leaves and flowers at positions related to each other by consecutive terms in the...

Radiobiological researches on Dianthus caryophyllus L. carnation chimeras

International Nuclear Information System (INIS)

Pereau-Leroy, Pierre

1975-01-01

This research thesis reports a radiobiological study of Dianthus periclinal chimeras performed by submitting plants and plant cuttings at different physiological stages to cobalt-60 gamma irradiation under different dose conditions and rates. The effects of these treatments are studied while growing the so-processed plants and by microscopic examination of sections of irradiated meristems [fr

Cell-Type-Specific Cytokinin Distribution within the Arabidopsis Primary Root Apex

Czech Academy of Sciences Publication Activity Database

Antoniadi, I.; Plačková, Lenka; Simonovik, B.; Doležal, Karel; Turnbull, C.; Ljung, K.; Novák, Ondřej

2015-01-01

Roč. 27, č. 7 (2015), s. 1955-1967 ISSN 1040-4651 R&D Projects: GA ČR GA14-34792S; GA MŠk(CZ) LO1204; GA MŠk LK21306 Institutional support: RVO:61389030 Keywords : SOLID-PHASE EXTRACTION * ENDOPLASMIC-RETICULUM * MERISTEM ACTIVITY Subject RIV: CB - Analytical Chemistry, Separation Impact factor: 8.538, year: 2015

Over-expressing Salicornia europaea (SeNHX1) gene in tobacco ...

African Journals Online (AJOL)

An increase of salt tolerance in transgenics was observed both in vitro and in pot culture. When exposed to either 138 mM or 172 mM NaCl in vitro, the transgenic apical meristem and stem segments with buds exhibited stronger salt-tolerance than their wild-type counterparts. In pot soil with 10.2 mg g-1 DW Na+ stress, ...

The chromoplasts of Or mutants of cauliflower (Brassica oleracea L. var. botrytis).

Science.gov (United States)

Paolillo, D J; Garvin, D F; Parthasarathy, M V

2004-12-01

The Or mutation in cauliflower (Brassica oleracea L. var. botrytis) leads to abnormal accumulations of beta-carotene in orange chromoplasts, in tissues in which leucoplasts are characteristic of wild-type plants. Or chromoplasts were investigated by light microscopy of fresh materials and electron microscopy of glutaraldehyde- and potassium permanganate-fixed materials. Carotenoid inclusions in Or chromoplasts resemble those found in carrot root chromoplasts in their optical activity and angular shape. Electron microscopy revealed that the inclusions are made up of parallel, membrane-bound compartments. These stacks of membranes are variously rolled and folded into three-dimensional objects. We classify Or chromoplasts as "membranous" chromoplasts. The Or mutation also limits plastid replication so that a single chromoplast constitutes the plastidome in most of the affected cells. There are one to two chromoplasts in each cell of a shoot apex. The ability of differentiated chromoplasts to divide in the apical meristems of Or mutant plants resembles the ability of proplastids to maintain plastid continuity from cell to cell in meristems of Arabidopsis thaliana mutants in which plastid replication is drastically limited. The findings are used to discuss the number of levels of regulation involved in plastid replication.

The tropical cedar tree (Cedrela fissilis Vell., Meliaceae) homolog of the Arabidopsis LEAFY gene is expressed in reproductive tissues and can complement Arabidopsis leafy mutants.

Science.gov (United States)

Dornelas, Marcelo Carnier; Rodriguez, Adriana Pinheiro Martinelli

2006-01-01

A homolog of FLORICAULA/LEAFY, CfLFY (for Cedrela fissilis LFY), was isolated from tropical cedar. The main stages of the reproductive development in C. fissilis were documented by scanning electron microscopy and the expression patterns of CfLFY were studied during the differentiation of the floral meristems. Furthermore, the biological role of the CfLFY gene was assessed using transgenic Arabidopsis plants. CfLFY showed a high degree of similarity to other plant homologs of FLO/LFY. Southern analysis showed that CfLFY is a single-copy gene in the tropical cedar genome. Northern blot analysis and in situ hybridization results showed that CfLFY was expressed in the reproductive buds during the transition from vegetative to reproductive growth, as well as in floral meristems and floral organs but was excluded from the vegetative apex and leaves. Transgenic Arabidopsis lfy26 mutant lines expressing the CfLFY coding region, under the control of the LFY promoter, showed restored wild-type phenotype. Taken together, our results suggest that CfLFY is a FLO/LFY homolog probably involved in the control of tropical cedar reproductive development.

Root - shoot - signaling in Chenopodium rubrum L. as studied by 15O labeled water uptake

International Nuclear Information System (INIS)

Ohya, T.; Hayashi, Y.; Tanoi, K.; Rai, H.; Nakanishi, T.M.; Suzuki, K.; Albrechtova, J.T.P.; Wagner, E.

2005-01-01

Full text: It has been demonstrated with C. rubrum that the different organ systems are transmitting surface action potentials which might be the basis for systemic signal transduction. Shoot tip respectively root generated action potentials travel along the stem axis. Shoot tip generated action potentials arriving at the basis can be reflected and travel upwards. The radioactive labeling technique was established at the NIRS in Inage, Japan. About 2 GBq of 15 O labeled Hoagland's solution was supplied to the plant root or cut stem in a phytotron at 25 o C with 45 % of relative humidity and continuous light. By cutting the shoot apical bud and the apices of main side branches the uptake of 15 O labeled water was inhibited in plants with intact roots but not in plants with roots cut. Because of the short half-life of 15 O (2 min), experiments could be repeated in hourly intervals. Cutting the apex probably limits root water uptake via a hydraulic-electrochemical signal. The results are discussed with respect to the significance of a continuous communication between the root system and the shoot apical meristem(s) in the adaptation of plants to their environment. (author)

A molecular framework for the inhibition of Arabidopsis root growth in response to boron toxicity.

Science.gov (United States)

Aquea, Felipe; Federici, Fernan; Moscoso, Cristian; Vega, Andrea; Jullian, Pastor; Haseloff, Jim; Arce-Johnson, Patricio

2012-04-01

Boron is an essential micronutrient for plants and is taken up in the form of boric acid (BA). Despite this, a high BA concentration is toxic for the plants, inhibiting root growth and is thus a significant problem in semi-arid areas in the world. In this work, we report the molecular basis for the inhibition of root growth caused by boron. We show that application of BA reduces the size of root meristems, correlating with the inhibition of root growth. The decrease in meristem size is caused by a reduction of cell division. Mitotic cell number significantly decreases and the expression level of key core cell cycle regulators is modulated. The modulation of the cell cycle does not appear to act through cytokinin and auxin signalling. A global expression analysis reveals that boron toxicity induces the expression of genes related with abscisic acid (ABA) signalling, ABA response and cell wall modifications, and represses genes that code for water transporters. These results suggest that boron toxicity produces a reduction of water and BA uptake, triggering a hydric stress response that produces root growth inhibition. © 2011 Blackwell Publishing Ltd.

Cytokinins Are Initial Targets of Light in the Control of Bud Outgrowth(1[OPEN])

Czech Academy of Sciences Publication Activity Database

Roman, H.; Girault, T.; Barbier, F.; Peron, T.; Brouard, N.; Pěnčík, Aleš; Novák, Ondřej; Vian, A.; Sakr, S.; Lothier, J.; Le Gourrierec, J.; Leduc, N.

2016-01-01

Roč. 172, č. 1 (2016), s. 489-509 ISSN 0032-0889 R&D Projects: GA MŠk(CZ) LO1204; GA MŠk LK21306 Institutional support: RVO:61389030 Keywords : cell-cycle regulation * pea axillary buds * oryza-sativa l. * apical dominance * rosa sp * arabidopsis-thaliana * lateral buds * meristem activity * plant-responses * acts downstream Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 6.456, year: 2016

Comparison of meristem culture and heat therapy to clean garlic ...

African Journals Online (AJOL)

Experiment to detect garlic-infecting virus for three improved garlic varieties and to clean the virus were conducted in Ethiopia. Garlic cloves were planted in screen house at Biosciences Eastern and Central Africa-International Livestock Research Institute Hub Nairobi, Kenya in 2014. Reverse Transcription polymerase ...

[cDNA library construction from panicle meristem of finger millet].

Science.gov (United States)

Radchuk, V; Pirko, Ia V; Isaenkov, S V; Emets, A I; Blium, Ia B

2014-01-01

The protocol for production of full-size cDNA using SuperScript Full-Length cDNA Library Construction Kit II (Invitrogen) was tested and high quality cDNA library from meristematic tissue of finger millet panicle (Eleusine coracana (L.) Gaertn) was created. The titer of obtained cDNA library comprised 3.01 x 10(5) CFU/ml in avarage. In average the length of cDNA insertion consisted about 1070 base pairs, the effectivity of cDNA fragment insertions--99.5%. The selective sequencing of cDNA clones from created library was performed. The sequences of cDNA clones were identified with usage of BLAST-search. The results of cDNA library analysis and selective sequencing represents prove good functionality and full length character of inserted cDNA clones. Obtained cDNA library from meristematic tissue of finger millet panicle represents good and valuable source for isolation and identification of key genes regulating metabolism and meristematic development and for mining of new molecular markers to conduct out high quality genetic investigations and molecular breeding as well.

optimization of protocol for m apical meristem of embryonic axes

African Journals Online (AJOL)

userpc

The hypocotyl segments, prima were removed and embryonic axes were placed in culture bott nd Skoog basal + B5 vitamins (MSB5) fortified with 22.2µM, 26.6µM opurine (BAP) to induce multiple shoots. Elongated shoots we tion media consisting of MSB5 supplemented with low concentrati one free media promoted direct ...

Conserved CDC20 cell cycle functions are carried out by two of the five isoforms in Arabidopsis thaliana.

Directory of Open Access Journals (Sweden)

Zoltán Kevei

Full Text Available The CDC20 and Cdh1/CCS52 proteins are substrate determinants and activators of the Anaphase Promoting Complex/Cyclosome (APC/C E3 ubiquitin ligase and as such they control the mitotic cell cycle by targeting the degradation of various cell cycle regulators. In yeasts and animals the main CDC20 function is the destruction of securin and mitotic cyclins. Plants have multiple CDC20 gene copies whose functions have not been explored yet. In Arabidopsis thaliana there are five CDC20 isoforms and here we aimed at defining their contribution to cell cycle regulation, substrate selectivity and plant development.Studying the gene structure and phylogeny of plant CDC20s, the expression of the five AtCDC20 gene copies and their interactions with the APC/C subunit APC10, the CCS52 proteins, components of the mitotic checkpoint complex (MCC and mitotic cyclin substrates, conserved CDC20 functions could be assigned for AtCDC20.1 and AtCDC20.2. The other three intron-less genes were silent and specific for Arabidopsis. We show that AtCDC20.1 and AtCDC20.2 are components of the MCC and interact with mitotic cyclins with unexpected specificity. AtCDC20.1 and AtCDC20.2 are expressed in meristems, organ primordia and AtCDC20.1 also in pollen grains and developing seeds. Knocking down both genes simultaneously by RNAi resulted in severe delay in plant development and male sterility. In these lines, the meristem size was reduced while the cell size and ploidy levels were unaffected indicating that the lower cell number and likely slowdown of the cell cycle are the cause of reduced plant growth.The intron-containing CDC20 gene copies provide conserved and redundant functions for cell cycle progression in plants and are required for meristem maintenance, plant growth and male gametophyte formation. The Arabidopsis-specific intron-less genes are possibly "retrogenes" and have hitherto undefined functions or are pseudogenes.

Expression patterns of Passiflora edulis APETALA1/FRUITFULL homologues shed light onto tendril and corona identities

Directory of Open Access Journals (Sweden)

Livia C. T. Scorza

2017-02-01

Full Text Available Abstract Background Passiflora (passionflowers makes an excellent model for studying plant evolutionary development. They are mostly perennial climbers that display axillary tendrils, which are believed to be modifications of the inflorescence. Passionflowers are also recognized by their unique flower features, such as the extra whorls of floral organs composed of corona filaments and membranes enclosing the nectary. Although some work on Passiflora organ ontogeny has been done, the developmental identity of both Passiflora tendrils and the corona is still controversial. Here, we combined ultrastructural analysis and expression patterns of the flower meristem and floral organ identity genes of the MADS-box AP1/FUL clade to reveal a possible role for these genes in the generation of evolutionary novelties in Passiflora. Results We followed the development of structures arising from the axillary meristem from juvenile to adult phase in P. edulis. We further assessed the expression pattern of P. edulis AP1/FUL homologues (PeAP1 and PeFUL, by RT-qPCR and in situ hybridization in several tissues, correlating it with the developmental stages of P. edulis. PeAP1 is expressed only in the reproductive stage, and it is highly expressed in tendrils and in flower meristems from the onset of their development. PeAP1 is also expressed in sepals, petals and in corona filaments, suggesting a novel role for PeAP1 in floral organ diversification. PeFUL presented a broad expression pattern in both vegetative and reproductive tissues, and it is also expressed in fruits. Conclusions Our results provide new molecular insights into the morphological diversity in the genus Passiflora. Here, we bring new evidence that tendrils are part of the Passiflora inflorescence. This points to the convergence of similar developmental processes involving the recruitment of genes related to flower identity in the origin of tendrils in different plant families. The data obtained also

Assessing duplication and loss of APETALA1/FRUITFULL homologs in Ranunculales

Science.gov (United States)

Pabón-Mora, Natalia; Hidalgo, Oriane; Gleissberg, Stefan; Litt, Amy

2013-01-01

Gene duplication and loss provide raw material for evolutionary change within organismal lineages as functional diversification of gene copies provide a mechanism for phenotypic variation. Here we focus on the APETALA1/FRUITFULL MADS-box gene lineage evolution. AP1/FUL genes are angiosperm-specific and have undergone several duplications. By far the most significant one is the core-eudicot duplication resulting in the euAP1 and euFUL clades. Functional characterization of several euAP1 and euFUL genes has shown that both function in proper floral meristem identity, and axillary meristem repression. Independently, euAP1 genes function in floral meristem and sepal identity, whereas euFUL genes control phase transition, cauline leaf growth, compound leaf morphogenesis and fruit development. Significant functional variation has been detected in the function of pre-duplication basal-eudicot FUL-like genes, but the underlying mechanisms for change have not been identified. FUL-like genes in the Papaveraceae encode all functions reported for euAP1 and euFUL genes, whereas FUL-like genes in Aquilegia (Ranunculaceae) function in inflorescence development and leaf complexity, but not in flower or fruit development. Here we isolated FUL-like genes across the Ranunculales and used phylogenetic approaches to analyze their evolutionary history. We identified an early duplication resulting in the RanFL1 and RanFL2 clades. RanFL1 genes were present in all the families sampled and are mostly under strong negative selection in the MADS, I and K domains. RanFL2 genes were only identified from Eupteleaceae, Papaveraceae s.l., Menispermaceae and Ranunculaceae and show relaxed purifying selection at the I and K domains. We discuss how asymmetric sequence diversification, new motifs, differences in codon substitutions and likely protein-protein interactions resulting from this Ranunculiid-specific duplication can help explain the functional differences among basal-eudicot FUL-like genes

Wheat TILLING mutants show that the vernalization gene VRN1 down-regulates the flowering repressor VRN2 in leaves but is not essential for flowering.

Directory of Open Access Journals (Sweden)

Andrew Chen

Full Text Available Most of the natural variation in wheat vernalization response is determined by allelic differences in the MADS-box transcription factor VERNALIZATION1 (VRN1. Extended exposures to low temperatures during the winter (vernalization induce VRN1 expression and promote the transition of the apical meristem to the reproductive phase. In contrast to its Arabidopsis homolog (APETALA1, which is mainly expressed in the apical meristem, VRN1 is also expressed at high levels in the leaves, but its function in this tissue is not well understood. Using tetraploid wheat lines with truncation mutations in the two homoeologous copies of VRN1 (henceforth vrn1-null mutants, we demonstrate that a central role of VRN1 in the leaves is to maintain low transcript levels of the VRN2 flowering repressor after vernalization. Transcript levels of VRN2 were gradually down-regulated during vernalization in both mutant and wild-type genotypes, but were up-regulated after vernalization only in the vrn1-null mutants. The up-regulation of VRN2 delayed flowering by repressing the transcription of FT, a flowering-integrator gene that encodes a mobile protein that is transported from the leaves to the apical meristem to induce flowering. The role of VRN2 in the delayed flowering of the vrn1-null mutant was confirmed using double vrn1-vrn2-null mutants, which flowered two months earlier than the vrn1-null mutants. Both mutants produced normal flowers and seeds demonstrating that VRN1 is not essential for wheat flowering, which contradicts current flowering models. This result does not diminish the importance of VRN1 in the seasonal regulation of wheat flowering. The up-regulation of VRN1 during winter is required to maintain low transcript levels of VRN2, accelerate the induction of FT in the leaves, and regulate a timely flowering in the spring. Our results also demonstrate the existence of redundant wheat flowering genes that may provide new targets for engineering wheat

Citrus tissue culture employing vegetative explants.

Science.gov (United States)

Chaturvedi, H C; Singh, S K; Sharma, A K; Agnihotri, S

2001-11-01

Citrus being a number one fruit of the world due to its high nutritional value, huge production of fruits and fruit products, the citrus industry may be considered a major fruit industry. Though citrus orchard area in India is comparable to USA, the produce is far less, while its export is nil. Biotechnology has played an outstanding role in boosting the citrus industry, e.g., in Spain, which is now the biggest exporter of citrus fruit with the application of micrografting. Amongst the fruit trees, perhaps the maximum tissue culture research has been done in citrus during the past four decades, however, the results of practical value are meagre. The shortfalls in citrus tissue culture research and some advancements made in this direction along with bright prospects are highlighted, restricting the review to vegetative explants only. Whilst utilization of nucellar embryogenesis is limited to rootstocks, the other aspects, like, regeneration and proliferation of shoot meristems measuring 200 microm in length--a global breakthrough--of two commercially important scion species, Citrus aurantifolia and C. sinensis and an important rootstock, C. limonia, improvement of micrografting technique, cloning of the same two scion species as well as some Indian rootstock species, employing nodal stem segments of mature trees, of immense practical value have been elaborated. A rare phenomenon of shift in the morphogenetic pattern of differentiation from shoot bud differentiation to embryoid formation occurred during the long-term culture of stem callus of C. grandis. Stem callus-regenerated plants of C. aurantifolia, C. sinensis and C. grandis showed variation in their ploidy levels and a somaclonal variant of C. sinensis, which produced seedless fruits was isolated. Tailoring of rooting in microshoots to a tap root-like system by changing the inorganic salt composition of the rooting medium, resulting in 100% transplant success, and germplasm preservation through normal growth

Growing cells push back under pressure.

Science.gov (United States)

Gibson, W T; Gibson, M C

2012-04-13

In both plants and animals, the interplay between mechanical force generation and mechanical sensing plays a stabilizing role in many developmental processes. Uyttewaal et al. now demonstrate that cells in the Arabidopsis shoot apical meristem respond to local mechanical stresses by reorienting their growth, thereby guiding morphogenesis. Notably, the mechanism underlying such guidance is amplification--not suppression--of growth-rate heterogeneity. Copyright © 2012 Elsevier Inc. All rights reserved.

[Genetic regulation of plant shoot stem cells].

Science.gov (United States)

Al'bert, E V; Ezhova, T A

2013-02-01

This article describes the main features of plant stem cells and summarizes the results of studies of the genetic control of stem cell maintenance in the apical meristem of the shoot. It is demonstrated that the WUS-CLV gene system plays a key role in the maintenance of shoot apical stem cells and the formation of adventitious buds and somatic embryos. Unconventional concepts of plant stem cells are considered.

Use of over-the-top graminicides for johnsongrass control: their absorption and translocation patterns, and effects on ultrastructure

International Nuclear Information System (INIS)

Winton, K.T.

1986-01-01

A systems approach to johnsongrass control, which included the preplant incorporated herbicide fluchloralin, followed by various split or single applications of post-emergence grass herbicides was tested in Clarkedale, AR over a three-year period. The preplant incorporated treatment was found to be an integral part of johnsongrass control. It aided in decreasing the johnsongrass population enough that use of the post-emergence compounds could be decreased during the second and third years. Splitting applications and using lower rates of post-emergence herbicides decreased the amount of herbicides used while maintaining good johnsongrass control and yields. The radiolabeled graminicides 14 C-fluazifop, 14 C-haloxyfop, and 14 C-quizalofop were found to translocate throughout all parts of johnsongrass, pitted morning glory, and soybean. Differential absorption and translocation probably are not factors in the tolerance or susceptibility of johnsongrass and soybean, but may attribute to the tolerance of pitted morning glory. These herbicides provided effective grass control by translocating rapidly throughout the plant causing ultrastructural damage. The first external injury symptoms may not be seen for a week or more under field conditions and this generally is in the form of death of the meristem. These translocation studies indicated that a high concentration of these compounds is translocated to the meristem area

ADP1 Affects Plant Architecture by Regulating Local Auxin Biosynthesis

Science.gov (United States)

Li, Shibai; Qin, Genji; Novák, Ondřej; Pěnčík, Aleš; Ljung, Karin; Aoyama, Takashi; Liu, Jingjing; Murphy, Angus; Gu, Hongya; Tsuge, Tomohiko; Qu, Li-Jia

2014-01-01

Plant architecture is one of the key factors that affect plant survival and productivity. Plant body structure is established through the iterative initiation and outgrowth of lateral organs, which are derived from the shoot apical meristem and root apical meristem, after embryogenesis. Here we report that ADP1, a putative MATE (multidrug and toxic compound extrusion) transporter, plays an essential role in regulating lateral organ outgrowth, and thus in maintaining normal architecture of Arabidopsis. Elevated expression levels of ADP1 resulted in accelerated plant growth rate, and increased the numbers of axillary branches and flowers. Our molecular and genetic evidence demonstrated that the phenotypes of plants over-expressing ADP1 were caused by reduction of local auxin levels in the meristematic regions. We further discovered that this reduction was probably due to decreased levels of auxin biosynthesis in the local meristematic regions based on the measured reduction in IAA levels and the gene expression data. Simultaneous inactivation of ADP1 and its three closest homologs led to growth retardation, relative reduction of lateral organ number and slightly elevated auxin level. Our results indicated that ADP1-mediated regulation of the local auxin level in meristematic regions is an essential determinant for plant architecture maintenance by restraining the outgrowth of lateral organs. PMID:24391508

Ectopic expression of a WRKY homolog from Glycine soja alters flowering time in Arabidopsis.

Directory of Open Access Journals (Sweden)

Xiao Luo

Full Text Available Flowering is a critical event in the life cycle of plants; the WRKY-type transcription factors are reported to be involved in many developmental processes sunch as trichome development and epicuticular wax loading, but whether they are involved in flowering time regulation is still unknown. Within this study, we provide clear evidence that GsWRKY20, a member of WRKY gene family from wild soybean, is involved in controlling plant flowering time. Expression of GsWRKY20 was abundant in the shoot tips and inflorescence meristems of wild soybean. Phenotypic analysis showed that GsWRKY20 over-expression lines flowered earlier than the wild-type plants under all conditions: long-day and short-day photoperiods, vernalization, or exogenous GA3 application, indicating that GsWRKY20 may mainly be involved in an autonomous flowering pathway. Further analyses by qRT-PCR and microarray suggests that GsWRKY20 accelerating plant flowering might primarily be through the regulation of flowering-related genes (i.e., FLC, FT, SOC1 and CO and floral meristem identity genes (i.e., AP1, SEP3, AP3, PI and AG. Our results provide the evidence demonstrating the effectiveness of manipulating GsWRKY20 for altering plant flowering time.

A dominant mutation of TWISTED DWARF 1 encoding an alpha-tubulin protein causes severe dwarfism and right helical growth in rice.

Science.gov (United States)

Sunohara, Hidehiko; Kawai, Takayuki; Shimizu-Sato, Sae; Sato, Yutaka; Sato, Kanna; Kitano, Hidemi

2009-06-01

Dwarfism is a common type of mutation in many plant species. The pathways and factors regulating biosynthesis and signaling of several plant growth regulators have been clarified through analyses of dwarf mutants in rice, Arabidopsis, pea, and maize. However, the genetic mechanisms controlling dwarfism are not well characterized, and the causal genes underlying most dwarf mutants are still uncovered. Here, we report a dominant mutant, Twisted dwarf 1-1 (Tid1-1), showing dwarfism and twisted growth in rice. Tid1-1 exhibit right helical growth of the leaves and stem and shortening of the roots. They also show an increased number of cells in the shoot apical meristem. Cells in the leaves of Tid1-1 are often ill-shapen, possibly owing to irregular cell division. Cell elongation in roots is suppressed in the elongation zone, and cells in the root apical meristem are enlarged. Map-based cloning of TID1 revealed that it encodes an alpha-tubulin protein comprising microtubules and is an ortholog of Arabidopsis LEFTY genes. Our analysis of the Tid1-1 mutant revealed that the dynamics of microtubules affects not only anisotropic growth in both dicots and monocots, but also meristematic activity and gross plant morphology.

Regeneration and genetic transformation of cowpea (Vigna unguiculata Walp.)

Energy Technology Data Exchange (ETDEWEB)

Filippone, E; Colucci, G; Ciardi, F; Monti, L [Department of Agronomy and Plant Genetics, Univ. of Naples Federico 11, Portici (Italy)

1997-07-01

Regeneration of cowpea (Vigna unguiculata Walp.) was achieved through massive bud formation induced in apical and lateral meristems by the herbicide Thidiazuron (TDZ). The effect of TDZ (5, 10, or 20 {mu}M) was tested in vitro on four different cowpea genotypes. Thidiazuron, even at the highest concentration, had no effect on seed germination. After one month of culture, multiple bud cluster formation was observed in all genotypes tested; about 80% of shoot apices regenerated multiple buds, whilst only 34% of cotyledonary nodes behaved in the same way. Histology of regenerating multiple bud clusters revealed that regeneration initiated from pre-existing meristems in the apex and cotyledonary node. Thidiazuron at 10 {mu}M appeared to be the best concentration to produce clusters with high number of buds, ranging from 5 to 10. Shoot elongation occurred only on MS medium without TDZ. On the same medium, 75% of elongated shoots rooted. For genetic transformation of cowpea, a direct DNA transfer methods in plants under in vivo conditions was tested by electroporation of plasmid DNA into the nodal meristematic cells. Some transformed plants were obtained, and produced T{sub 1} transformed progenies; their transgenic nature was confirmed by Southern analysis. (author). 21 refs, 2 figs, 3 tabs.

Influence of caffeine on chromosome lesions induced by chemical mutagens and radiation. 2

International Nuclear Information System (INIS)

Dimitrov, B.

1977-01-01

The modifying influence of caffeine on γ-ray induced chromosome lesions was studied by chromosome aberration anaysis. Caffeine was applied as a pre- and post-treatment agent following seed (G 1 ) and root meristem (G 2 and S) irradiation of C.capillaris. The frequency of chromosome aberrations induced in G 1 was changed neither by post- nor by pre-treatment with caffeine. This fact proves the lack of caffeine modifying effect. Applied as a post-treatment agent caffeine enhances considerably the frequency of chromosome aberrations induced in root meristem cells. This is especially valid for G 2 irradiated cells, while in S cells no synergistic effect was established between induced chromosome lesions and caffeine. The enhancement of chromosome aberration frequency produced in G 2 shows a clearly manifested dependence on the time (moment) of caffeine application post irradiation. Most considerable enhancement was obtained following post-treatment with caffeine immediately after irradiation. In the following intervals - 15 and 30 min - it decreases progressively, while after 60, 180 and 300 min no enhancing effect is observed. The probable causes for the manifestation and the lack of synergistic effect between chromosome lesions induced in the various mitotic cycle phases and caffeine are discussed. (author)

Regeneration and genetic transformation of cowpea (Vigna unguiculata Walp.)

International Nuclear Information System (INIS)

Filippone, E.; Colucci, G.; Ciardi, F.; Monti, L.

1997-01-01

Regeneration of cowpea (Vigna unguiculata Walp.) was achieved through massive bud formation induced in apical and lateral meristems by the herbicide Thidiazuron (TDZ). The effect of TDZ (5, 10, or 20 μM) was tested in vitro on four different cowpea genotypes. Thidiazuron, even at the highest concentration, had no effect on seed germination. After one month of culture, multiple bud cluster formation was observed in all genotypes tested; about 80% of shoot apices regenerated multiple buds, whilst only 34% of cotyledonary nodes behaved in the same way. Histology of regenerating multiple bud clusters revealed that regeneration initiated from pre-existing meristems in the apex and cotyledonary node. Thidiazuron at 10 μM appeared to be the best concentration to produce clusters with high number of buds, ranging from 5 to 10. Shoot elongation occurred only on MS medium without TDZ. On the same medium, 75% of elongated shoots rooted. For genetic transformation of cowpea, a direct DNA transfer methods in plants under in vivo conditions was tested by electroporation of plasmid DNA into the nodal meristematic cells. Some transformed plants were obtained, and produced T 1 transformed progenies; their transgenic nature was confirmed by Southern analysis. (author). 21 refs, 2 figs, 3 tabs

Colleters in Caryocar brasiliense (Caryocaraceae ontogenesis, ultrastructure and secretion

Directory of Open Access Journals (Sweden)

E. A. S. Paiva

Full Text Available Colleters are widely distributed and have been reported in several taxa. However, the only report of colleters in the Caryocaraceae family is in Caryocar brasiliense. This study purports to describe the distribution, structure and ultrastructure of colleters in C. brasiliense. Vegetative shoot apices with stipules in different stages of development were collected, fixed, and processed by light, transmission and scanning electron microscopy. Colleters occur on the stipule adaxial face and are differentiated on younger stipules, remaining functional until senescence. Stipules are deciduous, falling before the beginning of leaf expansion. Colleter secretion is abundant, filling all the space delimited by the stipule. Colleter origin is mixed, involving the protoderm and ground meristem. In this species, colleters are finger-shaped, consisting of a column of non-secretory central cells and a secretory epithelium whose cells are arranged in palisades. Secretory epithelium cells show dense cytoplasm, rough endoplasmic reticulum (RER segments, free ribosomes, mitochondria, and abundant well developed dictyosomes. The colleters central cell shows a flocculated cytoplasm and developed vacuole. These cells have a small lobated nucleus with an inconspicuous nucleolus. Mitochondria and RER stand out in the organelles. There is evidence of granulocrine secretion and colleter involvement with protection of the apical meristem and leaves in the initial stages of development.

RNAseq Transcriptional Profiling following Whip Development in Sugarcane Smut Disease.

Directory of Open Access Journals (Sweden)

Patricia D C Schaker

Full Text Available Sugarcane smut disease is caused by the biotrophic fungus Sporisorium scitamineum. The disease is characterized by the development of a whip-like structure from the primary meristems, where billions of teliospores are produced. Sugarcane smut also causes tillering and low sucrose and high fiber contents, reducing cane productivity. We investigated the biological events contributing to disease symptoms in a smut intermediate-resistant sugarcane genotype by examining the transcriptional profiles (RNAseq shortly after inoculating the plants and immediately after whip emission. The overall picture of disease progression suggests that premature transcriptional reprogramming of the shoot meristem functions continues until the emergence of the whip. The guidance of this altered pattern is potentially primarily related to auxin mobilization in addition to the involvement of other hormonal imbalances. The consequences associated with whip emission are the modulation of typical meristematic functions toward reproductive organ differentiation, requiring strong changes in carbon partitioning and energy production. These changes include the overexpression of genes coding for invertases and trehalose-6P synthase, as well as other enzymes from key metabolic pathways, such as from lignin biosynthesis. This is the first report describing changes in the transcriptional profiles following whip development, providing a hypothetical model and candidate genes to further study sugarcane smut disease progression.

Herbivore-mediated ecological costs of reproduction shape the life history of an iteroparous plant.

Science.gov (United States)

Miller, Tom E X; Tenhumberg, Brigitte; Louda, Svata M

2008-02-01

Plant reproduction yields immediate fitness benefits but can be costly in terms of survival, growth, and future fecundity. Life-history theory posits that reproductive strategies are shaped by trade-offs between current and future fitness that result from these direct costs of reproduction. Plant reproduction may also incur indirect ecological costs if it increases susceptibility to herbivores. Yet ecological costs of reproduction have received little empirical attention and remain poorly integrated into life-history theory. Here, we provide evidence for herbivore-mediated ecological costs of reproduction, and we develop theory to examine how these costs influence plant life-history strategies. Field experiments with an iteroparous cactus (Opuntia imbricata) indicated that greater reproductive effort (proportion of meristems allocated to reproduction) led to greater attack by a cactus-feeding insect (Narnia pallidicornis) and that damage by this herbivore reduced reproductive success. A dynamic programming model predicted strongly divergent optimal reproductive strategies when ecological costs were included, compared with when these costs were ignored. Meristem allocation by cacti in the field matched the optimal strategy expected under ecological costs of reproduction. The results indicate that plant reproductive allocation can strongly influence the intensity of interactions with herbivores and that associated ecological costs can play an important selective role in the evolution of plant life histories.

Plant reproductive allocation predicts herbivore dynamics across spatial and temporal scales.

Science.gov (United States)

Miller, Tom E X; Tyre, Andrew J; Louda, Svata M

2006-11-01

Life-history theory suggests that iteroparous plants should be flexible in their allocation of resources toward growth and reproduction. Such plasticity could have consequences for herbivores that prefer or specialize on vegetative versus reproductive structures. To test this prediction, we studied the response of the cactus bug (Narnia pallidicornis) to meristem allocation by tree cholla cactus (Opuntia imbricata). We evaluated the explanatory power of demographic models that incorporated variation in cactus relative reproductive effort (RRE; the proportion of meristems allocated toward reproduction). Field data provided strong support for a single model that defined herbivore fecundity as a time-varying, increasing function of host RRE. High-RRE plants were predicted to support larger insect populations, and this effect was strongest late in the season. Independent field data provided strong support for these qualitative predictions and suggested that plant allocation effects extend across temporal and spatial scales. Specifically, late-season insect abundance was positively associated with interannual changes in cactus RRE over 3 years. Spatial variation in insect abundance was correlated with variation in RRE among five cactus populations across New Mexico. We conclude that plant allocation can be a critical component of resource quality for insect herbivores and, thus, an important mechanism underlying variation in herbivore abundance across time and space.

RNAseq Transcriptional Profiling following Whip Development in Sugarcane Smut Disease

Science.gov (United States)

Taniguti, Lucas M.; Peters, Leila P.; Creste, Silvana; Aitken, Karen S.; Van Sluys, Marie-Anne; Kitajima, João P.; Vieira, Maria L. C.; Monteiro-Vitorello, Claudia B.

2016-01-01

Sugarcane smut disease is caused by the biotrophic fungus Sporisorium scitamineum. The disease is characterized by the development of a whip-like structure from the primary meristems, where billions of teliospores are produced. Sugarcane smut also causes tillering and low sucrose and high fiber contents, reducing cane productivity. We investigated the biological events contributing to disease symptoms in a smut intermediate-resistant sugarcane genotype by examining the transcriptional profiles (RNAseq) shortly after inoculating the plants and immediately after whip emission. The overall picture of disease progression suggests that premature transcriptional reprogramming of the shoot meristem functions continues until the emergence of the whip. The guidance of this altered pattern is potentially primarily related to auxin mobilization in addition to the involvement of other hormonal imbalances. The consequences associated with whip emission are the modulation of typical meristematic functions toward reproductive organ differentiation, requiring strong changes in carbon partitioning and energy production. These changes include the overexpression of genes coding for invertases and trehalose-6P synthase, as well as other enzymes from key metabolic pathways, such as from lignin biosynthesis. This is the first report describing changes in the transcriptional profiles following whip development, providing a hypothetical model and candidate genes to further study sugarcane smut disease progression. PMID:27583836

Natural Arabidopsis brx loss-of-function alleles confer root adaptation to acidic soil.

Science.gov (United States)

Gujas, Bojan; Alonso-Blanco, Carlos; Hardtke, Christian S

2012-10-23

Soil acidification is a major agricultural problem that negatively affects crop yield. Root systems counteract detrimental passive proton influx from acidic soil through increased proton pumping into the apoplast, which is presumably also required for cell elongation and stimulated by auxin. Here, we found an unexpected impact of extracellular pH on auxin activity and cell proliferation rate in the root meristem of two Arabidopsis mutants with impaired auxin perception, axr3 and brx. Surprisingly, neutral to slightly alkaline media rescued their severely reduced root (meristem) growth by stimulating auxin signaling, independent of auxin uptake. The finding that proton pumps are hyperactive in brx roots could explain this phenomenon and is consistent with more robust growth and increased fitness of brx mutants on overly acidic media or soil. Interestingly, the original brx allele was isolated from a natural stock center accession collected from acidic soil. Our discovery of a novel brx allele in accessions recently collected from another acidic sampling site demonstrates the existence of independently maintained brx loss-of-function alleles in nature and supports the notion that they are advantageous in acidic soil pH conditions, a finding that might be exploited for crop breeding. Copyright © 2012 Elsevier Ltd. All rights reserved.

Ectopic Expression of a WRKY Homolog from Glycine soja Alters Flowering Time in Arabidopsis

Science.gov (United States)

Liu, Baohui; Zhu, Dan; Bai, Xi; Cai, Hua; Ji, Wei; Cao, Lei; Wu, Jing; Wang, Mingchao; Ding, Xiaodong; Zhu, Yanming

2013-01-01

Flowering is a critical event in the life cycle of plants; the WRKY-type transcription factors are reported to be involved in many developmental processes sunch as trichome development and epicuticular wax loading, but whether they are involved in flowering time regulation is still unknown. Within this study, we provide clear evidence that GsWRKY20, a member of WRKY gene family from wild soybean, is involved in controlling plant flowering time. Expression of GsWRKY20 was abundant in the shoot tips and inflorescence meristems of wild soybean. Phenotypic analysis showed that GsWRKY20 over-expression lines flowered earlier than the wild-type plants under all conditions: long-day and short-day photoperiods, vernalization, or exogenous GA3 application, indicating that GsWRKY20 may mainly be involved in an autonomous flowering pathway. Further analyses by qRT-PCR and microarray suggests that GsWRKY20 accelerating plant flowering might primarily be through the regulation of flowering-related genes (i.e., FLC, FT, SOC1 and CO) and floral meristem identity genes (i.e., AP1, SEP3, AP3, PI and AG). Our results provide the evidence demonstrating the effectiveness of manipulating GsWRKY20 for altering plant flowering time. PMID:23991184

Ferns: the missing link in shoot evolution and development

Directory of Open Access Journals (Sweden)

Andrew Robert George Plackett

2015-11-01

Full Text Available Shoot development in land plants is a remarkably complex process that gives rise to an extreme diversity of forms. Our current understanding of shoot developmental mechanisms comes almost entirely from studies of angiosperms (flowering plants, the most recently diverged plant lineage. Shoot development in angiosperms is based around a layered multicellular apical meristem that produces lateral organs and/or secondary meristems from populations of founder cells at its periphery. In contrast, non-seed plant shoots develop from either single apical initials or from a small population of morphologically distinct apical cells. Although developmental and molecular information is becoming available for non-flowering plants, such as the model moss Physcomitrella patens, making valid comparisons between highly divergent lineages is extremely challenging. As sister group to the seed plants, the monilophytes (ferns and relatives represent an excellent phylogenetic midpoint of comparison for unlocking the evolution of shoot developmental mechanisms, and recent technical advances have finally made transgenic analysis possible in the emerging model fern Ceratopteris richardii. This review compares and contrasts our current understanding of shoot development in different land plant lineages with the aim of highlighting the potential role that the fern C. richardii could play in shedding light on the evolution of underlying genetic regulatory mechanisms.

An evolutionarily conserved gene, FUWA, plays a role in determining panicle architecture, grain shape and grain weight in rice.

Science.gov (United States)

Chen, Jun; Gao, He; Zheng, Xiao-Ming; Jin, Mingna; Weng, Jian-Feng; Ma, Jin; Ren, Yulong; Zhou, Kunneng; Wang, Qi; Wang, Jie; Wang, Jiu-Lin; Zhang, Xin; Cheng, Zhijun; Wu, Chuanyin; Wang, Haiyang; Wan, Jian-Min

2015-08-01

Plant breeding relies on creation of novel allelic combinations for desired traits. Identification and utilization of beneficial alleles, rare alleles and evolutionarily conserved genes in the germplasm (referred to as 'hidden' genes) provide an effective approach to achieve this goal. Here we show that a chemically induced null mutation in an evolutionarily conserved gene, FUWA, alters multiple important agronomic traits in rice, including panicle architecture, grain shape and grain weight. FUWA encodes an NHL domain-containing protein, with preferential expression in the root meristem, shoot apical meristem and inflorescences, where it restricts excessive cell division. Sequence analysis revealed that FUWA has undergone a bottleneck effect, and become fixed in landraces and modern cultivars during domestication and breeding. We further confirm a highly conserved role of FUWA homologs in determining panicle architecture and grain development in rice, maize and sorghum through genetic transformation. Strikingly, knockdown of the FUWA transcription level by RNA interference results in an erect panicle and increased grain size in both indica and japonica genetic backgrounds. This study illustrates an approach to create new germplasm with improved agronomic traits for crop breeding by tapping into evolutionary conserved genes. © 2015 The Authors The Plant Journal © 2015 John Wiley & Sons Ltd.

Primary root protophloem differentiation requires balanced phosphatidylinositol-4,5-biphosphate levels and systemically affects root branching.

OpenAIRE

Rodriguez-Villalon Antia; Gujas Bojan; van Wijk Ringo; Munnik Teun; Hardtke Christian S

2015-01-01

Protophloem is a specialized vascular tissue in growing plant organs, such as root meristems. In Arabidopsis mutants with impaired primary root protophloem differentiation, brevis radix (brx) and octopus (ops), meristematic activity and consequently overall root growth are strongly reduced. Second site mutation in the protophloem-specific presumed phosphoinositide 5-phosphatase cotyledon vascular pattern 2 (CVP2), but not in its homolog CVP2-like 1 (CVL1), partially rescues brx defects. Consi...

Detection of Norspermidine and Norspermine in Medicago sativa L. (Alfalfa) 1

Science.gov (United States)

Rodriguez-Garay, Benjamin; Phillips, Gregory C.; Kuehn, Glenn D.

1989-01-01

Shoot meristem tissues of alfalfa, Medicago sativa L., were found by high performance liquid chromatography analyses to contain the uncommon polyamines, norspermidine and norspermine. The chemical structures of norspermidine and norspermine, purified from alfalfa, were confirmed by comparison of mass spectra with those from authentic standards. The discovery of norspermidine and norspermine in alfalfa implicates the presence of at least two biosynthetic enzymes, a polyamine oxidase and a previously uncharacterized aminopropyltransferase. PMID:16666576

Micropropagação do porta-enxerto de macieira 'Seleção 69' tolerante à podridão do colo (Phytophthora cactorum Micropropagation of 'Seleção 69' apple rootstock tolerant the rotting (Phytophthora cactorum

Directory of Open Access Journals (Sweden)

Claudete Santa-Catarina

2001-10-01

Full Text Available A utilização de porta-enxertos anões, tolerantes a problemas fitossanitários da cultura da macieira, como a podridão do colo (Phytophthora cactorum, pode aumentar o rendimento e reduzir os custos de produção. Com o presente trabalho, objetivou-se estabelecer um protocolo de micropropagação do porta-enxerto 'Seleção 69', tolerante à podridão do colo. Ápices meristemáticos foram cultivados in vitro em meio de cultura MS, suplementado com 4,4mM de 6-Benzilaminopurina (BAP, 2,5mM de Ácido indolbutírico (AIB, 0,3mM de Ácido giberélico (GA3, 3% de sacarose e 0,6% de ágar. Foram testados o efeito da concentração de BAP (2,2 e 4,4mM e o efeito dos meios de cultura (MS, Cheng e Quoirin & Lepoivre na multiplicação das brotações. No alongamento das brotações, foram testados os efeitos do GA3 (0; 0,5; 1,0 e 1,5mM e AIB (0; 0,5 e 1,0mM. Para a fase de enraizamento ex vitro e aclimatização, foram testadas diferentes concentrações de AIB (0; 1 e 2g L-1. A taxa de desenvolvimento dos ápices meristemáticos cultivados in vitro foi de 30%. Para estimular a brotação, a melhor concentração de BAP foi 2,2mM, a qual proporcionou 2,6 brotações por explante. O meio MS proporcionou o maior número de brotações por explante (2,5, porém não diferiu estatisticamente do meio Cheng (2,0 brotações por explante. Para a fase de alongamento, o meio MS suplementado com 2,2mM de BAP e 1,0mM de AIB, proporcionou a maior altura das brotações (23mm. Na fase de enraizamento ex vitro e aclimatização, as concentrações de 0, 1 e 2g L-1 de AIB possibilitaram em média, 77,3% de enraizamento das microestacas.The use of tolerant apple rootstocks to phytossanitary problems as the rotting (Phytophthora cactorum is able to increase the production with cost reduction. The objective of the present study is to establish in vitro micropropagation protocol of the '69 Selection' rootstocks tolerant to the rotting. Meristems was cultivated in vitro

Effect of 6-benzyl aminopurine (BAP) on meristem culture for virus ...

African Journals Online (AJOL)

Hiru

2013-05-01

May 1, 2013 ... culture for virus free seed production of some popular potato varieties in ... cannot be controlled by any physical or chemical agent. Eradication of virus ..... In: Potato Health. Management. ... Asian J. Plant Sci. 2(8):616-622.

Somatic embryogenesis in plantain cultivar 'FHIA - 25' (AAB from meristem tips

Directory of Open Access Journals (Sweden)

Dayana Rodríguez González

2015-07-01

Full Text Available Plantain cultivar 'FHIA – 25' (AAB shows high yielding qualities and high resistance to Black Sigatoka disease, but its sugar content in the fruit is low, so a regeneration method at cell level is necessary, such as somatic embryogenesis supported by biotechnological tools to improve fruit quality. This work was performed with the aim of establishing a plant regeneration method via somatic embryogenesis using initial explants of shoot apices from axillary buds in liquid culture medium. Homogenous embryogenic cell suspensions were obtained from mentioned explants. The highest cellular multiplication rates were achieved at 3,0% density. The incubation of somatic embryos during 30 days in the maturation culture medium permitted to increase germination. During the acclimatization stage, plants regenerated from somatic embryos, as well as plants from organogenesis, showed a high survival percentage (98 and 97 respectively, without somaclonal variation.

Clonal multiplication of Cymbidiums through tissue culture of the shoot meristem

Energy Technology Data Exchange (ETDEWEB)

Wimber, Donald E.

1963-09-01

The propagation of clonal varieties of some orchids is at times exasperatingly slow and occasionally an almost futile effort. Clonal multiplication is generally confined to dlvidlng mature plants and to starting plants from pseudobulbs. There is, of course, the specialized technique for obtaining Phalaenopsis plantlets from the aseptic culture of inflorescence nodes, but this is basically the same thing as propagating plants from pseudobulbs. In certain cases it is highly desirable to rapidly multiply certain clones of orchids. Awarded varieties could thereby be dispersed with great rapidity where now it may take decades for some clones to became fairly common. Commercial flower production would be very much enhanced if certain desirable clones could be multiplied ad infinitum within a short time. Orchid flower production could then be placed more on a par with many of the other cut flowers and the clonal peculiarities of some fo the current hybrids could be pampered instead of ignored. This paper describes a tissue culture method for the rapid propagation of Cymbidium clones.

Embryonic origin of the Arabidopsis primary root and root meristem initials

NARCIS (Netherlands)

Scheres, B.J.G.; Wolkenfelt, H.; Willemsen, V.; Terlouw, M.; Lawson, E.; Dean, C.; Weisbeek, P.

1994-01-01

The embryonic origin of the Arabidopsis root and hypocotyl region has been investigated using histological techniques and clonal analysis. Our data reveal the pattern of cell division in the embryo giving rise to the various initials within the root promeristem. A small region of the root at its

The garlic allelochemical diallyl disulfide affects tomato root growth by influencing cell division, phytohormone balance and expansin gene expression

Directory of Open Access Journals (Sweden)

Fang Cheng

2016-08-01

Full Text Available Diallyl disulfide (DADS is a volatile organosulfur compound derived from garlic (Allium sativum L., and it is known as an allelochemical responsible for the strong allelopathic potential of garlic. The anticancer properties of DADS have been studied in experimental animals and various types of cancer cells, but to date, little is known about its mode of action as an allelochemical at the cytological level. The current research presents further studies on the effects of DADS on tomato (Solanum lycopersicum L. seed germination, root growth, mitotic index and cell size in root meristem, as well as the phytohormone levels and expression profile of auxin biosynthesis genes (FZYs, auxin transport genes (SlPINs and expansin genes (EXPs in tomato root. The results showed a biphasic, dose-dependent effect on tomato seed germination and root growth under different DADS concentrations. Lower concentrations (0.01-0.62 mM of DADS significantly promoted root growth, whereas higher levels (6.20-20.67 mM showed inhibitory effects. Cytological observations showed that the cell length of root meristem was increased and that the mitotic activity of meristematic cells in seedling root tips was enhanced at lower concentrations of DADS. In contrast, DADS at higher concentrations inhibited root growth by affecting both the length and division activity of meristematic cells. However, the cell width of the root meristem was not affected. Additionally, DADS increased the IAA and ZR contents of seedling roots in a dose-dependent manner. The influence on IAA content may be mediated by the up-regulation of FZYs and PINs. Further investigation into the underlying mechanism revealed that the expression levels of tomato EXPs were significantly affected by DADS. The expression levels of EXPB2 and beta-expansin precursor were increased after 3 d, and those of EXP1, EXPB3 and EXLB1 were increased after 5 d of DADS treatment (0.41 mM. This result suggests that tomato root growth

CONTENIDO DE POLIAMINAS LIBRES EN PALMAS AFECTADAS POR PUDRICION DEL COGOLLO EN LAS ZONAS CENTRAL Y OCCIDENTAL DE COLOMBIA

Directory of Open Access Journals (Sweden)

Hernán Mauricio Romero

2010-01-01

Full Text Available La pudrición del cogollo (PC es la principal enfermedad de la palma en Colombia. En las zonas palmeras Central (ZC y Oriental (ZE, las palmas enfermas pueden recuperarse naturalmente. En la Zona Occidental (ZW el proceso de recuperación no es evidente. La recuperación de palmas está ligada a gran actividad meristemática que podría involucrar la acción inductora de metabolitos como las poliaminas (PA. Este trabajo muestra la relación entre poliaminas del meristemo y la capacidad de recuperación de palmas con PC, en dos zonas agroclimáticas diferentes. Poliaminas extraídas del meristemo de palmas sembradas en ZC y ZW, fueron analizadas por HPLC. En ZC, donde existe recuperación espontánea, los niveles más altos de PA se presentan en palmas sanas y en recuperación y a medida que avanza la enfermedad la concentración desciende hasta un mínimo en el estado de PC inicial (PCI. Luego la concentración de PA aumenta hasta el estado de Buena Recuperación (BR donde los valores de poliaminas son más altos que los de palmas sanas. En la ZW, con la enfermedad el contenido de PA aumenta llegando al máximo en plantas sin recuperación y el mínimo se presenta en plantas sanas. Las diferencias entre zonas pueden explicarse por diferentes roles de las poliaminas en plantas. En la ZC la cantidad elevada de PA en palmas sanas o en recuperación funcionaría en la inducción de actividad meristemática, para la recuperación espontánea. En la ZW el aumento en el contenido de PA con la enfermedad induciría la generación de especies reactivas de oxígeno para defensa secundaria de la planta ante la imposibilidad de, a través de incrementos en la actividad meristemática producir rápidamente estructuras sanas que no sean reinfectadas.

Sample preparation method for induced mutation on orchid

International Nuclear Information System (INIS)

Suhaimi Musa; Sakinah Ariffin

2005-01-01

Studies on the induction of mutation in Dendrobium orchid at MINT has produced a number of new orchid mutant cultivars. Tissue culture techniques on orchid seeds and meristem cloning are employed in preparing the samples for the mutation induction. Solid medium based on the Murashige and Skoog (1962) and liquid medium based on Vacin and Went (1949) were found to be suitable in producing protocorm like bodies (PLBs) that are required for the irradiation treatment. (Author)

Effects of polyamines and polyamine biosynthetic inhibitors on mitotic activity of Allium cepa root tips.

Science.gov (United States)

Unal, Meral; Palavan-Unsal, Narcin; Tufekci, M A

2008-03-01

The genotoxic and cytotoxic effects of exogenous polyamines (PAs), putrescine (Put), spermidine (Spd), spermine (Spm) and PA biosynthetic inhibitors, alpha-difluoromethylornithine (DFMO), cyclohexilamine (CHA), methylglioxal bis-(guanylhydrazone) (MGBG) were investigated in the root meristems of Allium cepa L. The reduction of mitotic index and the induction of chromosomal aberrations such as bridges, stickiness, c-mitotic anaphases, micronuclei, endoredupliction by PAs and PA biosynthetic inhibitors were observed and these were used as evidence of genotoxicity and cytotoxicity.

Selective weed control using laser techniques

OpenAIRE

Marx, Christian; Pastrana-Perez, Julio; Hustedt, Michael; Barcikowski, Stephan; Haferkamp, Heinz; Rath, Thomas

2012-01-01

This contribution discusses technical and growth relevant aspects of using laser techniques for weed control. The research on thermal weed control via laser first focused on the interaction of laser beams and weed plants. Due to preliminary studies, a CO2-laser was selected for further studies with regard to the process factors laser energy, laser spot area, coverage of the weeds meristem, weed species (Amaranthus retroflexus), and weed growth stage. Thereby, the laser damage was modeled in o...

Effect of 2 MHz ultrasound irradiation on Pisum sativum roots

International Nuclear Information System (INIS)

Miller, M.W.; Voorhees, S.M.; Carstensen, E.L.; Kaufman, G.E.

1976-01-01

The effect of 2 MHz ultrasound at intensity levels from 2.5 to 22 W/cm 2 on the growth rate and mitotic index of Pisum sativum roots was studied. The ultrasound produced an immediate reduction in the growth rate on the first postexposure day, followed by a gradual recovery to the control value. Ultrasound reduced the root meristem mitotic index. Intensity- and time-dependent relations were found for the growth rate and mitotic index reductions

Micropropagation of globe artichoke (Cynara cardunculus L. var. scolymus).

Science.gov (United States)

Iapichino, Giovanni

2013-01-01

The globe artichoke (Cynara cardunculus L. var. scolymus) is a perennial plant cultivated in the Mediterranean region and the Americas for its edible young flower heads. Although vegetative propagation by offshoots or by "ovoli" (underground dormant axillary buds) has been the primary method of propagation, the potential for the diffusion of diseases and the phenotypic variability can be very high. The propagation of this species by axillary shoot proliferation from in vitro-cultured meristems produces systemic pathogen-free plants and a higher multiplication rate as compared to that obtained by conventional agamic multiplication. Axillary shoot proliferation can be induced from excised shoot apices cultured on Murashige and Skoog agar solidified medium supplemented with various concentrations of cytokinins and auxins, depending on genotype. For the production of virus-free plants, meristems, 0.3-0.8 mm long are excised from shoot apices and surface sterilized. The transfer of artichoke microshoots to a medium lacking cytokinins or with low cytokinin concentration is critical for rooting. Adventitious roots develop within 3-5 weeks after transfer to root induction MS medium containing NAA or IAA at various concentrations. However, in vitro rooting frequency rate is dependent on the genotype and the protocol used. Acclimatization of in vitro microshoots having 3-4 roots is successfully accomplished; plantlets develop new roots in ex vitro conditions and continue to grow.

Overexpression of Arabidopsis plasmodesmata germin-like proteins disrupts root growth and development.

Science.gov (United States)

Ham, Byung-Kook; Li, Gang; Kang, Byung-Ho; Zeng, Fanchang; Lucas, William J

2012-09-01

In plants, a population of non-cell-autonomous proteins (NCAPs), including numerous transcription factors, move cell to cell through plasmodesmata (PD). In many cases, the intercellular trafficking of these NCAPs is regulated by their interaction with specific PD components. To gain further insight into the functions of this NCAP pathway, coimmunoprecipitation experiments were performed on a tobacco (Nicotiana tabacum) plasmodesmal-enriched cell wall protein preparation using as bait the NCAP, pumpkin (Cucurbita maxima) PHLOEM PROTEIN16 (Cm-PP16). A Cm-PP16 interaction partner, Nt-PLASMODESMAL GERMIN-LIKE PROTEIN1 (Nt-PDGLP1) was identified and shown to be a PD-located component. Arabidopsis thaliana putative orthologs, PDGLP1 and PDGLP2, were identified; expression studies indicated that, postgermination, these proteins were preferentially expressed in the root system. The PDGLP1 signal peptide was shown to function in localization to the PD by a novel mechanism involving the endoplasmic reticulum-Golgi secretory pathway. Overexpression of various tagged versions altered root meristem function, leading to reduced primary root but enhanced lateral root growth. This effect on root growth was corrected with an inability of these chimeric proteins to form stable PD-localized complexes. PDGLP1 and PDGLP2 appear to be involved in regulating primary root growth by controlling phloem-mediated allocation of resources between the primary and lateral root meristems.

Differential transcriptome analysis between Populus and its synthesized allotriploids driven by second-division restitution.

Science.gov (United States)

Cheng, Shiping; Huang, Zhen; Li, Yun; Liao, Ting; Suo, Yujing; Zhang, Pingdong; Wang, Jun; Kang, Xiangyang

2015-12-01

In this report, we compared transcriptomic differences between a synthetic Populus section Tacamahaca triploid driven by second-division restitution and its parents using a high-throughput RNA-seq method. A total of 4,080 genes were differentially expressed between the high-growth vigor allotriploids (SDR-H) and their parents, and 719 genes were non-additively expressed in SDR-H. Differences in gene expression between the allotriploid and male parent were more significant than those between the allotriploid and female parent, which may be caused by maternal effects. We observed 3,559 differentially expressed genes (DEGs) between the SDR-H and male parent. Notably, the genes were mainly involved in metabolic process, cell proliferation, DNA methylation, cell division, and meristem and developmental growth. Among the 1,056 DEGs between SDR-H and female parent, many genes were associated with metabolic process and carbon utilization. In addition, 1,789 DEGs between high- and low-growth vigor allotriploid were mainly associated with metabolic process, auxin poplar transport, and regulation of meristem growth. Our results indicated that the higher poplar ploidy level can generate extensive transcriptomic diversity compared with its parents. Overall, these results increased our understanding of the driving force for phenotypic variation and adaptation in allopolyploids driven by second-division restitution. © 2015 Institute of Botany, Chinese Academy of Sciences.

The glutamate carboxypeptidase AMP1 mediates abscisic acid and abiotic stress responses in Arabidopsis.

Science.gov (United States)

Shi, Yiting; Wang, Zheng; Meng, Pei; Tian, Siqi; Zhang, Xiaoyan; Yang, Shuhua

2013-07-01

ALTERED MERISTEM PROGRAM1 (AMP1) encodes a glutamate carboxypeptidase that plays an important role in shoot apical meristem development and phytohormone homeostasis. We isolated a new mutant allele of AMP1, amp1-20, from a screen for abscisic acid (ABA) hypersensitive mutants and characterized the function of AMP1 in plant stress responses. amp1 mutants displayed ABA hypersensitivity, while overexpression of AMP1 caused ABA insensitivity. Moreover, endogenous ABA concentration was increased in amp1-20- and decreased in AMP1-overexpressing plants under stress conditions. Application of ABA reduced the AMP1 protein level in plants. Interestingly, amp1 mutants accumulated excess superoxide and displayed hypersensitivity to oxidative stress. The hypersensitivity of amp1 to ABA and oxidative stress was partially rescued by reactive oxygen species (ROS) scavenging agent. Furthermore, amp1 was tolerant to freezing and drought stress. The ABA hypersensitivity and freezing tolerance of amp1 was dependent on ABA signaling. Moreover, amp1 had elevated soluble sugar content and showed hypersensitivity to high concentrations of sugar. By contrast, the contents of amino acids were changed in amp1 mutant compared to the wild-type. This study suggests that AMP1 modulates ABA, oxidative and abotic stress responses, and is involved in carbon and amino acid metabolism in Arabidopsis. © 2013 The Authors. New Phytologist © 2013 New Phytologist Trust.

Influence of Plant Growth Retardants on Quality of Codonopsis Radix

Directory of Open Access Journals (Sweden)

Yinyin Liao

2017-10-01

Full Text Available Plant growth retardant (PGR refers to organics that can inhibit the cell division of plant stem tip sub-apical meristem cells or primordial meristem cell. They are widely used in the cultivation of rhizomatous functional plants; such as Codonopsis Radix, that is a famous Chinese traditional herb. However, it is still unclear whether PGR affects the medicinal quality of C. Radix. In the present study, amino acid analyses, targeted and non-targeted analyses by ultra-performance liquid chromatography combined with time-of-flight mass spectrometry (UPLC-TOF-MS and gas chromatography-MS were used to analyze and compare the composition of untreated C. Radix and C. Radix treated with PGR. The contents of two key bioactive compounds, lobetyolin and atractylenolide III, were not affected by PGR treatment. The amounts of polysaccharides and some internal volatiles were significantly decreased by PGR treatment; while the free amino acids content was generally increased. Fifteen metabolites whose abundance were affected by PGR treatment were identified by UPLC-TOF-MS. Five of the up-regulated compounds have been reported to show immune activity, which might contribute to the healing efficacy (“buqi” of C. Radix. The results of this study showed that treatment of C. Radix with PGR during cultivation has economic benefits and affected some main bioactive compounds in C. Radix.

TrMADS3, a new MADS-box gene, from a perennial species Taihangia rupestris (Rosaceae) is upregulated by cold and experiences seasonal fluctuation in expression level.

Science.gov (United States)

Du, Xiaoqiu; Xiao, Qiying; Zhao, Ran; Wu, Feng; Xu, Qijiang; Chong, Kang; Meng, Zheng

2008-06-01

In many temperate perennial plants, floral transition is initiated in the first growth season but the development of flower is arrested during the winter to ensure production of mature flowers in the next spring. The molecular mechanisms of the process remain poorly understood with few well-characterized regulatory genes. Here, a MADS-box gene, named as TrMADS3, was isolated from the overwintering inflorescences of Taihangia rupestris, a temperate perennial in the rose family. Phylogenetic analysis reveals that TrMADS3 is more closely related to the homologs of the FLOWERING LOCUS C lineage than to any of the other MIKC-type MADS-box lineages known from Arabidopsis. The TrMADS3 transcripts are extensively distributed in inflorescences, roots, and leaves during the winter. In controlled conditions, the TrMADS3 expression level is upregulated by a chilling exposure for 1 to 2 weeks and remains high for a longer period of time in warm conditions after cold treatment. In situ hybridization reveals that TrMADS3 is predominantly expressed in the vegetative and reproductive meristems. Ectopic expression of TrMADS3 in Arabidopsis promotes seed germination on the media containing relatively high NaCl or mannitol concentrations. These data indicate that TrMADS3 in a perennial species might have its role in both vegetative and reproductive meristems in response to cold.

AtLa1 protein initiates IRES-dependent translation of WUSCHEL mRNA and regulates the stem cell homeostasis of Arabidopsis in response to environmental hazards.

Science.gov (United States)

Cui, Yuchao; Rao, Shaofei; Chang, Beibei; Wang, Xiaoshuang; Zhang, Kaidian; Hou, Xueliang; Zhu, Xueyi; Wu, Haijun; Tian, Zhaoxia; Zhao, Zhong; Yang, Chengwei; Huang, Tao

2015-10-01

Plant stem cells are hypersensitive to environmental hazards throughout their life cycle, but the mechanism by which plants safeguard stem cell homeostasis in response to environmental hazards is largely unknown. The homeodomain transcription factor WUSCHEL (WUS) protein maintains the stem cell pool in the shoot apical meristem of Arabidopsis. Here, we demonstrate that the translation of WUS mRNA is directed by an internal ribosomal entry site (IRES) located in the 5'-untranslated region. The AtLa1 protein, an RNA-binding factor, binds to the 5'-untranslated region and initiates the IRES-dependent translation of WUS mRNA. Knockdown of AtLa1 expression represses the WUS IRES-dependent translation and leads to the arrest of growth and development. The AtLa1 protein is mainly located in the nucleoplasm. However, environmental hazards promote the nuclear-to-cytoplasmic translocation of the AtLa1 protein, which further enhances the IRES-dependent translation of WUS mRNA. Genetic evidence indicates that the WUS protein increases the tolerance of the shoot apical meristem to environmental hazards. Based on these results, we conclude that the stem cell niche in Arabidopsis copes with environmental hazards by enhancing the IRES-dependent translation of WUS mRNA under the control of the AtLa1 protein. © 2015 John Wiley & Sons Ltd.

Europium Uptake and Partitioning in Oat (Avena sativa) Roots as studied By Laser-Induced Fluorescence Spectroscopy and Confocal Microscopy Profiling Technique

International Nuclear Information System (INIS)

Fellows, Robert J.; Wang, Zheming; Ainsworth, Calvin C.

2003-01-01

The uptake of Eu3+ by elongating oat plant roots was studied by fluorescence spectroscopy, fluorescence lifetime measurement, as well as laser excitation time-resolved confocal fluorescence profiling technique. The results of this work indicated that the initial uptake of Eu(III) by oat root was most evident within the apical meristem of the root just proximal to the root cap. Distribution of assimilated Eu(III) within the roots differentiation and elongation zone was non-uniform. Higher concentrations were observed within the vascular cylinder, specifically in the phloem and developing xylem parenchyma. Elevated levels of the metal were also observed in the root hairs of the mature root. The concentration of assimilated Eu3+ dropped sharply from the apical meristem to the differentiation and elongation zone and then gradually decreased as the distance from the root cap increased. Fluorescence spectroscopic characteristics of the assimilated Eu3+ suggested that the Eu3+ exists a s inner-sphere mononuclear complexes inside the root. This work has also demonstrated the effectiveness of a time-resolved Eu3+ fluorescence spectroscopy and confocal fluorescence profiling techniques for the in vivo, real-time study of metal[Eu3+] accumulation by a functioning intact plant root. This approach can prove valuable for basic and applied studies in plant nutrition and environmental uptake of actinide radionuclides

Bottlenecks in bog pine multiplication by somatic embryogenesis and their visualization with the environmental scanning electron microscope.

Science.gov (United States)

Vlašínová, Helena; Neděla, Vilem; Đorđević, Biljana; Havel, Ladislav

2017-07-01

Somatic embryogenesis (SE) is an important biotechnological technique used for the propagation of many pine species in vitro. However, in bog pine, one of the most endangered tree species in the Czech Republic, limitations were observed, which negatively influenced the development and further germination of somatic embryos. Although initiation frequency was very low-0.95 %, all obtained cell lines were subjected to maturation. The best responding cell line (BC1) was used and subjected to six different variants of the maturation media. The media on which the highest number of early-precotyledonary/cotyledonary somatic embryos was formed was supplemented with 121 μM abscisic acid (ABA) and with 6 % maltose. In the end of maturation experiments, different abnormalities in formation of somatic embryos were observed. For visualization and identification of abnormalities in meristem development during proliferation and maturation processes, the environmental scanning electron microscope was used. In comparison to the classical light microscope, the non-commercial environmental scanning electron microscope AQUASEM II has been found as a very useful tool for the quick recognition of apical meristem disruption and abnormal development. To our knowledge, this is the first report discussing somatic embryogenesis in bog pine. Based on this observation, the cultivation procedure could be enhanced and the method for SE of bog pine optimized.

Transformation of Oats and Its Application to Improving Osmotic Stress Tolerance

Science.gov (United States)

Maqbool, Shahina B.; Zhong, Heng; Oraby, Hesham F.; Sticklen, Mariam B.

Oat (Avena sativa L.), a worldwide temperate cereal crop, is deficient in tolerance to osmotic stress due to drought and/or salinity. To genetically transform the available commercial oat cultivars, a genotype-independent and efficient regeneration system from shoot apical meristems was developed using four oat cultivars: Prairie, Porter, Ogle, and Pacer. All these oat cultivars generated a genotype-independent in vitro differentiated multiple shoots from shoot apical meristems at a high frequency. Using this system, three oat cultivars were genetically co-transformed with pBY520 (containing hva1 and bar) and pAct1-D (containing gus) using biolistic™ bombardment. Transgenic plants were selected and regenerated using herbicide resistance and GUS as a marker. Molecular and biochemical analyses of putative transgenic plants confirmed the co-integration of hva1 and bar genes with a frequency of 100%, and 61.6% of the transgenic plants carried all three genes (hva1, bar and gus). Further analyses of R0, R1, and R2 progenies confirmed stable integration, expression, and Mendalian inheritance for all transgenes. Histochemical analysis of GUS protein in transgenic plants showed a high level of GUS expression in vascular tissues and in the pollen grains of mature flowers. Immunochemical analysis of transgenic plants indicated a constitutive expression of hva1 at all developmental stages. However, the level of HVA1 was higher during the early seedling stages.

MAIL1 is essential for development of the primary root but not of anchor roots

OpenAIRE

Ühlken, Christine; Hoth, Stefan; Weingartner, Magdalena

2014-01-01

MAIN-LIKE1 (MAIL1) is a ubiquitously expressed nuclear protein, which has a crucial function during root development. We have recently described loss of function mutants for MAIL1, in which the organization and function of the primary root meristem is lost soon after germination. Moreover cell differentiation is impaired resulting in primary root growth arrest soon after emergence. Here we show that mail1 mutants form several anchor roots from the hypocotyl to root junction. These anchor root...

Main: 1UT7 [RPSD[Archive

Lifescience Database Archive (English)

Full Text Available 1UT7 シロイヌナズナ Arabidopsis Arabidopsis thaliana (L.) Heynh. Nac-Domain Containing Pro... Meristem Protein; Synonym: Nam, Anac, Abscisic Acid Responsive Nac, Dicyanoaurate Derivative; Chain: A, B; ...Fragment: Dna-Binding Nac Domain, Residues 1-168; Engineered: Yes; Other_details:...A.Ernst, A.N.Olsen, K.Skriver, S.Larsen, L.Lo Leggio Structure Of The Conserved Domain Of Anac, A Member Of ... Transcription Factor, Dna Binding, Abscisic Acid Response, Arabidopsis Thaliana, Crystal Structure, Nac Domai

Number of nucleoli in diploids and polyploids of the genus Achillea L.

Directory of Open Access Journals (Sweden)

Janina Dąbrowska

2014-01-01

Full Text Available Nucleoli were counted in 9228 interphase nuclei of the apical root meristem of 40 Achillea L. taxa (di-, tetra-. hexa- and octoploids. It was established that the distribution of nucleoli number in an interphase nucleus can be used as a rough practical indicator to distinguish between diploids and polyploids. The highest number of nucleoli (12 was found in an octoploid Achillea pannonica, but only in a small percentage of the nuclei (0.3% out of 283 nuclei.

Use of ionizing radiations In vitro for the production of new varieties of flowers: Tiny rose

International Nuclear Information System (INIS)

Gonzalez J, J.; Cruz G, M.T.

1993-01-01

The miniature rose (Rosa Chinensis) is one of the ornamental plants with more potential in the International flower market. Its great propagation difficulty has impede the mass production. The aim of this work is to produce a new variety of miniature rose with optimal market characteristics using the biotechnology of irradiation of meristems In vitro to induce mutations in ornamental plants. As a first stage in this work, the micro propagation In vitro and the determination of lethal dose 50 (LD 50 ) were carried out. (Author)

Somatic embryogenesis in Malaysian cultivars of sweet potato (Ipomoea batatas L.).

OpenAIRE

De Silva, Angela Ee

2017-01-01

Three Malaysian sweet potato cultivars, namely Ipomoea batatas (L.) cv. Gendut, Jalomas and Telong, were investigated for their abilities to produce somatic embryos. Shoot meristems were used as the starting materials and cultured on Murashige and Skoog basal media (Murashige and Skoog, 1962) in the presence of auxin 2,4-dichlorophenoxyacetic acid (2,4-D) or 2,4,5-trichlorophenoxyacetic acid (2,4,5-T). Auxin 2,4,5-T at 5 µM was most effective for the initiation of primary embryogenic formati...

Effect of hydroxyurea on mitotic activity 3H-thymidine and 3H-phenylalanine incorporation in the antheridial filament cells of Chara vulgaris

International Nuclear Information System (INIS)

Bielecka, A.

1979-01-01

Hydroxyurea inhibits mitotic activity in cells of the antheridial filaments of Chara vulgaris by blocking phase S and phase G 2 . Blocking of cells in phase G 2 also occurs in the case of the root meristem cells of Helianthus annuus and Vicia faba var. minor. 3 H-thine incorporation confirmed autoradiographically the blocking of cells of the antheridial filaments in Chara vulgaris at phase S and slowing down of the rate of DNA replication. Incubation with 3 H-phenylalanine demonstrated that hydroxyurea inhibits protein synthesis. (author)

Protein intrinsic disorder in Arabidopsis NAC transcription factors

DEFF Research Database (Denmark)

O'Shea, Charlotte; Jensen, Mikael Kryger; Stender, Emil G.P.

2015-01-01

of differences in binding mechanisms. Although substitution of both hydrophobic and acidic residues of the ANAC046 MoRF region abolished binding, substitution of other residues, even with α-helix-breaking proline, was less disruptive. Together, the biophysical analyses suggest that RCD1-ANAC046 complex formation......Protein ID (intrinsic disorder) plays a significant, yet relatively unexplored role in transcription factors (TFs). In the present paper, analysis of the transcription regulatory domains (TRDs) of six phylogenetically representative, plant-specific NAC [no apical meristem, ATAF (Arabidopsis...

Chromosomal aberrations induced by Glycidol in Allium cepa L root meristem cells

OpenAIRE

N.Panneerselvam; L.Palanikumar; S.Gopinathan

2012-01-01

Glycidol is used as a stabilizer in the manufacture of vinyl polymers and natural oils and as an intermediate in the synthesis of glycerol, glycidyl ethers, and amines. It is also used as an alkylating agent,demulsifier, and dye-leveling agent and for sterilizing milk of magnesia. Glycidol is an alkylating agent which reacts readily with glutathione; it causes a decrease in glutathione content in rat liver, probably reflecting its binding to glutathione. It is a suspected reproductive toxican...

PHABULOSA Controls the Quiescent Center-Independent Root Meristem Activities in Arabidopsis thaliana

Czech Academy of Sciences Publication Activity Database

Sebastian, J.; Ryu, K.H.; Zhou, J.; Tarkowská, Danuše; Tarkowski, P.; Cho, Y.H.; Yoo, S.D.; Kim, E.S.; Lee, J.Y.

2015-01-01

Roč. 11, č. 3 (2015) ISSN 1553-7390 Grant - others:GA MŠk(CZ) ED0007/01/01 Program:ED Institutional support: RVO:61389030 Keywords : STEM-CELL NICHE * POSTTRANSCRIPTIONAL REGULATION * GENE-EXPRESSION Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 7.528, year: 2014

Abnormal mitosis in root meristem cells of Allium cepa L. induced by ...

African Journals Online (AJOL)

This investigation was aimed to find mitotic abnormalities as cytological evidence induced by the dye in root tip cells of onion (Allium cepa L.) grown in different concentrations: 0.01, 0.05, 0.1, 0.5 and 1.0% (weight per volume) prepared in distilled water in separate treatment schedules for 24 and 48 h. Mitotic aberrations ...

Shoot apical meristem and plant body organization: a cross-species comparative study

Czech Academy of Sciences Publication Activity Database

Schnablová, Renáta; Herben, Tomáš; Klimešová, Jitka

2017-01-01

Roč. 120, č. 5 (2017), s. 833-843 ISSN 0305-7364 R&D Projects: GA ČR GB14-36079G Institutional support: RVO:67985939 Keywords : Corner's rule * cell number * cell size Subject RIV: EF - Botanics OBOR OECD: Plant sciences, botany Impact factor: 4.041, year: 2016

In-vitro regeneration of castor bean (ricinus communis, L) and physic nut (jatropha curcas, L.)

International Nuclear Information System (INIS)

Afful, N. T.

2008-06-01

Investigations were conducted on in vitro regeneration of physic nut (Jatropha curcas, 1.) and castor bean (Ricinus communis, 1.) using zygotic embryo culture, shoot tip and meristem culture as well as somatic embryogenesis. Zygotic embryos from different stages of fruit maturity cultured on Murashige and Skoog (MS) medium supplemented with benzylaminopurine (BAP), kinetin and 2-isopentyl (2iP) produced vigorous seedlings with roots. However the optimal concentration of cytokinin for seedling development depended on the type cytokinin as well as the maturity stage of the fruit. Embryos from yellow fruits of Jatropha had the highest germination (100%) on an MS medium supplemented with 0.5 mg/L kinetin or 1 mg/L BAP while in Ricinus embryos from black fruits had the highest percentage germination (97%) on an MS medium modified with I mg/L 2iP or 0.5 or I mg/L BAP. Decrease in embryo viability especially in Jatropha as the seed matured may be due to high oil content in matured (black) fruit. Oil content in both Jatropha and Ricinus increased as the fruit matured from green to black and this may have effect on germination of zygotic embryos. In vitro culture response of shoot tip or meristem was significantly influenced by the concentration of growth regulators in the culture medium as well as the plant species. In both plant species, 2iP resulted in highest percentage shoot regeneration. The optimal concentration of 2iP was 0.5 mg/L for Ricinus shoot tip and 1.5 or 2.0 mg/L for Jatropha, indicating genotypic difference between the species. However excessive callus formation and browning in Ricinus led to the loss of all the regenerants. Shoot regeneration from meristem explants was also influenced by growth regulators with 2iP again being the best. Cultures of cotyledon and leaf lobe explants on MS medium supplemented with 2, 4-D and picloram resulted in callus induction with the exception of cotyledons obtained from black fruits. However transfer of calli onto fresh

Why is intracellular ice lethal? A microscopical study showing evidence of programmed cell death in cryo-exposed embryonic axes of recalcitrant seeds of Acer saccharinum.

Science.gov (United States)

Wesley-Smith, James; Walters, Christina; Pammenter, N W; Berjak, Patricia

2015-05-01

Conservation of the genetic diversity afforded by recalcitrant seeds is achieved by cryopreservation, in which excised embryonic axes (or, where possible, embryos) are treated and stored at temperatures lower than -180 °C using liquid nitrogen. It has previously been shown that intracellular ice forms in rapidly cooled embryonic axes of Acer saccharinum (silver maple) but this is not necessarily lethal when ice crystals are small. This study seeks to understand the nature and extent of damage from intracellular ice, and the course of recovery and regrowth in surviving tissues. Embryonic axes of A. saccharinum, not subjected to dehydration or cryoprotection treatments (water content was 1·9 g H2O g(-1) dry mass), were cooled to liquid nitrogen temperatures using two methods: plunging into nitrogen slush to achieve a cooling rate of 97 °C s(-1) or programmed cooling at 3·3 °C s(-1). Samples were thawed rapidly (177 °C s(-1)) and cell structure was examined microscopically immediately, and at intervals up to 72 h in vitro. Survival was assessed after 4 weeks in vitro. Axes were processed conventionally for optical microscopy and ultrastructural examination. Immediately following thaw after cryogenic exposure, cells from axes did not show signs of damage at an ultrastructural level. Signs that cells had been damaged were apparent after several hours of in vitro culture and appeared as autophagic decomposition. In surviving tissues, dead cells were sloughed off and pockets of living cells were the origin of regrowth. In roots, regrowth occurred from the ground meristem and procambium, not the distal meristem, which became lethally damaged. Regrowth of shoots occurred from isolated pockets of surviving cells of peripheral and pith meristems. The size of these pockets may determine the possibility for, the extent of and the vigour of regrowth. Autophagic degradation and ultimately autolysis of cells following cryo-exposure and formation of small

Arabidopsis pdr2 reveals a phosphate-sensitive checkpoint in root development.

Science.gov (United States)

Ticconi, Carla A; Delatorre, Carla A; Lahner, Brett; Salt, David E; Abel, Steffen

2004-03-01

Plants have evolved complex strategies to maintain phosphate (Pi) homeostasis and to maximize Pi acquisition when the macronutrient is limiting. Adjustment of root system architecture via changes in meristem initiation and activity is integral to the acclimation process. However, the mechanisms that monitor external Pi status and interpret the nutritional signal remain to be elucidated. Here, we present evidence that the Pi deficiency response, pdr2, mutation disrupts local Pi sensing. The sensitivity and amplitude of metabolic Pi-starvation responses, such as Pi-responsive gene expression or accumulation of anthocyanins and starch, are enhanced in pdr2 seedlings. However, the most conspicuous alteration of pdr2 is a conditional short-root phenotype that is specific for Pi deficiency and caused by selective inhibition of root cell division followed by cell death below a threshold concentration of about 0.1 mm external Pi. Measurements of general Pi uptake and of total phosphorus (P) in root tips exclude a defect in high-affinity Pi acquisition. Rescue of root meristem activity in Pi-starved pdr2 by phosphite (Phi), a non-metabolizable Pi analog, and divided-root experiments suggest that pdr2 disrupts sensing of low external Pi availability. Thus, PDR2 is proposed to function at a Pi-sensitive checkpoint in root development, which monitors environmental Pi status, maintains and fine-tunes meristematic activity, and finally adjusts root system architecture to maximize Pi acquisition.

Clonal analysis of the cell lineages in the male flower of maize

International Nuclear Information System (INIS)

Dawe, R.K.; Freeling, M.

1990-01-01

The cell lineages in the male flower of maize were characterized using X-rays and transposable elements to produce clonal sectors differing in anthocyanin pigmentation. Less than 50% of the somatic tassel mutations (caused by reversion of unstable color mutations) that were visible on the anther wall were sexually transmitted by the male gametes, unless the sectors were larger than half the tassel circumference. This result is explained by showing that: (a) both the outer (LI) and inner (LII) lineages of the shoot apical meristem form a cell layer in the bilayered anther wall, and that anther pigmentation can be derived from either cell layer; and that (b) the male germ cells are derived almost exclusively from the LII. Therefore, while reversion events in either the LI or LII are visible on the anther, only the LII events are heritable. Reversion events that occur prior to the organization of the shoot apical meristem however, produce large (usually more than one-half tassel) sectors that include both the outer and inner lineages. In contrast to the high level of cell layer invasion previously reported during leaf development, during anther development less than 10(-3) cells in the LI invade the LII to form male gametes. The strong correlation between cell lineage and cell fate in the maize anther has implications for studies on plant evolution and the genetic improvement of cereals by DNA transformation

ACCERBATIN, a small molecule at the intersection of auxin and reactive oxygen species homeostasis with herbicidal properties.

Science.gov (United States)

Hu, Yuming; Depaepe, Thomas; Smet, Dajo; Hoyerova, Klara; Klíma, Petr; Cuypers, Ann; Cutler, Sean; Buyst, Dieter; Morreel, Kris; Boerjan, Wout; Martins, José; Petrášek, Jan; Vandenbussche, Filip; Van Der Straeten, Dominique

2017-07-10

The volatile two-carbon hormone ethylene acts in concert with an array of signals to affect etiolated seedling development. From a chemical screen, we isolated a quinoline carboxamide designated ACCERBATIN (AEX) that exacerbates the 1-aminocyclopropane-1-carboxylic acid-induced triple response, typical for ethylene-treated seedlings in darkness. Phenotypic analyses revealed distinct AEX effects including inhibition of root hair development and shortening of the root meristem. Mutant analysis and reporter studies further suggested that AEX most probably acts in parallel to ethylene signaling. We demonstrated that AEX functions at the intersection of auxin metabolism and reactive oxygen species (ROS) homeostasis. AEX inhibited auxin efflux in BY-2 cells and promoted indole-3-acetic acid (IAA) oxidation in the shoot apical meristem and cotyledons of etiolated seedlings. Gene expression studies and superoxide/hydrogen peroxide staining further revealed that the disrupted auxin homeostasis was accompanied by oxidative stress. Interestingly, in light conditions, AEX exhibited properties reminiscent of the quinoline carboxylate-type auxin-like herbicides. We propose that AEX interferes with auxin transport from its major biosynthesis sites, either as a direct consequence of poor basipetal transport from the shoot meristematic region, or indirectly, through excessive IAA oxidation and ROS accumulation. Further investigation of AEX can provide new insights into the mechanisms connecting auxin and ROS homeostasis in plant development and provide useful tools to study auxin-type herbicides. © The Author 2017. Published by Oxford University Press on behalf of the Society for Experimental Biology.

Diversity and dynamics of plant genome size: an example of polysomaty from a cytogenetic study of Tahitian vanilla (Vanilla xtahitensis, Orchidaceae).

Science.gov (United States)

Lepers-Andrzejewski, Sandra; Siljak-Yakovlev, Sonja; Brown, Spencer C; Wong, Maurice; Dron, Michel

2011-06-01

Abnormal mitotic behavior with somatic aneuploidy and partial endoreplication were previously reported for the first time in the plant kingdom in Vanilla planifolia. Because vanilla plants are vegetatively propagated, such abnormalities have been transmitted. This study aimed to determine whether mitotic abnormalities also occur in Vanilla hybrid or are suppressed by sexual reproduction. Twenty-eight accessions of Vanilla ×tahitensis, one V. planifolia, and hybrid V. planifolia × V. ×tahitensis were analyzed by chromosome counts, cytometry, and fluorescent in situ hybridization of 18S-5.8S-26S rDNA. In a single root meristem of V. ×tahitensis, chromosome number varied from 22 to 31 in diploids (mean 2C = 5.23 pg), 31 to 41 in triploids (2C = 7.82 pg) and 43 to 60 in tetraploids (2C = 10.27 pg). Morphological diversity is apparently related to ploidy changes. Aneuploidy and partial (asymmetrical) endoreduplication were observed in root meristems of both V. ×tahitensis and the hybrid V. planifolia × V. ×tahitensis, but pollen grains had the euploid chromosome number (n = 15 in diploids). Genome irregularities may be transmitted not only during vegetative propagation but also by sexual reproduction in Vanilla. However, there must be a complex regulation of genome size and organization between the aneuploidy in somatic tissues and subsequently euploid gametic tissue. This is a novel example of polysomaty with developmentally regulated partial endoreplication.

Effects of copper and arsenic stress on the development of Norway spruce somatic embryos and their visualization with the environmental scanning electron microscope.

Science.gov (United States)

Đorđević, Biljana; Neděla, Vilém; Tihlaříková, Eva; Trojan, Václav; Havel, Ladislav

2018-05-18

Somatic embryogenesis is an important biotechnological technique which can be used in studies associated with environmental stress. Four embryogenic cell lines of Norway spruce were grown on media enriched with copper and arsenic in concentration ranges 50-500 μM and 10-50 μM, respectively. The effects were observed during subsequent stages of somatic embryogenesis, the characteristics evaluated being proliferation potential, average number of somatic embryos obtained per g/fresh weight, morphology of developed somatic embryos, metal uptake, and microanalysis of macro- and micronutrients uptake. Copper and arsenic at higher concentrations significantly reduced the growth of early somatic embryos. In almost all treatments, the cell line V-1-3 showed the best performance compared with the other lines tested. Environmental scanning electron microscopy was used to visualize and identify morphological abnormalities in the development of somatic embryos. Abnormalities observed were classified into several categories: meristemless somatic embryos, somatic embryos with disrupted meristem, reduced number of cotyledons, single cotyledon and fused cotyledons. With the application of a low temperature method for the environmental scanning electron microscope, samples were stabilized and whole meristems could be investigated in their native state. As far as we are aware, this is the first report of the effect of copper and arsenic during the process of somatic embryogenesis and the first to evaluate the content of macro and micronutrients uptake in Norway spruce. Copyright © 2018 Elsevier B.V. All rights reserved.

Differential CLE peptide perception by plant receptors implicated from structural and functional analyses of TDIF-TDR interactions

Energy Technology Data Exchange (ETDEWEB)

Li, Zhijie; Chakraborty, Sayan; Xu, Guozhou; Kobe, Bostjan

2017-04-06

Tracheary Element Differentiation Inhibitory Factor (TDIF) belongs to the family of post-translationally modified CLE (CLAVATA3/embryo surrounding region (ESR)-related) peptide hormones that control root growth and define the delicate balance between stem cell proliferation and differentiation in SAM (shoot apical meristem) or RAM (root apical meristem). In Arabidopsis, Tracheary Element Differentiation Inhibitory Factor Receptor (TDR) and its ligand TDIF signaling pathway is involved in the regulation of procambial cell proliferation and inhibiting its differentiation into xylem cells. Here we present the crystal structures of the extracellular domains (ECD) of TDR alone and in complex with its ligand TDIF resolved at 2.65 Åand 2.75 Å respectively. These structures provide insights about the ligand perception and specific interactions between the CLE peptides and their cognate receptors. Our in vitro biochemical studies indicate that the interactions between the ligands and the receptors at the C-terminal anchoring site provide conserved binding. While the binding interactions occurring at the N-terminal anchoring site dictate differential binding specificities between different ligands and receptors. Our studies will open different unknown avenues of TDR-TDIF signaling pathways that will enhance our knowledge in this field highlighting the receptor ligand interaction, receptor activation, signaling network, modes of action and will serve as a structure function relationship model between the ligand and the receptor for various similar leucine-rich repeat receptor-like kinases (LRR-RLKs).

Dynamics of forage accumulation in Elephant grass subjected to rotational grazing intensities

Directory of Open Access Journals (Sweden)

Braulio Maia de Lana Sousa

2013-09-01

Full Text Available We assessed the accumulation dynamics of forage and its components in Elephant grass cv. Napier (Pennisetum purpureum Schum. that were subjected to three post-grazing height treatments (30, 50, and 70 cm from February through May 2009 (experiment one and December 2009 through May 2010 (experiment two. In experiment one, the grazing events started when the light interception by the canopy reached 95%. The same was adopted for experiment two, except for the first grazing event, which was based on the height of the apical meristems of basal tillers. The experimental design for both experiments was a randomized complete block with three replications. The pastures that were managed at a post-grazing height of 30 cm exhibited lower rates of leaf and stem growth, total growth and forage accumulation than those that were managed at 50 or 70 cm, indicating that post-grazing height affects Elephant grass. The pastures that were managed at 50 cm exhibited relatively stable accumulation rates and less stem accumulation. Pastures managed at 70 cm of pos-grazing height presented more leaf and stem accumulation. Most apical meristems of Elephant grass should be removed in the first grazing when they reach the post-grazing target height of 50 cm. The elevation in the residual post-grazing height, especially in the summer, raises the regrowth vigor in the Elephant grass cv. Napier pasture. The post-grazing height of 30 cm reduces the growth of the Elephant grass cv. Napier.

Determination of dose ranges of gamma rays to induce specific changes in three ornamental species

International Nuclear Information System (INIS)

Gonzalez J, J.

2011-11-01

In order to confirming the possibility of to settle a dose range that takes place directly and not at random, a specific effect independently of the species that is were produced several similar organisms to three ornamental species took place via meristems cultivation: Petunia hybrid, Impatiens walleriana and Sprekelia formosissima, same that were irradiated in an irradiator Gamma cell 220, to different dose: 0, 3.5, 5.0, 7.5, 10, 12.5, 15, 17.5 and 20 Gy. Later on, of the plants treated via in vitro the subsequent generations were obtained until the M 4 . To determine the DL 50 and the possible good doses, the survival parameters, development, morphogenesis and height were evaluated during 8 weeks, interpreting based on them, the possible physiologic and genetic alterations induced by the radiation. The established DL 50 were: 7.5 Gy (Petunia), 19.0 Gy (Impatiens) and 12.0 Gy (Sprekelia). Based on the DL 50 of each species, a range of coincident dose settled down that produces a similar effect in the three species: a range of DL 23 to the DL 50 induces and alteration in the cytokinins production affecting directly in the leaves number, buds and plants taken place by meristem, also a range of DL 32 - DL 50 impacts in the auxins production altering to the radicule system. However, when being superimposed the dose is considered that the investigation should continue. (Author)

ARABIDOPSIS HOMOLOG of TRITHORAX1 (ATX1) is required for cell production, patterning, and morphogenesis in root development

OpenAIRE

Napsucialy-Mendivil, Selene; Alvarez-Venegas, Raúl; Shishkova, Svetlana; Dubrovsky, Joseph G.

2014-01-01

ARABIDOPSIS HOMOLOG of TRITHORAX1 (ATX1/SDG27), a known regulator of flower development, encodes a H3K4histone methyltransferase that maintains a number of genes in an active state. In this study, the role of ATX1 in root development was evaluated. The loss-of-function mutant atx1-1 was impaired in primary root growth. The data suggest that ATX1 controls root growth by regulating cell cycle duration, cell production, and the transition from cell proliferation in the root apical meristem (RAM)...

Chromosome breakage in Vicia faba by ozone

Energy Technology Data Exchange (ETDEWEB)

Fetner, R H

1958-02-15

Meristem cells of Vicia faba roots were exposed to an atmosphere of ozone and the fraction of cells showing chromosome aberrations were recorded. Chromosome aberrations were observed on a dose-response basis after exposing the seeds to 0.4 wt. percent ozone for 15, 30, and 60 minutes. The results of ozone, x-rays, and ozone and x-ray treatments are presented. A small number of root tips from each group was treated with colchicine and an analysis made of metaphase aberrations. These observations confirmed that the aberrations were all of the chromosome-type.

Micropropagaión de stevia rebaudiana bertoni, un endulzante natural a través de explantes con meristemos pre existentes

OpenAIRE

Suárez, Isidro; Quintero, Irma R.

2014-01-01

Título en ingles: Micropropagation of  Stevia rebaudiana Bertoni, a natural sweetener, through pre existing meristem explants Titulo corto: Micropropagación de Stevia rebaudiana Bertoni Resumen: Las hojas de Stevia rebaudiana son fuente de esteviosidos y rebaudiosidos, sustancias endulzantes con bajo contenido calórico. La propagación sexual y clonal de estevia es difícil debido a la calidad de la semilla y el tamaño reducido de la planta. Para evaluar la multiplicación, brotes establecidos i...

The Root Transition Zone: A Hot Spot for Signal Crosstalk.

Science.gov (United States)

Kong, Xiangpei; Liu, Guangchao; Liu, Jiajia; Ding, Zhaojun

2018-05-01

The root transition zone (TZ), located between the apical meristem and basal elongation region, has a unique role in root growth and development. The root TZ is not only the active site for hormone crosstalk, but also the perception site for various environmental cues, such as aluminum (Al) stress and low phosphate (Pi) stress. We propose that the root TZ is a hot spot for the integration of diverse inputs from endogenous (hormonal) and exogenous (sensorial) stimuli to control root growth. Copyright © 2018 Elsevier Ltd. All rights reserved.

Radiation-cytogenetic study of the mechanism of formation of chromosome aberations in Crepis capillaris cells

International Nuclear Information System (INIS)

Belyaev, I.Ya.; Semakin, A.B.; Grigorova, N.V.; Akif'ev, A.P.; AN SSSR, Moscow. Inst. Khimicheskoj Fiziki)

1986-01-01

Incomplete chromatid exchanges induced by γ-quanta at G 2 stage of Crepis capillaris meristem cells are transformed into complete chromosome exchanges during the second nuclear cycle. After the combined effect of γ-quanta and DNA synthesis inhibitor 5-fluoro-2-deoxyridine, the exchange aberrations disappear. During the second nuclear cycle, the chromatid exchanges, which were not realized in the presence of 5-fluro-2-deoxyuridne and regarded as potential ones, are transformed into chromosome exchanges. The breaks induced by 5-fluoro-2-deoxyuridine at G 2 stage are repaired after one nuclear cycle

Mutations in a plastid-localized elongation factor G alter early stages of plastid development in Arabidopsis thaliana

Directory of Open Access Journals (Sweden)

Hangarter Roger P

2007-07-01

Full Text Available Abstract Background Proper development of plastids in embryo and seedling tissues is critical for plant development. During germination, plastids develop to perform many critical functions that are necessary to establish the seedling for further growth. A growing body of work has demonstrated that components of the plastid transcription and translation machinery must be present and functional to establish the organelle upon germination. Results We have identified Arabidopsis thaliana mutants in a gene that encodes a plastid-targeted elongation factor G (SCO1 that is essential for plastid development during embryogenesis since two T-DNA insertion mutations in the coding sequence (sco1-2 and sco1-3 result in an embryo-lethal phenotype. In addition, a point mutation allele (sco1-1 and an allele with a T-DNA insertion in the promoter (sco1-4 of SCO1 display conditional seedling-lethal phenotypes. Seedlings of these alleles exhibit cotyledon and hypocotyl albinism due to improper chloroplast development, and normally die shortly after germination. However, when germinated on media supplemented with sucrose, the mutant plants can produce photosynthetically-active green leaves from the apical meristem. Conclusion The developmental stage-specific phenotype of the conditional-lethal sco1 alleles reveals differences in chloroplast formation during seedling germination compared to chloroplast differentiation in cells derived from the shoot apical meristem. Our identification of embryo-lethal mutant alleles in the Arabidopsis elongation factor G indicates that SCO1 is essential for plant growth, consistent with its predicted role in chloroplast protein translation.

Somatic embryogenesis and in vitro plant regeneration from pejibaye adult plant leaf primordia Embriogênese somática e regeneração de plantas in vitro a partir de primórdios foliares de pupunheiras adultas

Directory of Open Access Journals (Sweden)

Marcílio de Almeida

2006-09-01

Full Text Available The aim of this work was to evaluate a protocol for plant regeneration by means of somatic embryos obtained from isolated adult pejibaye leaf primordia, and to describe histological origin of embryos and morphogenetic response. Explants were cultivated in modified MS medium. Mesophyll parenchymatous cells originated meristemoids (preembryonic complex formation induced with 7.1 µM BAP in the first two subculture periods. After polarized structures with 12.9 µM NAA and 3.55 µM BAP were formed in the third subculture, somatic embryos developed and regenerated normal plants. The mesophyll parenchymatous cells display high capacity of direct response to the auxin and cytokinin.O objetivo deste trabalho foi avaliar um protocolo de regeneração de plantas por meio de embriões somáticos, obtidos a partir de primórdios foliares de pupunheiras adultas e identificar a origem histológica dos embriões e descrever as etapas morfogenéticas. Os explantes foram cultivados em meio MS modificado. Células parenquimáticas do mesofilo originaram meristemóides com BAP (7,1 µM nos dois primeiros períodos de subcultura. A polarização das estruturas ocorreu com ANA (12,9 µM e BAP (3,55 µM no terceiro período de subcultura. Meristemóides se desenvolveram em embriões somáticos, regenerando plantas normais. As células parenquimáticas do mesofilo apresentam elevada capacidade de resposta direta à auxina e à citocinina.

Occurrence of Bacillus amyloliquefaciens as a systemic endophyte of vanilla orchids.

Science.gov (United States)

White, James F; Torres, Mónica S; Sullivan, Raymond F; Jabbour, Rabih E; Chen, Qiang; Tadych, Mariusz; Irizarry, Ivelisse; Bergen, Marshall S; Havkin-Frenkel, Daphna; Belanger, Faith C

2014-11-01

We report the occurrence of Bacillus amyloliquefaciens in vanilla orchids (Vanilla phaeantha) and cultivated hybrid vanilla (V. planifolia × V. pompona) as a systemic bacterial endophyte. We determined with light microscopy and isolations that tissues of V. phaeantha and the cultivated hybrid were infected by a bacterial endophyte and that shoot meristems and stomatal areas of stems and leaves were densely colonized. We identified the endophyte as B. amyloliquefaciens using DNA sequence data. Since additional endophyte-free plants and seed of this orchid were not available, additional studies were performed on surrogate hosts Amaranthus caudatus, Ipomoea tricolor, and I. purpurea. Plants of A. caudatus inoculated with B. amyloliquefaciens demonstrated intracellular colonization of guard cells and other epidermal cells, confirming the pattern observed in the orchids. Isolations and histological studies suggest that the bacterium may penetrate deeply into developing plant tissues in shoot meristems, forming endospores in maturing tissues. B. amyloliquefaciens produced fungal inhibitors in culture. In controlled experiments using morning glory seedlings we showed that the bacterium promoted seedling growth and reduced seedling necrosis due to pathogens. We detected the gene for phosphopantetheinyl transferase (sfp), an enzyme in the pathway for production of antifungal lipopeptides, and purified the lipopeptide "surfactin" from cultures of the bacterium. We hypothesize that B. amyloliquefaciens is a robust endophyte and defensive mutualist of vanilla orchids. Whether the symbiosis between this bacterium and its hosts can be managed to protect vanilla crops from diseases is a question that should be evaluated in future research. © 2014 Wiley Periodicals, Inc.

TOPOISOMERASE1α Acts through Two Distinct Mechanisms to Regulate Stele and Columella Stem Cell Maintenance.

Science.gov (United States)

Zhang, Yonghong; Zheng, Lanlan; Hong, Jing Han; Gong, Ximing; Zhou, Chun; Pérez-Pérez, José Manuel; Xu, Jian

2016-05-01

TOPOISOMERASE1 (TOP1), which releases DNA torsional stress generated during replication through its DNA relaxation activity, plays vital roles in animal and plant development. In Arabidopsis (Arabidopsis thaliana), TOP1 is encoded by two paralogous genes (TOP1α and TOP1β), of which TOP1α displays specific developmental functions that are critical for the maintenance of shoot and floral stem cells. Here, we show that maintenance of two different populations of root stem cells is also dependent on TOP1α-specific developmental functions, which are exerted through two distinct novel mechanisms. In the proximal root meristem, the DNA relaxation activity of TOP1α is critical to ensure genome integrity and survival of stele stem cells (SSCs). Loss of TOP1α function triggers DNA double-strand breaks in S-phase SSCs and results in their death, which can be partially reversed by the replenishment of SSCs mediated by ETHYLENE RESPONSE FACTOR115 In the quiescent center and root cap meristem, TOP1α is epistatic to RETINOBLASTOMA-RELATED (RBR) in the maintenance of undifferentiated state and the number of columella stem cells (CSCs). Loss of TOP1α function in either wild-type or RBR RNAi plants leads to differentiation of CSCs, whereas overexpression of TOP1α mimics and further enhances the effect of RBR reduction that increases the number of CSCs Taken together, these findings provide important mechanistic insights into understanding stem cell maintenance in plants. © 2016 American Society of Plant Biologists. All Rights Reserved.

CsSCL1 is differentially regulated upon maturation in chestnut microshoots and is specifically expressed in rooting-competent cells.

Science.gov (United States)

Vielba, Jesús M; Díaz-Sala, Carmen; Ferro, Enrique; Rico, Saleta; Lamprecht, María; Abarca, Dolores; Ballester, Antonio; Sánchez, Conchi

2011-10-01

The Castanea sativa SCL1 gene (CsSCL1) has previously been shown to be induced by auxin during adventitious root (AR) formation in rooting-competent microshoots. However, its expression has not previously been analyzed in rooting-incompetent shoots. This study focuses on the regulation of CsSCL1 during maturation and the role of the gene in the formation of AR. The expression of CsSCL1 in rooting-incompetent microshoots and other tissues was investigated by quantitative reverse transcriptase--polymerase chain reaction. The analysis was complemented by in situ hybridization of the basal segments of rooting-competent and --incompetent microshoots during AR induction, as well as in AR and lateral roots. It was found that CsSCL1 is upregulated by auxin in a cell-type- and phase-dependent manner during the induction of AR. In root-forming shoots, CsSCL1 mRNA was specifically located in the cambial zone and derivative cells, which are rooting-competent cells, whereas in rooting-incompetent shoots the hybridization signal was more diffuse and evenly distributed through the phloem and parenchyma. CsSCL1 expression was also detected in lateral roots and axillary buds. The different CsSCL1 expression patterns in rooting-competent and -incompetent microshoots, together with the specific location of transcripts in cell types involved in root meristem initiation and in the root primordia of AR and lateral roots, indicate an important role for the gene in determining whether certain cells will enter the root differentiation pathway and its involvement in meristem maintenance.

Genetic improvement of sweet potato through somatic embyrogenesis and in vitro induction of mutations

Energy Technology Data Exchange (ETDEWEB)

Sonnino, A; Thinh, N T; Santangelo, E; Mini, P [Centro Ricerche Energia, ENEA, Rome (Italy)

1997-07-01

Mutation breeding is a promising option for the genetic improvement of sweet potato. Callus induction, somatic embryogenesis and plant regeneration was investigated in twenty-two sweet potato varieties of different origin. Plant regeneration was found to depend on the genotype and composition of the induction medium. The regeneration through somatic embryogenesis induced morphological and physiological changes among the regenerated plants. The irradiation with 30 to 50 Gy of meristems before culture on induction medium inhibited somatic embryogenesis. A number of accessions were evaluated in field trials and showed wide differences in yield. (author). 6 refs, 6 tabs.

Heterogeneity of critical systems as the main factor determining their radiostability

International Nuclear Information System (INIS)

Gudkov, I.N.

1984-01-01

It is shown that meristem can be considered as a convenient object for investigating regularities in the propagation kinetics of cells of critical systems and mechanisms of its regulation. Critical organs are rather perfect heterogeneous systems of automatic control where processes of their propagation and functional activity occur under strict control of spectral regulation systems to provide permanent composition and amount of cells. These systems influence purposeful cell alterations when they pass separate stages of the cell cycle. They provide the formation of funds of reserve cells and reliability of functioning of these highely sensitive organism tissues

Genetic improvement of sweet potato through somatic embyrogenesis and in vitro induction of mutations

International Nuclear Information System (INIS)

Sonnino, A.; Thinh, N.T.; Santangelo, E.; Mini, P.

1997-01-01

Mutation breeding is a promising option for the genetic improvement of sweet potato. Callus induction, somatic embryogenesis and plant regeneration was investigated in twenty-two sweet potato varieties of different origin. Plant regeneration was found to depend on the genotype and composition of the induction medium. The regeneration through somatic embryogenesis induced morphological and physiological changes among the regenerated plants. The irradiation with 30 to 50 Gy of meristems before culture on induction medium inhibited somatic embryogenesis. A number of accessions were evaluated in field trials and showed wide differences in yield. (author). 6 refs, 6 tabs

Ectopic expression of the HAM59 gene causes homeotic transformations of reproductive organs in sunflower (Helianthus annuus L.).

Science.gov (United States)

Shulga, O A; Neskorodov, Ya B; Shchennikova, A V; Gaponenko, A K; Skryabin, K G

2015-01-01

The function of the HAM59 MADS-box gene in sunflower (Helianthus annuus L.) was studied to clarify homeotic C activity in the Asteraceae plant family. For the first time, transgenic sunflower plants with a modified pattern of HAM59 expression were obtained. It was shown that the HAM59 MADS-box transcription factor did mediate C activity in sunflower. In particular, it participated in termination of the floral meristem, repression of the cadastral function of A-activity, and together with other C-type sunflower protein HAM45-in the specification of the identity of stamens and pistils.

The vascular plants: open system of growth.

Science.gov (United States)

Basile, Alice; Fambrini, Marco; Pugliesi, Claudio

2017-03-01

What is fascinating in plants (true also in sessile animals such as corals and hydroids) is definitely their open and indeterminate growth, as a result of meristematic activity. Plants as well as animals are characterized by a multicellular organization, with which they share a common set of genes inherited from a common eukaryotic ancestor; nevertheless, circa 1.5 billion years of evolutionary history made the two kingdoms very different in their own developmental biology. Flowering plants, also known as angiosperms, arose during the Cretaceous Period (145-65 million years ago), and up to date, they count around 235,000 species, representing the largest and most diverse group within the plant kingdom. One of the foundations of their success relies on the plant-pollinator relationship, essentially unique to angiosperms that pushed large speciation in both plants and insects and on the presence of the carpel, the structure devoted to seed enclosure. A seed represents the main organ preserving the genetic information of a plant; during embryogenesis, the primary axis of development is established by two groups of pluripotent cells: the shoot apical meristem (SAM), responsible for gene rating all aboveground organs, and the root apical meristem (RAM), responsible for producing all underground organs. During postembryonic shoot development, axillary meristem (AM) initiation and outgrowth are responsible for producing all secondary axes of growth including inflorescence branches or flowers. The production of AMs is tightly linked to the production of leaves and their separation from SAM. As leaf primordia are formed on the flanks of the SAM, a region between the apex and the developing organ is established and referred to as boundary zone. Interaction between hormones and the gene network in the boundary zone is fundamental for AM initiation. AMs only develop at the adaxial base of the leaf; thus, AM initiation is also strictly associated with leaf polarity. AMs

Poly herbal formulation with anti-elastase and anti-oxidant properties for skin anti-aging.

Science.gov (United States)

Kalyana Sundaram, Induja; Sarangi, Deepika Deeptirekha; Sundararajan, Vignesh; George, Shinomol; Sheik Mohideen, Sahabudeen

2018-01-29

Skin forms an important part of human innate immune system. Wrinkles, thinning and roughening of skin are some of the symptoms that affect the skin as it ages. Reactive oxygen species induced oxidative stress plays a major role in skin aging by modulating the elastase enzyme level in the skin. Extrinsic factors that affect skin aging such as UV radiation can also cause malignant melanoma. Here we selected four medicinal plant materials, namely, leaves of Nyctanthes arbor-tristis, unripe and ripe Aegle marmelos fruit pulp and the terminal meristem of Musa paradisiaca flower and investigated their anti-aging properties and cytotoxicity in vitro individually as well as in a poly herbal formulation containing the four plant extracts in different ratios. The phytochemical contents of the plant extracts were investigated for radical scavenging activity and total reducing power. Based upon its anti-oxidant properties, a poly herbal formulation containing leaves of Nyctanthes arbor-tristis, unripe and ripe fruit pulp of Aegle marmelos, and the terminal meristem of Musa paradisiaca flower in the ratio 6:2:1:1 (Poly Herbal Formulation 1) and 1:1:1:1 (Poly Herbal Formulation 2), respectively were formulated. It has been observed that the Poly Herbal Formulation 1 was more potent than Poly Herbal Formulation 2 due to better anti-oxidant and anti-elastase activities in NIH3T3 fibroblast cells. In addition Poly Herbal formulation 1 also had better anti-cancer activity in human malignant melanoma cells. Based on these results these beneficial plant extracts were identified for its potential application as an anti-aging agent in skin creams as well as an anti-proliferation compound against cancer cells.

ROTUNDA3 function in plant development by phosphatase 2A-mediated regulation of auxin transporter recycling.

Science.gov (United States)

Karampelias, Michael; Neyt, Pia; De Groeve, Steven; Aesaert, Stijn; Coussens, Griet; Rolčík, Jakub; Bruno, Leonardo; De Winne, Nancy; Van Minnebruggen, Annemie; Van Montagu, Marc; Ponce, María Rosa; Micol, José Luis; Friml, Jiří; De Jaeger, Geert; Van Lijsebettens, Mieke

2016-03-08

The shaping of organs in plants depends on the intercellular flow of the phytohormone auxin, of which the directional signaling is determined by the polar subcellular localization of PIN-FORMED (PIN) auxin transport proteins. Phosphorylation dynamics of PIN proteins are affected by the protein phosphatase 2A (PP2A) and the PINOID kinase, which act antagonistically to mediate their apical-basal polar delivery. Here, we identified the ROTUNDA3 (RON3) protein as a regulator of the PP2A phosphatase activity in Arabidopsis thaliana. The RON3 gene was map-based cloned starting from the ron3-1 leaf mutant and found to be a unique, plant-specific gene coding for a protein with high and dispersed proline content. The ron3-1 and ron3-2 mutant phenotypes [i.e., reduced apical dominance, primary root length, lateral root emergence, and growth; increased ectopic stages II, IV, and V lateral root primordia; decreased auxin maxima in indole-3-acetic acid (IAA)-treated root apical meristems; hypergravitropic root growth and response; increased IAA levels in shoot apices; and reduced auxin accumulation in root meristems] support a role for RON3 in auxin biology. The affinity-purified PP2A complex with RON3 as bait suggested that RON3 might act in PIN transporter trafficking. Indeed, pharmacological interference with vesicle trafficking processes revealed that single ron3-2 and double ron3-2 rcn1 mutants have altered PIN polarity and endocytosis in specific cells. Our data indicate that RON3 contributes to auxin-mediated development by playing a role in PIN recycling and polarity establishment through regulation of the PP2A complex activity.

Identification of the arabidopsis RAM/MOR signalling network: adding new regulatory players in plant stem cell maintenance and cell polarization

Science.gov (United States)

Zermiani, Monica; Begheldo, Maura; Nonis, Alessandro; Palme, Klaus; Mizzi, Luca; Morandini, Piero; Nonis, Alberto; Ruperti, Benedetto

2015-01-01

Background and Aims The RAM/MOR signalling network of eukaryotes is a conserved regulatory module involved in co-ordination of stem cell maintenance, cell differentiation and polarity establishment. To date, no such signalling network has been identified in plants. Methods Genes encoding the bona fide core components of the RAM/MOR pathway were identified in Arabidopsis thaliana (arabidopsis) by sequence similarity searches conducted with the known components from other species. The transcriptional network(s) of the arabidopsis RAM/MOR signalling pathway were identified by running in-depth in silico analyses for genes co-regulated with the core components. In situ hybridization was used to confirm tissue-specific expression of selected RAM/MOR genes. Key Results Co-expression data suggested that the arabidopsis RAM/MOR pathway may include genes involved in floral transition, by co-operating with chromatin remodelling and mRNA processing/post-transcriptional gene silencing factors, and genes involved in the regulation of pollen tube polar growth. The RAM/MOR pathway may act upstream of the ROP1 machinery, affecting pollen tube polar growth, based on the co-expression of its components with ROP-GEFs. In silico tissue-specific co-expression data and in situ hybridization experiments suggest that different components of the arabidopsis RAM/MOR are expressed in the shoot apical meristem and inflorescence meristem and may be involved in the fine-tuning of stem cell maintenance and cell differentiation. Conclusions The arabidopsis RAM/MOR pathway may be part of the signalling cascade that converges in pollen tube polarized growth and in fine-tuning stem cell maintenance, differentiation and organ polarity. PMID:26078466

Symbiosome-like intracellular colonization of cereals and other crop plants by nitrogen-fixing bacteria for reduced inputs of synthetic nitrogen fertilizers.

Science.gov (United States)

Cocking, Edward C; Stone, Philip J; Davey, Michael R

2005-09-01

It has been forecast that the challenge of meeting increased food demand and protecting environmental quality will be won or lost in maize, rice and wheat cropping systems, and that the problem of environmental nitrogen enrichment is most likely to be solved by substituting synthetic nitrogen fertilizers by the creation of cereal crops that are able to fix nitrogen symbiotically as legumes do. In legumes, rhizobia present intracellularly in membrane-bound vesicular compartments in the cytoplasm of nodule cells fix nitrogen endosymbiotically. Within these symbiosomes, membrane-bound vesicular compartments, rhizobia are supplied with energy derived from plant photosynthates and in return supply the plant with biologically fixed nitrogen, usually as ammonia. This minimizes or eliminates the need for inputs of synthetic nitrogen fertilizers. Recently we have demonstrated, using novel inoculation conditions with very low numbers of bacteria, that cells of root meristems of maize, rice, wheat and other major non-legume crops, such as oilseed rape and tomato, can be intracellularly colonized by the non-rhizobial, non-nodulating, nitrogen fixing bacterium,Gluconacetobacter diazotrophicus that naturally occurs in sugarcane.G. diazotrophicus expressing nitrogen fixing (nifH) genes is present in symbiosome-like compartments in the cytoplasm of cells of the root meristems of the target cereals and non-legume crop species, somewhat similar to the intracellular symbiosome colonization of legume nodule cells by rhizobia. To obtain an indication of the likelihood of adequate growth and yield, of maize for example, with reduced inputs of synthetic nitrogen fertilizers, we are currently determining the extent to which nitrogen fixation, as assessed using various methods, is correlated with the extent of systemic intracellular colonization byG. diazotrophicus, with minimal or zero inputs.

High efficiency transformation of banana [Musa acuminata L. cv. Matti (AA)] for enhanced tolerance to salt and drought stress through overexpression of a peanut salinity-induced pathogenesis-related class 10 protein.

Science.gov (United States)

Rustagi, Anjana; Jain, Shalu; Kumar, Deepak; Shekhar, Shashi; Jain, Mukesh; Bhat, Vishnu; Sarin, Neera Bhalla

2015-01-01

Bananas and plantains (Musa spp. L.) are important subsistence crops and premium export commodity in several countries, and susceptible to a wide range of environmental and biotic stress conditions. Here, we report efficient, rapid, and reproducible Agrobacterium-mediated transformation and regeneration of an Indian niche cultivar of banana [M. acuminata cv. Matti (AA)]. Apical meristem-derived highly proliferative multiple shoot clump (MSC) explants were transformed with the Agrobacterium strain EHA105 harboring a binary vector pCAMBIA-1301 carrying hptII and uidA. Sequential agro-infiltration (10 min, 400 mmHg), infection (additional 35 min, Agrobacterium density A 600 = 0.8) and co-cultivation (18 h) regimen in 100 µM acetosyringone containing liquid medium were critical factors yielding high transformation efficiency (~81 %) corroborated by transient GUS expression assay. Stable transgenic events were recovered following two cycles of meristem initiation and selection on hygromycin containing medium. Histochemical GUS assay in several tissues of transgenic plants and molecular analyses confirmed stable integration and expression of transgene. The protocol described here allowed recovery of well-established putative transgenic plantlets in as little as 5 months. The transgenic banana plants could be readily acclimatized under greenhouse conditions, and were phenotypically similar to the wild-type untransformed control plants (WT). Transgenic plants overexpressing Salinity-Induced Pathogenesis-Related class 10 protein gene from Arachis hypogaea (AhSIPR10) in banana cv. Matti (AA) showed better photosynthetic efficiency and less membrane damage (P < 0.05) in the presence of NaCl and mannitol in comparison to WT plants suggesting the role of AhSIPR10 in better tolerance of salt stress and drought conditions.

An RNA-seq transcriptome analysis of histone modifiers and RNA silencing genes in soybean during floral initiation process.

Directory of Open Access Journals (Sweden)

Lim Chee Liew

Full Text Available Epigenetics has been recognised to play vital roles in many plant developmental processes, including floral initiation through the epigenetic regulation of gene expression. The histone modifying proteins that mediate these modifications involve the SET domain-containing histone methyltransferases, JmjC domain-containing demethylase, acetylases and deacetylases. In addition, RNA interference (RNAi-associated genes are also involved in epigenetic regulation via RNA-directed DNA methylation and post-transcriptional gene silencing. Soybean, a major crop legume, requires a short day to induce flowering. How histone modifications regulate the plant response to external cues that initiate flowering is still largely unknown. Here, we used RNA-seq to address the dynamics of transcripts that are potentially involved in the epigenetic programming and RNAi mediated gene silencing during the floral initiation of soybean. Soybean is a paleopolyploid that has been subjected to at least two rounds of whole genome duplication events. We report that the expanded genomic repertoire of histone modifiers and RNA silencing genes in soybean includes 14 histone acetyltransferases, 24 histone deacetylases, 47 histone methyltransferases, 15 protein arginine methyltransferases, 24 JmjC domain-containing demethylases and 47 RNAi-associated genes. To investigate the role of these histone modifiers and RNA silencing genes during floral initiation, we compared the transcriptional dynamics of the leaf and shoot apical meristem at different time points after a short-day treatment. Our data reveal that the extensive activation of genes that are usually involved in the epigenetic programming and RNAi gene silencing in the soybean shoot apical meristem are reprogrammed for floral development following an exposure to inductive conditions.

Differential TOR activation and cell proliferation in Arabidopsis root and shoot apexes.

Science.gov (United States)

Li, Xiaojuan; Cai, Wenguo; Liu, Yanlin; Li, Hui; Fu, Liwen; Liu, Zengyu; Xu, Lin; Liu, Hongtao; Xu, Tongda; Xiong, Yan

2017-03-07

The developmental plasticity of plants relies on the remarkable ability of the meristems to integrate nutrient and energy availability with environmental signals. Meristems in root and shoot apexes share highly similar molecular players but are spatially separated by soil. Whether and how these two meristematic tissues have differential activation requirements for local nutrient, hormone, and environmental cues (e.g., light) remain enigmatic in photosynthetic plants. Here, we report that the activation of root and shoot apexes relies on distinct glucose and light signals. Glucose energy signaling is sufficient to activate target of rapamycin (TOR) kinase in root apexes. In contrast, both the glucose and light signals are required for TOR activation in shoot apexes. Strikingly, exogenously applied auxin is able to replace light to activate TOR in shoot apexes and promote true leaf development. A relatively low concentration of auxin in the shoot and high concentration of auxin in the root might be responsible for this distinctive light requirement in root and shoot apexes, because light is required to promote auxin biosynthesis in the shoot. Furthermore, we reveal that the small GTPase Rho-related protein 2 (ROP2) transduces light-auxin signal to activate TOR by direct interaction, which, in turn, promotes transcription factors E2Fa,b for activating cell cycle genes in shoot apexes. Consistently, constitutively activated ROP2 plants stimulate TOR in the shoot apex and cause true leaf development even without light. Together, our findings establish a pivotal hub role of TOR signaling in integrating different environmental signals to regulate distinct developmental transition and growth in the shoot and root.

Use of radiation for inducing mutants in potatoes through tissue culture technique

International Nuclear Information System (INIS)

Sharabash, M.T.

1997-01-01

Meristem-tips obtained from sprouts of potato tubers, cv. 'Diamant' (Solanum tuberosum) were cultured on MS-medium and multiplied into plantlets through micropropagation. After 2-3 weeks, the micropropagated plantlets had 5-6 nodes each. The plantlets were irradiated with 20 to 40 Gy gamma rays at 27.7 rad/sec. Irradiated plantlets were cut into single nodes and cultured on MS-medium supplemented with 2 g NaCl. Salt resistant plantlets were transferred to MS-liquid medium supplemented with 2g NaCl/l 5.2, and microtubers were collected after 6 weeks. Minitubers were produced under the same level of salinity. (author). 2 tabs

Tree immunity: growing old without antibodies.

Science.gov (United States)

Tobias, Peri A; Guest, David I

2014-06-01

Perennial plants need to cope with changing environments and pathogens over their lifespan. Infections are compartmentalised by localised physiological responses, and multiple apical meristems enable repair and regrowth, but genes are another crucial component in the perception and response to pathogens. In this opinion article we suggest that the mechanism for dynamic pathogen-specific recognition in long-lived plants could be explained by extending our current understanding of plant defence genes. We propose that, in addition to physiological responses, tree defence uses a three-pronged genomic approach involving: (i) gene numbers, (ii) genomic architecture, and (iii) mutation loads accumulated over long lifespans. Copyright © 2014 Elsevier Ltd. All rights reserved.

Geno-toxicity assay of sediment and water samples from the Upper Silesia post-mining areas, Poland by means of Allium-test

Energy Technology Data Exchange (ETDEWEB)

Geras' kin, S.; Oudalova, A.; Michalik, B.; Dikareva, N.; Dikarev, V. [Russian Institute of Agricultural Radiology & Agroecology RAAS, Obninsk (Russian Federation)

2011-05-15

Genotoxic potential of two environmental compartments (water and sediment) from the Upper Silesia Coal Basin (USCB), Poland were evaluated and compared by employing root meristem cells of Allium cepa. The clear genotoxic effect of water and sediment sampled was shown, with an important contribution of severe types of cytogenetic abnormalities. The most biologically relevant pollutants were revealed through multivariate statistical analysis of relationships between biological effects registered and the environment contamination. Overall, results of simultaneous use of conventional monitoring methods and biological tests suggested that contemporary levels of persistent pollutants in post-mining areas of the USCB may enhance the risk both for human health and biological components of natural ecosystems.

Use of radiation for inducing mutants in potatoes through tissue culture technique

Energy Technology Data Exchange (ETDEWEB)

Sharabash, M T [National Centre for Radiation Research and Technology, Cairo (Egypt)

1997-07-01

Meristem-tips obtained from sprouts of potato tubers, cv. `Diamant` (Solanum tuberosum) were cultured on MS-medium and multiplied into plantlets through micropropagation. After 2-3 weeks, the micropropagated plantlets had 5-6 nodes each. The plantlets were irradiated with 20 to 40 Gy gamma rays at 27.7 rad/sec. Irradiated plantlets were cut into single nodes and cultured on MS-medium supplemented with 2 g NaCl. Salt resistant plantlets were transferred to MS-liquid medium supplemented with 2g NaCl/l 5.2, and microtubers were collected after 6 weeks. Minitubers were produced under the same level of salinity. (author). 2 tabs.

Learning To Breathe: Developmental Phase Transitions in Oxygen Status.

Science.gov (United States)

Considine, Michael J; Diaz-Vivancos, Pedro; Kerchev, Pavel; Signorelli, Santiago; Agudelo-Romero, Patricia; Gibbs, Daniel J; Foyer, Christine H

2017-02-01

Plants are developmentally disposed to significant changes in oxygen availability, but our understanding of the importance of hypoxia is almost entirely limited to stress biology. Differential patterns of the abundance of oxygen, nitric oxide ( • NO), and reactive oxygen species (ROS), as well as of redox potential, occur in organs and meristems, and examples are emerging in the literature of mechanistic relationships of these to development. We describe here the convergence of these cues in meristematic and reproductive tissues, and discuss the evidence for regulated hypoxic niches within which oxygen-, ROS-, • NO-, and redox-dependent signalling curate developmental transitions in plants. Copyright © 2017 Elsevier Ltd. All rights reserved.

Effect of seeds of heavy charged particles of galactic cosmic radiation

International Nuclear Information System (INIS)

Maksimova, Y.N.

1985-01-01

The experiments were carried out on Lactuca sativa seeds exposed for 20, 66, 123 and 308 days in a biostack also containing physical detectors of heavy charged particles. The yield of aberrant cells and its dependence on the exposure time and the site where particles hit the object were measured. The cytogenetic examination demonstrated a significant difference between the seeds that were or were not hit by heavy charged particles. A significant contribution of galactic cosmic radiation to the radiobiological effect is indicated. The yield of aberrant cells as a function of the localization of heavy charged particles in the seed is established. The most sensitive target is the root meristem

Analysis of nodule meristem persistence and ENOD40 functioning in Medicago truncatula nodule formation

NARCIS (Netherlands)

Wan Xi,

2007-01-01

Medicago root nodules are formed as a result of the interaction of the plant with the soil-borne bacterium Sinorhizobium meliloti. Several plant genes are induced during nodule formation and MtENOD40 is one of the earliest genes activated. The precise function as well as the molecule

Mitochondrial type-I prohibitins of Arabidopsis thaliana are required for supporting proficient meristem development

Czech Academy of Sciences Publication Activity Database

Van Aken, O.; Pečenková, Tamara; van de Cotte, B.; De Rycke, R.; Eeckhout, D.; Fromm, H.; De Jaeger, G.; Witters, E.; Beemster, G.T.S.; Inzé, D.; Van Breusegem, F.

2007-01-01

Roč. 52, č. 5 (2007), s. 850-864 ISSN 0960-7412 Institutional research plan: CEZ:AV0Z50380511 Keywords : Arabidopsis * prohibitins * mitochondria Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 6.751, year: 2007

Gamma induced chromosomal aberrations in meristem cells of cotton hybrids and their parental forms

International Nuclear Information System (INIS)

Kraevoj, S.Ya.; Akhmedova, M.M.; Amirkulov, D.

1977-01-01

The effect of gamma quanta on the first mitoses in the small roots of cotton hybrids and their parents results in different frequency of chromosome rearrangements in them. It has been proved that the frequency of chromosome aberrations is different in hybrids and different varieties of cotton. With increase in irradiation doses (from 10 to 30 kR) the frequency of chromosome aberrations goes up in all varieties and hybrids studies. The type of chromosome rearrangements in hybrids and their parents depends on the irradiation dose

Anatomical Study of Somatic Embryogenesis in Glycine max (L. Merrill

Directory of Open Access Journals (Sweden)

Juliana Aparecida Fernando

2002-09-01

Full Text Available A comparative anatomical analysis of somatic embryogenesis in two soybean (Glycine max (L. Merrill genotypes was carried out. The somatic embryos were originated from cotyledonary explants obtained from immature zygotic embryos. The medium used for somatic embryogenesis induction was Murashige and Skoog, 1962, salts and Gamborg et al., 1968, vitamins (MSB supplemented with 0.8 mg.L-1 of 2,4-D for genotype PI 123439 and 40 mg.L-1 of 2,4-D for ‘Williams 82’. Globular structures, constituted by meristematic cells, originated from subepidermal cell divisions of the cotyledonary mesophyll. In PI 123439, the globular structures presented tracheary differentiation among meristematic cells and they could follow distinct morphogenetic process depending on their location along the explant. For ‘Williams 82’ it was observed globular structures along the cotyledonary explant surface. They gave rise to somatic embryos. These embryos showed different morphologies and they were classified based on their shape and number of cotyledons. The ability of these morphological types to convert to plantlets was discussed.Realizou-se uma análise anatômica comparativa da embriogênese somática em dois genótipos de soja (Glycine max (L. Merrill. Os embriões somáticos foram obtidos a partir de explantes cotiledonares excisados de embriões zigóticos imaturos do genótipo PI 123439, adaptado às condições tropicais, e ‘Williams 82’. O meio utilizado para indução da embriogênese somática constituiu-se de sais de Murashige e Skoog,1962, e vitaminas de Gamborg et al., 1968 (MSB suplementado com 0,8 mg.L-1 de 2,4-D (PI 123439 e 40 mg.L-1 (‘Williams 82’. Estruturas globulares originaram-se a partir de divisões celulares nas camadas subepidérmicas do mesofilo cotiledonar e foram constituídas por células meristemáticas. No genótipo PI 123439, as estruturas globulares apresentaram diferenciação traqueal entre as células meristemáticas e

Stress and strain provide positional and directional cues in development.

Directory of Open Access Journals (Sweden)

Behruz Bozorg

2014-01-01

Full Text Available The morphogenesis of organs necessarily involves mechanical interactions and changes in mechanical properties of a tissue. A long standing question is how such changes are directed on a cellular scale while being coordinated at a tissular scale. Growing evidence suggests that mechanical cues are participating in the control of growth and morphogenesis during development. We introduce a mechanical model that represents the deposition of cellulose fibers in primary plant walls. In the model both the degree of material anisotropy and the anisotropy direction are regulated by stress anisotropy. We show that the finite element shell model and the simpler triangular biquadratic springs approach provide equally adequate descriptions of cell mechanics in tissue pressure simulations of the epidermis. In a growing organ, where circumferentially organized fibers act as a main controller of longitudinal growth, we show that the fiber direction can be correlated with both the maximal stress direction and the direction orthogonal to the maximal strain direction. However, when dynamic updates of the fiber direction are introduced, the mechanical stress provides a robust directional cue for the circumferential organization of the fibers, whereas the orthogonal to maximal strain model leads to an unstable situation where the fibers reorient longitudinally. Our investigation of the more complex shape and growth patterns in the shoot apical meristem where new organs are initiated shows that a stress based feedback on fiber directions is capable of reproducing the main features of in vivo cellulose fiber directions, deformations and material properties in different regions of the shoot. In particular, we show that this purely mechanical model can create radially distinct regions such that cells expand slowly and isotropically in the central zone while cells at the periphery expand more quickly and in the radial direction, which is a well established growth pattern

Juvenile resilience and adult longevity explain residual populations of the Andean wax palm Ceroxylon quindiuense after deforestation.

Directory of Open Access Journals (Sweden)

María José Sanín

Full Text Available Wax palms are an important element of the cloud forests in the tropical Andes. Despite heavy deforestation, the density of adults seems to be similar in deforested pastures as in forests. We aimed to infer the mechanisms responsible for this apparent resilience in pastures and we tested two hypotheses to explain it: 1 adult palms survived in pastures because they were spared from logging, and 2 adults occurred in pastures through the resilience of large juvenile rosettes, which survived through subterranean meristems and later developed into adults. For this purpose, we characterized the demographic structure of C. quindiuense in a total of 122 plots of 400 m(2 in forests and pastures at two sites with contrasted land use histories in Colombia and Peru. Additionally, we implemented growth models that allowed us to estimate the age of individuals at four sites. These data were combined with information collected from local land managers in order to complete our knowledge on the land use history at each site. At two sites, the presence of old individuals up to 169 years and a wide age range evidenced that, at least, a portion of current adults in pastures were spared from logging at the time of deforestation. However, at the two other sites, the absence of older adults in pastures and the narrow age range of the populations indicated that individuals came exclusively from rosette resilience. These interpretations were consistent with the land use history of sites. In consequence, the combination of the two hypotheses (spared individuals and rosette resilience explained patterns of C. quindiuense in pastures on a regional scale. Regeneration through subterranean meristems in palms is an important, yet overlooked mechanism of resilience, which occurs in a number of palm species and deserves being integrated in the conceptual framework of disturbance ecology.

Linking salinity stress tolerance with tissue-specific Na+ sequestration in wheat roots

Directory of Open Access Journals (Sweden)

Honghong eWu

2015-02-01

Full Text Available Salinity stress tolerance is a physiologically complex trait that is conferred by the large array of interacting mechanisms. Among these, vacuolar Na+ sequestration has always been considered as one of the key components differentiating between sensitive and tolerant species and genotypes. However, vacuolar Na+ sequestration has been rarely considered in the context of the tissue-specific expression and regulation of appropriate transporters contributing to Na+ removal from the cytosol. In this work, six bread wheat varieties contrasting in their salinity tolerance (three tolerant and three sensitive were used to understand the essentiality of vacuolar Na+ sequestration between functionally different root tissues, and link it with the overall salinity stress tolerance in this species. Roots of 4-d old wheat seedlings were treated with 100 mM NaCl for 3 days, and then Na+ distribution between cytosol and vacuole was quantified by CoroNa Green fluorescent dye imaging. Our major observations were as follows: 1 salinity stress tolerance correlated positively with vacuolar Na+ sequestration ability in the mature root zone but not in the root apex; 2 Contrary to expectations, cytosolic Na+ levels in root meristem were significantly higher in salt tolerant than sensitive group, while vacuolar Na+ levels showed an opposite trend. These results are interpreted as meristem cells playing a role of the salt sensor; 3 No significant difference in the vacuolar Na+ sequestration ability was found between sensitive and tolerant group in either transition or elongation zones; 4 The overall Na+ accumulation was highest in the elongation zone, suggesting its role in osmotic adjustment and turgor maintenance required to drive root expansion growth. Overall, the reported results suggest high tissue-specificity of Na+ uptake, signalling, and sequestration in wheat root. The implications of these findings for plant breeding for salinity stress tolerance are discussed.

An Intergenic Region Shared by At4g35985 and At4g35987 in Arabidopsis thaliana Is a Tissue Specific and Stress Inducible Bidirectional Promoter Analyzed in Transgenic Arabidopsis and Tobacco Plants

Science.gov (United States)

Banerjee, Joydeep; Sahoo, Dipak Kumar; Dey, Nrisingha; Houtz, Robert L.; Maiti, Indu Bhushan

2013-01-01

On chromosome 4 in the Arabidopsis genome, two neighboring genes (calmodulin methyl transferase At4g35987 and senescence associated gene At4g35985) are located in a head-to-head divergent orientation sharing a putative bidirectional promoter. This 1258 bp intergenic region contains a number of environmental stress responsive and tissue specific cis-regulatory elements. Transcript analysis of At4g35985 and At4g35987 genes by quantitative real time PCR showed tissue specific and stress inducible expression profiles. We tested the bidirectional promoter-function of the intergenic region shared by the divergent genes At4g35985 and At4g35987 using two reporter genes (GFP and GUS) in both orientations in transient tobacco protoplast and Agro-infiltration assays, as well as in stably transformed transgenic Arabidopsis and tobacco plants. In transient assays with GFP and GUS reporter genes the At4g35985 promoter (P85) showed stronger expression (about 3.5 fold) compared to the At4g35987 promoter (P87). The tissue specific as well as stress responsive functional nature of the bidirectional promoter was evaluated in independent transgenic Arabidopsis and tobacco lines. Expression of P85 activity was detected in the midrib of leaves, leaf trichomes, apical meristemic regions, throughout the root, lateral roots and flowers. The expression of P87 was observed in leaf-tip, hydathodes, apical meristem, root tips, emerging lateral root tips, root stele region and in floral tissues. The bidirectional promoter in both orientations shows differential up-regulation (2.5 to 3 fold) under salt stress. Use of such regulatory elements of bidirectional promoters showing spatial and stress inducible promoter-functions in heterologous system might be an important tool for plant biotechnology and gene stacking applications. PMID:24260266

Gain-of-function analysis of poplar CLE genes in Arabidopsis by exogenous application and over-expression assays.

Science.gov (United States)

Liu, Yisen; Yang, Shaohui; Song, Yingjin; Men, Shuzhen; Wang, Jiehua

2016-04-01

Among 50 CLE gene family members in the Populus trichocarpa genome, three and six PtCLE genes encode a CLE motif sequence highly homologous to Arabidopsis CLV3 and TDIF peptides, respectively, which potentially make them functional equivalents. To test and compare their biological activity, we first chemically synthesized each dodecapeptide and analysed itsi n vitro bioactivity on Arabidopsis seedlings. Similarly, but to a different extent, three types of poplar CLV3-related peptides caused root meristem consumption, phyllotaxis disorder, anthocyanin accumulation and failure to enter the bolting stage. In comparison, application of two poplar TDIF-related peptides led to root length promotion in a dose-dependent manner with an even stronger effect observed for poplar TDIF-like peptide than TDIF. Next, we constructed CaMV35S:PtCLE transgenic plants for each of the nine PtCLE genes. Phenotypic abnormalities exemplified by arrested shoot apical meristem and abnormal flower structure were found to be more dominant and severe in 35S:PtCLV3 and 35S:PtCLV3-like2 lines than in the 35S:PtCLV3-like line. Disordered vasculature was detected in both stem and hypocotyl cross-sections in Arabidopsis plants over-expressing poplar TDIF-related genes with the most defective vascular patterning observed for TDIF2 and two TDIF-like genes. Phenotypic difference consistently observed in peptide application assay and transgenic analysis indicated the functional diversity of nine poplar PtCLE genes under investigation. This work represents the first report on the functional analysis of CLE genes in a tree species and constitutes a basis for further study of the CLE peptide signalling pathway in tree development. © The Author 2016. Published by Oxford University Press on behalf of the Society for Experimental Biology. All rights reserved. For permissions, please email: journals.permissions@oup.com.

Ectopic expression of Jatropha curcas APETALA1 (JcAP1 caused early flowering in Arabidopsis, but not in Jatropha

Directory of Open Access Journals (Sweden)

Mingyong Tang

2016-04-01

Full Text Available Jatropha curcas is a promising feedstock for biofuel production because Jatropha oil is highly suitable for the production of biodiesel and bio-jet fuels. However, Jatropha exhibits a low seed yield as a result of unreliable and poor flowering. APETALA1 (AP1 is a floral meristem and organ identity gene in higher plants. The flower meristem identity genes of Jatropha have not yet been identified or characterized. To better understand the genetic control of flowering in Jatropha, an AP1 homolog (JcAP1 was isolated from Jatropha. An amino acid sequence analysis of JcAP1 revealed a high similarity to the AP1 proteins of other perennial plants. JcAP1 was expressed in inflorescence buds, flower buds, sepals and petals. The highest expression level was observed during the early developmental stage of the flower buds. The overexpression of JcAP1 using the cauliflower mosaic virus (CaMV 35S promoter resulted in extremely early flowering and abnormal flowers in transgenic Arabidopsis plants. Several flowering genes downstream of AP1 were up-regulated in the JcAP1-overexpressing transgenic plant lines. Furthermore, JcAP1 overexpression rescued the phenotype caused by the Arabidopsis AP1 loss-of-function mutant ap1-11. Therefore, JcAP1 is an ortholog of AtAP1, which plays a similar role in the regulation of flowering in Arabidopsis. However, the overexpression of JcAP1 in Jatropha using the same promoter resulted in little variation in the flowering time and floral organs, indicating that JcAP1 may be insufficient to regulate flowering by itself in Jatropha. This study helps to elucidate the function of JcAP1 and contributes to the understanding of the molecular mechanisms of flower development in Jatropha.

Ectopic expression of Jatropha curcas APETALA1 (JcAP1) caused early flowering in Arabidopsis, but not in Jatropha

Science.gov (United States)

Tang, Mingyong; Tao, Yan-Bin

2016-01-01

Jatropha curcas is a promising feedstock for biofuel production because Jatropha oil is highly suitable for the production of biodiesel and bio-jet fuels. However, Jatropha exhibits a low seed yield as a result of unreliable and poor flowering. APETALA1 (AP1) is a floral meristem and organ identity gene in higher plants. The flower meristem identity genes of Jatropha have not yet been identified or characterized. To better understand the genetic control of flowering in Jatropha, an AP1 homolog (JcAP1) was isolated from Jatropha. An amino acid sequence analysis of JcAP1 revealed a high similarity to the AP1 proteins of other perennial plants. JcAP1 was expressed in inflorescence buds, flower buds, sepals and petals. The highest expression level was observed during the early developmental stage of the flower buds. The overexpression of JcAP1 using the cauliflower mosaic virus (CaMV) 35S promoter resulted in extremely early flowering and abnormal flowers in transgenic Arabidopsis plants. Several flowering genes downstream of AP1 were up-regulated in the JcAP1-overexpressing transgenic plant lines. Furthermore, JcAP1 overexpression rescued the phenotype caused by the Arabidopsis AP1 loss-of-function mutant ap1-11. Therefore, JcAP1 is an ortholog of AtAP1, which plays a similar role in the regulation of flowering in Arabidopsis. However, the overexpression of JcAP1 in Jatropha using the same promoter resulted in little variation in the flowering time and floral organs, indicating that JcAP1 may be insufficient to regulate flowering by itself in Jatropha. This study helps to elucidate the function of JcAP1 and contributes to the understanding of the molecular mechanisms of flower development in Jatropha. PMID:27168978

Enhanced resistance to soybean cyst nematode Heterodera glycines in transgenic soybean by silencing putative CLE receptors.

Science.gov (United States)

Guo, Xiaoli; Chronis, Demosthenis; De La Torre, Carola M; Smeda, John; Wang, Xiaohong; Mitchum, Melissa G

2015-08-01

CLE peptides are small extracellular proteins important in regulating plant meristematic activity through the CLE-receptor kinase-WOX signalling module. Stem cell pools in the SAM (shoot apical meristem), RAM (root apical meristem) and vascular cambium are controlled by CLE signalling pathways. Interestingly, plant-parasitic cyst nematodes secrete CLE-like effector proteins, which act as ligand mimics of plant CLE peptides and are required for successful parasitism. Recently, we demonstrated that Arabidopsis CLE receptors CLAVATA1 (CLV1), the CLAVATA2 (CLV2)/CORYNE (CRN) heterodimer receptor complex and RECEPTOR-LIKE PROTEIN KINASE 2 (RPK2), which transmit the CLV3 signal in the SAM, are required for perception of beet cyst nematode Heterodera schachtii CLEs. Reduction in nematode infection was observed in clv1, clv2, crn, rpk2 and combined double and triple mutants. In an effort to develop nematode resistance in an agriculturally important crop, orthologues of Arabidopsis receptors including CLV1, CLV2, CRN and RPK2 were identified from soybean, a host for the soybean cyst nematode Heterodera glycines. For each of the receptors, there are at least two paralogues in the soybean genome. Localization studies showed that most receptors are expressed in the root, but vary in their level of expression and spatial expression patterns. Expression in nematode-induced feeding cells was also confirmed. In vitro direct binding of the soybean receptors with the HgCLE peptide was analysed. Knock-down of the receptors in soybean hairy roots showed enhanced resistance to SCN. Our findings suggest that targeted disruption of nematode CLE signalling may be a potential means to engineer nematode resistance in crop plants. © 2015 Society for Experimental Biology, Association of Applied Biologists and John Wiley & Sons Ltd.

Composite Cucurbita pepo plants with transgenic roots as a tool to study root development.

Science.gov (United States)

Ilina, Elena L; Logachov, Anton A; Laplaze, Laurent; Demchenko, Nikolay P; Pawlowski, Katharina; Demchenko, Kirill N

2012-07-01

In most plant species, initiation of lateral root primordia occurs above the elongation zone. However, in cucurbits and some other species, lateral root primordia initiation and development takes place in the apical meristem of the parental root. Composite transgenic plants obtained by Agrobacterium rhizogenes-mediated transformation are known as a suitable model to study root development. The aim of the present study was to establish this transformation technique for squash. The auxin-responsive promoter DR5 was cloned into the binary vectors pKGW-RR-MGW and pMDC162-GFP. Incorporation of 5-ethynyl-2'-deoxyuridine (EdU) was used to evaluate the presence of DNA-synthesizing cells in the hypocotyl of squash seedlings to find out whether they were suitable for infection. Two A. rhizogenes strains, R1000 and MSU440, were used. Roots containing the respective constructs were selected based on DsRED1 or green fluorescent protein (GFP) fluorescence, and DR5::Egfp-gusA or DR5::gusA insertion, respectively, was verified by PCR. Distribution of the response to auxin was visualized by GFP fluorescence or β-glucuronidase (GUS) activity staining and confirmed by immunolocalization of GFP and GUS proteins, respectively. Based on the distribution of EdU-labelled cells, it was determined that 6-day-old squash seedlings were suited for inoculation by A. rhizogenes since their root pericycle and the adjacent layers contain enough proliferating cells. Agrobacterium rhizogenes R1000 proved to be the most virulent strain on squash seedlings. Squash roots containing the respective constructs did not exhibit the hairy root phenotype and were morphologically and structurally similar to wild-type roots. The auxin response pattern in the root apex of squash resembled that in arabidopsis roots. Composite squash plants obtained by A. rhizogenes-mediated transformation are a good tool for the investigation of root apical meristem development and root branching.

Cytogenetic variability in pinus sylvestris L. populations experiencing anthropogenic influence

International Nuclear Information System (INIS)

Oudalova, A.; Geras'kin, S.; Vasiliev, D.; Dikarev, V.

2004-01-01

Techno-genic pollution has become one of the most significant ecological factors determining biosphere existence and development. An analysis of genetic consequences of the radiation accidents in the South Urals and Chernobyl has shown that mutation and recombination processes are considerably accelerated in plant and animal's populations experiencing techno-genic influence. This implies that there are complicated adaptation processes leading to changes in genetic structure of populations and increasing genetic load. Pinus sylvestris L. populations growing at the territory of the 'radon' Leningrad regional radioactive waste reprocessing enterprise and Sosnovy Bor town were monitored 6 years (1997-2002) by a set of cyto-genetical and morphological tests. Cytogenetic damage levels within intercalary meristem of needle as well as in root meristem of seedlings were found to significantly exceed corresponding controls. A higher radioresistance of the Scots pine seeds analyzed was demonstrated with an acute γ-radiation that also revealed a selection process directed at an enhancement of repair efficiency and resulting in a shift of mean values of radioresistance in populations towards higher values. An enlargement of variance of studied cytogenetic parameters was found in the populations experiencing techno-genic influence. This indicates, with an account of phenomenon of the enhanced radioresistance, that there are processes of cyto-genetical adaptation in the investigated regions. An analysis of the structure of ecological-genetical variability was carried out with the purpose of separating two components in the inter-population variability - the first is engaged to the genetically determined variability of biological characteristics intrinsic for this species, and the second is responsible for the variability originating from anthropogenic contamination of the natural habitat. Changes of these two types of variability were studied in dependence on time and techno

DNA sequencing, anatomy, and calcification patterns support a monophyletic, subarctic, carbonate reef-forming Clathromorphum (Hapalidiaceae, Corallinales, Rhodophyta).

Science.gov (United States)

Adey, Walter H; Hernandez-Kantun, Jazmin J; Johnson, Gabriel; Gabrielson, Paul W

2015-02-01

For the first time, morpho-anatomical characters that were congruent with DNA sequence data were used to characterize several genera in Hapalidiaceae-the major eco-engineers of Subarctic carbonate ecosystems. DNA sequencing of three genes (SSU, rbcL, ribulose-1, 5-bisphosphate carboxylase/oxygenase large subunit gene and psbA, photosystem II D1 protein gene), along with patterns of cell division, cell elongation, and calcification supported a monophyletic Clathromorphum. Two characters were diagnostic for this genus: (i) cell division, elongation, and primary calcification occurred only in intercalary meristematic cells and in a narrow vertical band (1-2 μm wide) resulting in a "meristem split" and (ii) a secondary calcification of interfilament crystals was also produced. Neopolyporolithon was resurrected for N. reclinatum, the generitype, and Clathromorphum loculosum was transferred to this genus. Like Clathromorphum, cell division, elongation, and calcification occurred only in intercalary meristematic cells, but in a wider vertical band (over 10-20 μm), and a "meristem split" was absent. Callilithophytum gen. nov. was proposed to accommodate Clathromorphum parcum, the obligate epiphyte of the northeast Pacific endemic geniculate coralline, Calliarthron. Diagnostic for this genus were epithallial cells terminating all cell filaments (no dorsi-ventrality was present), and a distinct "foot" was embedded in the host. Leptophytum, based on its generitype, L. laeve, was shown to be a distinct genus more closely related to Clathromorphum than to Phymatolithon. All names of treated species were applied unequivocally by linking partial rbcL sequences from holotype, isotype, or epitype specimens with field-collected material. Variation in rbcL and psbA sequences suggested that multiple species may be passing under each currently recognized species of Clathromorphum and Neopolyporolithon. © 2014 Phycological Society of America.

Involvements of PCD and changes in gene expression profile during self-pruning of spring shoots in sweet orange (Citrus sinensis).

Science.gov (United States)

Zhang, Jin-Zhi; Zhao, Kun; Ai, Xiao-Yan; Hu, Chun-Gen

2014-10-13

Citrus shoot tips abscise at an anatomically distinct abscission zone (AZ) that separates the top part of the shoots into basal and apical portions (citrus self-pruning). Cell separation occurs only at the AZ, which suggests its cells have distinctive molecular regulation. Although several studies have looked into the morphological aspects of self-pruning process, the underlying molecular mechanisms remain unknown. In this study, the hallmarks of programmed cell death (PCD) were identified by TUNEL experiments, transmission electron microscopy (TEM) and histochemical staining for reactive oxygen species (ROS) during self-pruning of the spring shoots in sweet orange. Our results indicated that PCD occurred systematically and progressively and may play an important role in the control of self-pruning of citrus. Microarray analysis was used to examine transcriptome changes at three stages of self-pruning, and 1,378 differentially expressed genes were identified. Some genes were related to PCD, while others were associated with cell wall biosynthesis or metabolism. These results strongly suggest that abscission layers activate both catabolic and anabolic wall modification pathways during the self-pruning process. In addition, a strong correlation was observed between self-pruning and the expression of hormone-related genes. Self-pruning plays an important role in citrus floral bud initiation. Therefore, several key flowering homologs of Arabidopsis and tomato shoot apical meristem (SAM) activity genes were investigated in sweet orange by real-time PCR and in situ hybridization, and the results indicated that these genes were preferentially expressed in SAM as well as axillary meristem. Based on these findings, a model for sweet orange spring shoot self-pruning is proposed, which will enable us to better understand the mechanism of self-pruning and abscission.

Juvenile Resilience and Adult Longevity Explain Residual Populations of the Andean Wax Palm Ceroxylon quindiuense after Deforestation

Science.gov (United States)

Sanín, María José; Anthelme, Fabien; Pintaud, Jean-Christophe; Galeano, Gloria; Bernal, Rodrigo

2013-01-01

Wax palms are an important element of the cloud forests in the tropical Andes. Despite heavy deforestation, the density of adults seems to be similar in deforested pastures as in forests. We aimed to infer the mechanisms responsible for this apparent resilience in pastures and we tested two hypotheses to explain it: 1) adult palms survived in pastures because they were spared from logging, and 2) adults occurred in pastures through the resilience of large juvenile rosettes, which survived through subterranean meristems and later developed into adults. For this purpose, we characterized the demographic structure of C. quindiuense in a total of 122 plots of 400 m2 in forests and pastures at two sites with contrasted land use histories in Colombia and Peru. Additionally, we implemented growth models that allowed us to estimate the age of individuals at four sites. These data were combined with information collected from local land managers in order to complete our knowledge on the land use history at each site. At two sites, the presence of old individuals up to 169 years and a wide age range evidenced that, at least, a portion of current adults in pastures were spared from logging at the time of deforestation. However, at the two other sites, the absence of older adults in pastures and the narrow age range of the populations indicated that individuals came exclusively from rosette resilience. These interpretations were consistent with the land use history of sites. In consequence, the combination of the two hypotheses (spared individuals and rosette resilience) explained patterns of C. quindiuense in pastures on a regional scale. Regeneration through subterranean meristems in palms is an important, yet overlooked mechanism of resilience, which occurs in a number of palm species and deserves being integrated in the conceptual framework of disturbance ecology. PMID:24194823

Molecular aspects of zygotic embryogenesis in sunflower (Helianthus annuus L.): correlation of positive histone marks with HaWUS expression and putative link HaWUS/HaL1L.

Science.gov (United States)

Salvini, Mariangela; Fambrini, Marco; Giorgetti, Lucia; Pugliesi, Claudio

2016-01-01

The link HaWUS/ HaL1L , the opposite transcriptional behavior, and the decrease/increase in positive histone marks bond to both genes suggest an inhibitory effect of WUS on HaL1L in sunflower zygotic embryos. In Arabidopsis, a group of transcription factors implicated in the earliest events of embryogenesis is the WUSCHEL-RELATED HOMEOBOX (WOX) protein family including WUSCHEL (WUS) and other 14 WOX protein, some of which contain a conserved WUS-box domain in addition to the homeodomain. WUS transcripts appear very early in embryogenesis, at the 16-cell embryo stage, but gradually become restricted to the center of the developing shoot apical meristem (SAM) primordium and continues to be expressed in cells of the niche/organizing center of SAM and floral meristems to maintain stem cell population. Moreover, WUS has decisive roles in the embryonic program presumably promoting the vegetative-to-embryonic transition and/or maintaining the identity of the embryonic stem cells. However, data on the direct interaction between WUS and key genes for seed development (as LEC1 and L1L) are not collected. The novelty of this report consists in the characterization of Helianthus annuus WUS (HaWUS) gene and in its analysis regarding the pattern of the methylated lysine 4 (K4) of the Histone H3 and of the acetylated histone H3 during the zygotic embryo development. Also, a parallel investigation was performed for HaL1L gene since two copies of the WUS-binding site (WUSATA), previously identified on HaL1L nucleotide sequence, were able to be bound by the HaWUS recombinant protein suggesting a not described effect of HaWUS on HaL1L transcription.

Cytogenetic variability in pinus sylvestris L. populations experiencing anthropogenic influence

Energy Technology Data Exchange (ETDEWEB)

Oudalova, A.; Geras' kin, S.; Vasiliev, D.; Dikarev, V. [Russian Institute of Agricultural Radiology and Agroecology, Obninsk (Russian Federation)

2004-07-01

Techno-genic pollution has become one of the most significant ecological factors determining biosphere existence and development. An analysis of genetic consequences of the radiation accidents in the South Urals and Chernobyl has shown that mutation and recombination processes are considerably accelerated in plant and animal's populations experiencing techno-genic influence. This implies that there are complicated adaptation processes leading to changes in genetic structure of populations and increasing genetic load. Pinus sylvestris L. populations growing at the territory of the 'radon' Leningrad regional radioactive waste reprocessing enterprise and Sosnovy Bor town were monitored 6 years (1997-2002) by a set of cyto-genetical and morphological tests. Cytogenetic damage levels within intercalary meristem of needle as well as in root meristem of seedlings were found to significantly exceed corresponding controls. A higher radioresistance of the Scots pine seeds analyzed was demonstrated with an acute {gamma}-radiation that also revealed a selection process directed at an enhancement of repair efficiency and resulting in a shift of mean values of radioresistance in populations towards higher values. An enlargement of variance of studied cytogenetic parameters was found in the populations experiencing techno-genic influence. This indicates, with an account of phenomenon of the enhanced radioresistance, that there are processes of cyto-genetical adaptation in the investigated regions. An analysis of the structure of ecological-genetical variability was carried out with the purpose of separating two components in the inter-population variability - the first is engaged to the genetically determined variability of biological characteristics intrinsic for this species, and the second is responsible for the variability originating from anthropogenic contamination of the natural habitat. Changes of these two types of variability were studied in dependence on

An intergenic region shared by At4g35985 and At4g35987 in Arabidopsis thaliana is a tissue specific and stress inducible bidirectional promoter analyzed in transgenic arabidopsis and tobacco plants.

Directory of Open Access Journals (Sweden)

Joydeep Banerjee

Full Text Available On chromosome 4 in the Arabidopsis genome, two neighboring genes (calmodulin methyl transferase At4g35987 and senescence associated gene At4g35985 are located in a head-to-head divergent orientation sharing a putative bidirectional promoter. This 1258 bp intergenic region contains a number of environmental stress responsive and tissue specific cis-regulatory elements. Transcript analysis of At4g35985 and At4g35987 genes by quantitative real time PCR showed tissue specific and stress inducible expression profiles. We tested the bidirectional promoter-function of the intergenic region shared by the divergent genes At4g35985 and At4g35987 using two reporter genes (GFP and GUS in both orientations in transient tobacco protoplast and Agro-infiltration assays, as well as in stably transformed transgenic Arabidopsis and tobacco plants. In transient assays with GFP and GUS reporter genes the At4g35985 promoter (P85 showed stronger expression (about 3.5 fold compared to the At4g35987 promoter (P87. The tissue specific as well as stress responsive functional nature of the bidirectional promoter was evaluated in independent transgenic Arabidopsis and tobacco lines. Expression of P85 activity was detected in the midrib of leaves, leaf trichomes, apical meristemic regions, throughout the root, lateral roots and flowers. The expression of P87 was observed in leaf-tip, hydathodes, apical meristem, root tips, emerging lateral root tips, root stele region and in floral tissues. The bidirectional promoter in both orientations shows differential up-regulation (2.5 to 3 fold under salt stress. Use of such regulatory elements of bidirectional promoters showing spatial and stress inducible promoter-functions in heterologous system might be an important tool for plant biotechnology and gene stacking applications.

Induction of leafy galls in Acacia mearnsii De Wild seedlings infected by Rhodococcus fascians

Directory of Open Access Journals (Sweden)

Marguerite Quoirin

2004-07-01

Full Text Available Plantlets of blackwattle (Acacia mearnsii De Wild were inoculated with the bacterium Rhodococcus fascians and cultured in vitro. Leafy galls appeared at the cotyledonary nodes in 75% of the infected plants. The galls were separated from the plants and cultured on a medium containing three-quarters-strength MS salts (Murashige and Skoog, 1962, MS vitamins, 2% sucrose and an antibiotic (cephalothin, supplemented with or without 0.2% activated charcoal. Histological studies conducted from the sixth to the twenty-second day after plant infection revealed the presence of newly formed meristematic centers, first in the axillary region, then on the petioles and lamina of the leaflets around the apical meristem. Approximately 37% of the galls developed one shoot with both concentrations of cephalothin.Plantas recém germinadas de acácia negra (Acacia mearnsii De Wild. foram inoculadas com a bactéria Rhodococcus fascians e cultivadas in vitro. Galhas cobertas por folhas apareceram na altura do nó cotiledonar em 75% das plantas infectadas. As galhas foram separadas das plantas e cultivadas num meio de cultura contendo os sais do meio MS (Murashige e Skoog, 1962 reduzidos a 3/4, as vitaminas do mesmo meio, 2% de sacarose e um antibiótico (cefalotina, adicionado ou não de 0,2% de carvão ativo. Estudos histológicos realizados entre o sexto e o vigésimo segundo dia depois da inoculação, revelaram a presença de centros meristemáticos novos, primeiro nas regiões axilares, em seguida nos pecíolos e limbos dos folíolos ao redor do meristema apical. Aproximadamente 37% das galhas desenvolveram um broto na presença de cefalotina.

Stress and strain provide positional and directional cues in development.

Science.gov (United States)

Bozorg, Behruz; Krupinski, Pawel; Jönsson, Henrik

2014-01-01

The morphogenesis of organs necessarily involves mechanical interactions and changes in mechanical properties of a tissue. A long standing question is how such changes are directed on a cellular scale while being coordinated at a tissular scale. Growing evidence suggests that mechanical cues are participating in the control of growth and morphogenesis during development. We introduce a mechanical model that represents the deposition of cellulose fibers in primary plant walls. In the model both the degree of material anisotropy and the anisotropy direction are regulated by stress anisotropy. We show that the finite element shell model and the simpler triangular biquadratic springs approach provide equally adequate descriptions of cell mechanics in tissue pressure simulations of the epidermis. In a growing organ, where circumferentially organized fibers act as a main controller of longitudinal growth, we show that the fiber direction can be correlated with both the maximal stress direction and the direction orthogonal to the maximal strain direction. However, when dynamic updates of the fiber direction are introduced, the mechanical stress provides a robust directional cue for the circumferential organization of the fibers, whereas the orthogonal to maximal strain model leads to an unstable situation where the fibers reorient longitudinally. Our investigation of the more complex shape and growth patterns in the shoot apical meristem where new organs are initiated shows that a stress based feedback on fiber directions is capable of reproducing the main features of in vivo cellulose fiber directions, deformations and material properties in different regions of the shoot. In particular, we show that this purely mechanical model can create radially distinct regions such that cells expand slowly and isotropically in the central zone while cells at the periphery expand more quickly and in the radial direction, which is a well established growth pattern in the meristem.

Tissue- and environmental response-specific expression of 10 PP2C transcripts in Mesembryanthemum crystallinum.

Science.gov (United States)

Miyazaki, S; Koga, R; Bohnert, H J; Fukuhara, T

1999-03-01

Ten transcripts (Mpc1-10) homologous to protein phosphatases of the 2C family have been isolated from the halophyte Mesembryanthemum crystallinum (common ice plant). Transcripts range in size from 1.6 to 2.6 kb, and encode proteins whose catalytic domains are between 24% and 62% identical to that of the Arabidopsis PP2C, ABI1. Transcript expression is tissue specific. Two isoforms are present only in roots (Mpc1 and Mpc5), three in young leaves (Mpc6, 8 and 9), two in old leaves (Mpc6 and Mpc8), and two in post-flowering leaves (Mpc8 and Mpc9). Mpc2 is strongly expressed in roots and also in seeds, meristematic tissues and mature flowers. Mpc3 is specific for leaf meristems, and Mpc4 is found in root and leaf meristems. Mpc7 is restricted to meristematic tissues. Mpc10 is only present in mature flowers. Mpc2 (in roots and leaves), Mpc5 (in roots) and Mpc8 (weakly in leaves) are induced by salinity stress and drought conditions with different kinetics in different tissues, but other Mpcs are downregulated by stress. Cold stress (4 degrees C) leads to a decline in Mpc5 and Mp6, but low temperature provoked a long-term (days) increase in Mpc2 levels in leaves and a transient increase (less than 24 h) in roots. Four full-length transcripts have been obtained. In each case, after over-expression in E. coli, the isolated proteins exhibited (Mg2+-dependent, okadeic acid-insensitive) protein phosphatase activity, although activity against 32P-phosphocasein varied among different PP2Cs. Determination of tissue developmental and stress response specificity of PP2C will facilitate functional studies of signal-transducing enzymes in this halophytic organism.

Genetic improvement of the shoot architecture and yield in soya bean plants via the manipulation of GmmiR156b.

Science.gov (United States)

Sun, Zhengxi; Su, Chao; Yun, Jinxia; Jiang, Qiong; Wang, Lixiang; Wang, Youning; Cao, Dong; Zhao, Fang; Zhao, Qingsong; Zhang, Mengchen; Zhou, Bin; Zhang, Lei; Kong, Fanjiang; Liu, Baohui; Tong, Yiping; Li, Xia

2018-05-05

The optimization of plant architecture in order to breed high-yielding soya bean cultivars is a goal of researchers. Tall plants bearing many long branches are desired, but only modest success in reaching these goals has been achieved. MicroRNA156 (miR156)-SQUAMOSA PROMOTER BINDING PROTEIN-LIKE (SPL) gene modules play pivotal roles in controlling shoot architecture and other traits in crops like rice and wheat. However, the effects of miR156-SPL modules on soya bean architecture and yield, and the molecular mechanisms underlying these effects, remain largely unknown. In this study, we achieved substantial improvements in soya bean architecture and yield by overexpressing GmmiR156b. Transgenic plants produced significantly increased numbers of long branches, nodes and pods, and they exhibited an increased 100-seed weight, resulting in a 46%-63% increase in yield per plant. Intriguingly, GmmiR156b overexpression had no significant impact on plant height in a growth room or under field conditions; however, it increased stem thickness significantly. Our data indicate that GmmiR156b modulates these traits mainly via the direct cleavage of SPL transcripts. Moreover, we found that GmSPL9d is expressed in the shoot apical meristem and axillary meristems (AMs) of soya bean, and that GmSPL9d may regulate axillary bud formation and branching by physically interacting with the homeobox gene WUSCHEL (WUS), a central regulator of AM formation. Together, our results identify GmmiR156b as a promising target for the improvement of soya bean plant architecture and yields, and they reveal a new and conserved regulatory cascade involving miR156-SPL-WUS that will help researchers decipher the genetic basis of plant architecture. © 2018 The Authors. Plant Biotechnology Journal published by Society for Experimental Biology and The Association of Applied Biologists and John Wiley & Sons Ltd.

Identification of candidate genes for dissecting complex branch number trait in chickpea.

Science.gov (United States)

Bajaj, Deepak; Upadhyaya, Hari D; Das, Shouvik; Kumar, Vinod; Gowda, C L L; Sharma, Shivali; Tyagi, Akhilesh K; Parida, Swarup K

2016-04-01

The present study exploited integrated genomics-assisted breeding strategy for genetic dissection of complex branch number quantitative trait in chickpea. Candidate gene-based association analysis in a branch number association panel was performed by utilizing the genotyping data of 401 SNP allelic variants mined from 27 known cloned branch number gene orthologs of chickpea. The genome-wide association study (GWAS) integrating both genome-wide GBS- (4556 SNPs) and candidate gene-based genotyping information of 4957 SNPs in a structured population of 60 sequenced desi and kabuli accessions (with 350-400 kb LD decay), detected 11 significant genomic loci (genes) associated (41% combined PVE) with branch number in chickpea. Of these, seven branch number-associated genes were further validated successfully in two inter (ICC 4958 × ICC 17160)- and intra (ICC 12299 × ICC 8261)-specific mapping populations. The axillary meristem and shoot apical meristem-specific expression, including differential up- and down-regulation (4-5 fold) of the validated seven branch number-associated genes especially in high branch number as compared to the low branch number-containing parental accessions and homozygous individuals of two aforesaid mapping populations was apparent. Collectively, this combinatorial genomic approach delineated diverse naturally occurring novel functional SNP allelic variants in seven potential known/candidate genes [PIN1 (PIN-FORMED protein 1), TB1 (teosinte branched 1), BA1/LAX1 (BARREN STALK1/LIKE AUXIN1), GRAS8 (gibberellic acid insensitive/GAI, Repressor of ga13/RGA and Scarecrow8/SCR8), ERF (ethylene-responsive element-binding factor), MAX2 (more axillary growth 2) and lipase] governing chickpea branch number. The useful information generated from this study have potential to expedite marker-assisted genetic enhancement by developing high-yielding cultivars with more number of productive (pods and seeds) branches in chickpea. Copyright © 2016 Elsevier

Expression of the KNOTTED HOMEOBOX Genes in the Cactaceae Cambial Zone Suggests Their Involvement in Wood Development.

Science.gov (United States)

Reyes-Rivera, Jorge; Rodríguez-Alonso, Gustavo; Petrone, Emilio; Vasco, Alejandra; Vergara-Silva, Francisco; Shishkova, Svetlana; Terrazas, Teresa

2017-01-01

The vascular cambium is a lateral meristem that produces secondary xylem (i.e., wood) and phloem. Different Cactaceae species develop different types of secondary xylem; however, little is known about the mechanisms underlying wood formation in the Cactaceae. The KNOTTED HOMEOBOX (KNOX) gene family encodes transcription factors that regulate plant development. The role of class I KNOX genes in the regulation of the shoot apical meristem, inflorescence architecture, and secondary growth is established in a few model species, while the functions of class II KNOX genes are less well understood, although the Arabidopsis thaliana class II KNOX protein KNAT7 is known to regulate secondary cell wall biosynthesis. To explore the involvement of the KNOX genes in the enormous variability of wood in Cactaceae, we identified orthologous genes expressed in species with fibrous ( Pereskia lychnidiflora and Pilosocereus alensis ), non-fibrous ( Ariocarpus retusus ), and dimorphic ( Ferocactus pilosus ) wood. Both class I and class II KNOX genes were expressed in the cactus cambial zone, including one or two class I paralogs of KNAT1 , as well as one or two class II paralogs of KNAT3 - KNAT4 - KNAT5 . While the KNOX gene SHOOTMERISTEMLESS ( STM) and its ortholog ARK1 are expressed during secondary growth in the Arabidopsis and Populus stem, respectively, we did not find STM orthologs in the Cactaceae cambial zone, which suggests possible differences in the vascular cambium genetic regulatory network in these species. Importantly, while two class II KNOX paralogs from the KNAT7 clade were expressed in the cambial zone of A. retusus and F. pilosus , we did not detect KNAT7 ortholog expression in the cambial zone of P. lychnidiflora . Differences in the transcriptional repressor activity of secondary cell wall biosynthesis by the KNAT7 orthologs could therefore explain the differences in wood development in the cactus species.

Origin of the subepidermal tissue in Piper L. leaves.

Science.gov (United States)

Nakamura, A T; Simão, E; Silva, L; Torres, G A

2015-05-01

Studies on the anatomy of Piper leaves demonstrate the presence of a subepidermal tissue distinct from the adjacent epidermis, which cells show thin walls and hyaline contents. Some authors consider such cells a hypodermal tissue, while others refer to them as components of a multiple epidermis. In this study, the nature of this subepidermal tissue was investigated through the analysis of leaf ontogeny in three Piper species. The analysis showed that the referred tissue originates from the ground meristem and, thus, should be considered a hypodermis. The studied species suggests that the role of the hypodermis would be to protect the photosynthetic apparatus from excess light, regulating the intensity of light reaching the chlorophyll parenchyma.

Induction of micronuclei by irradiation with neutrons produced from 600 MeV protons

CERN Document Server

Diehl-Marshall, I

1980-01-01

Chromosome damage can be detected by the observation of micronuclei . Because its sensitivity, the micronuclei induciton in meristems of Vicia faba bean roots has been selected to determine the radiation damage produced by doses ranging from 1 to 82 cGy of neutrons. The average number of miconuclei found between 24 and 48 hours after irradiation was plotted as a funciton of dose. The RBE values, using as reference radiation 60 Co y-rays, ranged from 3.5 for a neutron dose of 82 cGy to 18 for a neutron of 1 cGy. Even higher RBE values were deduced at low doses from the evaluation of cells containing multiple micronuclei.

Cytological Effects of Irradiated Guayabano Fruit Juice on Native Onion (Allium fistulosum L.

Directory of Open Access Journals (Sweden)

Milagros Serrana

1993-06-01

Full Text Available Thirty bottles of guayabano fruit juice were exposed to gamma ray doses of 0, 1, 2, 3 and 4 KGy. These bottles were then stored for 0, 4 and 8 days and used for treatment of Allium fistulosum L. root meristems. For each treatment, 2000 cells were scored to obtain data on mitotic index and types and frequency of cytological aberrations. The newly irradiated juice did not inhibit mitosis but storage showed marked effects on the mitotic index. Both irradiated or unirradiated juice stored for 8 days caused a significant inhibition of mitosis. The irradiated juice induced the production of anaphase bridges, binucleate cells, cells, cells with elongated nucleus and cells with obliquely oriented equatorial plate.

Effects of ionizing radiation on the hypocotyl-root axis of three species of gossypium

International Nuclear Information System (INIS)

Reed, J.P.

1977-01-01

The hypocotyl-root axis of cotton seedlings grown from irradiated and non-irradiated seeds was investigated using light microscopy and histological techniques. Special emphasis was placed on the pattern of vascular transition. Two patterns of vascular transition in non-irradiated seedlings were found. In Gossypium hirsutum and G. barbadense there are prominent metaxylem bands between the vascular bundles in the hypocotyl. In G. gossypioides there are no bands. The presence or absence of the bands was easily detected using polarized light. The most outstanding effects of radiation were inhibition of lateral root development and alteration of the pattern of vascular transition in seedlings grown from irradiated seeds. The findings suggest that the root apical meristem determines the vascular pattern

Effect of heavy charged particles of galactic cosmic radiation on seeds

International Nuclear Information System (INIS)

Maksimova, E.N.

1985-01-01

The experiments were carried out on Lactuca sativa seeds exposed for 20, 66, 123 and 308 days in a biostack also containing physical detectors of heavy charged particles. The puppose of the experiments was to measure the yield of abberrant cells and its dependence on the exposure time and the site where particles hit the object. The cytogenetic examination demonstrated a significant difference between the seeds that were or were not hit by heavy charged particles. This is indicative of a significant contribution of galactic cosmic radiation to the radiobiological effect. The yield of aberrant cells as a function of the localization of heavy charged particles in the seed was established. The most sensitive target was the root meristem

Arabidopsis thaliana Somatic Embryogenesis Receptor Kinase 1 protein is present in sporophytic and gametophytic cells and undergoes endocytosis

DEFF Research Database (Denmark)

Kwaaitaal, Mark Adrianus Cornelis J; de Vries, S C; Russinova, E

2005-01-01

Arabidopsis thaliana plants expressing AtSERK1 fused to yellow-fluorescent protein were generated. Fluorescence was detected predominantly at the cell periphery, most likely the plasma membrane, of cells in ovules, embryo sacs, anthers, and embryos and in seedlings. The AtSERK1 protein was detected...... in diverse cell types including the epidermis and the vascular bundles. In some cells, fluorescent receptors were seen in small vesicle-like compartments. After application of the fungal toxin Brefeldin A, the fluorescent receptors were rapidly internalized in the root meristem and root vascular tissue. We...... conclude that the AtSERK1 receptor functions in a common signalling pathway employed in both sporophytic and gametophytic cells....

Diverse roles of ERECTA family genes in plant development.

Science.gov (United States)

Shpak, Elena D

2013-12-01

Multiple receptor-like kinases (RLKs) enable intercellular communication that coordinates growth and development of plant tissues. ERECTA family receptors (ERfs) are an ancient family of leucine-rich repeat RLKs that in Arabidopsis consists of three genes: ERECTA, ERL1, and ERL2. ERfs sense secreted cysteine-rich peptides from the EPF/EPFL family and transmit the signal through a MAP kinase cascade. This review discusses the functions of ERfs in stomata development, in regulation of longitudinal growth of aboveground organs, during reproductive development, and in the shoot apical meristem. In addition the role of ERECTA in plant responses to biotic and abiotic factors is examined. Elena D. Shpak (Corresponding author). © 2013 Institute of Botany, Chinese Academy of Sciences.

Accessibility of. gamma. -ray induced primer toward DNA polymerase I of Escherichia coli during soaking of barley seed

Energy Technology Data Exchange (ETDEWEB)

Yamaguchi, H; Tatara, A; Naito, T [Tokyo Univ. (Japan). Faculty of Agriculture

1976-09-01

After dry barley seeds were irradiated with ..gamma..-rays and soaked for various times, the squashed preparations were made of the first leaf meristems and incubated with E.coli DNA polymerase I with appropriate substrates. The incorporation of nucleotides with DNA polymerase occurred in the cells fixed at late G/sub 1/ after 15 kR and at middle and late G/sub 1/ after 30 kR, respectively. There was an interrelation between the incorporation of nucleotides by DNA polymerase and the chromatin diffusion throughout a nucleus. The observations were interpreted in terms of the accessibility of 3'-0H groups of DNA breaks which accompanies the change of the conformation of chromatin fibres.

Katanin: A Sword Cutting Microtubules for Cellular, Developmental, and Physiological Purposes

Directory of Open Access Journals (Sweden)

Ivan Luptovčiak

2017-11-01

Full Text Available KATANIN is a well-studied microtubule severing protein affecting microtubule organization and dynamic properties in higher plants. By regulating mitotic and cytokinetic and cortical microtubule arrays it is involved in the progression of cell division and cell division plane orientation. KATANIN is also involved in cell elongation and morphogenesis during plant growth. In this way KATANIN plays critical roles in diverse plant developmental processes including the development of pollen, embryo, seed, meristem, root, hypocotyl, cotyledon, leaf, shoot, and silique. KATANIN-dependent microtubule regulation seems to be under the control of plant hormones. This minireview provides an overview on available KATANIN mutants and discusses advances in our understanding of KATANIN biological roles in plants.

Dichlorophen and Dichlorovos mediated genotoxic and cytotoxic assessment on root meristem cells of Allium cepa

Directory of Open Access Journals (Sweden)

Sibhghatulla Shaikh

2012-06-01

Full Text Available Plants are direct recipients of agro – toxics and therefore important materials for assessing environmental chemicals for genotoxicity. The meristematic mitotic cell of Allium cepa is an efficient cytogenetic material for chromosome aberration assay on environmental pollutants. Onion root tips were grown on moistened filter paper in petri dish at room temperature. Germinated root tips were then exposed to three concentrations of each pesticide for 24 h. About 1 – 2 mm length of root tip was cut, fixed in cornoy’s fixative, hydrolyzed in warm 1 N HCL, stained with acetocarmine and squashed on glass slide. About 3000 cells were scored and classified into interphase and normal or aberrant division stage. Cytotoxicity was determined by comparing the mitotic index (MI of treated cells with that of the negative control. The MI of cells treated with Dichlorophen and Dichlorovos at one or more concentration was half or less than that of control are said to be cytotoxic. Genotoxicity was measured by comparing the number of cells/1000 in aberrant division stages at each dose with the negative control using Mann – Whitney U test. Both Dichlorophen and Dichlorovos are genotoxic at higher concentrations i.e. 0.001%, 0.002% and 0.028%, 0.056% inducing chromosome fragment, chromosome lagging and bridges, stick chromosome and multipolar anaphase.

Plant Aurora kinases play a role in maintenance of primary meristems and control of endoreduplication

Czech Academy of Sciences Publication Activity Database

Petrovská, Beáta; Cenklová, Věra; Pochylová, Žaneta; Kourová, Hana; Doskočilová, Anna; Plíhal, Ondřej; Binarová, Lenka; Binarová, Pavla

2012-01-01

Roč. 193, č. 3 (2012), s. 590-604 ISSN 0028-646X R&D Projects: GA ČR(CZ) GA204/07/1169; GA ČR GP204/09/P155; GA ČR(CZ) GD204/09/H084; GA MŠk(CZ) LC06034; GA MŠk LC545; GA AV ČR IAA500200719 Grant - others:GA MŠk(CZ) ED0007/01/01 Program:ED Institutional research plan: CEZ:AV0Z50380511; CEZ:AV0Z50200510 Keywords : Arabidopsis thaliana * AtTPX2 (targeting protein for Xklp2) * Aurora kinases Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 6.736, year: 2012

Effect of apical meristem clipping on carbon allocation and morphological development of white oak seedlings

Science.gov (United States)

Paul P. Kormanik; Shi-Jean S. Sung; T.L. Kormanik; Stanley J. Zarnoch

1994-01-01

Seedlings from three open-pollinated half-sib white oak seedlots were clipped in mid-July and their development was compared to nonclipped controls after one growing season.In general when data were analyzed by family, clipped seedlings were significantly less desirable in three to six of the eight variables tested.Numerically, in all families seedlots, the clipped...

Floral Reversion in Arabidopsis suecica Is Correlated with the Onset of Flowering and Meristem Transitioning.

Directory of Open Access Journals (Sweden)

Amelia Asbe

Full Text Available Angiosperm flowers are usually determinate structures that may produce seeds. In some species, flowers can revert from committed flower development back to an earlier developmental phase in a process called floral reversion. The allopolyploid Arabidopsis suecica displays photoperiod-dependent floral reversion in a subset of its flowers, yet little is known about the environmental conditions enhancing this phenotype, or the morphological processes leading to reversion. We have used light and electron microscopy to further describe this phenomenon. Additionally, we have further studied the phenology of flowering and floral reversion in A. suecica. In this study we confirm and expand upon our previous findings that floral reversion in the allopolyploid A. suecica is photoperiod-dependent, and show that its frequency is correlated with the timing for the onset of flowering. Our results also suggest that floral reversion in A. suecica displays natural variation in its penetrance between geographic populations of A. suecica.

Crescimento e teores de clorofila em mudas de bananeira em função da supressão do pseudocaule, de doses de nitrogênio e de boro Growth and chlorophyll content of banana suckers in function of pseudostem suppression and doses of nitrogen and boron

Directory of Open Access Journals (Sweden)

Walter Esfrain Pereira

2010-12-01

Full Text Available O objetivo deste experimento foi avaliar a influência da eliminação da gema apical do rizoma e de doses de nitrogênio e boro, sobre a produção e o crescimento de mudas de bananeira. O experimento foi realizado no Centro de Formação de Tecnólogos da UFPB. O delineamento foi em blocos casualizados, com quatro blocos e nove plantas matrizes por parcela, sendo duas plantas úteis. Os fatores avaliados foram doses de N (0 a 240 g/planta e de B (0 a 2,2 g/planta combinados com a matriz experimental Composto Central de Box, originando nove combinações, arranjados fatorialmente com e sem eliminação da gema apical da planta matriz. Os dados foram submetidos à análise de variância e de regressão. A supressão do pseudocaule da planta principal, com a eliminação da gema apical do rizoma aumentou o número de perfilhos, com maior crescimento, exceto do diâmetro do rizoma, o qual diminuiu. Os teores foliares de clorofila total e de B também foram diminuídos, nos perfilhos das bananeiras amputadas. Para a produção de mudas da bananeira ‘Pacovan’, recomenda-se a supressão do pseudocaule da planta principal, com eliminação da gema apical do rizoma e aplicação do N.The objective of this research was to evaluate the influence of the removal in the pseudostem with elimination of the meristem apical of the rhizome and doses of nitrogen and boron, about the production and growth of banana suckers. The experiment was carried out at Centro de Formação de Tecnólogos - UFPB, State of Paraíba. The experimental design was in randomized blocks, with four replications and nine mother plants for experimental unit, being two useful plants. The evaluated valued factors were doses of N (0 to 240 g plant-1 and of B (0 to 240 g plant-1 combined in agreement with the experimental matrix ‘Central Composite’, originating nine combinations, which were arranged factorially with suppression and without suppression of the pseudostem of the mother

Meios de cultura, reguladores de crescimento e fontes de nitrogênio na regulação da calogênese do pau-brasil (Caesalpinia echinata Lam. Culture media, growth regulators and nitrogen sources in callus formation regulation of Brazilwood (Caesalpinia echinata Lam.

Directory of Open Access Journals (Sweden)

Elias Terra Werner

2010-12-01

Full Text Available A regulação da calogênese é o primeiro passo para a embriogênese somática indireta in vitro. Nesse sentido, foram investigados os efeitos de diferentes meios de cultura, reguladores de crescimento e fontes nitrogenadas no desenvolvimento de calos em tecidos foliares de Caesalpinia echinata (pau-brasil. Explantes foliares foram cultivados em meios de cultura MS, B5, White e WPM. Testou-se, também, o efeito dos compostos nitrogenados (NH4NO3, KNO3 e glutamina e a interação entre auxinas (2,4-D, AIA e AIB e citocininas (BAP e KIN na desdiferenciação celular indicado pela formação de calos. Os meios MS, B5 e White não foram significantemente diferentes e proporcionaram melhores resultados. Em meio MS contendo as fontes nitrogenadas 2,4 g L-1 NH4NO3 e 1,35 g L-1 glutamina + 4,11 g L-1 de KNO3 na presença de 1,0 mg L-1 2,4-D e 5,0 mg L-1 BAP ocorreu maior proliferação celular indicada pela massa fresca dos calos. As combinações dos reguladores 0,5 mg L-1 2,4-D + 5 mg L-1 BAP e 0,5 mg L-1 AIB + 5,0 mg L-1 BAP suplementado com 2,4 g L-1 NH4NO3 em meio MS estimularam o crescimento dos calos. De maneira geral, os calos apresentaram aspectos friáveis, não embriogênicos, com acúmulo de fenóis e presença de áreas meristemáticas (meristemóides.The regulation of callus formation is the first step to indirect somatic embryogenesis in vitro. Therefore, we investigated hormonal and nutrient factors on development of callus in leaf tissues of Caesalpinia echinata (Brazilwood. Explants were cultivated in culture media MS, B5, WPM, and White. The effect of nitrogen sources (NH4NO3, KNO3 and glutamine and the interaction between auxins (2,4-D, IAA and IBA and cytokinins (BAP and KIN were also evaluated. Media MS, B5 and White were not significantly different and provided better results. MS medium containing 2.4 g L-1 NH4NO3, 1.35 g L-1 glutamine, and 4.11 g L-1 of KNO3 in the presence of 1 mg.L-1 2,4-D and 5 mg.L-1 BAP increased cellular

Flower development: open questions and future directions.

Science.gov (United States)

Wellmer, Frank; Bowman, John L; Davies, Brendan; Ferrándiz, Cristina; Fletcher, Jennifer C; Franks, Robert G; Graciet, Emmanuelle; Gregis, Veronica; Ito, Toshiro; Jack, Thomas P; Jiao, Yuling; Kater, Martin M; Ma, Hong; Meyerowitz, Elliot M; Prunet, Nathanaël; Riechmann, José Luis

2014-01-01

Almost three decades of genetic and molecular analyses have resulted in detailed insights into many of the processes that take place during flower development and in the identification of a large number of key regulatory genes that control these processes. Despite this impressive progress, many questions about how flower development is controlled in different angiosperm species remain unanswered. In this chapter, we discuss some of these open questions and the experimental strategies with which they could be addressed. Specifically, we focus on the areas of floral meristem development and patterning, floral organ specification and differentiation, as well as on the molecular mechanisms underlying the evolutionary changes that have led to the astounding variations in flower size and architecture among extant and extinct angiosperms.

Development and Characterization of Microsatellite Markers for Central American Begonia sect. Gireoudia (Begoniaceae

Directory of Open Access Journals (Sweden)

Alex D. Twyford

2013-05-01

Full Text Available Premise of the study: Transcriptome sequence data were used to design microsatellite primers for two widespread Central American Begonia species, B. heracleifolia and B. nelumbiifolia, to investigate population structure and hybridization. Methods and Results: The transcriptome from vegetative meristem tissue from the related B. plebeja was mined for microsatellite loci, and 31 primer pairs amplified in the target species. Fifteen primer pairs were combined in two multiplex PCR reactions, which amplified an average of four alleles per locus. Conclusions: The markers developed will be a valuable genetic resource for medium-throughput genotyping of Central American species of Begonia sect. Gireoudia. A subset of these markers have perfect sequence matches to Asian B. venusta, and are promising for studies in other Begonia sections.

Multiple shoot cultures of Atropa belladonna: Effect of physico-chemical factors on growth and alkaloid formation

International Nuclear Information System (INIS)

Benjamin, B.D.; Roja, P.C.; Heble, M.R.; Chandha, M.S.

1987-01-01

Multiple shoot cultures were established from shoot tip and axillary meristem of the plant Atropa belladonna. The cultures were initially raised on agar medium and subsequently maintained on liquid medium of Murashige and Skoog (1962) supplemented with BA. These cultures were subjected to different doses of -y-irradiation. Recovery from the radiation effects was observed in tissues subjected to 29 Gy during four successive passages. Plant growth regulators influenced the growth and morphogenetic events of the tissues. The precursors of tropane alkaloids marginally increased the alkaloid synthesis during the stationary phase of growth. Shoot cultures, established from different field grown plants varying in alkaloid content, were morphologically similar and did not exhibit the parental characteristics with respect to alkaloid formation

Peculiarities of the radioprotective effect of antioxidants during gamma irradiation of wheat seeds

International Nuclear Information System (INIS)

Babaev, U.Sh.

1988-01-01

Bioantioxidant radioprotective action mechanism was studied using wheat seeds. Cobalt-60 was used as radiation source, phenosane potassium salt in aqueous solution in 0.1 and 0.25% concentrations possessing the maximum radioprotective effect - as an antioxidant. Dry seeds irradiated with 100 Gy dose were treated with fresh antioxidant solutions during 20 hours with 0.2, 4.6 an 8 hour interval at room temperature. The number of cells with aberrations at the anaphase stage in the main root apical meristem were counted in germinated seeds. A high radioprotective effect of phenosane antioxidant which represents space-complicated phenols is ascertained. Radioprotective effect is dependent on time interval between seed irradaition and germination and is maximal when this time makes up 4-8 hours

Studies on cambial activity: advances and challenges in the knowledge of growth dynamics of Brazilian woody species

Directory of Open Access Journals (Sweden)

CÁTIA H. CALLADO

2014-03-01

Full Text Available The lack of specific research on the sequence of events that determine plant growth from meristem until wood formation represents a gap in the knowledge of growth dynamics in woody species. In this work, we surveyed published studies concerning cambial activity of Brazilian native species aiming at allowing the comparison of applied methods and obtained results. The annual cambial seasonality was observed in all the investigated species. Nevertheless, we found high heterogeneity in the used methodologies. As a result from this analysis, our opinion points to the need for standardizing sampling protocols and for discussing the suitability of experimental designs. This will help to define with greater precision the factors that determine the radial growth in the different tropical ecosystems.

Growth versus immunity--a redirection of the cell cycle?

Science.gov (United States)

Eichmann, Ruth; Schäfer, Patrick

2015-08-01

Diseases caused by plant pathogens significantly reduce growth and yield in agricultural crop production. Raising immunity in crops is therefore a major aim in breeding programs. However, efforts to enhance immunity are challenged by the occurrence of growth inhibition triggered by immunity that can be as detrimental as diseases. In this review, we will propose molecular models to explain the inhibitory growth-immunity crosstalk. We will briefly discuss why the resource reallocation model might not represent the driving force for the observed growth-immunity trade-offs. We suggest a model in which immunity redirects and initiates hormone signalling activities that can impair plant growth by antagonising cell cycle regulation and meristem activities. Copyright © 2015 The Authors. Published by Elsevier Ltd.. All rights reserved.

Onion root tip cell system for biodosimetry?

International Nuclear Information System (INIS)

Paradiz, J; Druskovic, B.; Lovka, M.; Skrk, J.

1996-01-01

Methodology for radiation dose assessment based on chromosomal damage to plant cells has no yet been established, although root meristems have been the pioneer cytogenetic materials and profound analyses of irradiated meristematic cells of horse bean (Viciafaba L.) had been performed. Onion (Allium cepa L.) root tips frequently used for radiation cytogenetic studies, are recently considered to be one of the most promising plant test system for the detection of genotoxic environmental pollutants. We studied the possibility of using cytogenetic analyses of irradiated onion cells to determine the effective biological dose of ionizing radiation. The dose-effect relationships for chromosomal damages to onion meristematic cells were established after plants had been irradiated and subsequently grown in both laboratory and field conditions

Propagación vegetativa in vitro de Puya santossi Puya santossi in vitro propagation

Directory of Open Access Journals (Sweden)

Pedroza–Manrique Jaime Alonso

2008-07-01

ías de extinción; reguladores de crecimiento.Puya santossi (L is an endemic threatened shrub from the high Andean region. Conservation procedures must thus be established for this important germplasm species’ conservation. This study evaluated the in vitro adaptation of this species with Benlate and nine sodium hypochlorite treatments and the effect of five growth regulators on the morphogenetic development of shoots, meristems and leaves. The base medium used was MS enriched with the following growth regulators: indol butyric acid (IBA and benzylaminopurine (BAP (0.0, 0.5, 1.0 and 1.5 mg/L in meristem culture; α-naphthaleneacetic acid (NAA (0.0, 1.0, 2.0 and 3.0 mg/L in the rooting of buds regenerated in vitro; 2, 4-dichlorophenoxy acetic acid and Kinetin (0.0, 1.0, 3.0 and 5.0 mg/l in leaves. It was observed that treatment 5 (1% NaOCl, 10 min was the most successful in contamination control. The meristem was the most appropriate explant for Puya santossi micropropagation, allowing mass proliferation of adventitious buds when they were grown on MS media enriched with 1.5 mg/L BAP. Buds from the meristem culture were rooted with 3.0 mg/L NAA. This protocol represents a conservation model for endangered species and led to propagating Puya santossi. This investigation revealed that morphogenetic leaf explants were inhibited by the presence of a group of chlorophycea algae which were found to be symbiotically associated with P. santossi. Key words: Puya santossi; micropropagation; endangered plant; growth regulators

Radiobiological researches on Dianthus caryophyllus L. carnation chimeras; Recherches radiobiologiques sur des chimeres d'oeillet Dianthus caryophyllus L.

Energy Technology Data Exchange (ETDEWEB)

Pereau-Leroy, Pierre

1975-04-12

This research thesis reports a radiobiological study of Dianthus periclinal chimeras performed by submitting plants and plant cuttings at different physiological stages to cobalt-60 gamma irradiation under different dose conditions and rates. The effects of these treatments are studied while growing the so-processed plants and by microscopic examination of sections of irradiated meristems [French] Une etude radiobiologique de chimeres periclinales d'oeillet est effectuee en soumettant au rayonnement gamma du cobalt 60, sous differentes conditions de doses et debits de dose, des plantes entieres et des boutures a des stades physiologiques differents. Les effets des traitements sont observes au cours de la culture des plantes traitees et par l'examen microscopique de coupes des meristemes irradies. La destruction de cellules meristematiques, dans des proportions variables avec les modalites d'irradiation, provoque des modifications de structure des chimeres dont les plus frequentes sont la formation de tiges genetiquement homogenes a partir des differents genotypes existants dans la plante irradiee. Le traitement aux radiations ionisantes constitue donc une methode pratique de detection des chimeres periclinales qui, a l'image de ce qui se passe pour l'oeillet, sont tres repandues chez les plantes cultivees a propagation vegetative. Mais, comme il existe generalement plus de deux ensembles cellulaires meristematiques independants, cette methode ne permet pas, a elle seule, de definir la repartition des differents genotypes dans ces ensembles; elle doit alors etre completee par des etudes genetiques ou des marquages cellulaires tels que des mutations chlorophylliennes ou de genomes. Ainsi la structure de deux varietes d'oeillet a fleurs oranges, qui produisent, apres irradiation, des fleurs rouges et des fleurs jaunes, a ete determinee grace a l'obtention, par traitement a la colchicine, de cytochimeres 4 - 2 - 2 et 2 - 4 - 4. Les tiges a fleurs jaunes, produites par

Lateral root development in the maize (Zea mays) lateral rootless1 mutant.

Science.gov (United States)

Husakova, Eva; Hochholdinger, Frank; Soukup, Ales

2013-07-01

The maize lrt1 (lateral rootless1) mutant is impaired in its development of lateral roots during early post-embryonic development. The aim of this study was to characterize, in detail, the influences that the mutation exerts on lateral root initiation and the subsequent developments, as well as to describe the behaviour of the entire plant under variable environmental conditions. Mutant lrt1 plants were cultivated under different conditions of hydroponics, and in between sheets of moist paper. Cleared whole mounts and anatomical sections were used in combination with both selected staining procedures and histochemical tests to follow root development. Root surface permeability tests and the biochemical quantification of lignin were performed to complement the structural data. The data presented suggest a redefinition of lrt1 function in lateral roots as a promoter of later development; however, neither the complete absence of lateral roots nor the frequency of their initiation is linked to lrt1 function. The developmental effects of lrt1 are under strong environmental influences. Mutant primordia are affected in structure, growth and emergence; and the majority of primordia terminate their growth during this last step, or shortly thereafter. The lateral roots are impaired in the maintenance of the root apical meristem. The primary root shows disturbances in the organization of both epidermal and subepidermal layers. The lrt1-related cell-wall modifications include: lignification in peripheral layers, the deposition of polyphenolic substances and a higher activity of peroxidase. The present study provides novel insights into the function of the lrt1 gene in root system development. The lrt1 gene participates in the spatial distribution of initiation, but not in its frequency. Later, the development of lateral roots is strongly affected. The effect of the lrt1 mutation is not as obvious in the primary root, with no influences observed on the root apical meristem

Lateral root development in the maize (Zea mays) lateral rootless1 mutant

Science.gov (United States)

Husakova, Eva; Hochholdinger, Frank; Soukup, Ales

2013-01-01

Background and Aims The maize lrt1 (lateral rootless1) mutant is impaired in its development of lateral roots during early post-embryonic development. The aim of this study was to characterize, in detail, the influences that the mutation exerts on lateral root initiation and the subsequent developments, as well as to describe the behaviour of the entire plant under variable environmental conditions. Methods Mutant lrt1 plants were cultivated under different conditions of hydroponics, and in between sheets of moist paper. Cleared whole mounts and anatomical sections were used in combination with both selected staining procedures and histochemical tests to follow root development. Root surface permeability tests and the biochemical quantification of lignin were performed to complement the structural data. Key Results The data presented suggest a redefinition of lrt1 function in lateral roots as a promoter of later development; however, neither the complete absence of lateral roots nor the frequency of their initiation is linked to lrt1 function. The developmental effects of lrt1 are under strong environmental influences. Mutant primordia are affected in structure, growth and emergence; and the majority of primordia terminate their growth during this last step, or shortly thereafter. The lateral roots are impaired in the maintenance of the root apical meristem. The primary root shows disturbances in the organization of both epidermal and subepidermal layers. The lrt1-related cell-wall modifications include: lignification in peripheral layers, the deposition of polyphenolic substances and a higher activity of peroxidase. Conclusions The present study provides novel insights into the function of the lrt1 gene in root system development. The lrt1 gene participates in the spatial distribution of initiation, but not in its frequency. Later, the development of lateral roots is strongly affected. The effect of the lrt1 mutation is not as obvious in the primary root, with no

Radiation-induced cytogenetic and hematologic effects on aquatic biota within the Chernobyl exclusion zone.

Science.gov (United States)

Gudkov, D I; Shevtsova, N L; Pomortseva, N A; Dzyubenko, E V; Kaglyan, A E; Nazarov, A B

2016-01-01

During 1998-2014 the rate of chromosomal aberrations in embryo tissues of the pond snail (Lymnaea stagnalis) and root meristems of higher aquatic plants, and also hematologic indexes of mantle liquid of the adult snails and peripheral blood of fishes in water bodies within the Chernobyl exclusion zone (EZ) was studied. The absorbed dose rate for hydrobionts from water bodies of the EZ registered in a range from 0.25 to 420 μGy h(-1) and in the reference ones - up to 0.09 μGy h(-1). The level of chromosomal aberrations in the molluscs from the most contaminated water bodies of the EZ was registered within range of 18-27% and for the molluscs from the reference lakes this index was on the average 1.5% with the maximal values 2.3%. The rate of chromosomal aberrations in root meristematic cells of higher aquatic plants from the contaminated lakes of the EZ was in range of 7-17% and in the plants from reference water bodies was not exceed 2.1%. The positive correlation between chromosomal aberration rate and absorbed dose rate in the pond snail's embryos and root meristems of higher aquatic plants in water bodies of the EZ was registered. Analysis of hemolymph structure of snails from the most contaminated water bodies showed a high rate of dead and phagocytic cells as well as decrease of the young amoebocytes quantity. Hematologic research of fish allows to determine on the one hand an insignificant changes of leukogram structure, and from the other hand a high level of red cells with different abnormalities in the peripheral blood of fishes from the water bodies with high levels of radioactive contamination. It is suppose that qualitative indexes of red cells in peripheral blood of fish are more sensitive to long-term radiation impact in comparison with elements of white blood, which can be used for conducting of the hematologic monitoring of radioactive contaminated water bodies. Copyright © 2015 Elsevier Ltd. All rights reserved.

Plants regeneration of a papaya hybrid (IBP 42-99 from callus obtained from apexes of in vitro plants.

Directory of Open Access Journals (Sweden)

Jorge Gallardo Colina

2004-07-01

Full Text Available In Cuba there realizes innumerable efforts to increase the food production and especially the fruit trees Inside which the papaya has great importance. In this sense studies are realized to obtain plants resistant to virus that they need of tools that they support and increase the indexes of obtaining transgenic line in the events of transformation specifically in a papaya hybrid. As main objective was to develop a protocol for the regeneration of plants of papaya hybrid from callus obtained of in vitro plant apexes.plan to develop a tool that supports and increases the indexes of obtaining line transgenic in the events of transformation in a hybrid of papaya.In vitro plants of the hybrid IBP 42-99 were used as plant material. The culture medium Nitsh and Nitsh was used and the growth regulators that permitted the obtaining of the best callus with embryogenic structures were studied, and also, the concentrations in which they were more efficient were adjusted. The capacity of callus formation from different parts of the stem of the in vitro plants was studied. Different culture medium for the regeneration of papaya plants from the obtained callus was studied. It was possible to obtain callus by combining 6-BAP with ANA and AIA. The best results are obtained when segments from in vitro plants shoot, 1 cm length from the meristem, were used. Also, by eliminating the meristem in the apexes, an increase in the callus formation capacity of the explant was achieved. Plants were obtained from callus using the culture medium MS supplement with 0.09mg.l-1 of AIA, 0.01mg.l-1 of AG3 and 2mg.l-1 of Zeatin and the best percentage was achieved with the callus coming from the treatments with less concentration of 6-BAP and AIA. Key words: culture medium, micropropagation, organogenesis, segments

Distinctive features and differential regulation of the DRTS genes of Arabidopsis thaliana.

Science.gov (United States)

Maniga, Antonio; Ghisaura, Stefania; Perrotta, Lara; Marche, Maria Giovanna; Cella, Rino; Albani, Diego

2017-01-01

In plants and protists, dihydrofolate reductase (DHFR) and thymidylate synthase (TS) are part of a bifunctional enzyme (DRTS) that allows efficient recycling of the dihydrofolate resulting from TS activity. Arabidopsis thaliana possesses three DRTS genes, called AtDRTS1, AtDRTS2 and AtDRTS3, that are located downstream of three members of the sec14-like SFH gene family. In this study, a characterization of the AtDRTS genes identified alternatively spliced transcripts coding for AtDRTS isoforms which may account for monofunctional DHFR enzymes supporting pathways unrelated to DNA synthesis. Moreover, we discovered a complex differential regulation of the AtDRTS genes that confirms the expected involvement of the AtDRTS genes in cell proliferation and endoreduplication, but indicates also functions related to other cellular activities. AtDRTS1 is widely expressed in both meristematic and differentiated tissues, whereas AtDRTS2 expression is almost exclusively limited to the apical meristems and AtDRTS3 is preferentially expressed in the shoot apex, in stipules and in root cap cells. The differential regulation of the AtDRTS genes is associated to distinctive promoter architectures and the expression of AtDRTS1 in the apical meristems is strictly dependent on the presence of an intragenic region that includes the second intron of the gene. Upon activation of cell proliferation in germinating seeds, the activity of the AtDRTS1 and AtDRTS2 promoters in meristematic cells appears to be maximal at the G1/S phase of the cell cycle. In addition, the promoters of AtDRTS2 and AtDRTS3 are negatively regulated through E2F cis-acting elements and both genes, but not AtDRTS1, are downregulated in plants overexpressing the AtE2Fa factor. Our study provides new information concerning the function and the regulation of plant DRTS genes and opens the way to further investigations addressing the importance of folate synthesis with respect to specific cellular activities.

Plant regeneration via direct somatic embryogenesis from leaf explants of Tolumnia Louise Elmore 'Elsa'.

Science.gov (United States)

Shen, Hui-Ju; Chen, Jen-Tsung; Chung, Hsiao-Hang; Chang, Wei-Chin

2018-01-22

Tolumnia genus (equitant Oncidium) is a group of small orchids with vivid flower color. Thousands of hybrids have been registered on Royal Horticulture Society and showed great potential for ornamental plant market. The aim of this study is to establish an efficient method for in vitro propagation. Leaf explants taken from in vitro-grown plants were used to induce direct somatic embryogenesis on a modified 1/2 MS medium supplemented with five kinds of cytokinins, 2iP, BA, kinetin, TDZ and zeatin at 0.3, 1 and 3 mg l -1 in darkness. TDZ at 3 mg l -1 gave the highest percentage of explants with somatic globular embryos after 90 days of culture. It was found that 2,4-D and light regime highly retarded direct somatic embryogenesis and showed 95-100% of explant browning. Histological observations revealed that the leaf cells divided into meristematic cells firstly, followed by somatic proembryos, and then somatic globular embryos. Eventually, somatic embryos developed a bipolar structure with the shoot apical meristem and the root meristem. Scanning electron microscopy observations showed that the direct somatic embryogenesis from leaf explants was asynchronously. The somatic embryos were found on the leaf tip, the adaxial surface and also the mesophyll through a cleft, and it reflected the heterogeneity of the explant. The 90-day-old globular embryos were detached from the parent explants and transferred onto a hormone-free 1/2 MS medium in light condition for about 1 month to obtain 1-cm-height plantlets. After another 3 months for growth, the plantlets were potted with Sphagnum moss and were acclimatized in a shaded greenhouse. After 1 month of culture, the survival rate was 100%. In this report, a protocol for efficient regenerating a Tolumnia orchid, Louise Elmore 'Elsa', was established via direct somatic embryogenesis and might reveal an alternative approach for mass propagation of Tolumnia genus in orchid industry.

Influence of root-bed size on the response of tobacco to elevated CO2 as mediated by cytokinins

Science.gov (United States)

Schaz, Ulrike; Düll, Barbara; Reinbothe, Christiane; Beck, Erwin

2014-01-01

The extent of growth stimulation of C3 plants by elevated CO2 is modulated by environmental factors. Under optimized environmental conditions (high light, continuous water and nutrient supply, and others), we analysed the effect of an elevated CO2 atmosphere (700 ppm, EC) and the importance of root-bed size on the growth of tobacco. Biomass production was consistently higher under EC. However, the stimulation was overridden by root-bed volumes that restricted root growth. Maximum growth and biomass production were obtained at a root bed of 15 L at ambient and elevated CO2 concentrations. Starting with seed germination, the plants were strictly maintained under ambient or elevated CO2 until flowering. Thus, the well-known acclimation effect of growth to enhanced CO2 did not occur. The relative growth rates of EC plants exceeded those of ambient-CO2 plants only during the initial phases of germination and seedling establishment. This was sufficient for a persistently higher absolute biomass production by EC plants in non-limiting root-bed volumes. Both the size of the root bed and the CO2 concentration influenced the quantitative cytokinin patterns, particularly in the meristematic tissues of shoots, but to a smaller extent in stems, leaves and roots. In spite of the generally low cytokinin concentrations in roots, the amounts of cytokinins moving from the root to the shoot were substantially higher in high-CO2 plants. Because the cytokinin patterns of the (xylem) fluid in the stems did not match those of the shoot meristems, it is assumed that cytokinins as long-distance signals from the roots stimulate meristematic activity in the shoot apex and the sink leaves. Subsequently, the meristems are able to synthesize those phytohormones that are required for the cell cycle. Root-borne cytokinins entering the shoot appear to be one of the major control points for the integration of various environmental cues into one signal for optimized growth. PMID:24790131

Transformation of oats and its application to improving osmotic stress tolerance.

Science.gov (United States)

Maqbool, Shahina B; Zhong, Heng; Oraby, Hesham F; Sticklen, Mariam B

2009-01-01

Oat (Avena sativa L.), a worldwide temperate cereal crop, is deficient in tolerance to osmotic stress due to drought and/or salinity. To genetically transform the available commercial oat cultivars, a genotype-independent and efficient regeneration system from shoot apical meristems was developed using four oat cultivars: Prairie, Porter, Ogle, and Pacer. All these oat cultivars generated a genotype-independent in vitro differentiated multiple shoots from shoot apical meristems at a high frequency. Using this system, three oat cultivars were genetically co-transformed with pBY520 (containing hva1 and bar) and pAct1-D (containing gus) using biolistic trade mark bombardment. Transgenic plants were selected and regenerated using herbicide resistance and GUS as a marker. Molecular and biochemical analyses of putative transgenic plants confirmed the co-integration of hva1 and bar genes with a frequency of 100%, and 61.6% of the transgenic plants carried all three genes (hva1, bar and gus). Further analyses of R0, R1, and R2 progenies confirmed stable integration, expression, and Mendalian inheritance for all transgenes. Histochemical analysis of GUS protein in transgenic plants showed a high level of GUS expression in vascular tissues and in the pollen grains of mature flowers. Immunochemical analysis of transgenic plants indicated a constitutive expression of hva1 at all developmental stages. However, the level of HVA1 was higher during the early seedling stages. The characteristic of HVA1 expression for osmotic tolerance in transgenic oat progeny was analyzed in vitro as well as in vivo. Transgenic plants exhibited significantly (Pplants. The symptoms of wilting or death of leaves as observed in 80% of non-transgenic plants due to osmotic stress was delayed and detected only in less than 10% of trans-genic plants. These observations confirmed the characteristic of HVA1 protein as providing or enhancing the osmotic tolerance in transgenic plants against salinity and

PLATINUM SENSITIVE 2 LIKE impacts growth, root morphology, seed set, and stress responses.

Directory of Open Access Journals (Sweden)

Amr R A Kataya

Full Text Available Eukaryotic protein phosphatase 4 (PP4 is a PP2A-type protein phosphatase that is part of a conserved complex with regulatory factors PSY2 and PP4R2. Various lines of Arabidopsis thaliana with mutated PP4 subunit genes were constructed to study the so far completely unknown functions of PP4 in plants. Mutants with knocked out putative functional homolog of the PSY2 LIKE (PSY2L gene were dwarf and bushy, while plants with knocked out PP4R2 LIKE (PP4R2L looked very similar to WT. The psy2l seedlings had short roots with disorganized morphology and impaired meristem. Seedling growth was sensitive to the genotoxin cisplatin. Global transcript analysis (RNA-seq of seedlings and rosette leaves revealed several groups of genes, shared between both types of tissues, strongly influenced by knocked out PSY2L. Receptor kinases, CRINKLY3 and WAG1, important for growth and development, were down-regulated 3-7 times. EUKARYOTIC ELONGATION FACTOR5A1 was down-regulated 4-6 fold. Analysis of hormone sensitive genes indicated that abscisic acid levels were high, while auxin, cytokinin and gibberellic acid levels were low in psy2l. Expression of specific transcription factors involved in regulation of anthocyanin synthesis were strongly elevated, e.g. the master regulator PAP1, and intriguingly TT8, which is otherwise mainly expressed in seeds. The psy2l mutants accumulated anthocyanins under conditions where WT did not, pointing to PSY2L as a possible upstream negative regulator of PAP1 and TT8. Expression of the sugar-phosphate transporter GPT2, important for cellular sugar and phosphate homeostasis, was enhanced 7-8 times. Several DNA damage response genes, including the cell cycle inhibitor gene WEE1, were up-regulated in psy2l. The activation of DNA repair signaling genes, in combination with phenotypic traits showing aberrant root meristem and sensitivity to the genotoxic cisplatin, substantiate the involvement of Arabidopsis PSY2L in maintenance of genome

Leaf-Like Sepals Induced by Ectopic Expression of a SHORT VEGETATIVE PHASE (SVP)-Like MADS-Box Gene from the Basal Eudicot Epimedium sagittatum

Science.gov (United States)

Li, Zhineng; Zeng, Shaohua; Li, Yanbang; Li, Mingyang; Souer, Erik

2016-01-01

Epimedium L. (Berberidaceae, Ranales), a perennial traditional Chinese medicinal herb, has become a new popular landscape plant for ground cover and pot culture in many countries based on its excellent ornamental characteristics and, distinctive and diverse floral morphology. However, little is known about the molecular genetics of flower development in Epimedium sagittatum. Here, we describe the characterization of EsSVP that encodes a protein sharing 68, 54, and 35% similarity with SVP, AGAMOUS-like 24 (AGL24) and SUPPRESSOR OF OVEREXPRESSION OF CONSTANS 1 (SOC1) in Arabidopsis, respectively. Quantitative RT-PCR (qRT-PCR) indicated that EsSVP transcripts were principally found in petiole and leaf tissues, with little expression in roots and flowers and no in fruits. The highest EsSVP expression was observed in leaves. The flowering time of 35S::EsSVP in most Arabidopsis thaliana and in all petunia plants was not affected in both photoperiod conditions, but 35S::EsSVP 5# and 35S::EsSVP 1# Arabidopsis lines induced late and early flowering under long day (LD, 14 h light/10 h dark) and short day (SD, 10 h light/14 h dark) conditions, respectively. The 35S::EsSVP Arabidopsis produced extra secondary inflorescence or floral meristems in the axils of the leaf-like sepals with excrescent trichomes, and leaf-like sepals not able to enclose the inner three whorls completely. Moreover, almost all transgenic Arabidopsis plants showed persistent sepals around the completely matured fruits. Upon ectopic expression of 35S::EsSVP in Petunia W115, sepals were enlarged, sometimes to the size of leaves; corollas were greenish and did not fully open. These results suggest that EsSVP is involved in inflorescence meristem identity and flowering time regulation in some conditions. Although, the SVP homologs might have suffered functional diversification among diverse species between core and basal eudicots, the protein functions are conserved between Arabidopsis/Petunia and Epimedium

Early histological, hormonal, and molecular changes during pineapple (Ananas comosus (L.) Merrill) artificial flowering induction.

Science.gov (United States)

Espinosa, Maita Eulalia Ávila; Moreira, Rafael Oliveira; Lima, André Almeida; Ságio, Solange Aparecida; Barreto, Horllys Gomes; Luiz, Sara Lazara Pérez; Abreu, Carlos Eduardo Aragón; Yanes-Paz, Ermis; Ruíz, Yanelis Capdesuñer; González-Olmedo, Justo Lorenzo; Chalfun-Júnior, Antonio

2017-02-01

Natural flowering can cause serious scheduling problems in the pineapple (Ananas comosus) industry and increase harvest costs. Pineapple flowering is thought to be triggered by increased ethylene levels and artificial forcing of pineapple flowering is a common practice to promote flowering synchronisation. However, little is known about the early hormonal and molecular changes of pineapple flowering induction and development. Here, we aimed to analyse the molecular, hormonal, and histological changes during artificial pineapple flowering by Ethrel ® 48 treatment. Histological analyses of the shoot apical meristem, leaf gibberellic acid (GA 3 ), and ethylene quantification were carried out during the first 72h after Ethrel ® 48 treatment. Expression profiles from ethylene biosynthesis (AcACS2 and AcACO1), gibberellin metabolism (AcGA2-ox1 and AcDELLA1), and flower development (FT-like gene (AcFT), LFY-like gene (AcLFY), and a PISTILLATA-like gene (AcPI)) genes were analysed during the first 24h after Ethrel ® 48 treatment. Differentiation processes of the shoot apical meristem into flower buds were already present in the first 72h after Ethrel ® 48 treatment. Ethrel ® 48 lead to a reduction in GA 3 levels, probably triggered by elevated ethylene levels and the positive regulation AcGA2-ox1. AcLFY activation upon Ethrel ® 48 may also have contributed to the reduction of GA 3 levels and, along with the up-regulation of AcPI, are probably associated with the flower induction activation. AcFT and AcDELLA1 do not seem to be regulated by GA 3 and ethylene. Decreased GA 3 and increased ethylene levels suggest an accumulation of AcDELLA1, which may display an important role in pineapple flowering induction. Thus, this study shows that molecular, hormonal, and histological changes are present right after Ethrel ® 48 treatment, providing new insights into how pineapple flowering occurs under natural conditions. Copyright © 2016 Elsevier GmbH. All rights reserved.

Clonal analysis of corn plant development. I. The development of the tassel and the ear shoot

International Nuclear Information System (INIS)

Johri, M.M.; Coe, E.H. Jr.

1983-01-01

The development of the tassel and the ear shoot has been investigated in corn (Zea mays L.). X irradiation of dry kernels and seedlings heterozygous for anthocyanin markers or for factors altering tassel and ear morphology results in the formation of clones (sectors) from cells of the apical meristem. Most tassels develop from 4 +/- 1 cells of the mature embryo. The expression of ramosa-1, tunicate, tassel seed-6, and vestigial is cell autonomous in the tassel. These genes act late in development and modify the developmental fate or decision of an individual clone and not of the whole group of cells producing a tassel. The ear shoot develops from lineages of one to three cells derived each from the L-I (outmost cell layer) and L-II (second cell layer) of the apical meristem. Typically the clones start in the ear shoot (in the husks and possibly in the cob), extend upward in an internode, continue along the margin of the leaf sheath or leaf blade at the node above, and terminate in this or the next higher leaf. The separation of lineages for ear shoot and internode occurs in the period around 13 days after sowing. The analysis of clonal boundaries shows that a small number of embryonic cells become isolated in their developmental capacity. This commitment process appears to be analogous to the process of compartmentation in the imaginal disks of fruit flies. The extent of proliferation of individual cells within a group of highly flexible and any particular clone does not generate a specific part of a tassel or an ear shoot. There must be cellular communication between various clones so that the overall size and morphology of an organ remain normal and more or less fixed. Thus the process of development in plants is also highly regulative in nature and shares many features in common with development in fruit flies

Identification of genes involved in the ACC-mediated control of root cell elongation in Arabidopsis thaliana

Directory of Open Access Journals (Sweden)

Markakis Marios

2012-11-01

Full Text Available Abstract Background Along the root axis of Arabidopsis thaliana, cells pass through different developmental stages. In the apical meristem repeated cycles of division increase the numbers of cells. Upon leaving the meristem, these cells pass the transition zone where they are physiologically and mechanically prepared to undergo subsequent rapid elongation. During the process of elongation epidermal cells increase their length by 300% in a couple of hours. When elongation ceases, the cells acquire their final size, shape and functions (in the differentiation zone. Ethylene administered as its precursor 1-aminocyclopropane-1-carboxylic acid (ACC is capable of inhibiting elongation in a concentration-dependent way. Using a microarray analysis, genes and/or processes involved in this elongation arrest are identified. Results Using a CATMA-microarray analysis performed on control and 3h ACC-treated roots, 240 differentially expressed genes were identified. Quantitative Real-Time RT-PCR analysis of the 10 most up and down regulated genes combined with literature search confirmed the accurateness of the analysis. This revealed that inhibition of cell elongation is, at least partly, caused by restricting the events that under normal growth conditions initiate elongation and by increasing the processes that normally stop cellular elongation at the end of the elongation/onset of differentiation zone. Conclusions ACC interferes with cell elongation in the Arabidopsis thaliana roots by inhibiting cells from entering the elongation process and by immediately stimulating the formation of cross-links in cell wall components, diminishing the remaining elongation capacity. From the analysis of the differentially expressed genes, it becomes clear that many genes identified in this response, are also involved in several other kind of stress responses. This suggests that many responses originate from individual elicitors, but that somewhere in the downstream

Leaf-like sepals induced by ectopic expression of a SHORT VEGETATIVE PHASE (SVP-like MADS-box gene from the basal eudicot Epimedium sagittatum

Directory of Open Access Journals (Sweden)

Zhineng Li

2016-09-01

Full Text Available Epimedium L. (Berberidaceae, Ranales, a perennial traditional Chinese medicinal herb, has become a new popular landscape plant for ground cover and pot culture in many countries based on its excellent ornamental characteristics and, distinctive and diverse floral morphology. However, little is known about the molecular genetics of flower development in Epimedium sagittatum. Here, we describe the characterization of EsSVP that encodes a protein sharing 68%, 54% and 35% similarity with SVP, AGAMOUS-like 24 (AGL24 and SUPPRESSOR OF OVEREXPRESSION OF CONSTANS 1 (SOC1 in Arabidopsis, respectively. Quantitative RT-PCR (qRT-PCR indicated that EsSVP transcripts were principally found in petiole and leaf tissues, with little expression in roots and flowers and no in fruits. The highest EsSVP expression was observed in leaves. The flowering time of 35S::EsSVP in most Arabidopsis thaliana and in all petunia plants was not affected in both photoperiod conditions, but 35S::EsSVP 5# and 35S::EsSVP 1# Arabidopsis lines induced late and early flowering under long day (LD, 14 hr light/10 hr dark and short day (SD, 10 hr light/14 hr dark conditions, respectively. The 35S::EsSVP Arabidopsis produced extra secondary inflorescence or floral meristems in the axils of the leaf-like sepals with excrescent trichomes, and leaf-like sepals not able to enclose the inner three whorls completely. Moreover, almost all transgenic Arabidopsis plants showed persistent sepals around the completely matured fruits. Upon ectopic expression of 35S::EsSVP in Petunia W115, sepals were enlarged, sometimes to the size of leaves; corollas were greenish and did not fully open. These results suggest that EsSVP is involved in inflorescence meristem identity and flowering time regulation in some conditions. Although the SVP homologs might have suffered functional diversification among diverse species between core and basal eudicots, the protein functions are conserved between Arabidopsis

The cyclic nucleotide gated cation channel AtCNGC10 traffics from the ER via Golgi vesicles to the plasma membrane of Arabidopsis root and leaf cells

Directory of Open Access Journals (Sweden)

Andres Marilou A

2007-09-01

Full Text Available Abstract Background The cyclic nucleotide-gated ion channels (CNGCs maintain cation homeostasis essential for a wide range of physiological processes in plant cells. However, the precise subcellular locations and trafficking of these membrane proteins are poorly understood. This is further complicated by a general deficiency of information about targeting pathways of membrane proteins in plants. To investigate CNGC trafficking and localization, we have measured Atcngc5 and Atcngc10 expression in roots and leaves, analyzed AtCNGC10-GFP fusions transiently expressed in protoplasts, and conducted immunofluorescence labeling of protoplasts and immunoelectron microscopic analysis of high pressure frozen leaves and roots. Results AtCNGC10 mRNA and protein levels were 2.5-fold higher in roots than leaves, while AtCNGC5 mRNA and protein levels were nearly equal in these tissues. The AtCNGC10-EGFP fusion was targeted to the plasma membrane in leaf protoplasts, and lightly labeled several intracellular structures. Immunofluorescence microscopy with affinity purified CNGC-specific antisera indicated that AtCNGC5 and AtCNGC10 are present in the plasma membrane of protoplasts. Immunoelectron microscopy demonstrated that AtCNGC10 was associated with the plasma membrane of mesophyll, palisade parenchyma and epidermal cells of leaves, and the meristem, columella and cap cells of roots. AtCNCG10 was also observed in the endoplasmic reticulum and Golgi cisternae and vesicles of 50–150 nm in size. Patch clamp assays of an AtCNGC10-GFP fusion expressed in HEK293 cells measured significant cation currents. Conclusion AtCNGC5 and AtCNGC10 are plasma membrane proteins. We postulate that AtCNGC10 traffics from the endoplasmic reticulum via the Golgi apparatus and associated vesicles to the plasma membrane. The presence of the cation channel, AtCNGC10, in root cap meristem cells, cell plate, and gravity-sensing columella cells, combined with the previously reported

Estudos histológicos preliminares da microenxertia de plantas micropropagadas de macieira Preliminaries histological studies from the micrografting of tissue cultured apple

Directory of Open Access Journals (Sweden)

Monita Fiori de Abreu

2003-04-01

Full Text Available A fruticultura moderna necessita implantar tecnologias que possibilitem a produção de frutos de alta qualidade, com custos cada vez menores. A micropropagação associada à microenxertia possibilita altas taxas de multiplicação de plantas com alta qualidade fitossanitária, além de possibilitar a realização de estudos sobre compatibilidade de enxertia em diferentes clones. O presente trabalho tem como objetivo estudar o processo de soldadura entre genótipos de macieira (Malus domestica. Borkh multiplicadas in vitro após a microenxertia. Esta técnica foi realizada em fenda simples, sob condições assépticas. Os estudos histológicos foram realizados através de cortes longitudinais seriados de segmentos de 8 mm do ponto de enxertia. O processo de soldadura foi caracterizado pelo desenvolvimento de tecido meristemático, originando células parenquimáticas na interface do microenxerto, com a proliferação do tecido cambial da cultivar copa. Isso possibilita a ligação do sistema vascular da copa com o do porta-enxerto, resultando na sobrevivência do microenxerto.The modern fruitculture needs to introduce techniques that allow a less expensive production of high quality fruits. The micropropagation associate to micrografting provides high average of plant multiplication and disease free material. In addition it provides studies of grafting compatibilities. The present work aim to study the process of the micrografting union of tissue cultured apple (Malus domestica. Borkh. The scions were cleft-grafted on the rootstocks, under aseptic conditions. For histological studies specimens were trimmed down to 4mm above and below the graft union (longitudinal cuts. The graft union development resulted in the generation of meristem tissue, originating parenchymatous cells at the graft interface, and a cambial tissue proliferation from the scion. This procedure allows the vascular system connection between the scion and the rootstock

Biolistic-mediated transient gene expression in shoot apical meristems of the prickly-pear (Opuntia ficus-indica

Directory of Open Access Journals (Sweden)

Romulo Marino Llamoca-Zárate

1999-01-01

Full Text Available We have demonstrated the transient expression of the GUS gene in cells of the meristematic apical dome of Opuntia ficus-indica. DNA delivery into the cells was achieved using a biolistic PDS-1000He instrument from Bio-Rad Laboratories. The transforming DNA was coated in tungsten particles with diameter of 1.3 m m and the distance between the flying disk and the target tissue was 7.5cm and the shooting pressure was adjusted to 1200 psi. This is the first demonstration that the biolistic transformation system can be used to express a transgene in a member of the Cactaceae.Nós demonstramos a expressão transiente do gene GUS nas células do meristema apical de Opuntia ficus-indica. A introdução do DNA nas células foi realizada através de um sistema de biolística PDS-1000He da Bio-Rad Laboratories. Para transformação, partículas de tungstenio com diâmetro de 1,3 µm foram cobertas com DNA e a distância entre o disco das partículas e o tecido alvo foi de 7,5cm, a pressão de tiro foi 1200 psi. Esta é a primeira demonstração que o sistema de biolística de transformação pode ser usado para a expressão de transgenes nas cactáceas.

The Growth and Cultivation of Meristem From Shallot (Allium ascalonicum L. cv. Katumi by In Vitro

Directory of Open Access Journals (Sweden)

Lamro Purba

2017-12-01

Full Text Available This study aimed for knowing and obtaining the best concentration of kinetin and NAA interaction effects in influencing the shoot induction, knowing how the plant growth regulators in induction mediastill affect the shoot additionin the MS0media and also knowing the largest number of roots in rooting media for shallot by in vitro. The experiment was conducted at Laboratory of Tissue Culture Seed Technology, Faculty of Agriculture, Padjadjaran University, during January 2011 until May 2011. This experiment divided in 3 stages, namely shoot induction stage, shoot subculture to MS0 media stage and shoot subculture to rooting media stage. Experimental method used in the shoot induction stage was factorial Completely Randomized Design with three replications. The first factor was the kinetin with four levels,0, 1, 2, and 3 mg L-1. The second factor was the NAA with three levels, as 0, 0.01, and 0.1 mg L-1. Basic media used for each treatment was MS. The experiment result showed there was an interaction between kinetin and NAA on shoot induction stagewith the plantlet height, leaf number, and shoot addition. The best result for leaf number was gained from interaction with 2 mg L-1 kinetin without NAA,while the treatment of 2 mg L-1 kinetin with 0.01 mg L-1 NAA gave a better interaction for theshoot addition variable.

Converging Light, Energy and Hormonal Signaling Control Meristem Activity, Leaf Initiation, and Growth1[CC-BY

Science.gov (United States)

Mohammed, Binish; Bilooei, Sara Farahi; Grove, Elliot; Railo, Saana; Palme, Klaus

2018-01-01

The development of leaf primordia is subject to light control of meristematic activity. Light regulates the expression of thousands of genes with roles in cell proliferation, organ development, and differentiation of photosynthetic cells. Previous work has highlighted roles for hormone homeostasis and the energy-dependent Target of Rapamycin (TOR) kinase in meristematic activity, yet a picture of how these two regulatory mechanisms depend on light perception and interact with each other has yet to emerge. Their relevance beyond leaf initiation also is unclear. Here, we report the discovery that the dark-arrested meristematic region of Arabidopsis (Arabidopsis thaliana) experiences a local energy deprivation state and confirm previous findings that the PIN1 auxin transporter is diffusely localized in the dark. Light triggers a rapid removal of the starvation state and the establishment of PIN1 polar membrane localization consistent with auxin export, both preceding the induction of cell cycle- and cytoplasmic growth-associated genes. We demonstrate that shoot meristematic activity can occur in the dark through the manipulation of auxin and cytokinin activity as well as through the activation of energy signaling, both targets of photomorphogenesis action, but the organ developmental outcomes differ: while TOR-dependent energy signals alone stimulate cell proliferation, the development of a normal leaf lamina requires photomorphogenesis-like hormonal responses. We further show that energy signaling adjusts the extent of cell cycle activity and growth of young leaves non-cellautonomously to available photosynthates and leads to organs constituted of a greater number of cells developing under higher irradiance. This makes energy signaling perhaps the most important biomass growth determinant under natural, unstressed conditions. PMID:29284741

The early inflorescence of Arabidopsis thaliana demonstrates positional effects in floral organ growth and meristem patterning.

Science.gov (United States)

Plackett, Andrew R G; Powers, Stephen J; Phillips, Andy L; Wilson, Zoe A; Hedden, Peter; Thomas, Stephen G

2018-06-01

Linear modelling approaches detected significant gradients in organ growth and patterning across early flowers of the Arabidopsis inflorescence and uncovered evidence of new roles for gibberellin in floral development. Most flowering plants, including the genetic model Arabidopsis thaliana, produce multiple flowers in sequence from a reproductive shoot apex to form a flower spike (inflorescence). The development of individual flowers on an Arabidopsis inflorescence has typically been considered as highly stereotypical and uniform, but this assumption is contradicted by the existence of mutants with phenotypes visible in early flowers only. This phenomenon is demonstrated by mutants partially impaired in the biosynthesis of the phytohormone gibberellin (GA), in which floral organ growth is retarded in the first flowers to be produced but has recovered spontaneously by the 10th flower. We presently lack systematic data from multiple flowers across the Arabidopsis inflorescence to explain such changes. Using mutants of the GA 20-OXIDASE (GA20ox) GA biosynthesis gene family to manipulate endogenous GA levels, we investigated the dynamics of changing floral organ growth across the early Arabidopsis inflorescence (flowers 1-10). Modelling of floral organ lengths identified a significant, GA-independent gradient of increasing stamen length relative to the pistil in the wild-type inflorescence that was separable from other, GA-dependent effects. It was also found that the first flowers exhibited unstable organ patterning in contrast to later flowers and that this instability was prolonged by exogenous GA treatment. These findings indicate that the development of individual flowers is influenced by hitherto unknown factors acting across the inflorescence and also suggest novel functions for GA in floral patterning.

THE MECHANISM OF 5-AMINOURACIL-INDUCED SYNCHRONY OF CELL DIVISION IN VI CIA FABA ROOT MERISTEMS

Science.gov (United States)

Prensky, Wolf; Smith, Harold H.

1965-01-01

Cessation of mitosis was brought about in Vicia faba roots incubated for 24 hours in the thymine analogue, 5-aminouracil. Recovery of mitotic activity began 8 hours after removal from 5-aminouracil and reached a peak at 15 hours. If colchicine was added 4 hours before the peak of mitoses, up to 80 per cent of all cells accumulated in mitotic division stages. By use of single and double labeling techniques, it was shown that synchrony of cell divisions resulted from depression in the rate of DNA synthesis by 5-aminouracil, which brought about an accumulation of cells in the S phase of the cell cycle. Treatment with 5-aminouracil may have also caused a delay in the rate of exit of cells from the G2 period. It appeared to have no effect on the duration of the G1 period. When roots were removed from 5-aminouracil, DNA synthesis resumed in all cells in the S phase. Although thymidine antagonized the effects of 5-aminouracil, an exogenous supply of it was not necessary for the resumption of DNA synthesis, as shown by incorporation studies with tritiated deoxycytidine. PMID:19866644

Esau's Plant anatomy: meristems, cells, and tissues of the plant body : their structure, function, and development

National Research Council Canada - National Science Library

Evert, Ray Franklin; Esau, Katherine; Eichhorn, Susan E

2006-01-01

... . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . The Body of a Vascular Plant Is Composed of Three Tissue Systems . . . . . . . . . . . . . . . . . . . . . Structurally Stem, Leaf, and Root Differ Primarily...

Esau's Plant anatomy: meristems, cells, and tissues of the plant body : their structure, function, and development

National Research Council Canada - National Science Library

Evert, Ray Franklin; Esau, Katherine; Eichhorn, Susan E

2006-01-01

... . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . xix Chapter 1 Structure and Development of the Plant Body- An Overview . . . . . . . . . . . . . . . . . . . . . . . . 1 Internal Organization of the Plant Body...

Cytokinin signaling during root development.

Science.gov (United States)

Bishopp, Anthony; Help, Hanna; Helariutta, Ykä

2009-01-01

The cytokinin class of phytohormones regulates division and differentiation of plant cells. They are perceived and signaled by a phosphorelay mechanism similar to those observed in prokaryotes. Research into the components of phosphorelay had previously been marred by genetic redundancy. However, recent studies have addressed this with the creation of high-order mutants. In addition, several new elements regulating cytokinin signaling have been identified. This has uncovered many roles in diverse developmental and physiological processes. In this review, we look at these processes specifically in the context of root development. We focus on the formation and maintenance of the root apical meristem, primary and secondary vascular development, lateral root emergence and development, and root nodulation. We believe that the root is an ideal organ with which to investigate cytokinin signaling in a wider context.

Histology of somatic embryos of eurycoma longifolia (simaroubaceae): relevance in agrobacterium rhizogenes-mediated transformation

International Nuclear Information System (INIS)

Balakrishnan, B.; Rabiah, S.S.; Keng, C.L.

2014-01-01

Histological analysis conducted on somatic embryos of Eurycoma longifolia shows the developmental structures that are remarkably similar to seeds found in the wild. The primary components of a growing somatic embryo are its shoot and root apical meristems indicated by dense layers of rapidly growing cells. The increased understanding of In vitro culture systems and anatomical changes provide information into cellular processes that govern genetic transformation of E. longifolia with Agrobacterium rhizogenes. The presence of meristematic regions on cultured somatic embryos suggests that they are suitable for genetic transformation as genetic elements could be transported to these regions where growth and differentiation are centered. This allows the successful integration and expression of transferred DNA in the host organism, leading the way for an efficient A. rhizogenes-mediated transformation protocol. (author)

Influence of chronic internal and acute external irradiations on the critical tissues of plants

International Nuclear Information System (INIS)

Kostyuk, O.P.; Ryasnenko, N.A.; Grodzins'kij, D.M.

1998-01-01

Peculiarities of chronic internal and acute external irradiations of the critical (as for irradiation influence) plants part, meristem, are studied. In particular, the investigation has aimed to evaluate the level of doses, accumulated by plant tissues, of the chronic internal irradiation from radiocaesium incorporated by them, and to compare its possible effect to one caused by the acute external irradiation. It is shown that the effects of both chronic and acute irradiations have similar features, and it is assumed that they have the very same mechanisms. We think that such a parameter of the plant ability to accumulate radiocaesium as the ratio of its content in a root tip and in the whole root system is a very sensible and useful criterion to estimate the irradiation influence on plants

Control of the first flowering in forest trees

Energy Technology Data Exchange (ETDEWEB)

Chalupka, W. [Inst. od Dendrology, Kornik (Poland); Cecich, R.A. [U.S.D.A.-Forest Service, Columbia, MO (United States). North Central Forest Experiment Station

1997-04-01

Precocious flowering provides opportunities to shorten a breeding cycle. A tree may flower for the first time when sufficient crown development has occurred and there are enough meristems to support both vegetative and reproductive buds. Precocious flowering can be promoted through the use of cultural techniques, such as photoperiod, accelerated growth, gibberellins and water stress. The length of the juvenile phase is dependent on genetic and environmental variables that affect achievement of a minimum size, and is positively correlated with the height of the plants within a family. Selection pressure can be applied successfully to the precocious flowering character, and crossed or inbred lines of precocious flowering progeny can be developed. Various levels and amounts of genetic control have been implicated in the control of precocious flowering. 90 refs, 1 tab

Enzymatic regulation of photosynthetic and light-independent carbon fixation in Laminaria setchellii (Phaeophyta, Ulva lactuca (Chlorophyta and Iridaea cordata (Rhodophyta Regulación enzimática de la fotosíntesis y la fijación de carbono en obscuridad por Laminaria setchellii (Phaeophyta, Ulva lactuca (Chlorophyta e Iridaea cordata (Rhodophyta

Directory of Open Access Journals (Sweden)

ALEJANDRO CABELLO-PASINI

2001-06-01

Full Text Available Carbon is acquired through photosynthetic and non-photosynthetic processes in marine algae. However, little is known about the biochemical regulation of these metabolic pathways along the thallus of seaweeds. Consequently, the objective of this study was to assess the distribution of in vivo carboxylation pathways and to relate them to the in vitro activity of ribulose 1,5-bisphosphate carboxylase/oxygenase (RUBISCO, phosphoenolpyruvate carboxykinase (PEPCK, and phosphoenolpyruvate carboxylase (PEPC in the Phaeophyte Laminaria setchellii, the Chlorophyte Ulva lactuca, and the Rhodophyte Iridaea cordata. Chlorophyll-a levels did not vary in U. lactuca and I. cordata. However, pigment levels were significantly lower in the meristematic region of L. setchellii probably as a result of a lack of differentiation of the chloroplasts in this region. Similarly, net photosynthesis did not vary in the thallus of U. lactuca and I. cordata, while it increased from the stipe and meristem towards the lamina of L. setchellii. In contrast to photosynthesis, light-independent carbon fixation rates were significantly greater in the meristematic region of L. setchellii suggesting a compensating mechanism for carbon incorporation in photosynthetically limited tissue. The activity of RUBISCO and PEPCK followed a pattern similar to that of in vivo carboxylation processes indicating that in vivo carbon assimilation is regulated by the activity of the carboxylating enzymes throughout the thallus of L. setchelliiLa incorporación de carbono en algas marinas se lleva a cabo mediante procesos fotosintéticos y no-fotosintéticos. Sin embargo, poco se sabe sobre la regulación bioquímica de estas rutas metabólicas en el tejido de algas marinas. En consecuencia, el objetivo de este estudio fue el de evaluar la distribución de la carboxilación in vivo y relacionarlas a la actividad in vitro de ribulosa 1,5-bisfosfato carboxilasa/oxigenasa (RUBISCO, fosfoenolpiruvato

MAIL1 is essential for development of the primary root but not of anchor roots.

Science.gov (United States)

Ühlken, Christine; Hoth, Stefan; Weingartner, Magdalena

2014-01-01

MAIN-LIKE1 (MAIL1) is a ubiquitously expressed nuclear protein, which has a crucial function during root development. We have recently described loss of function mutants for MAIL1, in which the organization and function of the primary root meristem is lost soon after germination. Moreover cell differentiation is impaired resulting in primary root growth arrest soon after emergence. Here we show that mail1 mutants form several anchor roots from the hypocotyl to root junction. These anchor roots show similar defects in the organization of the stem cell niche as the primary root. In contrast, differentiation processes are not impaired and thus anchor roots seem to be able to compensate for the loss of primary root function. Our data show that MAIL1 is essential for specification of cell fate in the primary root but not in anchor roots.

Tissue culture of adult larch as a tool for breeding purposes

Energy Technology Data Exchange (ETDEWEB)

Ewald, D.; Kretzschmar, U. [Federal Research Centre of Forestry and Forest Products, Waldsieversdorf (Germany). Inst. for Forest Tree Biology

1995-12-31

Aimed at the identical reproduction of genotypes which are considered superior different methods were tested to establish and to propagate tissue cultures from old larch trees (L. decidua, L. kaempferi, L. sukaczewii, L. gmelinii, L. eurolepis). Serial subcultures without phytohormones (shoot tip propagation) led to the establishment of clone lines. After ten subcultures propagation velocity, shoot morphology and rooting behavior were similar to juvenile plant material. Serial subcultures which included a cytokinin induction led to the formation of adventitious shoot clusters (adventitious bud propagation). Adventitious shoots derived from male flowers of one L. kaempferi clone could be propagated via shoot tip propagation. Micrografting of meristems in vitro resulted in a regained rooting capacity of green cuttings from micrografts. Combining these in vitro techniques offers now the possibility to propagate selected mature larch trees for different breeding purposes. 23 refs, 5 figs, 2 tabs

The Arabidopsis thaliana NAC transcription factor family: structure-function relationships and determinants of ANAC019 stress signalling

DEFF Research Database (Denmark)

Jensen, Michael K; Kjaersgaard, Trine; Nielsen, Michael M.

2010-01-01

-termini. Nine of the ten NAC domains analysed bind a previously identified conserved DNA target sequence with a CGT[GA] core, although with different affinities. Likewise, all but one of the NAC proteins analysed is dependent on the C-terminal region for transactivational activity. In silico analyses show......TFs (transcription factors) are modular proteins minimally containing a DBD (DNA-binding domain) and a TRD (transcription regulatory domain). NAC [for NAM (no apical meristem), ATAF, CUC (cup-shaped cotyledon)] proteins comprise one of the largest plant TF families. They are key regulators...... of stress perception and developmental programmes, and most share an N-terminal NAC domain. On the basis of analyses of gene expression data and the phylogeny of Arabidopsis thaliana NAC TFs we systematically decipher structural and functional specificities of the conserved NAC domains and the divergent C...

Phytotoxic and genotoxic effects of ZnO nanoparticles on garlic (Allium sativum L.): a morphological study.

Science.gov (United States)

Shaymurat, Talgar; Gu, Jianxiu; Xu, Changshan; Yang, Zhikun; Zhao, Qing; Liu, Yuxue; Liu, Yichun

2012-05-01

The effects of zinc oxide nanoparticles (ZnO NPs) on the root growth, root apical meristem mitosis and mitotic aberrations of garlic (Allium sativum L.) were investigated. ZnO NPs caused a concentration-dependent inhibition of root length. When treated with 50 mg/L ZnO NPs for 24 h, the root growth of garlic was completely blocked. The 50% inhibitory concentration (IC(50)) was estimated to be 15 mg/L. The mitosis index was also decreased in a concentration- and time-dependent manner. ZnO NPs also induced several kinds of mitotic aberrations, mainly consisted of chromosome stickiness, bridges, breakages and laggings. The total percentage of abnormal cells increased with the increase of ZnO NPs concentration and the prolongation of treatment time. The investigation provided new information for the possible genotoxic effects of ZnO NPs on plants.

The stability of induced compact mutant clones of Bramley's Seedling apple

International Nuclear Information System (INIS)

Lacey, C.N.D.

1982-01-01

Twelve selected, compact, clones of Bramley's Seedling induced by gamma radiation treatment were checked for stability. Representative trees were used as vegetative parents for large scale multiplication, and further buds were treated with gamma radiation to disrupt the structure of their meristems. The results indicate that seven of the clones are as stable as the original cultivar, and therefore probably homohistont, containing only cells with compact mutant genotype. The other five clones proved to be unstable and gave rise to a large proportion of apparently normal trees. It is hypothesized that in these clones the L 1 (epidermis) consists of normal unchanged tissue, while the bulk of the plant tissue layers are of mutant cells, i.e. that they are periclinal chimaeras with the genotypes of the different cell layers coded for different growth forms. (orig.)

[Assessment of cyto- and genotoxicity of natural waters in the vicinity of radioactive waste storage facility using Allium-test].

Science.gov (United States)

Udalova, A A; Geras'kin, S A; Dikarev, V G; Dikareva, N S

2014-01-01

Efficacy of bioassays of "aberrant cells frequency" and "proliferative activity" in root meristem of Allium cepa L. is studied in the present work for a cyto- and genotoxicity assessment of natural waters contaminated with 90Sr and heavy metals in the vicinity of the radioactive waste storage facility in Obninsk, Kaluga region. The Allium-test is shown to be applicable for the diagnostics of environmental media at their combined pollution with chemical and radioactive substances. The analysis of aberration spectrum shows an important role of chemical toxicants in the mutagenic potential of waters collected in the vicinity of the radioactive waste storage facility. Biological effects are not always possible to explain from the knowledge on water contamination levels, which shows limitations of physical-chemical monitoring in providing the adequate risk assessment for human and biota from multicomponent environmental impacts.

Effects of potentially acidic air pollutants on the intracellular distribution and transport of plant growth regulators in mesophyll cells of leaves. Consequences on stress- and developmental physiology

Energy Technology Data Exchange (ETDEWEB)

Kremer, H.; Pfanz, H.; Hartung, W.

1987-07-11

The influence of SO/sub 2/ on the intracellular distribution of abscisic acid (ABA) and indole-acetic acid (IAA) in mesophyll cells of Picea abies, Tsuga americana and Hordeum vulgare was investigated. The compartmentation of ABA and IAA depends on intracellular pH-gradients. The hydrophilic anions ABA and IAA are accumulated in the alkaline cell compartments cytosol and chloroplasts, which act as anion traps for weak acids. Uptake of sulfur dioxide into leaves leads to an acidification of alkaline cell compartments, thus decreasing intracellular pH-gradients. Consequently this results in an increased release of plant growth regulators from the cell interior into the apoplast. Therefore the target cells of plant hormones i.e. meristems and stomates are exposed to altered hormone concentrations. Obviously this influences the regulation of cellular metabolism plant development and growth.

Inheritance and gene expression of a root-growth inhibiting mutant in rice (Oryza sativa L.)

International Nuclear Information System (INIS)

Kitano, H.; Futsuhara, Y.

1990-01-01

Full text: A root-growth inhibiting mutant was induced in the dwarf mutant line, 'Fukei 71', through ethylene-imine. The mutant is characterised by the excessive inhibition of both seminal and crown roots elongation just after germination, although its shoots grow nearly normal. To study the genetics, the mutant was crossed with its original line 'Fukei 71' and some other normal cultivars. Results show that the root-growth inhibition is controlled by a recessive gene (rt), independent of the dwarf gene, d-50(t) locus in Fukei 71. For elucidating the gene action on root morphogenesis, histological and cytological experiments were carried out using a longitudinal and transverse thin section of seminal and/or crown root tips. Observations suggest that the rt gene affects the normal formation of the epidermal system which is differentiated from the protoderm of the root apical meristem. (author)

The Effect of Laser Treatment as a Weed Control Method

DEFF Research Database (Denmark)

Mathiassen, Solvejg K; Bak, Thomas; Christensen, Svend

2006-01-01

at the cotyledon stage. Experiments were carried out under controlled conditions, using pot-grown weeds. Two lasers and two spot sizes were tested and different energy doses were applied by varying the exposure time. The biological efficacy was examined on three different weed species: Stellaria media (common...... was related to wavelength, exposure time, spot size and laser power. The efficacy also varied between the weed species. The results indicate that the efficacy of laser treatments can be improved by a more precise pointing of the laser beam towards the apical meristems and optimisation of the energy density...... (exposure time and spot size of the laser beam). The experiment also showed a significant difference between two wavelengths. In order to improve the performance and to validate the efficacy on a broader spectrum of weed species, further research and development is needed....

Radiation doses and possible radiation effects of low-level, chronic radiation in vegetation

International Nuclear Information System (INIS)

Rhoads, W.A.; Franks, L.A.

1975-01-01

Measurements were made of radiation doses in soil and vegetation in Pu-contaminated areas at the Nevada Test Site with the objective of investigating low-level, low-energy gamma radiation (with some beta radiation) effects at the cytological or morphological level in native shrubs. In this preliminary investigation, the exposure doses to shrubs at the approximate height of stem apical meristems were estimated from 35 to 140 R for a ten-year period. The gamma exposure dose estimated for the same period was 20.7 percent +- 6.4 percent of that recorded by the dosimeters used in several kinds of field instrument surveys. Hence, a survey instrument reading made at about 25 cm in the tops of shrubs should indicate about 1 / 5 the dosimeter-measured exposures. No cytology has yet been undertaken because of the drought since last winter. (auth)

“Lateral Control”

DEFF Research Database (Denmark)

Rasmussen, Hanne Nina; Veierskov, Bjarke; Hansen-Møller, Jens

2010-01-01

In a conifer tree, such as Nordmann fir, Abies nordmanniana Spach, the leader bud and its immediate surroundings play a decisive role in crown architecture. As subapical branch buds are segregated from the leader meristem, resource allocation between ortho- and plagiotropic growth is determined....... The relationship between treetop buds in young trees was studied in the natural state and after surgical removal in early July of either the leader bud (decapitation) or the subapical whorl branch buds (destipitation). The two bud types showed consistent cytokinin profile differences but similar seasonal dynamics...... in cytokinins and auxin (IAA). After bud excision, ZRP increased dramatically in the subapical stem within 1 h, followed by ZR within 1 week. Supernormal levels of ZR were maintained through autumn and persisted in spring in the destipitated trees, but had returned to normal in the decapitated trees...

Comparative Cytogenetic Study on the Toxicity of Magnetite and Zinc Ferrite Nanoparticles in Sunflower Root Cells

Science.gov (United States)

Foca-nici, Ecaterina; Capraru, Gabriela; Creanga, Dorina

2010-12-01

In this experimental study the authors present their results regarding the cellular division rate and the percentage of chromosomal aberrations in the root meristematic cells of Helianthus annuus cultivated in the presence of different volume fractions of magnetic nanoparticle suspensions, ranging between 20 and 100 microl/l. The aqueous magnetic colloids were prepared from chemically co-precipitated ferrites coated in sodium oleate. Tissue samples from the root meristeme of 2-3 day old germinated seeds were taken to prepare microscope slides following Squash method combined with Fuelgen techniques. Microscope investigation (cytogenetic tests) has resulted in the evaluation of mitotic index and chromosomal aberration index that appeared diminished and respectively increased following the addition of magnetic nanoparticles in the culture medium of the young seedlings. Zinc ferrite toxic influence appeared to be higher than that of magnetite, according to both cytogenetic parameters.

Tissue culture of adult larch as a tool for breeding purposes

Energy Technology Data Exchange (ETDEWEB)

Ewald, D; Kretzschmar, U [Federal Research Centre of Forestry and Forest Products, Waldsieversdorf (Germany). Inst. for Forest Tree Biology

1996-12-31

Aimed at the identical reproduction of genotypes which are considered superior different methods were tested to establish and to propagate tissue cultures from old larch trees (L. decidua, L. kaempferi, L. sukaczewii, L. gmelinii, L. eurolepis). Serial subcultures without phytohormones (shoot tip propagation) led to the establishment of clone lines. After ten subcultures propagation velocity, shoot morphology and rooting behavior were similar to juvenile plant material. Serial subcultures which included a cytokinin induction led to the formation of adventitious shoot clusters (adventitious bud propagation). Adventitious shoots derived from male flowers of one L. kaempferi clone could be propagated via shoot tip propagation. Micrografting of meristems in vitro resulted in a regained rooting capacity of green cuttings from micrografts. Combining these in vitro techniques offers now the possibility to propagate selected mature larch trees for different breeding purposes. 23 refs, 5 figs, 2 tabs

Variation of Growth and Disease Characters Between Clones of Potato (Solanum tuberosum L.)

DEFF Research Database (Denmark)

Nielsen, Steen Lykke; Bång, H; Kotkas, K

2007-01-01

The occurrence and magnitude of variation of selected characters in clones derived from meristem tips of four potato cultivars in field trials in three countries was assessed. Recorded were: the number of plants per plot; maturity of plants; skin and flesh colour; tuber deformity; time of emergence......; flowering; number of stems and tubers per plant; tuber size, yield and dry matter percentage; and the occurrence of common scab. Far more significant differences between clones than could be expected by chance were found for the last eight characters. Most of the significant differences for number of stems...... per plant, number of tubers, yield and tuber size distribution were found in six clones of three cultivars and were repeated at different locations and in different years. It is concluded that significant clone differences exist and are repeated at independent locations over the years...

Métodos para acelerar a germinação de sementes de Bacuri (Platonia insignis Mart. Methods to accelerate the germination of Bacuri seeds (Platonia insignis Mart.

Directory of Open Access Journals (Sweden)

FRANCISCO DAS CHAGAS OLIVEIRA

2002-04-01

Full Text Available Este trabalho teve o objetivo de avaliar métodos para acelerar a germinação de sementes de bacuri (Platonia insignis Mart., e foi conduzido no laboratório de Fisiologia Vegetal e na Câmara de Nebulização da Embrapa Meio-Norte, Teresina-PI. O delineamento utilizado foi o de blocos ao acaso, constituído por dez tratamentos e quatro repetições, sendo a unidade experimental constituída por dez sementes. Foram testados os seguintes tratamentos: testemunha (T1; remoção do tegumento da semente (T2; remoção do meristema fundamental cortical por meio de cortes em planos perpendiculares ao plano dorsal/ventral, nos dois lados da semente, sem atingir o meristema fundamental medular (T3; T3 mais a remoção do meristema fundamental cortical por meio de cortes em planos paralelos ao plano dorsal/ventral, na região dorsal, sem atingir o meristema fundamental medular (T4; T3 e T4 mantidos em água a 40ºC por vinte minutos (T5 e T6; T3 e T4 mantidos em etanol 80% por cinco minutos (T7 e T8; T3 e T4 mantidos em acetona 80% por cinco minutos (T9 e T10. As variáveis estudadas foram a percentagem de emergência da radícula aos 14; 21; 28 e 35 dias após a semeadura e o índice de velocidade de emergência da radícula (IVE, no 35º dia após a semeadura. As sementes submetidas aos tratamentos T2, T3, T4, T5 e T6 apresentaram 72,5%, 65,0%, 72,5%, 52,5% e 67,5% de emergência, respectivamente, aos 14 dias, sendo superiores (pThe objective of this study was to evaluate methods to accelerate the germination of bacuri seeds (Platonia insignis Mart.. The experiment was conducted in the laboratory of Plant Physiology and in the greenhouse of Embrapa Meio-Norte (Teresina-PI, in a randomized block design, constituted by ten treatments and four repetitions, being the experimental unit constituted by ten seeds. The following treatments were tested: control (T1; removal of the seed tegument (T2; removal of the fundamental meristem, through cuts in

N-MYC DOWN-REGULATED-LIKE Proteins Regulate Meristem Initiation by Modulating Auxin Transport and MAX2 Expression

OpenAIRE

Mudgil, Yashwanti; Ghawana, Sanjay; Jones, Alan M.

2013-01-01

Background N-MYC DOWN-REGULATED-LIKE (NDL) proteins interact with the G? subunit (AGB1) of the heterotrimeric G protein complex and play an important role in AGB1-dependent regulation of lateral root formation by affecting root auxin transport, auxin gradients and the steady-state levels of mRNA encoding the PIN-FORMED 2 and AUXIN 1 auxin transport facilitators. Auxin transport in aerial tissue follows different paths and utilizes different transporters than in roots; therefore, in the presen...

Genotoxicity test of Maytenus rigida and Aristolochia birostris in the radicular meristem of the onion, Allium cepa

Directory of Open Access Journals (Sweden)

Sandra S. Mendes

2011-09-01

Full Text Available Medicinal plants are an important source of treatment for many ailments, although little is known of the potential genotoxic effects of most species. In the present study, two species from diverse and medicinally important genera - Maytenus rigida Mart., Celastraceae, and Aristolochia birostris Ducht, Aristolochiaceae - were analyzed to identify potentially significant secondary metabolites and the possible effects of their aqueous and alcoholic extracts on cell division in the onion root stem (genotoxicity test. The phytochemical testing revealed the presence of a number of potentially important secondary compounds in both species, including phenols, flavonoids, triterpenoids, steroids, and saponins. In the genotoxicity tests, no chromosomal abnormalities of any kind were observed in either species. In the case of M. rigida, a significant increase in mitotic activity was observed at the highest concentration. No significant tendency was recorded in A. birostris, although a considerable increase in the prophase was observed at all concentrations of the alcoholic extract. The triterpenoid content of both species may be especially important from a medicinal viewpoint, although recent findings on the carcinogenic potential of Aristolochia extracts demands caution in the interpretation of the results, and the need for further research.

Genotoxicity test of Maytenus rigida and Aristolochia birostris in the radicular meristem of the onion, Allium cepa

Directory of Open Access Journals (Sweden)

Sandra S. Mendes

2012-02-01

Full Text Available Medicinal plants are an important source of treatment for many ailments, although little is known of the potential genotoxic effects of most species. In the present study, two species from diverse and medicinally important genera - Maytenus rigida Mart., Celastraceae, and Aristolochia birostris Ducht, Aristolochiaceae - were analyzed to identify potentially significant secondary metabolites and the possible effects of their aqueous and alcoholic extracts on cell division in the onion root stem (genotoxicity test. The phytochemical testing revealed the presence of a number of potentially important secondary compounds in both species, including phenols, flavonoids, triterpenoids, steroids, and saponins. In the genotoxicity tests, no chromosomal abnormalities of any kind were observed in either species. In the case of M. rigida, a significant increase in mitotic activity was observed at the highest concentration. No significant tendency was recorded in A. birostris, although a considerable increase in the prophase was observed at all concentrations of the alcoholic extract. The triterpenoid content of both species may be especially important from a medicinal viewpoint, although recent findings on the carcinogenic potential of Aristolochia extracts demands caution in the interpretation of the results, and the need for further research.

Genotoxicity assessment of water sampled from R-11 reservoir by means of allium test

Energy Technology Data Exchange (ETDEWEB)

Bukatich, E.; Pryakhin, E. [Urals Research Center for Radiation Medicine (Russian Federation); Geraskin, S. [Russian Institute of Agricultural Radiology and Agroecology (Russian Federation)

2014-07-01

slides of root tips meristem were dyed with aceto-orcein. Approximately 150 ana-telophases were scored for each root. 20-40 roots were analyzed for each water sample. In total 3000 - 6000 ana-telophases for each water sample were analyzed. Chromosome aberrations in ana-telophases (chromatid and chromosomal bridges and fragments), mitotic abnormalities (multipolar mitosis and laggards) were scored. The data analysis was arranged using R statistics. Aberration frequency in water samples from the natural control reservoir (0.46 ± 0.12%) exceeded insignificantly the frequency of aberrations in distilled (0.15 ± 0.08%) and bottled waters (0.33 ± 0.08%). Average frequency of aberrant cells in root meristem of onion germinated in water samples from R-11 reservoir (1.36 ± 0.24%) was about 3 times higher compared to control ones. Mitotic activity in root meristem was slightly inhibited in bulbs germinated in R-11 sample, but this effect was statistically insignificant. There was no difference in types of aberrations among all water samples but only in the frequency of abnormalities. So genotoxicity assessment of water sampled from R-11 reservoir by means of allium test shows the presence of genotoxic factor in water from the reservoir. Document available in abstract form only. (authors)

Accelerated Stem Growth Rates and Improved Fiber Properties of Loblolly Pine: Functional Analysis Of CyclinD from Pinus taeda

Energy Technology Data Exchange (ETDEWEB)

Dr. John Cairney, School of Biology and Institute of Paper Science and Technology @ Georgia Tech, Georgia Institute of Technology; Dr. Gary Peter, University of Florida; Dr. Ulrika Egertsdotter, Dept. of Forestry, Virgina Tech; Dr. Armin Wagner, New Zealand Forest Research Institute Ltd. (Scion Research.)

2005-11-30

A sustained supply of low-cost, high quality raw materials is essential for the future success of the U.S. forest products industry. To maximize stem (trunk) growth, a fundamental understanding of the molecular mechanisms that regulate cell divisions within the cambial meristem is essential. We hypothesize that auxin levels within the cambial meristem regulate cyclin gene expression and this in turn controls cell cycle progression as occurs in all eukaryotic cells. Work with model plant species has shown that ectopic overexpression of cyclins promotes cell division thereby increasing root growth > five times. We intended to test whether ectopic overexpression of cambial cyclins in the cambial zone of loblolly pine also promotes cell division rates that enhance stem growth rates. Results generated in model annual angiosperm systems cannot be reliably extrapolated to perennial gymnosperms, thus while the generation and development of transgenic pine is time consuming, this is the necessary approach for meaningful data. We succeeded in isolating a cyclin D gene and Clustal analysis to the Arabidopsis cyclin D gene family indicates that it is more closely related to cyclin D2 than D1 or D3 Using this gene as a probe we observed a small stimulation of cyclin D expression in somatic embryo culture upon addition of auxin. We hypothesized that trees with more cells in the vascular cambial and expansion zones will have higher cyclin mRNA levels. We demonstrated that in trees under compressive stress where the rates of cambial divisions are increased on the underside of the stem relative to the top or opposite side, there was a 20 fold increase in the level of PtcyclinD1 mRNA on the compressed side of the stem relative to the opposite. This suggests that higher secondary growth rates correlate with PtcyclinD1 expression. We showed that larger diameter trees show more growth during each year and that the increased growth in loblolly pine trees correlates with more cell

Development of new varieties of chrysanthemum by mutagenesis in vitro

International Nuclear Information System (INIS)

Ramirez, G.Z.; Hernandez, M.A.

2001-01-01

Full text: At present, the industry of flower cultivation in Mexico has been demanding new varieties produced locally. There are 6,000 hectares dedicated to the cultivation of flowers for domestic use, however the export is very low. The main production area is located in Villa Guerrero, a small town near Mexico City, where 80% of the total national production is grown. In addition, approximately 10 hectares of greenhouses are dedicated to the production of flowers for export, mainly in the Peninsula de Baja California and the Altiplano Central (Central Plateau). Unfortunately, the production of flowers in Mexico has been affected by two factors: the first, stock plants must be imported from Holland, France and the United States; and the second, there are some government restrictions on their import. Due to these factors, producers are behind in recent innovations related to new varieties. An alternative to solve this problem would be meristem in vitro culture. Plantlets from two varieties 'Polaris Yellow' pompom type and 'Dramatic' margarita type, were obtained through the meristems tip culture in the MS culture medium, to which kinetin 1.0 mg/l and NAA 0.05 mg/l were added. In preliminary studies, the plant material was irradiated with doses between 10 to 60 Gy and it was possible to determine that doses higher than 35 Gy were lethal for both varieties. In this experiment, plantlets were irradiated with seven doses (7.5, 10, 15, 17.5, 20, 22.5 Gy) of 60 Co gamma rays. They were then subcultured using three types of explants: bud, leaf and internode. The best variety for production of direct organogenesis was Polaris Yellow in a range of doses between 7.5 and 15 Gy, the buds being the best explant, while the internordes and leaves were not so suitable. In contrary, the leaf was considered to be the best explant for the induction of indirect organogenesis in the variety Dramatic, in a range of doses between 10 and 20 Gy. It was possible to obtain some mutants for

Study of genes induced by ionizing radiations at Arabidopsis thaliana: identification and molecular characterization of the ATGR1 gene, a new gene encoding a protein involved in plant cell division

International Nuclear Information System (INIS)

Deveaux, Yves

1999-01-01

DNA damage, that can be experimentally introduced by ionizing radiation (IR), induces complex signal transduction pathways leading to cell recovery or, alternatively to programmed cell death if damages are too severe. To identify the inducible components of the response to genotoxic stress in plants, we have screened by Differential Display for mRNAs that rapidly and strongly accumulate after IR treatment in A. thaliana cells. We have characterized ATGR1, a new single copy Arabidopsis gene encoding a PEST-box protein of unknown function. In unstressed plant organs the ATGR1 mRNA is hardly detectable, whereas the protein is present in extracts prepared from roots, shoot meristems and inflorescences, that all contain large amounts of actively dividing cells. This pattern is confirmed by immuno localisation on tissue sections that shows constitutive ATGR1 protein expression covering the root elongation zone, the shoot meristem, leaf primordial and the ovules of developing flowers. Histochemical analysis of transgenic plants expressing the GUS reporter gene under the control of the ATGR1 promoter, demonstrate that the developmental and tissue-specific profile of ATGR1 protein expression is conferred by the gene promoter. The massive, transient and dose-dependent accumulation of ATGR1 transcripts after IR treatment observed in all plant organs does not lead to significant changes in ATGR1 protein pattern. Stable ATGR1 protein overexpression, as exemplified by transgenic A. thaliana plants that contain a 35S promoter-ATGR1 gene fusion, does not induce notable changes of the overall ATGR1 protein level, but leads to male and female sterility. The cause of sterility is a lack of correct chromosome assembly and distribution at the stage metaphase II of meiosis. Taken together our results show that i) ATGR1 gene expression is associated to cell division during plant development ii) the ATGR1 protein level is regulated at the transcriptional and post-transcriptional level iii

On the language and physiology of dormancy and quiescence in plants.

Science.gov (United States)

Considine, Michael J; Considine, John A

2016-05-01

The language of dormancy is rich and poetic, as researchers spanning disciplines and decades have attempted to understand the spell that entranced 'Sleeping Beauty', and how she was gently awoken. The misleading use of 'dormancy', applied to annual axillary buds, for example, has confounded progress. Language is increasingly important as genetic and genomic approaches become more accessible to species of agricultural and ecological importance. Here we examine how terminology has been applied to different eco-physiological states in plants, and with pertinent reference to quiescent states described in other domains of life, in order to place plant quiescence and dormancy in a more complete context than previously described. The physiological consensus defines latency or quiescence as opportunistic avoidance states, where growth resumes in favourable conditions. In contrast, the dormant state in higher plants is entrained in the life history of the organism. Competence to resume growth requires quantitative and specific conditioning. This definition applies only to the embryo of seeds and specialized meristems in higher plants; however, mechanistic control of dormancy extends to mobile signals from peripheral tissues and organs, such as the endosperm of seed or subtending leaf of buds. The distinction between dormancy, quiescence, and stress-hardiness remains poorly delineated, most particularly in buds of winter perennials, which comprise multiple meristems of differing organogenic states. Studies in seeds have shown that dormancy is not a monogenic trait, and limited study has thus far failed to canalize dormancy as seen in seeds and buds. We argue that a common language, based on physiology, is central to enable further dissection of the quiescent and dormant states in plants. We direct the topic largely to woody species showing a single cycle of growth and reproduction per year, as these bear the majority of global timber, fruit, and nut production, as well being

Non-linearity of dose-effect relationship at low level exposure on the example of cytogenetic effects in plant cells

International Nuclear Information System (INIS)

Oudalova, A.A.; Geras'kin, S.A.; Dikarev, V.G.; Dikareva, N.S.; Chernonog, E.V.

2007-01-01

Complete text of publication follows. There has been an increasing concern in the current scientific society and among the public about the need to protect the environment in order to maintain the ecosystem sustainability and future well-being of man. The linear non-threshold (LNT) hypothesis as the most officially acknowledged concept of biological effect of radiation fails to explain many facts on effects at low level exposures (LLE) accumulated lately. Available information on the dose-effect relationship at low doses is scarce and incomplete for non-human species despite the fact that, under conditions of increased radiation exposure, some biota species occur at a risk of higher impact than humans because of differences in ecological niches occupied. Dose-effect relationships for cytogenetic damage in the range of LLE are studied in a series os experiments with plant (Hordeum vulgare L.) meristem cells. Dose-effect dependences obtained show an obvious non-linear behavior in the LLE region. A piecewise linear model (PLM) for dose-cytogenetic effect relationship that considers an existence of dose-independent part at LLE ('plateau') is developed and specified on the data obtained. An advantage of the PLM over linear model in approximating the frequency of cytogenetic disturbances is demonstrated. From an empirical probability distribution analysis, it is shown that the increase in cytogenetic damage level is tightly connected with changes in a process of absorbed energy distribution between target volumes in terms of fraction of cells experienced a radiation hit event. An appropriateness of the LNT hypothesis to the description of cytogenetic disturbances yield in plant meristem cells in the LLE region is discussed. The results support a conclusion about indirect mechanism of mutagenesis induced by low doses. New data obtained concern a perception of fundamental mechanisms governing cell response to LLE. These findings are of general biological interest, since

Fase gametofítica del helecho Microgramma nitida (Polypodiaceae

Directory of Open Access Journals (Sweden)

Ma. del Rosario Ramírez

1998-09-01

Full Text Available Se describe la fase gametofítica del helecho Microgramma nitid con esporas de Veracruz, México (siembra promedio 40 esporas/ cm². La morfogénesis se caracteriza por: germinación tipo Vittaria, un filamento inicial de seis células protálicas; gametofitos jóvenes espatulados que se transforman en gametofitos adultos cordiformes-alargados, con márgenes ondulados y tricomas unicelulares-capitados en los margenes y en las superficies; aparición de una célula meristemática obcónica apical, que es reemplazada rápidamente por un meristemo pluricelular. Los anteridios y arquegonios son del tipo usual de las Polypodiaceae s.str. El desarrollo protálico es del tipo Drynaria. Ocho meses después de la siembra apareció la primera hoja del esporofito; ésta es espatulada, con márgenes lisos y una hilera de células aclorofílicas, tricomas pluricelulares, bifurcados y estomas anomocíticos. Las células epidérmicas de la hoja del esporofito tienen paredes laterales onduladas en las superficies dorsal y ventral.The development of the gametophytic phase of Microgramma nitida is described based on spore samples that was obtained of fertil specimens gathered on Veracruz State, Mexico. The spore sowing density was 40 spores/cm2 ; it is characterized by Vittaria-type germination of the spore, a germinal filament of six cells; young gametophytes are naked, spathulated and later are transformed in cordate-elongated adult gametophytes with wavy borders; marginal, superficial capitated, unicellular hairs; the meristematic cell is wedge-shaped and is quickly replaced by a pluricellular meristem. The antheridia and archegonia are of the usual Polypodiaceae s. str.type. Prothallial development is thus of the Drynaria-type. The first leaf of the sporophyte appeared eight months after spore sowing. The leaf is spathulated, with smooth borders and the margin has a row of cells without chlorophyll; bifurcated and pluricellular hairs; anomocytic stomata; the

CLE peptides regulate lateral root development in response to nitrogen nutritional status of plants.

Science.gov (United States)

Araya, Takao; von Wirén, Nicolaus; Takahashi, Hideki

2014-01-01

CLE (CLAVATA3/embryo surrounding region (ESR)) peptides control meristem functions in plants. Our recent study highlights the critical role of a peptide-receptor signaling module composed of nitrogen (N)-responsive CLE peptides and the CLAVATA1 (CLV1) leucine-rich repeat receptor-like kinase in controlling lateral root development in Arabidopsis thaliana. CLE1, -3, -4 and -7 are expressed in root pericycle cells in Arabidopsis roots under N-limited growth conditions. Overexpression of these CLE genes inhibits lateral root emergence from the primary root. The inhibitory action of N-responsive CLE peptides on lateral root development requires the function of CLV1 expressed in phloem companion cells in roots, suggesting that downstream signals are transferred through phloem for systemic regulation of root system architecture. An additional mechanism downstream of CLV1 feedback-regulates transcript levels of N-responsive CLE genes in roots for fine-tuning the signal amplitude.

Flowering in Xanthium strumarium

Science.gov (United States)

Leonard, Maggy; Kinet, Jean-Marie; Bodson, Monique; Havelange, Andrée; Jacqmard, Annie; Bernier, Georges

1981-01-01

Vegetative plants of Xanthium strumarium L. grown in long days were induced to flower by exposure to one or several 16-hour dark periods. The distribution of male and female inflorescences on the flowering shoot was described, and a scoring system was designed to assess the development of the female inflorescences. The time of movement of the floral stimulus out of the induced leaf and the timing of action of high temperature were shown to be similar for both the apical male and lateral female inflorescences. Strong photoperiodic induction of the plants favored female sex expression, while maleness was enhanced by exogenous gibberellic acid. The problem of the control of sex expression in Xanthium is discussed in relation to the distribution pattern of male and female inflorescences on the flowering shoot and to the state of the meristem at the time of the arrival of the floral stimulus. Images PMID:16661844

Flowering in Xanthium strumarium: INITIATION AND DEVELOPMENT OF FEMALE INFLORESCENCE AND SEX EXPRESSION.

Science.gov (United States)

Leonard, M; Kinet, J M; Bodson, M; Havelange, A; Jacqmard, A; Bernier, G

1981-06-01

Vegetative plants of Xanthium strumarium L. grown in long days were induced to flower by exposure to one or several 16-hour dark periods. The distribution of male and female inflorescences on the flowering shoot was described, and a scoring system was designed to assess the development of the female inflorescences. The time of movement of the floral stimulus out of the induced leaf and the timing of action of high temperature were shown to be similar for both the apical male and lateral female inflorescences.Strong photoperiodic induction of the plants favored female sex expression, while maleness was enhanced by exogenous gibberellic acid. The problem of the control of sex expression in Xanthium is discussed in relation to the distribution pattern of male and female inflorescences on the flowering shoot and to the state of the meristem at the time of the arrival of the floral stimulus.

Transient expression of green fluorescent protein in parasitic dodder as a tool for studying of cytoskeleton

Directory of Open Access Journals (Sweden)

Kaštier Peter

2017-06-01

Full Text Available Dodder (Cuscuta species cause severe agricultural damage in many countries throughout the world. To establish strategies for control of its growth and spreading it is important to study its life cycle and survival strategies. For these efforts genetic modification would represent a powerful tool. Here we report on Agrobacteriummediated transformation of dodder using green fluorescent protein (GFP fused to actin-binding protein as a vital marker. Since the shoot of germinating C. europaea contains a functional apical meristem and grows quickly comparing to the root-like structure, the shoot apex was used here as explant. The transgene expression was only transient, nevertheless it enabled to detect allocation of actin filaments and studying the cytoskeleton organization in dodder shoot apex. Transient expression of GFP appears to be a suitable method for studying Cuscuta development through cytoskeleton organisation that is presently largely unexplored.

Micropropagation of apple--a review.

Science.gov (United States)

Dobránszki, Judit; da Silva, Jaime A Teixeira

2010-01-01

Micropropagation of apple has played an important role in the production of healthy, disease-free plants and in the rapid multiplication of scions and rootstocks with desirable traits. During the last few decades, in apple, many reliable methods have been developed for both rootstocks and scions from a practical, commercial point of view. Successful micropropagation of apple using pre-existing meristems (culture of apical buds or nodal segments) is influenced by several internal and external factors including ex vitro (e.g. genotype and physiological state) and in vitro conditions (e.g., media constituents and light). Specific requirements during stages of micropropagation, such as the establishment of in vitro cultures, shoot multiplication, rooting of microshoots and acclimatization are summarized in this review. New approaches for increasing shoot multiplication and rooting for apple and current use of micropropagated plantlets as tools in basic and applied research are also discussed.

Micropropagation and cryopreservation of garlic (Allium sativum L.).

Science.gov (United States)

Keller, E R Joachim; Senula, Angelika

2013-01-01

Garlic (Allium sativum L.) is a very important medicinal and spice plant. It is conventionally propagated by daughter bulbs ("cloves") and bulbils from the flower head. Micropropagation is used for speeding up the vegetative propagation mainly using the advantage to produce higher numbers of healthy plants free of viruses, which have higher yield than infected material. Using primary explants from bulbs and/or bulbils (shoot tips) or unripe inflorescence bases, in vitro cultures are initiated on MS-based media containing auxins, e.g., naphthalene acetic acid, and cytokinins, e.g., 6-γ-γ-(dimethylallylaminopurine) (2iP). Rooting is accompanying leaf formation. It does not need special culture phases. The main micropropagation methods rely on growth of already formed meristems. Long-term storage of micropropagated material, cryopreservation, is well-developed to maintain germplasm. The main method is vitrification using the cryoprotectant mixture PVS3.

In vitro culture of lavenders (Lavandula spp.) and the production of secondary metabolites.

Science.gov (United States)

Gonçalves, Sandra; Romano, Anabela

2013-01-01

Lavenders (Lavandula spp., Lamiaceae) are aromatic ornamental plants that are used widely in the food, perfume and pharmaceutical industries. The large-scale production of lavenders requires efficient in vitro propagation techniques to avoid the overexploitation of natural populations and to allow the application of biotechnology-based approaches for plant improvement and the production of valuable secondary metabolites. In this review we discuss micropropagation methods that have been developed in several lavender species, mainly based on meristem proliferation and organogenesis. Specific requirements during stages of micropropagation (establishment, shoot multiplication, root induction and acclimatization) and requisites for plant regeneration trough organogenesis, as an important step for the implementation of plant improvement programs, were revised. We also discuss different methods for the in vitro production of valuable secondary metabolites, focusing on the prospects for highly scalable cultures to meet the market demand for lavender-derived products. Copyright © 2012 Elsevier Inc. All rights reserved.

The duration of G1, S, G2, and mitosis at four different temperatures in Zea mays L. as measured with 3H-thymidine

International Nuclear Information System (INIS)

Verma, R.S.

1980-01-01

The effect of different temperatures on the duration of nuclear cycle in Zea mays (single cross hybrid 'Seneca 60') root meristem cells, was studied with autoradiographic techniques and it was shown that all component phases of the nuclear cycle are shortened by an increase in temperature from 20 to 35 0 C. The durations of total nuclear cycle at 20, 25, 30, and 35 0 C were 16.5, 9.9, 7.0, and 4.4 hours respectively while the durations of mitosis were 2.68, 1.10, 0.83, and 0.43 hours respectively. 85 - 90 percent of the nuclear cycle is required for interphase, while the remaining 10 - 15 percent of the cycle is occupied by mitosis. The mean mitotic indices at 20, 25, 30, and 35 0 C were 9.8, 9.1, 5.3, and 4.9 percent respectively. (author)

Plant stem cell niches.

Science.gov (United States)

Aichinger, Ernst; Kornet, Noortje; Friedrich, Thomas; Laux, Thomas

2012-01-01

Multicellular organisms possess pluripotent stem cells to form new organs, replenish the daily loss of cells, or regenerate organs after injury. Stem cells are maintained in specific environments, the stem cell niches, that provide signals to block differentiation. In plants, stem cell niches are situated in the shoot, root, and vascular meristems-self-perpetuating units of organ formation. Plants' lifelong activity-which, as in the case of trees, can extend over more than a thousand years-requires that a robust regulatory network keep the balance between pluripotent stem cells and differentiating descendants. In this review, we focus on current models in plant stem cell research elaborated during the past two decades, mainly in the model plant Arabidopsis thaliana. We address the roles of mobile signals on transcriptional modules involved in balancing cell fates. In addition, we discuss shared features of and differences between the distinct stem cell niches of Arabidopsis.

Apple latent spherical virus vectors for reliable and effective virus-induced gene silencing among a broad range of plants including tobacco, tomato, Arabidopsis thaliana, cucurbits, and legumes

International Nuclear Information System (INIS)

Igarashi, Aki; Yamagata, Kousuke; Sugai, Tomokazu; Takahashi, Yukari; Sugawara, Emiko; Tamura, Akihiro; Yaegashi, Hajime; Yamagishi, Noriko; Takahashi, Tsubasa; Isogai, Masamichi; Takahashi, Hideki; Yoshikawa, Nobuyuki

2009-01-01

Apple latent spherical virus (ALSV) vectors were evaluated for virus-induced gene silencing (VIGS) of endogenous genes among a broad range of plant species. ALSV vectors carrying partial sequences of a subunit of magnesium chelatase (SU) and phytoene desaturase (PDS) genes induced highly uniform knockout phenotypes typical of SU and PDS inhibition on model plants such as tobacco and Arabidopsis thaliana, and economically important crops such as tomato, legume, and cucurbit species. The silencing phenotypes persisted throughout plant growth in these plants. In addition, ALSV vectors could be successfully used to silence a meristem gene, proliferating cell nuclear antigen and disease resistant N gene in tobacco and RCY1 gene in A. thaliana. As ALSV infects most host plants symptomlessly and effectively induces stable VIGS for long periods, the ALSV vector is a valuable tool to determine the functions of interested genes among a broad range of plant species.

Plant GSK3 proteins regulate xylem cell differentiation downstream of TDIF-TDR signalling

Science.gov (United States)

Kondo, Yuki; Ito, Tasuku; Nakagami, Hirofumi; Hirakawa, Yuki; Saito, Masato; Tamaki, Takayuki; Shirasu, Ken; Fukuda, Hiroo

2014-03-01

During plant radial growth typically seen in trees, procambial and cambial cells act as meristematic cells in the vascular system to self-proliferate and differentiate into xylem cells. These two processes are regulated by a signalling pathway composed of a peptide ligand and its receptor; tracheary element differentiation inhibitory factor (TDIF) and TDIF RECEPTOR (TDR). Here we show that glycogen synthase kinase 3 proteins (GSK3s) are crucial downstream components of the TDIF signalling pathway suppressing xylem differentiation from procambial cells. TDR interacts with GSK3s at the plasma membrane and activates GSK3s in a TDIF-dependent fashion. Consistently, a specific inhibitor of plant GSK3s strongly induces xylem cell differentiation through BRI1-EMS SUPPRESSOR 1 (BES1), a well-known target transcription factor of GSK3s. Our findings provide insight into the regulation of cell fate determination in meristem maintenance.

A Protocol for Rapid, Measurable Plant Tissue Culture Using Stem Disc Meristem Micropropagation of Garlic ("Allium Sativum L.")

Science.gov (United States)

Peat, Gerry; Jones, Meriel

2012-01-01

Plant tissue culture is becoming an important technique for the mass propagation of plants. Problems with existing techniques, such as slow growth and contamination, have restricted the practical work in plant tissue culture carried out in schools. The new protocol using garlic meristematic stem discs explained in this article addresses many of…

Effects of long-term pruning, meristem origin, and branch order on the rooting of Douglas-fir stem cuttings.

Science.gov (United States)

D.L. Copes

1992-01-01

The rooting percentages of 14 Douglas-fir (Pseudotsuga menziesii (Mirb.) Franco) clones were examined annually from 1974 to 1988. The trees were 10 and 13 years old in 1974 and were pruned to 2.0 m in 1978 and 1979 and then recut annually to 0.5, 1.0, or 1.5 m, starting in 1983. The pruned trees showed no evidence of decreased rooting percentage...

A SWI/SNF Chromatin Remodelling Protein Controls Cytokinin Production through the Regulation of Chromatin Architecture

KAUST Repository

Jégu, Teddy

2015-10-12

Chromatin architecture determines transcriptional accessibility to DNA and consequently gene expression levels in response to developmental and environmental stimuli. Recently, chromatin remodelers such as SWI/SNF complexes have been recognized as key regulators of chromatin architecture. To gain insight into the function of these complexes during root development, we have analyzed Arabidopsis knock-down lines for one sub-unit of SWI/SNF complexes: BAF60. Here, we show that BAF60 is a positive regulator of root development and cell cycle progression in the root meristem via its ability to down-regulate cytokinin production. By opposing both the deposition of active histone marks and the formation of a chromatin regulatory loop, BAF60 negatively regulates two crucial target genes for cytokinin biosynthesis (IPT3 and IPT7) and one cell cycle inhibitor (KRP7). Our results demonstrate that SWI/SNF complexes containing BAF60 are key factors governing the equilibrium between formation and dissociation of a chromatin loop controlling phytohormone production and cell cycle progression.

Determinación de una metodología a nivel Citogenético Aplicada a Brugmansia Sangulnea

Directory of Open Access Journals (Sweden)

Alvarado de Coral Cecilia

1987-12-01

Full Text Available Teniendo en cuenta diferentes factores ambientales tales como: Temperatura, humedad, hora, así como el tamaño de los meristemos radicales y botones florales se logró establecer una metodología a nivel citogenético aplicable, con pequeñas variaciones, a cualquier tipo de planta. Se obtuvieron
preparaciones de células en estado metafásico cuyos cromosomas presentaron una buena diferenciación permitiendo evidenciar la posición del centrómero y así lograr un cariotipo e ideograma real en Brugmansía sangulnea.Working with Brugmansía sanguínea and bearing in mind environmental factors such as: Temperature, humidity time
and the size of radical meristemes and floral buas, a cytogenetical metodology was set up, usable with small varlations in any kind of plants in order to get clear cut metafasic
stages with well differentiated chromosomes where centromeres are easily located making easier to elaborate caryotypen and ideograms.

Preparation and Fluorescent Analysis of Plant Metaphase Chromosomes.

Science.gov (United States)

Schwarzacher, Trude

2016-01-01

Good preparations are essential for informative analysis of both somatic and meiotic chromosomes, cytogenetics, and cell divisions. Fluorescent chromosome staining allows even small chromosomes to be visualized and counted, showing their morphology. Aneuploidies and polyploidies can be established for species, populations, or individuals while changes occurring in breeding lines during hybridization or tissue culture and transformation protocols can be assessed. The process of division can be followed during mitosis and meiosis including pairing and chiasma distribution, as well as DNA organization and structure during the evolution of chromosomes can be studied. This chapter presents protocols for pretreatment and fixation of material, including tips of how to grow plants to get good and healthy meristem with many divisions. The chromosome preparation technique is described using proteolytic enzymes, but acids can be used instead. Chromosome slide preparations are suitable for fluorochrome staining for fast screening (described in the chapter) or fluorescent in situ hybridization (see Schwarzacher and Heslop-Harrison, In situ hybridization. BIOS Scientific Publishers, Oxford, 2000).

Banana research in the FAO/IAEA agriculture and biotechnology laboratory

International Nuclear Information System (INIS)

Morpurgo, R.; Afza, R.; Brunner, H.; Roux, N.; Grasso, G.; Lee, K.S.; Duren, M. Van; Zapata-Arias, F.J.

1997-01-01

The primary activity of the Agriculture and Biotechnology Laboratory on banana has been to develop and transfer mutation techniques using nuclear and related biotechnology, provide training and mutagen treatment services and technical advice to the Member States. The complex genetic nature and lack of seed formation do not allow conventional breeding of Musa varieties. The FAO/IAEA laboratory has developed in vitro techniques to induce mutations, minimize chimerisms, and rapid propagation of banana. The most commonly used method of propagation is rapid proliferation of axillary and adventitious buds from meristem tip culture. Somatic embryogenesis has been induced in clones with different genomic constitution; however, the low germination rate of somatic embryos is still a major constraint. Investigations have been carried out on enzymes associated with resistance to Fusarium oxisporum f. sp. cubense. Molecular methods based on DNA oligonucleotide and DNA amplification fingerprinting are being developed for genomic characterization of species, cultivars and mutant clones. (author)

A SWI/SNF Chromatin Remodelling Protein Controls Cytokinin Production through the Regulation of Chromatin Architecture

KAUST Repository

Jé gu, Teddy; Domenichini, Sé verine; Blein, Thomas; Ariel, Federico; Christ, Auré lie; Kim, SoonKap; Crespi, Martin; Boutet-Mercey, Sté phanie; Mouille, Gré gory; Bourge, Mickaë l; Hirt, Heribert; Bergounioux, Catherine; Raynaud, Cé cile; Benhamed, Moussa

2015-01-01

Chromatin architecture determines transcriptional accessibility to DNA and consequently gene expression levels in response to developmental and environmental stimuli. Recently, chromatin remodelers such as SWI/SNF complexes have been recognized as key regulators of chromatin architecture. To gain insight into the function of these complexes during root development, we have analyzed Arabidopsis knock-down lines for one sub-unit of SWI/SNF complexes: BAF60. Here, we show that BAF60 is a positive regulator of root development and cell cycle progression in the root meristem via its ability to down-regulate cytokinin production. By opposing both the deposition of active histone marks and the formation of a chromatin regulatory loop, BAF60 negatively regulates two crucial target genes for cytokinin biosynthesis (IPT3 and IPT7) and one cell cycle inhibitor (KRP7). Our results demonstrate that SWI/SNF complexes containing BAF60 are key factors governing the equilibrium between formation and dissociation of a chromatin loop controlling phytohormone production and cell cycle progression.

Ascorbate oxidase is the potential conductor of a symphony of signaling pathways.

Science.gov (United States)

De Tullio, Mario C; Guether, Mike; Balestrini, Raffaella

2013-03-01

The functional role of ascorbate oxidase (AO; EC 1.10.3.3) has never been fully explained so far, due to the difficulties in understanding the presence of an enzyme specifically oxidizing ascorbate with no obvious advantage, and the apparent disadvantage of lowering plant stress resistance as a consequence of ascorbate consumption. Here we suggest a complete change of perspective, by proposing an essential role of AO as a modulator of both ascorbate and oxygen content, with relevant implications related to signaling. By affecting the overall redox state, AO is actually involved in redox regulation in the extracellular matrix. In addition, AO can contribute to creating a hypoxic microenvironment, especially relevant in the maintenance of meristem identity and the establishment of mutualistic plant-microbe interactions. We also hypothesize the possible involvement of AO in the activation of a signaling cascade analogous to the mechanism of prolyl hydroxylases/Hypoxia Inducible Factors in animals.

Banana research in the FAO/IAEA agriculture and biotechnology laboratory

Energy Technology Data Exchange (ETDEWEB)

Morpurgo, R; Afza, R; Brunner, H; Roux, N; Grasso, G; Lee, K S; Duren, M Van; Zapata-Arias, F J [Agriculture and Biotechnology Laboratory, International Atomic Energy Agency, Seibersdorf (Austria)

1997-07-01

The primary activity of the Agriculture and Biotechnology Laboratory on banana has been to develop and transfer mutation techniques using nuclear and related biotechnology, provide training and mutagen treatment services and technical advice to the Member States. The complex genetic nature and lack of seed formation do not allow conventional breeding of Musa varieties. The FAO/IAEA laboratory has developed in vitro techniques to induce mutations, minimize chimerisms, and rapid propagation of banana. The most commonly used method of propagation is rapid proliferation of axillary and adventitious buds from meristem tip culture. Somatic embryogenesis has been induced in clones with different genomic constitution; however, the low germination rate of somatic embryos is still a major constraint. Investigations have been carried out on enzymes associated with resistance to Fusarium oxisporum f. sp. cubense. Molecular methods based on DNA oligonucleotide and DNA amplification fingerprinting are being developed for genomic characterization of species, cultivars and mutant clones. (author).

Mutagenesis for ACMV resistance in a Ghanian cassava cultivar `Bosom nsia`

Energy Technology Data Exchange (ETDEWEB)

Ahiabu, R K; Lokko, Y; Danso, K; Klu, G Y.P. [Biotechnology and Nuclear Agricultural Research Inst., Ghana Atomic Energy Commission, Legon (Ghana)

1997-07-01

Breeding for resistance to the African Cassava Mosaic Virus (ACMV) disease in the Ghanian cassava cultivar `Bosom nsia` has been on-going for the past four years at the Biotechnology and Nuclear Agricultural Research Institute. Protocols for in vitro culture from shoot meristems and acclimation of plantlets were established. Radiosensitivity tests on the regenerated plantlets indicated LD{sub 50} of 40 Gy, and doses of 25, 30 and 35 Gy were suitable for mutagenesis. These doses were applied to in vivo and in vitro grown plants, and selection was carried out in three propagations. Four variants, selected under field conditions with high viral incidence, were analyzed for virus particles with three virus indexing techniques. Polymerase chain reaction (PCR) product analysis of DNA extracts from Nicotiana benthamiana test plants, inoculated with sap from the leaves of variants, confirmed the presence of virus particles in all variants. Inoculation and ELISA tests suggested ACMV tolerance in selected variants. (author). 24 refs, 3 figs, 1 tab.

Evaluation of genetic variability in potato cv. 'Parda-Pastusa' obtained through the physical mutagenic agents

International Nuclear Information System (INIS)

Angarita-Zerda, A.; Mosquera, T.; Nustez, C.

1997-01-01

'Parda-Pastusa' is probably the most important variety of potato in Colombia. Its susceptibility to frost and Phytophthora infestans can cause important losses in the crop. In order to induce genetic variability to select clones resistant to frost and late blight, disease-free micropropagated plantlets, obtained from meristem culture of indexed tubers were irradiated with gamma rays from a 60 Co source. Virus-free mericlones were initially irradiated with 0,25, 50, 75 and 100 Gy or with 0, 10, 20 and 30 Gy. The optimal radiation dose was found to be 20 Gy. A mass propagation was carried out, and plantlets were irradiated with the optimal radiation dose. Clones derived from irradiated material were propagated for selection under simulated frost conditions (-7 deg. C for 360 minutes) and co-cultured with extracts of fungus, Phytophthora infestans. The selected clones will be transferred to field conditions for evaluation of agronomic and genetic characteristics. (author). 1 ref

Micropropagation of Prunus species relevant to cherry fruit production.

Science.gov (United States)

Druart, Philippe

2013-01-01

Cherry tree micropropagation is limited to the production of healthy cultivars of Prunus avium and Prunus cerasus, and their rootstocks; mainly the dwarfing ones. By using meristem-tip (0.1 mm long) or healthy shoot tips/nodes, four successive steps are needed to obtain whole plants capable of growing in the nursery: multiplication by axillary branching, shoot elongation, rooting, and plantlet acclimation. Along this process, several parameters have to be adjusted for each phase of the culture, including media composition, environmental culture conditions and plant handling. These parameters vary depending on genotypic response and specific vulnerability to physiological disorders such as hyperhydricity, apex necrosis, unstable propagation, and rooting rates. Based on a 40 year-long experience of study and application of culture conditions to large-scale plant production, this document summarizes the main problems (variability of the propagation rate, hyperhydricity, apex necrosis, plant re-growth) and solutions encountered to solve them, with means validated on many mericlones.