WorldWideScience

Sample records for mercury 201

  1. 7 CFR 201.58c - Detection of captan, mercury, or thiram on seed.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 3 2010-01-01 2010-01-01 false Detection of captan, mercury, or thiram on seed. 201.58c Section 201.58c Agriculture Regulations of the Department of Agriculture (Continued) AGRICULTURAL... Detection of captan, mercury, or thiram on seed. The bioassay method may be used according to the procedure...

  2. Studies on the preparation of thallium-201 by irradiating mercury with protons using extraction chromatography technique to separate thallium from mercury

    International Nuclear Information System (INIS)

    Fernandes, L.

    1990-01-01

    Radionuclide sup(201)Tl is used in Nuclear Medicine to identify myocardial ischemia or myocardial infarct. It is a cyclotron-produced radioisotope, obtained indirectly from the decay of sup(202)Pb or directly by irradiating mercury with deuterons or protons. The usual technique to prepare sup(201)Tl makes use of the nuclear reaction: sup(203)(p,3n) → sup(201)Tl, which requires proton energy of around 28 MeV. Due to the limited proton energy of IPEN'S CV-28 cyclotron, studies on the irradiating conditions of natural mercury oxide pellets and drops of natural mercury metal were made in the range of 19 - 24 MeV. At the end of the bombardment of a 6 MeV thickness target of natural mercury metal with 19 MeV protons around 10 MBq sup(201)Tl/μ A h was obtained. (author)

  3. Evidence of mercury trapping in biofilm-EPS and mer operon-based volatilization of inorganic mercury in a marine bacterium Bacillus cereus BW-201B.

    Science.gov (United States)

    Dash, Hirak R; Basu, Subham; Das, Surajit

    2017-04-01

    Biofilm-forming mercury-resistant marine bacterium Bacillus cereus BW-201B has been explored to evident that the bacterial biofilm-EPS (exopolymers) trap inorganic mercury but subsequently release EPS-bound mercury for induction of mer operon-mediated volatilization of inorganic mercury. The isolate was able to tolerate 50 ppm of mercury and forms biofilm in presence of mercury. mer operon-mediated volatilization was confirmed, and -SH was found to be the key functional group of bacterial EPS responsible for mercury binding. Biofilm-EPS-bound mercury was found to be internalized to the bacterial system as confirmed by reversible conformational change of -SH group and increased expression level of merA gene in a timescale experiment. Biofilm-EPS trapped Hg after 24 h of incubation, and by 96 h, the volatilization process reaches to its optimum confirming the internalization of EPS-bound mercury to the bacterial cells. Biofilm disintegration at the same time corroborates the results.

  4. Mercury

    International Nuclear Information System (INIS)

    Vilas, F.; Chapman, C.R.; Matthews, M.S.

    1988-01-01

    Papers are presented on future observations of and missions to Mercury, the photometry and polarimetry of Mercury, the surface composition of Mercury from reflectance spectrophotometry, the Goldstone radar observations of Mercury, the radar observations of Mercury, the stratigraphy and geologic history of Mercury, the geomorphology of impact craters on Mercury, and the cratering record on Mercury and the origin of impacting objects. Consideration is also given to the tectonics of Mercury, the tectonic history of Mercury, Mercury's thermal history and the generation of its magnetic field, the rotational dynamics of Mercury and the state of its core, Mercury's magnetic field and interior, the magnetosphere of Mercury, and the Mercury atmosphere. Other papers are on the present bounds on the bulk composition of Mercury and the implications for planetary formation processes, the building stones of the planets, the origin and composition of Mercury, the formation of Mercury from planetesimals, and theoretical considerations on the strange density of Mercury

  5. Mercury

    NARCIS (Netherlands)

    de Vries, Irma

    2017-01-01

    Mercury is a naturally occurring metal that exists in several physical and chemical forms. Inorganic mercury refers to compounds formed after the combining of mercury with elements such as chlorine, sulfur, or oxygen. After combining with carbon by covalent linkage, the compounds formed are called

  6. Mercury

    Science.gov (United States)

    ... build up in fish, shellfish, and animals that eat fish. The nervous system is sensitive to all forms of mercury. Exposure to high levels can damage the brain and kidneys. Pregnant women can pass the mercury in their bodies to their babies. It is important to protect your family from ...

  7. Mercury

    Science.gov (United States)

    ... has set a limit of 2 parts of mercury per billion parts of drinking water (2 ppb). The Food and Drug Administration (FDA) has set a maximum permissible level of 1 part of methylmercury in a million ... of 0.1 milligram of organic mercury per cubic meter of workplace air (0.1 ...

  8. Study to prepare 201Tl by irradiation of mercury with protons. Application of extraction chromatography technique in separation of thallium and mercury

    International Nuclear Information System (INIS)

    Fernandes, L.; Silva, C.P.G. da

    1986-01-01

    The extraction chromatography technique was used for the lig and 201 Tl separation. It was used glass columns of 5,0 cm height and 1,0 cm diameter filled with Voltalef powder impregnated with TBP/cyclohexane. By the Voltalef columns solutions of 203 Hg 2+ , 201 Tl 1+ and 20 1Te 3 were separately percolated in a nitric environment of 4 to 8 M concentration and in a hydrochloridric environment of 0,5 to 4 M. The separation of Hg and 201 Tl was obtained by the retention of 201 Tl3 + in the column during the elution of all the Hg with HCl 2 M. The 201 Tl 3+ was eluted from the column after its reduction with a hot hydrazine dichloride solution. (Author) [pt

  9. Mercury

    CERN Document Server

    Balogh, André; Steiger, Rudolf

    2008-01-01

    Mercury, the planet closest to the Sun, is different in several respects from the other three terrestrial planets. In appearance, it resembles the heavily cratered surface of the Moon, but its density is high, it has a magnetic field and magnetosphere, but no atmosphere or ionosphere. This book reviews the progress made in Mercury studies since the flybys by Mariner 10 in 1974-75, based on the continued research using the Mariner 10 archive, on observations from Earth, and on increasingly realistic models of its interior evolution.

  10. Investigation of characteristics of 201Tl → 201Hg

    International Nuclear Information System (INIS)

    Kharitonov, V.V.; Gerasimov, V.N.

    2002-01-01

    The estimated intensities of transitions on the ground and first-excited levels in the 201 Hg at the decay of 201 Tl and estimated constants lg ft are obtained from the analysis of the relative intensities of the mercury M 4 N 6,7 N 6,7 Auger-electron line, initiated by the e-capture and of the conversion O 3 -mercury line, due to the nuclear transition with the energy 1.56 keV [ru

  11. Mercury and Your Health

    Science.gov (United States)

    ... the Risk of Exposure to Mercury Learn About Mercury What is Mercury What is Metallic mercury? Toxicological Profile ToxFAQs Mercury Resources CDC’s National Biomonitoring Program Factsheet on Mercury ...

  12. Got Mercury?

    Science.gov (United States)

    Meyers, Valerie E.; McCoy, J. Torin; Garcia, Hector D.; James, John T.

    2009-01-01

    Many of the operational and payload lighting units used in various spacecraft contain elemental mercury. If these devices were damaged on-orbit, elemental mercury could be released into the cabin. Although there are plans to replace operational units with alternate light sources, such as LEDs, that do not contain mercury, mercury-containing lamps efficiently produce high quality illumination and may never be completely replaced on orbit. Therefore, exposure to elemental mercury during spaceflight will remain possible and represents a toxicological hazard. Elemental mercury is a liquid metal that vaporizes slowly at room temperature. However, it may be completely vaporized at the elevated operating temperatures of lamps. Although liquid mercury is not readily absorbed through the skin or digestive tract, mercury vapors are efficiently absorbed through the respiratory tract. Therefore, the amount of mercury in the vapor form must be estimated. For mercury releases from lamps that are not being operated, we utilized a study conducted by the New Jersey Department of Environmental Quality to calculate the amount of mercury vapor expected to form over a 2-week period. For longer missions and for mercury releases occurring when lamps are operating, we conservatively assumed complete volatilization of the available mercury. Because current spacecraft environmental control systems are unable to remove mercury vapors, both short-term and long-term exposures to mercury vapors are possible. Acute exposure to high concentrations of mercury vapors can cause irritation of the respiratory tract and behavioral symptoms, such as irritability and hyperactivity. Chronic exposure can result in damage to the nervous system (tremors, memory loss, insomnia, etc.) and kidneys (proteinurea). Therefore, the JSC Toxicology Group recommends that stringent safety controls and verifications (vibrational testing, etc.) be applied to any hardware that contains elemental mercury that could yield

  13. Production of 201Tl

    International Nuclear Information System (INIS)

    Braghirolli, A.M.S.; Silva, A.G. da; Teixeira, F.C.M.; Costa e Silva, A.; Souza, A.S.F. de

    1981-01-01

    The obtention of 201 Tl, free of charger and impurities, with large target yield of 1,7 mCi/μAh of 201 Pb, precursory of 201 Tl, and with 93% yield for chemical separation of 201 Tl, is related. (E.G.) [pt

  14. Basic Information about Mercury

    Science.gov (United States)

    ... Your Environment Contact Us Share Basic Information about Mercury On this page: What is mercury? Emissions of ... Consumer products that traditionally contain mercury What is Mercury? Mercury is a naturally-occurring chemical element found ...

  15. A New Trapped Ion Clock Based on Hg-201(+)

    Science.gov (United States)

    Taghavi-Larigani, S.; Burt, E. A.; Lea, S. N.; Prestage, J. D.; Tjoelker, R. L.

    2009-01-01

    There are two stable odd isotopes of mercury with singly ionized hyperfine structure suitable for a microwave clock: Hg-199(+) and Hg-201(+). Virtually all trapped mercury ion clocks to date have used the 199 isotope. We have begun to investigate the viability of a trapped ion clock based on Hg-201(+). We have measured the unperturbed frequency of the (S-2)(sub 1/2) F = 1, m(sub F) = 0 to (S-2)(sub 1/2) F = 2, m(sub F) = 0 clock transition to be 29.9543658211(2) GHz. In this paper we describe initial measurements with Hg-201(+) and new applications to clocks and fundamental physics.

  16. Mercury and Pregnancy

    Science.gov (United States)

    ... Home > Pregnancy > Is it safe? > Mercury and pregnancy Mercury and pregnancy E-mail to a friend Please ... vision problems. How can you be exposed to mercury? Mercury has several forms: It can be a ...

  17. Mercury's Messenger

    Science.gov (United States)

    Chapman, Clark R.

    2004-01-01

    Forty years after Mariner 2, planetary exploration has still only just begun, and many more missions are on drawing boards, nearing the launch pad, or even en route across interplanetary space to their targets. One of the most challenging missions that will be conducted this decade is sending the MESSENGER spacecraft to orbit the planet Mercury.…

  18. Mercury Report-Children's exposure to elemental mercury

    Science.gov (United States)

    ... gov . Mercury Background Mercury Report Additional Resources Mercury Report - Children's Exposure to Elemental Mercury Recommend on Facebook ... I limit exposure to mercury? Why was the report written? Children attending a daycare in New Jersey ...

  19. Environmental mercury problem

    Energy Technology Data Exchange (ETDEWEB)

    D' Itri, F.M.

    1972-01-01

    The urgent need to eliminate or greatly reduce the discharge of mercury into the environment is paramount to the health and well being of man. That all forms of mercury are hazardous is widely recognized, but what is more devastating to our society is that all forms of mercury appear to have the potential to be converted in to highly toxic monomethylmercury, or dimethylmercury. This paper examined the historical uses of mercury, the background concentrations of mercury, the analytical methods for the determination of mercury, the contamination of the food chain by mercury, the biological methylation of mercury, the decontamination and restoration of mercury polluted areas, the epidemiology and toxicology of mercury, and the chronology of the world's mercury poisoning problem.

  20. Mercury contamination extraction

    Science.gov (United States)

    Fuhrmann, Mark [Silver Spring, MD; Heiser, John [Bayport, NY; Kalb, Paul [Wading River, NY

    2009-09-15

    Mercury is removed from contaminated waste by firstly applying a sulfur reagent to the waste. Mercury in the waste is then permitted to migrate to the reagent and is stabilized in a mercury sulfide compound. The stable compound may then be removed from the waste which itself remains in situ following mercury removal therefrom.

  1. Main: SAD201 [AT Atlas

    Lifescience Database Archive (English)

    Full Text Available method Diversification of protein structural analysis technologies by the SAIL method Masatsune Kainosho Graduate School of Science, Nagoya University SAD201.csml ... ...SAD201 SAD2 Diversification of protein structural analysis technologies by the SAIL

  2. Mercury Quick Facts: Health Effects of Mercury Exposure

    Science.gov (United States)

    Mercury Quick Facts Health Effects of Mercury Exposure What is Elemental Mercury? Elemental (metallic) mercury is the shiny, silver-gray metal found in thermometers, barometers, and thermostats and other ...

  3. Thallium 201 scintigraphy

    International Nuclear Information System (INIS)

    Thallium-201 behaves physiologically as a potassium analog, and when injected intravenously accumulates rapidly within the cells of many organs. Uptake of the isotope reflects both regional perfusion and sodium-potassium pump activity. The main clinical application of 201 Tl scintigraphy has been in myocardial imaging. Abnormalities due to ischemia usually are seen only on the stress image whereas fixed defects in both rest and stress studies usually indicate areas of infarction or scarring. The sensitivity of stress imaging for detecting significant coronary disease is of the order of 80 to 95% though computer processing of the images may be necessary to achieve the higher figure. The main clinical value of 201 Tl myocardial imaging is likely to be in the noninvasive screening of patients with atypical chest pain or with ambiguous findings on stress electrocardiographic tests. It has also proved useful in studying patients with variant angina or following a coronary bypass operation. It is doubtful whether the technique is clinically helpful in most patients with suspected or established acute myocardial infarction. Imaging of organs other than the heart with 201 Tl has received much less attention but has been reported in patients with peripheral vascular disease and various primary and secondary neoplasms

  4. Thallium 201 scintigraphy

    Energy Technology Data Exchange (ETDEWEB)

    McKillop, J.H.

    1980-07-01

    Thallium-201 behaves physiologically as a potassium analog, and when injected intravenously accumulates rapidly within the cells of many organs. Uptake of the isotope reflects both regional perfusion and sodium-potassium pump activity. The main clinical application of /sup 201/Tl scintigraphy has been in myocardial imaging. Abnormalities due to ischemia usually are seen only on the stress image whereas fixed defects in both rest and stress studies usually indicate areas of infarction or scarring. The sensitivity of stress imaging for detecting significant coronary disease is of the order of 80 to 95% though computer processing of the images may be necessary to achieve the higher figure. The main clinical value of /sup 201/Tl myocardial imaging is likely to be in the noninvasive screening of patients with atypical chest pain or with ambiguous findings on stress electrocardiographic tests. It has also proved useful in studying patients with variant angina or following a coronary bypass operation. It is doubtful whether the technique is clinically helpful in most patients with suspected or established acute myocardial infarction. Imaging of organs other than the heart with /sup 201/Tl has received much less attention but has been reported in patients with peripheral vascular disease and various primary and secondary neoplasms.

  5. Thallium 201 Scintigraphy

    OpenAIRE

    McKillop, James H.

    1980-01-01

    The radioactive isotope thallium 201 behaves physiologically as a potassium analog, and when injected intravenously accumulates rapidly within the cells of many organs. Uptake of the isotope reflects both regional perfusion and sodium-potassium pump activity. The radionuclide emits 80 keV x-rays which are suitable for scintillation camera imaging.

  6. Thallium 201 Scintigraphy

    Science.gov (United States)

    McKillop, James H.

    1980-01-01

    The radioactive isotope thallium 201 behaves physiologically as a potassium analog, and when injected intravenously accumulates rapidly within the cells of many organs. Uptake of the isotope reflects both regional perfusion and sodium-potassium pump activity. The radionuclide emits 80 keV x-rays which are suitable for scintillation camera imaging. The main clinical application of 201TI scintigraphy has been in myocardial imaging. Abnormal uptake of the isotope results in a cold spot on the myocardial image. In patients with coronary artery disease, the differentiation of ischemic and infarcted myocardium is made by comparing images obtained after injecting the radionuclide at the peak of a maximal exercise test with those obtained after injection at rest. Abnormalities due to ischemia usually are seen only on the stress image whereas fixed defects in both rest and stress studies usually indicate areas of infarction or scarring. Some investigators believe that redistribution images obtained four to six hours after stress injection (without administering further 201TI) give the same information as a separate rest study. The sensitivity of stress imaging for detecting significant coronary disease is of the order of 80 percent to 95 percent, though computer processing of the images may be necessary to achieve the higher figure. The prediction of the extent of coronary disease from 201TI images is less reliable. An abnormal 201TI image is not entirely specific for coronary artery disease and the likelihood of an abnormal image being due to this diagnosis varies according to the clinical circumstances. The main clinical value of 201TI myocardial imaging is likely to be in the noninvasive screening of patients with atypical chest pain or with ambiguous findings on stress electrocardiographic tests. It has also proved useful in studying patients with variant angina or following a coronary bypass operation. It is doubtful whether the technique is clinically helpful in most

  7. Metallic mercury use by South African traditional health practitioners: perceptions and practices

    OpenAIRE

    Street, Ren?e A.; Kabera, Ga?tan M.; Connolly, Catherine

    2015-01-01

    Background Mercury is a toxic metal however its use in traditional healthcare systems remains widespread. The aim of this study was to determine the prevalence of mercury use by South African Traditional Health Practitioners (THP) and to document reasons for use and administration methods. Methods A cross-sectional study design was employed. A total of 201 THPs were enrolled from two main metropolitan areas of KwaZulu-Natal (South Africa), and 198 were included in the final analysis. Informat...

  8. Minamata Convention on Mercury

    Science.gov (United States)

    On November 6, 2013 the United States signed the Minamata Convention on Mercury, a new multilateral environmental agreement that addresses specific human activities which are contributing to widespread mercury pollution

  9. Mercury in Your Environment

    Science.gov (United States)

    Basic information about mercury, how it gets in the air, how people are exposed to it and health effects associated with exposure; what EPA and other organizations are doing to limit exposures; what citizens should know to minimize exposures and to reduce mercury in the environment; and information about products that contain mercury.

  10. Intentional intravenous mercury injection

    African Journals Online (AJOL)

    Three forms of mercury exist: elemental, inorganic and organic, all of which may be toxic with clinical consequences, depending on the type of exposure. Elemental mercury poisoning usually occurs via vapour inhalation, as mercury is well absorbed through the lungs. The central nervous system is then the major site of ...

  11. Process for producing thallium-201

    International Nuclear Information System (INIS)

    Ageev, V.A.; Kljucnikov, A.A.; Linev, A.F.; Chalkin, V.A.; Zajceva, N.G.

    1985-01-01

    A storage plate of pure Pb-206 enriched up to 95% is irradiated with a 50 to 70 MeV proton beam. The plate is then dissolved in acid, and the Th-201 contained in the solution is oxydated and precipitated from the Pb solution. Traces of Pb retained in the solution are separated from the Th-201 by cation exchange, and the Th-201 is eluated using hydrochloric acid. (orig./PW) [de

  12. 18 CFR 385.201 - Applicability (Rule 201).

    Science.gov (United States)

    2010-04-01

    ...). 385.201 Section 385.201 Conservation of Power and Water Resources FEDERAL ENERGY REGULATORY COMMISSION..., Notices of Tariff or Rate Examination, Orders To Show Cause, Intervention, and Summary Disposition § 385... tariff or rate examination, order to show cause, intervention, or summary disposition. ...

  13. Mercury evaporation from amalgams with varied mercury contents.

    Science.gov (United States)

    Ohmoto, K; Nakajima, H; Ferracane, J L; Shintani, H; Okabe, T

    2000-09-01

    This study examined the relationship between mercury content and mercury evaporation from amalgams during setting. Two different types of commercial high-copper amalgams (single composition and admixed types) were used. Cylindrical specimens of each amalgam were prepared with five different mercury contents according to ADA Specification No.1. Specimens were also prepared by hand condensation. Mercury evaporation from amalgam specimens maintained at 37 degrees C was measured using a gold film mercury analyzer from 10 min after the end of trituration until the mercury concentration in air reached an undetectable level. The mercury content more clearly influenced the mercury evaporation from the admixed type amalgam specimens when the mercury content decreased below the manufacturers' recommended trituration conditions. Triturating with less mercury than the manufacturers' recommended amount cannot lower the evaporation of mercury from freshly made amalgam. Proper condensing procedures can minimize the mercury evaporation from the amalgam surface.

  14. Mercury balance analysis

    International Nuclear Information System (INIS)

    Maag, J.; Lassen, C.; Hansen, E.

    1996-01-01

    A detailed assessment of the consumption of mercury, divided into use areas, was carried out. Disposal and emissions to the environment were also qualified. The assessment is mainly based on data from 1992 - 1993. The most important source of emission of mercury to air is solid waste incineration which is assessed in particular to be due to the supply of mercury in batteries (most likely mercury oxide batteries from photo equipment) and to dental fillings. The second most important source of mercury emission to air is coal-fired power plants which are estimated to account for 200-500 kg of mercury emission p.a. Other mercury emissions are mainly related to waste treatment and disposal. The consumption of mercury is generally decreasing. During the period from 1982/83 - 1992-93, the total consumption of mercury in Denmark was about halved. This development is related to the fact that consumption with regard to several important use areas (batteries, dental fillings, thermometers etc.) has been significantly reduced, while for other purposes the use of mercury has completely, or almost disappeared, i.e. (fungicides for seed, tubes etc.). (EG)

  15. Metallic mercury use by South African traditional health practitioners: perceptions and practices.

    Science.gov (United States)

    Street, Renée A; Kabera, Gaëtan M; Connolly, Catherine

    2015-08-15

    Mercury is a toxic metal however its use in traditional healthcare systems remains widespread. The aim of this study was to determine the prevalence of mercury use by South African Traditional Health Practitioners (THP) and to document reasons for use and administration methods. A cross-sectional study design was employed. A total of 201 THPs were enrolled from two main metropolitan areas of KwaZulu-Natal (South Africa), and 198 were included in the final analysis. Information on demographic characteristics, reasons for using or not using mercury as well as mercury administration methods were collected. Of the 198 THPs, 78 (39%) used mercury for healing purposes and 74 (95%) of the mercury users stated that they were taught to use it by another THP. The two main routes of administration were oral and sub-cutaneous implantations (ukugcaba) at 85% (n = 66) and 59% (n = 46), respectively. The most common responses for mercury administration were for child birth (n = 70; 90%) and protection against guns (n = 39; 50%). This is the first study to describe the prevalence and practice of mercury use in South African traditional medicine. Socio-cultural mercury use is a potential source of exposure to both THPs and their patients. In light of such findings, public education messages and regulatory measures need to be effected.

  16. Process for low mercury coal

    Science.gov (United States)

    Merriam, Norman W.; Grimes, R. William; Tweed, Robert E.

    1995-01-01

    A process for producing low mercury coal during precombustion procedures by releasing mercury through discriminating mild heating that minimizes other burdensome constituents. Said mercury is recovered from the overhead gases by selective removal.

  17. Historical variations in the stable isotope composition of mercury in a sediment core from a riverine lake: Effects of dams, pulp and paper mill wastes, and mercury from a chlor-alkali plant

    International Nuclear Information System (INIS)

    Jackson, Togwell A.

    2016-01-01

    The Wabigoon River (Ontario, Canada) was affected by dams starting in 1898 and was polluted with pulp and paper mill wastes starting in 1913 and mercury from a chlor-alkali plant from 1962 to 1975. A dated sediment core from a riverine lake was analysed to investigate resultant changes in the biogeochemistry of mercury as revealed by variations in mercury isotope ratios and sediment chemistry. A total mercury maximum formed by the mercury pollution coincided with minimums in the δ-values of the 198 Hg/ 202 Hg, 199 Hg/ 202 Hg, 200 Hg/ 202 Hg, and 201 Hg/ 202 Hg ratios, and the δ-values decreased in the order δ 201 Hg > δ 200 Hg > δ 199 Hg > δ 198 Hg. Thus, mass-dependent fractionation caused depletion in lighter isotopes, implying evaporation of Hg(0) and pollution of the atmosphere as well as the river-lake system. Concurrently, mass-independent fractionation caused 199 Hg enrichment, possibly reflecting an independently documented upsurge in methylmercury production, and 201 Hg depletion, suggesting removal of methylmercury with anomalously high 201 Hg/ 199 Hg ratios by aquatic organisms and accumulation of 201 Hg-depleted inorganic Hg(II) in sediments. The δ 201 Hg/δ 199 Hg ratio rose abruptly when mercury pollution began, reflecting the resultant increase in methylmercury production, and remained high but gradually declined as the pollution abated, paralleling trends shown by methylmercury in aquatic organisms. The δ 201 Hg/δ 199 Hg ratio of pre-1962 background mercury increased ca. 1898 and ca. 1913–1929, suggesting accelerated methylmercury production due to stimulation of microbial activities by the damming of the river and the input of pulp and paper mill wastes, respectively. Other variations were linked to economic and technological factors that affected pulp and paper manufacture. - Highlights: • A core from a lake polluted by Hg and organic wastes was analysed for Hg isotopes. • Hg from a chlor-alkali plant was depleted in lighter

  18. Mercury is Moon's brother

    International Nuclear Information System (INIS)

    Ksanfomalifi, L.V.

    1976-01-01

    The latest information on Mercury planet is presented obtained by studying the planet with the aid of radar and space vehicles. Rotation of Mercury about its axis has been discovered; within 2/3 of its year it executes a complete revolution about its axis. In images obtained by the ''Mariner-10'' Mercurys surface differs little from that of the Moon. The ''Mariner-10'' has also discovered the Mercurys atmosphere, which consists of extremely rarefied helium. The helium is continuously supplied to the planet by the solar wind. The Mercury's magnetic field has been discovered, whose strength is 35 x 10 -4 at the Equator and 70 x 10 -4 E at the poles. The inclination of the dipole axis to the Mercury's rotation axis is 7 deg

  19. Peru Mercury Inventory 2006

    Science.gov (United States)

    Brooks, William E.; Sandoval, Esteban; Yepez, Miguel A.; Howard, Howell

    2007-01-01

    In 2004, a specific need for data on mercury use in South America was indicated by the United Nations Environmental Programme-Chemicals (UNEP-Chemicals) at a workshop on regional mercury pollution that took place in Buenos Aires, Argentina. Mercury has long been mined and used in South America for artisanal gold mining and imported for chlor-alkali production, dental amalgam, and other uses. The U.S. Geological Survey (USGS) provides information on domestic and international mercury production, trade, prices, sources, and recycling in its annual Minerals Yearbook mercury chapter. Therefore, in response to UNEP-Chemicals, the USGS, in collaboration with the Economic Section of the U.S. Embassy, Lima, has herein compiled data on Peru's exports, imports, and byproduct production of mercury. Peru was selected for this inventory because it has a 2000-year history of mercury production and use, and continues today as an important source of mercury for the global market, as a byproduct from its gold mines. Peru is a regional distributor of imported mercury and user of mercury for artisanal gold mining and chlor-alkali production. Peruvian customs data showed that 22 metric tons (t) of byproduct mercury was exported to the United States in 2006. Transshipped mercury was exported to Brazil (1 t), Colombia (1 t), and Guyana (1 t). Mercury was imported from the United States (54 t), Spain (19 t), and Kyrgyzstan (8 t) in 2006 and was used for artisanal gold mining, chlor-alkali production, dental amalgam, or transshipment to other countries in the region. Site visits and interviews provided information on the use and disposition of mercury for artisanal gold mining and other uses. Peru also imports mercury-containing batteries, electronics and computers, fluorescent lamps, and thermometers. In 2006, Peru imported approximately 1,900 t of a wide variety of fluorescent lamps; however, the mercury contained in these lamps, a minimum of approximately 76 kilograms (kg), and in

  20. 7 CFR 201.42 - Small containers.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 3 2010-01-01 2010-01-01 false Small containers. 201.42 Section 201.42 Agriculture... REGULATIONS Sampling in the Administration of the Act § 201.42 Small containers. In sampling seed in small containers that it is not practical to sample as required in § 201.41, a portion of one unopened container or...

  1. Modeling Mercury in Proteins

    Energy Technology Data Exchange (ETDEWEB)

    Smith, Jeremy C [ORNL; Parks, Jerry M [ORNL

    2016-01-01

    Mercury (Hg) is a naturally occurring element that is released into the biosphere both by natural processes and anthropogenic activities. Although its reduced, elemental form Hg(0) is relatively non-toxic, other forms such as Hg2+ and, in particular, its methylated form, methylmercury, are toxic, with deleterious effects on both ecosystems and humans. Microorganisms play important roles in the transformation of mercury in the environment. Inorganic Hg2+ can be methylated by certain bacteria and archaea to form methylmercury. Conversely, bacteria also demethylate methylmercury and reduce Hg2+ to relatively inert Hg(0). Transformations and toxicity occur as a result of mercury interacting with various proteins. Clearly, then, understanding the toxic effects of mercury and its cycling in the environment requires characterization of these interactions. Computational approaches are ideally suited to studies of mercury in proteins because they can provide a detailed picture and circumvent issues associated with toxicity. Here we describe computational methods for investigating and characterizing how mercury binds to proteins, how inter- and intra-protein transfer of mercury is orchestrated in biological systems, and how chemical reactions in proteins transform the metal. We describe quantum chemical analyses of aqueous Hg(II), which reveal critical factors that determine ligand binding propensities. We then provide a perspective on how we used chemical reasoning to discover how microorganisms methylate mercury. We also highlight our combined computational and experimental studies of the proteins and enzymes of the mer operon, a suite of genes that confers mercury resistance in many bacteria. Lastly, we place work on mercury in proteins in the context of what is needed for a comprehensive multi-scale model of environmental mercury cycling.

  2. Intentional intravenous mercury injection

    African Journals Online (AJOL)

    In this case report, intravenous complications, treatment strategies and possible ... Mercury toxicity is commonly associated with vapour inhalation or oral ingestion, for which there exist definite treatment options. Intravenous mercury ... personality, anxiousness, irritability, insomnia, depression and drowsi- ness.[1] However ...

  3. International mercury conference

    CSIR Research Space (South Africa)

    Leaner, J

    2006-10-01

    Full Text Available Mercury (Hg) affects human health and the environment, it calls for immediate action. Action is needed at local, regional and international level to reduce the risk associated with mercury, which is a global international problem, as it is a...

  4. Mercury's shifting, rolling past

    OpenAIRE

    Trulove, Susan

    2008-01-01

    Patterns of scalloped-edged cliffs or lobate scarps on Mercury's surface are thrust faults that are consistent with the planet shrinking and cooling with time. However, compression occurred in the planet's early history and Mariner 10 images revealed decades ago that lobate scarps are among the youngest features on Mercury. Why don't we find more evidence of older compressive features?

  5. MESSENGER: Exploring Mercury's Magnetosphere

    Science.gov (United States)

    Slavin, James A.

    2008-01-01

    The MESSENGER mission to Mercury offers our first opportunity to explore this planet's miniature magnetosphere since Mariner 10's brief fly-bys in 1974-5. Mercury's magnetosphere is unique in many respects. The magnetosphere of Mercury is the smallest in the solar system with its magnetic field typically standing off the solar wind only - 1000 to 2000 km above the surface. For this reason there are no closed dri-fi paths for energetic particles and, hence, no radiation belts; the characteristic time scales for wave propagation and convective transport are short possibly coupling kinetic and fluid modes; magnetic reconnection at the dayside magnetopause may erode the subsolar magnetosphere allowing solar wind ions to directly impact the dayside regolith; inductive currents in Mercury's interior should act to modify the solar In addition, Mercury's magnetosphere is the only one with its defining magnetic flux tubes rooted in a planetary regolith as opposed to an atmosphere with a conductive ionosphere. This lack of an ionosphere is thought to be the underlying reason for the brevity of the very intense, but short lived, approx. 1-2 min, substorm-like energetic particle events observed by Mariner 10 in Mercury's magnetic tail. In this seminar, we review what we think we know about Mercury's magnetosphere and describe the MESSENGER science team's strategy for obtaining answers to the outstanding science questions surrounding the interaction of the solar wind with Mercury and its small, but dynamic magnetosphere.

  6. Global Mercury Assessment 2013

    International Development Research Centre (IDRC) Digital Library (Canada)

    mercury pollution. This summary report and the accompanying. Technical Background Report for the Global. Mercury Assessment 2013 are developed in response to Decision 25/5, paragraph ... The use of different pollution control technologies in different ...... vegetation, snow, freshwater, and seawater. One of the largest ...

  7. Municipal actions to reduce mercury

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    2005-03-15

    This paper presented proper management practices for products containing mercury. The measures can help reduce mercury releases, occupational exposure and mercury spills, thereby preventing impacts on human health and the environment. Despite mercury's toxic nature, many common products that contain mercury are commercially available. These include thermostats, thermometers, fluorescent lamps, pressure measuring devices, electrical switches and relays, and dental amalgam. Mercury emissions are also associated with base metal smelting, waste incineration and coal-fired power generation. Mercury in the environment is a global issue, because it can travel in the atmosphere on wind currents. The actions taken by municipalities to address the issue include reducing or eliminating mercury releases from internal municipal operations and sources within the community. This document provided guidance on how to develop a Municipal Mercury Elimination Policy and Plan that will help reduce mercury releases. It presented information and case studies that will help municipalities manage mercury-containing products found in municipal buildings and street lighting. Information on sources of mercury from within the community was presented along with case studies that can help municipalities determine where community action is needed to reduce mercury releases. The 5 modules of this document were intended to help municipalities identify priorities, timelines and budget requirements for mercury initiatives. It was emphasized that municipalities that adopt a Municipal Mercury Elimination Policy and Plan formally commit to reducing and eliminating mercury from the environment. tabs., figs.

  8. Getting Mercury out of Schools.

    Science.gov (United States)

    1999

    This guide was prepared while working with many Massachusetts schools to remove items that contain mercury and to find suitable alternatives. It contains fact sheets on: mercury in science laboratories and classrooms, mercury in school buildings and maintenance areas, mercury in the medical office and in medical technology classrooms in vocational…

  9. Mercury's Dynamic Magnetic Tail

    Science.gov (United States)

    Slavin, James A.

    2010-01-01

    The Mariner 10 and MESSENGER flybys of Mercury have revealed a magnetosphere that is likely the most responsive to upstream interplanetary conditions of any in the solar system. The source of the great dynamic variability observed during these brief passages is due to Mercury's proximity to the Sun and the inverse proportionality between reconnection rate and solar wind Alfven Mach number. However, this planet's lack of an ionosphere and its small physical dimensions also contribute to Mercury's very brief Dungey cycle, approx. 2 min, which governs the time scale for internal plasma circulation. Current observations and understanding of the structure and dynamics of Mercury's magnetotail are summarized and discussed. Special emphasis will be placed upon such questions as: 1) How much access does the solar wind have to this small magnetosphere as a function of upstream conditions? 2) What roles do heavy planetary ions play? 3) Do Earth-like substorms take place at Mercury? 4) How does Mercury's tail respond to extreme solar wind events such coronal mass ejections? Prospects for progress due to advances in the global magnetohydrodynamic and hybrid simulation modeling and the measurements to be taken by MESSENGER after it enters Mercury orbit on March 18, 2011 will be discussed.

  10. Direct determination of mercury in cosmetic samples by isotope dilution inductively coupled plasma mass spectrometry after dissolution with formic acid

    Energy Technology Data Exchange (ETDEWEB)

    Gao, Ying; Shi, Zeming; Zong, Qinxia; Wu, Peng; Su, Jing [Sichuan Provincial Key Laboratory of Nuclear Technology in Geology, College of Nuclear Technology and Automation Engineering, Chengdu University of Technology, Chengdu 610059 (China); Liu, Rui, E-mail: liur.ray@gmail.com [Mineral Resources Chemistry Key Laboratory of Sichuan Higher Education Institutions, College of Materials and Chemistry and Chemical Engineering, Chengdu University of Technology, Chengdu 610059 (China)

    2014-02-17

    Graphical abstract: -- Highlights: •Simple, sensitive, and accurate method is established for mercury determination in cosmetics. •The sample preparation procedure is highly simplified. •Isotope dilution efficiently eliminates matrix effect. •First report of using formic acid based method in combination with PVG-ID-ICP MS for mercury quantitation in cosmetics. -- Abstract: A new method was proposed for the accurate determination of mercury in cosmetic samples based on isotopic dilution (ID)-photochemical vapor generation (PVG)-inductively coupled plasma mass spectrometry (ICP MS) measurement. Cosmetic samples were directly dissolved in formic acid solution and subsequently subjected to PVG for the reduction of mercury into vapor species following by ICP MS detection. Therefore, the risks of analyte contamination and loss were avoided. Highly enriched {sup 201}Hg isotopic spike is added to cosmetics and the isotope ratios of {sup 201}Hg/{sup 202}Hg were measured for the quantitation of mercury. With ID calibration, the influences originating from sample matrixes for the determination of mercury in cosmetic samples have been efficiently eliminated. The effects of several experimental parameters, such as the concentration of the formic acid, and the flow rates of carrier gas and sample were investigated. The method provided good reproducibility and the detection limits were found to be 0.6 pg mL{sup −1}. Finally, the developed method was successfully applied for the determination of mercury in six cosmetic samples and a spike test was performed to verify the accuracy of the method.

  11. Direct determination of mercury in cosmetic samples by isotope dilution inductively coupled plasma mass spectrometry after dissolution with formic acid

    International Nuclear Information System (INIS)

    Gao, Ying; Shi, Zeming; Zong, Qinxia; Wu, Peng; Su, Jing; Liu, Rui

    2014-01-01

    Graphical abstract: -- Highlights: •Simple, sensitive, and accurate method is established for mercury determination in cosmetics. •The sample preparation procedure is highly simplified. •Isotope dilution efficiently eliminates matrix effect. •First report of using formic acid based method in combination with PVG-ID-ICP MS for mercury quantitation in cosmetics. -- Abstract: A new method was proposed for the accurate determination of mercury in cosmetic samples based on isotopic dilution (ID)-photochemical vapor generation (PVG)-inductively coupled plasma mass spectrometry (ICP MS) measurement. Cosmetic samples were directly dissolved in formic acid solution and subsequently subjected to PVG for the reduction of mercury into vapor species following by ICP MS detection. Therefore, the risks of analyte contamination and loss were avoided. Highly enriched 201 Hg isotopic spike is added to cosmetics and the isotope ratios of 201 Hg/ 202 Hg were measured for the quantitation of mercury. With ID calibration, the influences originating from sample matrixes for the determination of mercury in cosmetic samples have been efficiently eliminated. The effects of several experimental parameters, such as the concentration of the formic acid, and the flow rates of carrier gas and sample were investigated. The method provided good reproducibility and the detection limits were found to be 0.6 pg mL −1 . Finally, the developed method was successfully applied for the determination of mercury in six cosmetic samples and a spike test was performed to verify the accuracy of the method

  12. Inorganic: the other mercury.

    Science.gov (United States)

    Risher, John F; De Rosa, Christopher T

    2007-11-01

    There is a broad array of mercury species to which humans may be exposed. While exposure to methylmercury through fish consumption is widely recognized, the public is less aware of the sources and potential toxicity of inorganic forms of mercury. Some oral and laboratory thermometers, barometers, small batteries, thermostats, gas pressure regulators, light switches, dental amalgam fillings, cosmetic products, medications, cultural/religious practices, and gold mining all represent potential sources of exposure to inorganic forms of mercury. The route of exposure, the extent of absorption, the pharmacokinetics, and the effects all vary with the specific form of mercury and the magnitude and duration of exposure. If exposure is suspected, a number of tissue analyses can be conducted to confirm exposure or to determine whether an exposure might reasonably be expected to be biologically significant. By contrast with determination of exposure to methylmercury, for which hair and blood are credible indicators, urine is the preferred biological medium for the determination of exposure to inorganic mercury, including elemental mercury, with blood normally being of value only if exposure is ongoing. Although treatments are available to help rid the body of mercury in cases of extreme exposure, prevention of exposure will make such treatments unnecessary. Knowing the sources of mercury and avoiding unnecessary exposure are the prudent ways of preventing mercury intoxication. When exposure occurs, it should be kept in mind that not all unwanted exposures will result in adverse health consequences. In all cases, elimination of the source of exposure should be the first priority of public health officials.

  13. Recovery of mercury from mercury compounds via electrolytic methods

    Science.gov (United States)

    Grossman, Mark W.; George, William A.

    1988-01-01

    A process for electrolytically recovering mercury from mercury compounds is provided. In one embodiment, Hg is recovered from Hg.sub.2 Cl.sub.2 employing as the electrolyte solution a mixture of HCl and H.sub.2 O. In another embodiment, Hg is electrolytically recovered from HgO wherein the electrolyte solution is comprised of glacial acetic acid and H.sub.2 O. Also provided is an apparatus for producing isotopically enriched mercury compounds in a reactor and then transporting the dissolved compounds into an electrolytic cell where mercury ions are electrolytically reduced and elemental mercury recovered from the mercury compounds.

  14. The tectonics of Mercury

    International Nuclear Information System (INIS)

    Melosh, H.J.; Mckinnon, W.B.

    1988-01-01

    The probable tectonic history of Mercury and the relative sequence of events are discussed on the basis of data collected by the Mariner-10 spacecraft. Results indicate that Mercury's tectonic activity was confined to its early history; its endogenic activity was principally due to a small change in the shape of its lithosphere, caused by tidal despinning, and a small change in area caused by shrinkage due to cooling. Exogenic processes, in particular the impact activity, have produced more abundant tectonic features. Many features associated with the Caloris basin are due to loading of Mercury's thick lithosphere by extrusive lavas or subsidence due to magma withdrawal. It is emphasized that tectonic features observed on Mercury yield insight into the earliest tectonic events on planets like Mars and, perhaps, the earth, where subsequent events obscured or erased the most ancient tectonic records

  15. Mercury CEM Calibration

    Energy Technology Data Exchange (ETDEWEB)

    John F. Schabron; Joseph F. Rovani; Susan S. Sorini

    2007-03-31

    The Clean Air Mercury Rule (CAMR) which was published in the Federal Register on May 18, 2005, requires that calibration of mercury continuous emissions monitors (CEMs) be performed with NIST-traceable standards. Western Research Institute (WRI) is working closely with the Electric Power Research Institute (EPRI), the National Institute of Standards and Technology (NIST), and the Environmental Protection Agency (EPA) to facilitate the development of the experimental criteria for a NIST traceability protocol for dynamic elemental mercury vapor generators. The traceability protocol will be written by EPA. Traceability will be based on the actual analysis of the output of each calibration unit at several concentration levels ranging from about 2-40 ug/m{sup 3}, and this analysis will be directly traceable to analyses by NIST using isotope dilution inductively coupled plasma/mass spectrometry (ID ICP/MS) through a chain of analyses linking the calibration unit in the power plant to the NIST ID ICP/MS. Prior to this project, NIST did not provide a recommended mercury vapor pressure equation or list mercury vapor pressure in its vapor pressure database. The NIST Physical and Chemical Properties Division in Boulder, Colorado was subcontracted under this project to study the issue in detail and to recommend a mercury vapor pressure equation that the vendors of mercury vapor pressure calibration units can use to calculate the elemental mercury vapor concentration in an equilibrium chamber at a particular temperature. As part of this study, a preliminary evaluation of calibration units from five vendors was made. The work was performed by NIST in Gaithersburg, MD and Joe Rovani from WRI who traveled to NIST as a Visiting Scientist.

  16. Mercury in human hair

    International Nuclear Information System (INIS)

    Kapauan, P.A.; Cruz, C.C.; Verceluz, F.P.

    1980-10-01

    The analysis of mercury (Hg) in scalp hair obtained from individuals residing in five different localities in the Philippines - Metro Manila, Naga City in Bicol, Bataan, Oriental Mindoro, and Palawan is presented. An overall mean of 1.46 ug/g of hair was obtained for all samples excluding those from Palawan and represents a baseline value.'' In terms of the mercury levels found in hair, the Honda Bay area in Palawan is, relatively, a ''contaminated area.'' (author)

  17. Mercury Isotopic Evidence for Contrasting Mercury Transport Pathways to Coastal versus Open Ocean Fisheries (Invited)

    Science.gov (United States)

    Blum, J. D.; Senn, D. B.; Chesney, E. J.; Bank, M. S.; Maage, A.; Shine, J. P.

    2009-12-01

    Mercury stable isotopes provide a new method for tracing the sources and chemical transformations of Hg in the environment. In this study we used Hg isotopes to investigate Hg sources to coastal versus migratory open-ocean species of fish residing in the northern Gulf of Mexico (nGOM). We report Hg isotope ratios as δ202Hg (mass dependent fractionation relative to NIST 3133) and Δ201Hg (mass independent fractionation of odd isotopes). In six coastal and two open ocean species (blackfin and yellowfin tuna), Hg isotopic compositions fell into two non-overlapping ranges. The tuna had significantly higher δ202Hg (0.1 to 0.7‰) and Δ201Hg (1.0 to 2.2‰) than the coastal fish (δ202Hg = 0 to -1.0‰; Δ201Hg = 0.4 to 0.5‰). The observations can be best explained by largely disconnected food webs with isotopically distinct MeHg sources. The ratio Δ199Hg/Δ201Hg in nGOM fish is 1.30±0.10 which is consistent with laboratory studies of photochemical MeHg degradation and with ratios measured in freshwater fish (Bergquist and Blum, 2007). The magnitude of mass independent fractionation of Hg in the open-ocean fish suggests that this source of MeHg was subjected to extensive photodegradation (~50%) before entering the base of the open-ocean food web. Given the Mississippi River’s large, productive footprint in the nGOM and the potential for exporting prey and MeHg to the adjacent oligotrophic GOM, the different MeHg sources are noteworthy and consistent with recent evidence in other systems of important open-ocean MeHg sources. Bergquist, B. A. and Blum, J. D., 2007. Mass-dependent and -independent fractionation of Hg isotopes by photoreduction in aquatic systems. Science 318, 417-420.

  18. Method and apparatus for monitoring mercury emissions

    Science.gov (United States)

    Durham, Michael D.; Schlager, Richard J.; Sappey, Andrew D.; Sagan, Francis J.; Marmaro, Roger W.; Wilson, Kevin G.

    1997-01-01

    A mercury monitoring device that continuously monitors the total mercury concentration in a gas. The device uses the same chamber for converting speciated mercury into elemental mercury and for measurement of the mercury in the chamber by radiation absorption techniques. The interior of the chamber is resistant to the absorption of speciated and elemental mercury at the operating temperature of the chamber.

  19. 42 CFR 50.201 - Applicability.

    Science.gov (United States)

    2010-10-01

    ... 42 Public Health 1 2010-10-01 2010-10-01 false Applicability. 50.201 Section 50.201 Public Health PUBLIC HEALTH SERVICE, DEPARTMENT OF HEALTH AND HUMAN SERVICES GRANTS POLICIES OF GENERAL APPLICABILITY... Public Health Service. ...

  20. Double spike with isotope pattern deconvolution for mercury speciation

    International Nuclear Information System (INIS)

    Castillo, A.; Rodriguez-Gonzalez, P.; Centineo, G.; Roig-Navarro, A.F.; Garcia Alonso, J.I.

    2009-01-01

    Full text: A double-spiking approach, based on an isotope pattern deconvolution numerical methodology, has been developed and applied for the accurate and simultaneous determination of inorganic mercury (IHg) and methylmercury (MeHg). Isotopically enriched mercury species ( 199 IHg and 201 MeHg) are added before sample preparation to quantify the extent of methylation and demethylation processes. Focused microwave digestion was evaluated to perform the quantitative extraction of such compounds from solid matrices of environmental interest. Satisfactory results were obtained in different certificated reference materials (dogfish liver DOLT-4 and tuna fish CRM-464) both by using GC-ICPMS and GC-MS, demonstrating the suitability of the proposed analytical method. (author)

  1. Mercury pollution in Malaysia.

    Science.gov (United States)

    Hajeb, Parvaneh; Jinap, S; Ismail, Ahmad; Mahyudin, Nor Ainy

    2012-01-01

    Although several studies have been published on levels of mercury contamination of the environment, and of food and human tissues in Peninsular Malaysia, there is a serious dearth of research that has been performed in East Malaysia (Sabah and Sarawak). Industry is rapidly developing in East Malaysia, and, hence, there is a need for establishing baseline levels of mercury contamination in environmental media in that part of the country by performing monitoring studies. Residues of total mercury and inorganic in food samples have been determined in nearly all previous studies that have been conducted; however, few researchers have analyzed samples for the presence of methlymercury residues. Because methylmercury is the most toxic form of mercury, and because there is a growing public awareness of the risk posed by methylmercury exposure that is associated with fish and seafood consumption, further monitoring studies on methylmercury in food are also essential. From the results of previous studies, it is obvious that the economic development in Malaysia, in recent years, has affected the aquatic environment of the country. Primary areas of environmental concern are centered on the rivers of the west Peninsular Malaysian coast, and the coastal waters of the Straits of Malacca, wherein industrial activities are rapidly expanding. The sources of existing mercury input to both of these areas of Malaysia should be studied and identified. Considering the high levels of mercury that now exists in human tissues, efforts should be continued, and accelerated in the future, if possible, to monitor mercury contamination levels in the coastal states, and particularly along the west Peninsular Malaysian coast. Most studies that have been carried out on mercury residues in environmental samples are dated, having been conducted 20-30 years ago; therefore, the need to collect much more and more current data is urgent. Furthermore, establishing baseline levels of mercury exposure to

  2. Fabrication of mercury target vessel

    International Nuclear Information System (INIS)

    Wakui, Takashi; Kogawa, Hiroyuki; Haga, Katsuhiro; Futakawa, Masatoshi; Hayashi, Ryoichi; Uchiyama, Naoyoshi; Okamoto, Yoshinao; Nakamura, Koji

    2010-03-01

    The construction of materials and life science experimental facility in J-PARC (Japan Proton Accelerator Complex) project had been completed and accepted pulsed proton beams with low power. Since 2003, the detailed design, fabrication and examination for the mercury target vessel as a pulsed neutron source were carried out by the vender. The mercury target vessel consists of triple-walled structure in order to prevent the leak of mercury to outside at the failure of the mercury vessel and to remove the heat of the safety hull, which covers the mercury vessel, due to the injection of the pulsed proton beams. The high fabrication accuracy is required for the mercury target vessel assembled by the welding, because there are the relationships between the mercury target vessel and other components (target trolley, target storage container, flange of helium vessel, reflector and water-cooled shield). At each fabrication step, the examinations for the mercury target vessel with multi-walled structure were required. In this report, the required specification and basic structure of parts in the mercury target vessel are described and the fabrication procedure of the mercury target vessel by the vender is reported. In the fabrication of the mercury target vessel, there were many troubles such as large deformation due to the welding and then the vender repaired and brought the mercury target vessel to completion. Furthermore, improvements for the design and fabrication of the mercury target are reported. (author)

  3. 19 CFR 201.43 - Program.

    Science.gov (United States)

    2010-04-01

    ... 19 Customs Duties 3 2010-04-01 2010-04-01 false Program. 201.43 Section 201.43 Customs Duties... Information § 201.43 Program. The Director of Administration is designated as the official of the Commission who is responsible for implementation and oversight of information security programs and procedures...

  4. 49 CFR 384.201 - Testing program.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 5 2010-10-01 2010-10-01 false Testing program. 384.201 Section 384.201... COMMERCIAL DRIVER'S LICENSE PROGRAM Minimum Standards for Substantial Compliance by States § 384.201 Testing program. The State shall adopt and administer a program for testing and ensuring the fitness of persons to...

  5. 50 CFR 300.201 - Definition.

    Science.gov (United States)

    2010-10-01

    ... 50 Wildlife and Fisheries 7 2010-10-01 2010-10-01 false Definition. 300.201 Section 300.201... Definition of Illegal, Unreported, or Unregulated Fishing § 300.201 Definition. Illegal, unreported, or... fish stocks shared by the United States, for which there are no applicable international conservation...

  6. 28 CFR 31.201 - Audit.

    Science.gov (United States)

    2010-07-01

    ... 28 Judicial Administration 1 2010-07-01 2010-07-01 false Audit. 31.201 Section 31.201 Judicial Administration DEPARTMENT OF JUSTICE OJJDP GRANT PROGRAMS Formula Grants General Requirements § 31.201 Audit. The State must assure that it adheres to the audit requirements enumerated in the “Financial and...

  7. 46 CFR 201.51 - Computation.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 8 2010-10-01 2010-10-01 false Computation. 201.51 Section 201.51 Shipping MARITIME... (Rule 5) § 201.51 Computation. In computing any period of time under these Rules, the time begins with... seven (7) days, intermediate Saturdays, Sundays, and holidays shall be excluded from the computation. ...

  8. 42 CFR 441.201 - Definition.

    Science.gov (United States)

    2010-10-01

    ... 42 Public Health 4 2010-10-01 2010-10-01 false Definition. 441.201 Section 441.201 Public Health CENTERS FOR MEDICARE & MEDICAID SERVICES, DEPARTMENT OF HEALTH AND HUMAN SERVICES (CONTINUED) MEDICAL ASSISTANCE PROGRAMS SERVICES: REQUIREMENTS AND LIMITS APPLICABLE TO SPECIFIC SERVICES Abortions § 441.201...

  9. 40 CFR 243.201 - Safety.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 24 2010-07-01 2010-07-01 false Safety. 243.201 Section 243.201 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) SOLID WASTES GUIDELINES FOR THE STORAGE... Procedures § 243.201 Safety. ...

  10. 49 CFR 382.201 - Alcohol concentration.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 5 2010-10-01 2010-10-01 false Alcohol concentration. 382.201 Section 382.201... ALCOHOL USE AND TESTING Prohibitions § 382.201 Alcohol concentration. No driver shall report for duty or... concentration of 0.04 or greater. No employer having actual knowledge that a driver has an alcohol concentration...

  11. 17 CFR 201.57 - Commission review.

    Science.gov (United States)

    2010-04-01

    ... 17 Commodity and Securities Exchanges 2 2010-04-01 2010-04-01 false Commission review. 201.57 Section 201.57 Commodity and Securities Exchanges SECURITIES AND EXCHANGE COMMISSION RULES OF PRACTICE Regulations Pertaining to the Equal Access to Justice Act § 201.57 Commission review. In accordance with the...

  12. 19 CFR 201.140 - Employment.

    Science.gov (United States)

    2010-04-01

    ... 19 Customs Duties 3 2010-04-01 2010-04-01 false Employment. 201.140 Section 201.140 Customs Duties... Commission § 201.140 Employment. No qualified handicapped person shall, on the basis of handicap, be subjected to discrimination in employment under any program or activity conducted by the agency. The...

  13. 18 CFR 706.201 - Proscribed actions.

    Science.gov (United States)

    2010-04-01

    ... economy; (d) Losing complete independence or impartiality; (e) Making a Government decision outside....201 Section 706.201 Conservation of Power and Water Resources WATER RESOURCES COUNCIL EMPLOYEE RESPONSIBILITIES AND CONDUCT Conduct and Responsibilities of Employees § 706.201 Proscribed actions. An employee...

  14. 21 CFR 201.105 - Veterinary drugs.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 4 2010-04-01 2010-04-01 false Veterinary drugs. 201.105 Section 201.105 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES (CONTINUED) DRUGS: GENERAL LABELING Exemptions From Adequate Directions for Use § 201.105 Veterinary drugs. A drug subject to the...

  15. 49 CFR 393.201 - Frames.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 5 2010-10-01 2010-10-01 false Frames. 393.201 Section 393.201 Transportation... SAFE OPERATION Frames, Cab and Body Components, Wheels, Steering, and Suspension Systems § 393.201 Frames. (a) The frame or chassis of each commercial motor vehicle shall not be cracked, loose, sagging or...

  16. 7 CFR 201.3 - Administrator.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 3 2010-01-01 2010-01-01 false Administrator. 201.3 Section 201.3 Agriculture Regulations of the Department of Agriculture (Continued) AGRICULTURAL MARKETING SERVICE (Standards... REGULATIONS Administration § 201.3 Administrator. The Administrator of the Agricultural Marketing Service may...

  17. 32 CFR 724.201 - Authority.

    Science.gov (United States)

    2010-07-01

    ... 32 National Defense 5 2010-07-01 2010-07-01 false Authority. 724.201 Section 724.201 National Defense Department of Defense (Continued) DEPARTMENT OF THE NAVY PERSONNEL NAVAL DISCHARGE REVIEW BOARD Authority/Policy for Departmental Discharge Review § 724.201 Authority. The Naval Discharge Review Board...

  18. 48 CFR 24.201 - Authority.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 1 2010-10-01 2010-10-01 false Authority. 24.201 Section 24.201 Federal Acquisition Regulations System FEDERAL ACQUISITION REGULATION SOCIOECONOMIC PROGRAMS PROTECTION OF PRIVACY AND FREEDOM OF INFORMATION Freedom of Information Act 24.201 Authority. The Freedom of...

  19. 7 CFR 201.63 - Germination.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 3 2010-01-01 2010-01-01 false Germination. 201.63 Section 201.63 Agriculture... REGULATIONS Tolerances § 201.63 Germination. The following tolerances are applicable to the percentage of germination and also to the sum of the germination plus the hard seed when 400 or more seeds are tested. Mean...

  20. 7 CFR 201.6 - Germination.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 3 2010-01-01 2010-01-01 false Germination. 201.6 Section 201.6 Agriculture... REGULATIONS Records for Agricultural and Vegetable Seeds § 201.6 Germination. The complete record shall include the records of all laboratory tests for germination and hard seed for each lot of seed offered for...

  1. 7 CFR 201.20 - Germination.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 3 2010-01-01 2010-01-01 false Germination. 201.20 Section 201.20 Agriculture... REGULATIONS Labeling Agricultural Seeds § 201.20 Germination. The label shall show the percentage of germination each kind, or kind and variety, or kind and type, or kind and hybrid of agricultural seed present...

  2. 7 CFR 1260.201 - Reports.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 10 2010-01-01 2010-01-01 false Reports. 1260.201 Section 1260.201 Agriculture... Promotion and Research Order Reports, Books and Records § 1260.201 Reports. Each importer, person marketing... shall report to the Board periodically information required by regulations prescribed by the Board and...

  3. 7 CFR 201.30 - Hard seed.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 3 2010-01-01 2010-01-01 false Hard seed. 201.30 Section 201.30 Agriculture..., Inspections, Marketing Practices), DEPARTMENT OF AGRICULTURE (CONTINUED) FEDERAL SEED ACT FEDERAL SEED ACT REGULATIONS Labeling Vegetable Seeds § 201.30 Hard seed. The label shall show the percentage of hard seed, if...

  4. 7 CFR 201.21 - Hard seed.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 3 2010-01-01 2010-01-01 false Hard seed. 201.21 Section 201.21 Agriculture..., Inspections, Marketing Practices), DEPARTMENT OF AGRICULTURE (CONTINUED) FEDERAL SEED ACT FEDERAL SEED ACT REGULATIONS Labeling Agricultural Seeds § 201.21 Hard seed. The label shall show the percentage of hard seed...

  5. 47 CFR 201.2 - Definitions.

    Science.gov (United States)

    2010-10-01

    ... joint industry-government telecommunications entity established by the NCS pursuant to Executive Order... 47 Telecommunication 5 2010-10-01 2010-10-01 false Definitions. 201.2 Section 201.2 Telecommunication OFFICE OF SCIENCE AND TECHNOLOGY POLICY AND NATIONAL SECURITY COUNCIL EXECUTIVE POLICY § 201.2...

  6. Thymic scintigraphy using 201Tl-chloride

    International Nuclear Information System (INIS)

    Fukuda, Teruo; Itami, Michimasa; Sawa, Hisashi; Furukawa, Takashi; Harada, Shigeru

    1980-01-01

    Thymic scintigraphy using Thallium-201 Chloride ( 201 TlCl) was performed on 3 cases of thymoma (2 malignant mediastinal thymomas and 1 benign cervical thymoma). All of the 3 cases exhibited high abnormal activities corresponding to the tumor on the scintigram. Thus it is useful to perform the scintigraphy using 201 TlCl for the detection of thymoma. (author)

  7. 43 CFR 17.201 - Application.

    Science.gov (United States)

    2010-10-01

    ... 43 Public Lands: Interior 1 2010-10-01 2010-10-01 false Application. 17.201 Section 17.201 Public Lands: Interior Office of the Secretary of the Interior NONDISCRIMINATION IN FEDERALLY ASSISTED PROGRAMS OF THE DEPARTMENT OF THE INTERIOR Nondiscrimination on the Basis of Handicap § 17.201 Application...

  8. 7 CFR 201.59 - Application.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 3 2010-01-01 2010-01-01 false Application. 201.59 Section 201.59 Agriculture Regulations of the Department of Agriculture (Continued) AGRICULTURAL MARKETING SERVICE (Standards... REGULATIONS Tolerances § 201.59 Application. Tolerances shall be recognized between the percentages or rates...

  9. 46 CFR 16.201 - Application.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 1 2010-10-01 2010-10-01 false Application. 16.201 Section 16.201 Shipping COAST GUARD, DEPARTMENT OF HOMELAND SECURITY MERCHANT MARINE OFFICERS AND SEAMEN CHEMICAL TESTING Required Chemical Testing § 16.201 Application. (a) Chemical testing of personnel must be conducted as required by this...

  10. 7 CFR 201.50 - Weed seed.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 3 2010-01-01 2010-01-01 false Weed seed. 201.50 Section 201.50 Agriculture... REGULATIONS Purity Analysis in the Administration of the Act § 201.50 Weed seed. Seeds (including bulblets or tubers) of plants shall be considered weed seeds when recognized as weed seeds by the law or rules and...

  11. 7 CFR 201.15 - Weed seeds.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 3 2010-01-01 2010-01-01 false Weed seeds. 201.15 Section 201.15 Agriculture... REGULATIONS Labeling Agricultural Seeds § 201.15 Weed seeds. The percentage of weed seeds shall include seeds of plants considered weeds in the State into which the seed is offered for transportation or...

  12. 31 CFR 800.201 - Business day.

    Science.gov (United States)

    2010-07-01

    ... 31 Money and Finance: Treasury 3 2010-07-01 2010-07-01 false Business day. 800.201 Section 800.201 Money and Finance: Treasury Regulations Relating to Money and Finance (Continued) OFFICE OF INVESTMENT... FOREIGN PERSONS Definitions § 800.201 Business day. The term business day means Monday through Friday...

  13. 17 CFR 201.104 - Business hours.

    Science.gov (United States)

    2010-04-01

    ... 17 Commodity and Securities Exchanges 2 2010-04-01 2010-04-01 false Business hours. 201.104 Section 201.104 Commodity and Securities Exchanges SECURITIES AND EXCHANGE COMMISSION RULES OF PRACTICE Rules of Practice General Rules § 201.104 Business hours. The Headquarters office of the Commission, at...

  14. Mercury Emissions: The Global Context

    Science.gov (United States)

    Mercury emissions are a global problem that knows no national or continental boundaries. Mercury that is emitted to the air can travel thousands of miles in the atmosphere before it is eventually deposited back to the earth.

  15. Helium Pressure Shift of the Hyperfine Clock Transition in Hg-201(+)

    Science.gov (United States)

    Larigani, S. Taghavi; Burt, E. A.; Tjoelker, R. L.

    2010-01-01

    There are two stable odd isotopes of mercury with singly ionized hyperfine structure suitable for a microwave atomic clock: Hg-199(+) and Hg-201(+). We are investigating the viability of a trapped ion clock based on Hg-201(+) in a configuration that uses a buffer gas to increase ion loading efficiency and counter ion heating from rf trapping fields. Traditionally, either helium or neon is used as the buffer gas at approx. 10(exp -5) torr to confine mercury ions near room temperature. In addition to the buffer gas, other residual background gasses such as H2O, N2, O2, CO, CO2, and CH2 may be present in trace quantities. Collisions between trapped ions and buffer gas or background gas atoms/molecules produce a momentary shift of the ion clock transition frequency and constitute one of the largest systematic effects in this type of clock. Here we report an initial measurement of the He pressure shift in Hg-201(+) and compare this to Hg-199(+).

  16. Mercury's magnetic field and interior

    International Nuclear Information System (INIS)

    Connerney, J.E.P.; Ness, N.F.

    1988-01-01

    The magnetic-field data collected on Mercury by the Mariner-10 spacecraft present substantial evidence for an intrinsic global magnetic field. However, studies of Mercury's thermal evolution show that it is most likely that the inner core region of Mercury solidified or froze early in the planet's history. Thus, the explanation of Mercury's magnetic field in the framework of the traditional planetary dynamo is less than certain

  17. Reference Atmosphere for Mercury

    Science.gov (United States)

    Killen, Rosemary M.

    2002-01-01

    We propose that Ar-40 measured in the lunar atmosphere and that in Mercury's atmosphere is due to current diffusion into connected pore space within the crust. Higher temperatures at Mercury, along with more rapid loss from the atmosphere will lead to a smaller column abundance of argon at Mercury than at the Moon, given the same crustal abundance of potassium. Because the noble gas abundance in the Hermean atmosphere represents current effusion, it is a direct measure of the crustal potassium abundance. Ar-40 in the atmospheres of the planets is a measure of potassium abundance in the interiors, since Ar-40 is a product of radiogenic decay of K-40 by electron capture with the subsequent emission of a 1.46 eV gamma-ray. Although the Ar-40 in the Earth's atmosphere is expected to have accumulated since the late bombardment, Ar-40 in the atmospheres of Mercury and the Moon is eroded quickly by photoionization and electron impact ionization. Thus, the argon content in the exospheres of the Moon and Mercury is representative of current effusion rather than accumulation over the lifetime of the planet.

  18. Mercury content of edible mushrooms

    Energy Technology Data Exchange (ETDEWEB)

    Woidich, H.; Pfannhauser, W.

    1975-05-01

    The mercury content of edible fungi is different. Relatively high burdened are Boletus and Agaricus campestris. A minimum of mercury is found in Russula, Agaricus bisporus and Cantharellus cibarius. The possibilities of mercury uptake and the potential cumulation mechanism is discussed. 8 references, 3 tables.

  19. Mercury (Environmental Health Student Portal)

    Science.gov (United States)

    ... Water Waterborne Diseases & Illnesses Water Cycle Water Treatment Mercury The Basics Mercury — sometimes called quicksilver — is a natural metal. It’s ... to breathe it in without knowing it. When mercury combines with other chemical elements, it creates compounds, ...

  20. Sensing Mercury for Biomedical and Environmental Monitoring

    Directory of Open Access Journals (Sweden)

    Julia Xiaojun Zhao

    2009-07-01

    Full Text Available Mercury is a very toxic element that is widely spread in the atmosphere, lithosphere, and surface water. Concentrated mercury poses serious problems to human health, as bioaccumulation of mercury within the brain and kidneys ultimately leads to neurological diseases. To control mercury pollution and reduce mercury damage to human health, sensitive determination of mercury is important. This article summarizes some current sensors for the determination of both abiotic and biotic mercury. A wide array of sensors for monitoring mercury is described, including biosensors and chemical sensors, while piezoelectric and microcantilever sensors are also described. Additionally, newly developed nanomaterials offer great potential for fabricating novel mercury sensors. Some of the functional fluorescent nanosensors for the determination of mercury are covered. Afterwards, the in vivo determination of mercury and the characterization of different forms of mercury are discussed. Finally, the future direction for mercury detection is outlined, suggesting that nanomaterials may provide revolutionary tools in biomedical and environmental monitoring of mercury.

  1. Water displacement mercury pump

    Science.gov (United States)

    Nielsen, M.G.

    1984-04-20

    A water displacement mercury pump has a fluid inlet conduit and diffuser, a valve, a pressure cannister, and a fluid outlet conduit. The valve has a valve head which seats in an opening in the cannister. The entire assembly is readily insertable into a process vessel which produces mercury as a product. As the mercury settles, it flows into the opening in the cannister displacing lighter material. When the valve is in a closed position, the pressure cannister is sealed except for the fluid inlet conduit and the fluid outlet conduit. Introduction of a lighter fluid into the cannister will act to displace a heavier fluid from the cannister via the fluid outlet conduit. The entire pump assembly penetrates only a top wall of the process vessel, and not the sides or the bottom wall of the process vessel. This insures a leak-proof environment and is especially suitable for processing of hazardous materials.

  2. Mercury CEM Calibration

    Energy Technology Data Exchange (ETDEWEB)

    John Schabron; Joseph Rovani; Mark Sanderson

    2008-02-29

    Mercury continuous emissions monitoring systems (CEMS) are being implemented in over 800 coal-fired power plant stacks. The power industry desires to conduct at least a full year of monitoring before the formal monitoring and reporting requirement begins on January 1, 2009. It is important for the industry to have available reliable, turnkey equipment from CEM vendors. Western Research Institute (WRI) is working closely with the Electric Power Research Institute (EPRI), the National Institute of Standards and Technology (NIST), and the Environmental Protection Agency (EPA) to facilitate the development of the experimental criteria for a NIST traceability protocol for dynamic elemental mercury vapor generators. The generators are used to calibrate mercury CEMs at power plant sites. The Clean Air Mercury Rule (CAMR) which was published in the Federal Register on May 18, 2005 requires that calibration be performed with NIST-traceable standards (Federal Register 2007). Traceability procedures will be defined by EPA. An initial draft traceability protocol was issued by EPA in May 2007 for comment. In August 2007, EPA issued an interim traceability protocol for elemental mercury generators (EPA 2007). The protocol is based on the actual analysis of the output of each calibration unit at several concentration levels ranging initially from about 2-40 {micro}g/m{sup 3} elemental mercury, and in the future down to 0.2 {micro}g/m{sup 3}, and this analysis will be directly traceable to analyses by NIST. The document is divided into two separate sections. The first deals with the qualification of generators by the vendors for use in mercury CEM calibration. The second describes the procedure that the vendors must use to certify the generator models that meet the qualification specifications. The NIST traceable certification is performance based, traceable to analysis using isotope dilution inductively coupled plasma/mass spectrometry performed by NIST in Gaithersburg, MD. The

  3. Method and apparatus for sampling atmospheric mercury

    Science.gov (United States)

    Trujillo, Patricio E.; Campbell, Evan E.; Eutsler, Bernard C.

    1976-01-20

    A method of simultaneously sampling particulate mercury, organic mercurial vapors, and metallic mercury vapor in the working and occupational environment and determining the amount of mercury derived from each such source in the sampled air. A known volume of air is passed through a sampling tube containing a filter for particulate mercury collection, a first adsorber for the selective adsorption of organic mercurial vapors, and a second adsorber for the adsorption of metallic mercury vapor. Carbon black molecular sieves are particularly useful as the selective adsorber for organic mercurial vapors. The amount of mercury adsorbed or collected in each section of the sampling tube is readily quantitatively determined by flameless atomic absorption spectrophotometry.

  4. Mercury isotope fractionation during transfer from post-desulfurized seawater to air.

    Science.gov (United States)

    Huang, Shuyuan; Lin, Kunning; Yuan, Dongxing; Gao, Yaqin; Sun, Lumin

    2016-12-15

    Samples of dissolved gaseous mercury (DGM) in the post-desulfurized seawater discharged from a coal-fired power plant together with samples of gaseous elemental mercury (GEM) over the post-desulfurized seawater surface were collected and analyzed to study the mercury isotope fractionation during transfer from post-desulfurized seawater to air. Experimental results showed that when DGM in the seawater was converted to GEM in the air, the δ 202 Hg and Δ 199 Hg values were changed, ranging from -2.98 to -0.04‰ and from -0.31 to 0.64‰, respectively. Aeration played a key role in accelerating the transformation of DGM to GEM, and resulted in light mercury isotopes being more likely to be enriched in the GEM. The ratio Δ 199 Hg/Δ 201 Hg was 1.626 in all samples, suggesting that mercury mass independent fractionation occurred owing to the nuclear volume effect during the transformation. In addition, mass independent fractionation of mercury even isotopes was found in the GEM above the post-desulfurized seawater surface in the aeration pool. Copyright © 2016 Elsevier Ltd. All rights reserved.

  5. Mercury in soils and microbial biomass of the South Kirgizstan subregion of the biosphere

    Science.gov (United States)

    Vadim, Ermakov; Valentina, Danilova; Ul'yana, Gulyaeva

    2016-04-01

    negative correlation between the levels of the gross mercury and the mercury as extracted with hydrochloric acid is found. References 1. Danilova V.N., Khushvakhtova S.D., Ermakov V.V. Interaction of mercury with humic acids. Nowaday Problems of Soil Pollution. M.V. Lomonosov Moscow State University, 2010. P. 201-204 (in Russian). 2. Ermakov V.V., Danilova V.N. Bioaccumulation and destoxication of mercury/ Problems of Biogeochemistry and Geochemical Ecology, 2011. № 1 (15). P. 3-16 (in Russian).

  6. Blood mercury concentration, fish consumption and anthropometry in Chinese children: A national study.

    Science.gov (United States)

    Gao, Zhen-Yan; Li, Min-Ming; Wang, Ju; Yan, Jin; Zhou, Can-Can; Yan, Chong-Huai

    2018-01-01

    This study sought to obtain national cross-sectional data for blood mercury levels and risk factors for mercury exposure in Chinese children aged 0 to 6years to provide evidence to support preventive measures for reducing childhood blood mercury levels. A multi-stage, stratified, clustered random sampling survey was conducted May 2013-Mar 2015. Shanghai, Jilin, Shanxi, Guangdong, Qinghai, Yunnan and Hubei, which are located in seven different geographical regions in China, were selected as the study field. A total of 14,202 children aged 0-6years participated in the study. Whole-blood venous samples (3ml) were collected from the subjects for mercury exposure assessment. The DMA-80 was applied for mercury detection, and a health questionnaire gathering information on related confounders was completed by the subjects' parents of the subjects after they received guidance from the investigators. A general linear model was used for the primary descriptive statistical analysis. Odds ratios (ORs) and 95%CIs for the risk factors were estimated using unconditional logistic regression. A total of 14,202 eligible samples were collected. The mean mercury level was 1.39μg/L. Other results were as follows: median 1.23μg/L, p25 0.86μg/L, p75 1.73μg/L, and GM 1.10μg/L. Of the seven geographical regions, Qinghai, in northwestern China, had a median mercury level of 0.37μg/L, which was significantly lower than the mercury level in Guangdong, in southeastern China (2.01μg/L). The median blood mercury level of children in suburban areas was 1.34μg/L, which was remarkably higher than that of children in rural areas (1.09μg/L). Dichotomous subgroups were generated using the median mercury concentration. Unconditional logistic regression analysis revealed that fish consumption may contribute to increased blood mercury levels (pmercury concentrations and the children's anthropometric characteristics (BMI; pmercury concentrations among Chinese children aged 0-6years were

  7. Mercury analysis in hair

    DEFF Research Database (Denmark)

    Esteban, Marta; Schindler, Birgit Karin; Jiménez, José Antonio

    2015-01-01

    laboratories. Training sessions were organized for field workers and four external quality-assessment exercises (ICI/EQUAS), followed by the corresponding web conferences, were organized between March 2011 and February 2012. ICI/EQUAS used native hair samples at two mercury concentration ranges (0...

  8. Mercury exposure in Ireland

    DEFF Research Database (Denmark)

    Cullen, Elizabeth; Evans, David S; Davidson, Fred

    2014-01-01

    of a study to Coordinate and Perform Human Biomonitoring on a European Scale (DEMOCOPHES) pilot biomonitoring study. METHODS: Hair mercury concentrations were determined from a convenience sample of 120 mother/child pairs. Mothers also completed a questionnaire. Rigorous quality assurance within DEMOCOPHES...

  9. Metabolic models for methyl and inorganic mercury

    Energy Technology Data Exchange (ETDEWEB)

    Bernard, S.R.; Purdue, P.

    1984-03-01

    Following the outbreak of mercury poisoning in Minimata, Japan (1953-60), much work has been done on the toxicology of mercury - in particular methyl mercury. In this paper, the authors derive two compartmental models for the metabolism of methyl mercury and inorganic mercury based upon the data which have been collected since 1960.

  10. [Mercury in vaccines].

    Science.gov (United States)

    Hessel, Luc

    2003-01-01

    Thiomersal, also called thimerosal, is an ethyl mercury derivative used as a preservative to prevent bacterial contamination of multidose vaccine vials after they have been opened. Exposure to low doses of thiomersal has essentially been associated with hypersensitivity reactions. Nevertheless there is no evidence that allergy to thiomersal could be induced by thiomersal-containing vaccines. Allergy to thiomersal is usually of delayed-hypersensitivity type, but its detection through cutaneous tests is not very reliable. Hypersensitivity to thiomersal is not considered as a contraindication to the use of thiomersal-containing vaccines. In 1999 in the USA, thiomersal was present in approximately 30 different childhood vaccines, whereas there were only 2 in France. Although there were no evidence of neurological toxicity in infants related to the use of thiomersal-containing vaccines, the FDA considered that the cumulative dose of mercury received by young infants following vaccination was high enough (although lower than the FDA threshold for methyl mercury) to request vaccine manufacturers to remove thiomersal from vaccine formulations. Since 2002, all childhood vaccines used in Europe and the USA are thiomersal-free or contain only minute amounts of thiomersal. Recently published studies have shown that the mercury levels in the blood, faeces and urine of children who had received thiomersal-containing vaccines were much lower than those accepted by the American Environmental Protection Agency. It has also been demonstrated that the elimination of mercury in children was much faster than what was expected on the basis of studies conducted with methyl mercury originating from food. Recently, the hypothesis that mercury contained in vaccines could be the cause of autism and other neurological developmental disorders created a new debate in the medical community and the general public. To date, none of the epidemiological studies conducted in Europe and elsewhere

  11. Mercury Information Clearinghouse

    Energy Technology Data Exchange (ETDEWEB)

    Chad A. Wocken; Michael J. Holmes; Dennis L. Laudal; Debra F. Pflughoeft-Hassett; Greg F. Weber; Nicholas V. C. Ralston; Stanley J. Miller; Grant E. Dunham; Edwin S. Olson; Laura J. Raymond; John H. Pavlish; Everett A. Sondreal; Steven A. Benson

    2006-03-31

    The Canadian Electricity Association (CEA) identified a need and contracted the Energy & Environmental Research Center (EERC) to create and maintain an information clearinghouse on global research and development activities related to mercury emissions from coal-fired electric utilities. With the support of CEA, the Center for Air Toxic Metals{reg_sign} (CATM{reg_sign}) Affiliates, and the U.S. Department of Energy (DOE), the EERC developed comprehensive quarterly information updates that provide a detailed assessment of developments in the various areas of mercury monitoring, control, policy, and research. A total of eight topical reports were completed and are summarized and updated in this final CEA quarterly report. The original quarterly reports can be viewed at the CEA Web site (www.ceamercuryprogram.ca). In addition to a comprehensive update of previous mercury-related topics, a review of results from the CEA Mercury Program is provided. Members of Canada's coal-fired electricity generation sector (ATCO Power, EPCOR, Manitoba Hydro, New Brunswick Power, Nova Scotia Power Inc., Ontario Power Generation, SaskPower, and TransAlta) and CEA, have compiled an extensive database of information from stack-, coal-, and ash-sampling activities. Data from this effort are also available at the CEA Web site and have provided critical information for establishing and reviewing a mercury standard for Canada that is protective of environment and public health and is cost-effective. Specific goals outlined for the CEA mercury program included the following: (1) Improve emission inventories and develop management options through an intensive 2-year coal-, ash-, and stack-sampling program; (2) Promote effective stack testing through the development of guidance material and the support of on-site training on the Ontario Hydro method for employees, government representatives, and contractors on an as-needed basis; (3) Strengthen laboratory analytical capabilities through

  12. Small Mercury Relativity Orbiter

    Science.gov (United States)

    Bender, Peter L.; Vincent, Mark A.

    1989-01-01

    The accuracy of solar system tests of gravitational theory could be very much improved by range and Doppler measurements to a Small Mercury Relativity Orbiter. A nearly circular orbit at roughly 2400 km altitude is assumed in order to minimize problems with orbit determination and thermal radiation from the surface. The spacecraft is spin-stabilized and has a 30 cm diameter de-spun antenna. With K-band and X-band ranging systems using a 50 MHz offset sidetone at K-band, a range accuracy of 3 cm appears to be realistically achievable. The estimated spacecraft mass is 50 kg. A consider-covariance analysis was performed to determine how well the Earth-Mercury distance as a function of time could be determined with such a Relativity Orbiter. The minimum data set is assumed to be 40 independent 8-hour arcs of tracking data at selected times during a two year period. The gravity field of Mercury up through degree and order 10 is solved for, along with the initial conditions for each arc and the Earth-Mercury distance at the center of each arc. The considered parameters include the gravity field parameters of degree 11 and 12 plus the tracking station coordinates, the tropospheric delay, and two parameters in a crude radiation pressure model. The conclusion is that the Earth-Mercury distance can be determined to 6 cm accuracy or better. From a modified worst-case analysis, this would lead to roughly 2 orders of magnitude improvement in the knowledge of the precession of perihelion, the relativistic time delay, and the possible change in the gravitational constant with time.

  13. Mercury Phase II Study - Mercury Behavior in Salt Processing Flowsheet

    Energy Technology Data Exchange (ETDEWEB)

    Jain, V. [Savannah River Remediation, LLC., Aiken, SC (United States); Shah, H. [Savannah River Remediation, LLC., Aiken, SC (United States). Sludge and Salt Planning; Bannochie, C. J. [Savannah River Site (SRS), Aiken, SC (United States). Savannah River National Lab. (SRNL); Wilmarth, W. R. [Savannah River Site (SRS), Aiken, SC (United States). Savannah River National Lab. (SRNL)

    2016-07-25

    Mercury (Hg) in the Savannah River Site Liquid Waste System (LWS) originated from decades of canyon processing where it was used as a catalyst for dissolving the aluminum cladding of reactor fuel. Approximately 60 metric tons of mercury is currently present throughout the LWS. Mercury has long been a consideration in the LWS, from both hazard and processing perspectives. In February 2015, a Mercury Program Team was established at the request of the Department of Energy to develop a comprehensive action plan for long-term management and removal of mercury. Evaluation was focused in two Phases. Phase I activities assessed the Liquid Waste inventory and chemical processing behavior using a system-by-system review methodology, and determined the speciation of the different mercury forms (Hg+, Hg++, elemental Hg, organomercury, and soluble versus insoluble mercury) within the LWS. Phase II activities are building on the Phase I activities, and results of the LWS flowsheet evaluations will be summarized in three reports: Mercury Behavior in the Salt Processing Flowsheet (i.e. this report); Mercury Behavior in the Defense Waste Processing Facility (DWPF) Flowsheet; and Mercury behavior in the Tank Farm Flowsheet (Evaporator Operations). The evaluation of the mercury behavior in the salt processing flowsheet indicates, inter alia, the following: (1) In the assembled Salt Batches 7, 8 and 9 in Tank 21, the total mercury is mostly soluble with methylmercury (MHg) contributing over 50% of the total mercury. Based on the analyses of samples from 2H Evaporator feed and drop tanks (Tanks 38/43), the source of MHg in Salt Batches 7, 8 and 9 can be attributed to the 2H evaporator concentrate used in assembling the salt batches. The 2H Evaporator is used to evaporate DWPF recycle water. (2) Comparison of data between Tank 21/49, Salt Solution Feed Tank (SSFT), Decontaminated Salt Solution Hold Tank (DSSHT), and Tank 50 samples suggests that the total mercury as well as speciated

  14. Mercury Phase II Study - Mercury Behavior in Salt Processing Flowsheet

    International Nuclear Information System (INIS)

    Jain, V.; Shah, H.; Wilmarth, W. R.

    2016-01-01

    Mercury (Hg) in the Savannah River Site Liquid Waste System (LWS) originated from decades of canyon processing where it was used as a catalyst for dissolving the aluminum cladding of reactor fuel. Approximately 60 metric tons of mercury is currently present throughout the LWS. Mercury has long been a consideration in the LWS, from both hazard and processing perspectives. In February 2015, a Mercury Program Team was established at the request of the Department of Energy to develop a comprehensive action plan for long-term management and removal of mercury. Evaluation was focused in two Phases. Phase I activities assessed the Liquid Waste inventory and chemical processing behavior using a system-by-system review methodology, and determined the speciation of the different mercury forms (Hg+, Hg++, elemental Hg, organomercury, and soluble versus insoluble mercury) within the LWS. Phase II activities are building on the Phase I activities, and results of the LWS flowsheet evaluations will be summarized in three reports: Mercury Behavior in the Salt Processing Flowsheet (i.e. this report); Mercury Behavior in the Defense Waste Processing Facility (DWPF) Flowsheet; and Mercury behavior in the Tank Farm Flowsheet (Evaporator Operations). The evaluation of the mercury behavior in the salt processing flowsheet indicates, inter alia, the following: (1) In the assembled Salt Batches 7, 8 and 9 in Tank 21, the total mercury is mostly soluble with methylmercury (MHg) contributing over 50% of the total mercury. Based on the analyses of samples from 2H Evaporator feed and drop tanks (Tanks 38/43), the source of MHg in Salt Batches 7, 8 and 9 can be attributed to the 2H evaporator concentrate used in assembling the salt batches. The 2H Evaporator is used to evaporate DWPF recycle water. (2) Comparison of data between Tank 21/49, Salt Solution Feed Tank (SSFT), Decontaminated Salt Solution Hold Tank (DSSHT), and Tank 50 samples suggests that the total mercury as well as speciated

  15. A mercury transport and fate model (LM2-mercury) for mass budget assessment of mercury cycling in Lake Michigan

    Science.gov (United States)

    LM2-Mercury, a mercury mass balance model, was developed to simulate and evaluate the transport, fate, and biogeochemical transformations of mercury in Lake Michigan. The model simulates total suspended solids (TSS), disolved organic carbon (DOC), and total, elemental, divalent, ...

  16. Mercury Exposure and Heart Diseases.

    Science.gov (United States)

    Genchi, Giuseppe; Sinicropi, Maria Stefania; Carocci, Alessia; Lauria, Graziantonio; Catalano, Alessia

    2017-01-12

    Environmental contamination has exposed humans to various metal agents, including mercury. It has been determined that mercury is not only harmful to the health of vulnerable populations such as pregnant women and children, but is also toxic to ordinary adults in various ways. For many years, mercury was used in a wide variety of human activities. Nowadays, the exposure to this metal from both natural and artificial sources is significantly increasing. Recent studies suggest that chronic exposure, even to low concentration levels of mercury, can cause cardiovascular, reproductive, and developmental toxicity, neurotoxicity, nephrotoxicity, immunotoxicity, and carcinogenicity. Possible biological effects of mercury, including the relationship between mercury toxicity and diseases of the cardiovascular system, such as hypertension, coronary heart disease, and myocardial infarction, are being studied. As heart rhythm and function are under autonomic nervous system control, it has been hypothesized that the neurotoxic effects of mercury might also impact cardiac autonomic function. Mercury exposure could have a long-lasting effect on cardiac parasympathetic activity and some evidence has shown that mercury exposure might affect heart rate variability, particularly early exposures in children. The mechanism by which mercury produces toxic effects on the cardiovascular system is not fully elucidated, but this mechanism is believed to involve an increase in oxidative stress. The exposure to mercury increases the production of free radicals, potentially because of the role of mercury in the Fenton reaction and a reduction in the activity of antioxidant enzymes, such as glutathione peroxidase. In this review we report an overview on the toxicity of mercury and focus our attention on the toxic effects on the cardiovascular system.

  17. Mercury Exposure and Heart Diseases

    Directory of Open Access Journals (Sweden)

    Giuseppe Genchi

    2017-01-01

    Full Text Available Environmental contamination has exposed humans to various metal agents, including mercury. It has been determined that mercury is not only harmful to the health of vulnerable populations such as pregnant women and children, but is also toxic to ordinary adults in various ways. For many years, mercury was used in a wide variety of human activities. Nowadays, the exposure to this metal from both natural and artificial sources is significantly increasing. Recent studies suggest that chronic exposure, even to low concentration levels of mercury, can cause cardiovascular, reproductive, and developmental toxicity, neurotoxicity, nephrotoxicity, immunotoxicity, and carcinogenicity. Possible biological effects of mercury, including the relationship between mercury toxicity and diseases of the cardiovascular system, such as hypertension, coronary heart disease, and myocardial infarction, are being studied. As heart rhythm and function are under autonomic nervous system control, it has been hypothesized that the neurotoxic effects of mercury might also impact cardiac autonomic function. Mercury exposure could have a long-lasting effect on cardiac parasympathetic activity and some evidence has shown that mercury exposure might affect heart rate variability, particularly early exposures in children. The mechanism by which mercury produces toxic effects on the cardiovascular system is not fully elucidated, but this mechanism is believed to involve an increase in oxidative stress. The exposure to mercury increases the production of free radicals, potentially because of the role of mercury in the Fenton reaction and a reduction in the activity of antioxidant enzymes, such as glutathione peroxidase. In this review we report an overview on the toxicity of mercury and focus our attention on the toxic effects on the cardiovascular system.

  18. 7 CFR 201.11a - Hybrid.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 3 2010-01-01 2010-01-01 false Hybrid. 201.11a Section 201.11a Agriculture... REGULATIONS Labeling Agricultural Seeds § 201.11a Hybrid. If any one kind or kind and variety of seed present in excess of 5 percent is “hybrid” seed, it shall be designated “hybrid” on the label. The percentage...

  19. 7 CFR 201.41 - Bags.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 3 2010-01-01 2010-01-01 false Bags. 201.41 Section 201.41 Agriculture Regulations of... Sampling in the Administration of the Act § 201.41 Bags. (a) For lots of six bags or less, each bag shall be sampled. A total of at least five trierfuls shall be taken. (b) For lots of more than six bags...

  20. Thallium-201 for oncological imaging in children.

    Science.gov (United States)

    Nadel, H R

    1993-07-01

    Many pediatric centers are beginning to accumulate a large experience in the use of thallium-201 (201Tl) imaging with 201Tl requires a state-of-the-art high-resolution gamma camera computer system with single photon emission computed tomography (SPECT) capability and a physician-directed tailored examination. Tumor imaging with 201Tl, with its multifactorial localization mechanisms that are different from those for gallium-67, offers a distinct advantage over gallium tumor imaging with a short total imaging time. Tumors are variable in avidity and intensity of thallium uptake. Primary and metastatic disease can be detected with 201Tl scintigraphy. Baseline pretreatment determination of thallium avidity is crucial to its efficacy in therapeutic response assessment. Adjunctive SPECT imaging provides greater sensitivity for lesion detection and direct comparison of physiology (thallium uptake) with anatomy (computed tomography and magnetic resonance imaging). The sensitivity and specificity for detection of pediatric brain tumors has been reported as 77% and 93%, respectively. Thallium-201 brain SPECT also provides a less expensive and more readily available alternative to positron emission tomography for assessing the functional state of pediatric brain tumors. Extremity osteogenic sarcoma and Ewing's sarcoma have 100% sensitivity for 201Tl uptake pretreatment. Early results confirm an association between 201Tl uptake and histological tumor response. The determination of residual/recurrent disease versus thymic rebound and other nonneoplastic change in thallium-avid lymphoma, rhabdomyosarcoma, and germ cell tumors that involve the thorax can be confirmed with a 201Tl SPECT examination. Soft-tissue tumors elsewhere in the body may be detected with 201Tl scintigraphy. Thallium-201 does not exhibit 100% specificity for tumors. False-positive 201Tl uptake has been seen in histiocytosis X, benign bone tumors, stress fractures, and inflammation.

  1. Mercury's exosphere: observations during MESSENGER's First Mercury flyby.

    Science.gov (United States)

    McClintock, William E; Bradley, E Todd; Vervack, Ronald J; Killen, Rosemary M; Sprague, Ann L; Izenberg, Noam R; Solomon, Sean C

    2008-07-04

    During MESSENGER's first Mercury flyby, the Mercury Atmospheric and Surface Composition Spectrometer measured Mercury's exospheric emissions, including those from the antisunward sodium tail, calcium and sodium close to the planet, and hydrogen at high altitudes on the dayside. Spatial variations indicate that multiple source and loss processes generate and maintain the exosphere. Energetic processes connected to the solar wind and magnetospheric interaction with the planet likely played an important role in determining the distributions of exospheric species during the flyby.

  2. Recovery of mercury from acid waste residues

    Science.gov (United States)

    Greenhalgh, Wilbur O.

    1989-12-05

    Mercury can be recovered from nitric acid-containing fluids by reacting the fluid with aluminum metal to produce mercury metal, and then quenching the reactivity of the nitric acid prior to nitration of the mercury metal.

  3. Mercury Poisoning Linked to Skin Products

    Science.gov (United States)

    ... Products For Consumers Home For Consumers Consumer Updates Mercury Poisoning Linked to Skin Products Share Tweet Linkedin ... and, in some situations, criminal prosecution. Dangers of Mercury Exposure to mercury can have serious health consequences. ...

  4. Radiometric measurement of lead-201 and thallium-201 activity in industrial production of thallium chlorides

    International Nuclear Information System (INIS)

    Skokov, V.S.; Azbel', G.A.

    1989-01-01

    The spectrometric methods and equipment for 201 Pb and 201 Tl activity control in the prepared thallium chloride in industrial production are described. Estimation of thallium-201 activity is carried out in accord with the square of summary photopeak caused by γ-quanta at 167 keV energy. Attenuation is paid to spectrometer calibration. 5 refs.; 2 figs.; 2 tabs

  5. Mercury, Vaccines, and Autism

    Science.gov (United States)

    Baker, Jeffrey P.

    2008-01-01

    The controversy regarding the once widely used mercury-containing preservative thimerosal in childhood vaccines has raised many historical questions that have not been adequately explored. Why was this preservative incorporated in the first place? Was there any real evidence that it caused harm? And how did thimerosal become linked in the public mind to the “autism epidemic”? I examine the origins of the thimerosal controversy and their legacy for the debate that has followed. More specifically, I explore the parallel histories of three factors that converged to create the crisis: vaccine preservatives, mercury poisoning, and autism. An understanding of this history provides important lessons for physicians and policymakers seeking to preserve the public’s trust in the nation’s vaccine system. PMID:18172138

  6. Mercury in Canadian crude oil

    International Nuclear Information System (INIS)

    Hollebone, B.P.

    2005-01-01

    Estimates for average mercury concentrations in crude oil range widely from 10 ng/g of oil to 3,500 ng/g of oil. With such a broad range of estimates, it is difficult to determine the contributions of the petroleum sector to the total budget of mercury emissions. In response to concerns that the combustion of petroleum products may be a major source of air-borne mercury pollution, Environment Canada and the Canadian Petroleum Products Institute has undertaken a survey of the average total mercury concentration in crude oil processed in Canadian refineries. In order to calculate the potential upper limit of total mercury in all refined products, samples of more than 30 different types of crude oil collected from refineries were measured for their concentration of mercury as it enters into a refinery before processing. High temperature combustion, cold vapour atomic absorption and cold vapour atomic fluorescence were the techniques used to quantify mercury in the samples. The results of the study provide information on the total mass of mercury present in crude oil processed in Canada each year. Results can be used to determine the impact of vehicle exhaust emissions to the overall Canadian mercury emission budget. 17 refs., 2 tabs., 2 figs

  7. Method for mercury refinement

    Science.gov (United States)

    Grossman, M.W.; Speer, R.; George, W.A.

    1991-04-09

    The effluent from mercury collected during the photochemical separation of the [sup 196]Hg isotope is often contaminated with particulate mercurous chloride, Hg[sub 2]Cl[sub 2]. The use of mechanical filtering via thin glass tubes, ultrasonic rinsing with acetone (dimethyl ketone) and a specially designed cold trap have been found effective in removing the particulate (i.e., solid) Hg[sub 2]Cl[sub 2] contaminant. The present invention is particularly directed to such filtering. 5 figures.

  8. Apparatus for mercury refinement

    Science.gov (United States)

    Grossman, M.W.; Speer, R.; George, W.A.

    1991-07-16

    The effluent from mercury collected during the photochemical separation of the [sup 196]Hg isotope is often contaminated with particulate mercurous chloride, Hg[sub 2]Cl[sub 2]. The use of mechanical filtering via thin glass tubes, ultrasonic rinsing with acetone (dimethyl ketone) and a specially designed cold trap have been found effective in removing the particulate (i.e., solid) Hg[sub 2]Cl[sub 2] contaminant. The present invention is particularly directed to such filtering. 5 figures.

  9. Apparatus for mercury refinement

    International Nuclear Information System (INIS)

    Grossman, M.W.; Speer, R.; George, W.A.

    1991-01-01

    The effluent from mercury collected during the photochemical separation of the 196 Hg isotope is often contaminated with particulate mercurous chloride, Hg 2 Cl 2 . The use of mechanical filtering via thin glass tubes, ultrasonic rinsing with acetone (dimethyl ketone) and a specially designed cold trap have been found effective in removing the particulate (i.e., solid) Hg 2 Cl 2 contaminant. The present invention is particularly directed to such filtering. 5 figures

  10. Method for scavenging mercury

    Science.gov (United States)

    Chang, Shih-ger [El Cerrito, CA; Liu, Shou-heng [Kaohsiung, TW; Liu, Zhao-rong [Beijing, CN; Yan, Naiqiang [Berkeley, CA

    2009-01-20

    Disclosed herein is a method for removing mercury from a gas stream comprising contacting the gas stream with a getter composition comprising bromine, bromochloride, sulphur bromide, sulphur dichloride or sulphur monochloride and mixtures thereof. In one preferred embodiment the getter composition is adsorbed onto a sorbent. The sorbent may be selected from the group consisting of flyash, limestone, lime, calcium sulphate, calcium sulfite, activated carbon, charcoal, silicate, alumina and mixtures thereof. Preferred is flyash, activated carbon and silica.

  11. Magnetic field of Mercury

    International Nuclear Information System (INIS)

    Jackson, D.J.; Beard, D.B.

    1977-01-01

    The geomagnetic field, suitably scaled down and parameterized, is shown to give a very good fit to the magnetic field measurements taken on the first and third passes of the Mariner 10 space probe past Mercury. The excellence of the fit to a reliable planetary magnetospheric model is good evidence that the Mercury magnetosphere is formed by a simple, permanent, intrinsic planetary magnetic field distorted by the effects of the solar wind. The parameters used for a best fit to all the data are (depending slightly on the choice of data) 2.44--2.55 for the ratio of Mercury's magnetic field strength at the subsolar point to that of the earth's subsolar point field (this results in a dipole moment of 170 γR/sub M/ 3 (R/sub M/ is Mercury Radius), i.e., 2.41 x 10 22 G cm 3 in the same direction as the earth's dipole), approx.-113 γR/sub M/ 4 for the planetary quadrupole moment parallel to the dipole moment, 10degree--17degree for the tilt of the planet dipole toward the sun, 4.5degree for the tilt of the dipole toward dawn, and 2.5degree--7.6degree aberration angle for the shift in the tail axis from the planet-sun direction because of the planet's orbital velocity. The rms deviation overall for the entire data set compared with the theoretical fitted model for the magnetic field strength was 17 γ (approx.4% of the maximum field measured). If the data from the first pass that show presumed strong time variations are excluded, the overall rms deviation for the field magnitude is only 10 γ

  12. The planet Mercury (1971)

    Science.gov (United States)

    1972-01-01

    The physical properties of the planet Mercury, its surface, and atmosphere are presented for space vehicle design criteria. The mass, dimensions, mean density, and orbital and rotational motions are described. The gravity field, magnetic field, electromagnetic radiation, and charged particles in the planet's orbit are discussed. Atmospheric pressure, temperature, and composition data are given along with the surface composition, soil mechanical properties, and topography, and the surface electromagnetic and temperature properties.

  13. Mercury removal sorbents

    Science.gov (United States)

    Alptekin, Gokhan

    2016-03-29

    Sorbents and methods of using them for removing mercury from flue gases over a wide range of temperatures are disclosed. Sorbent materials of this invention comprise oxy- or hydroxyl-halogen (chlorides and bromides) of manganese, copper and calcium as the active phase for Hg.sup.0 oxidation, and are dispersed on a high surface porous supports. In addition to the powder activated carbons (PACs), this support material can be comprised of commercial ceramic supports such as silica (SiO.sub.2), alumina (Al.sub.2O.sub.3), zeolites and clays. The support material may also comprise of oxides of various metals such as iron, manganese, and calcium. The non-carbon sorbents of the invention can be easily injected into the flue gas and recovered in the Particulate Control Device (PCD) along with the fly ash without altering the properties of the by-product fly ash enabling its use as a cement additive. Sorbent materials of this invention effectively remove both elemental and oxidized forms of mercury from flue gases and can be used at elevated temperatures. The sorbent combines an oxidation catalyst and a sorbent in the same particle to both oxidize the mercury and then immobilize it.

  14. 17 CFR 201.160 - Time computation.

    Science.gov (United States)

    2010-04-01

    ... 17 Commodity and Securities Exchanges 2 2010-04-01 2010-04-01 false Time computation. 201.160... Rules of Practice General Rules § 201.160 Time computation. (a) Computation. In computing any period of... legal holidays shall be excluded from the computation when the period of time prescribed or allowed is...

  15. 24 CFR 201.31 - Insurance charge.

    Science.gov (United States)

    2010-04-01

    ... 24 Housing and Urban Development 2 2010-04-01 2010-04-01 false Insurance charge. 201.31 Section... DEVELOPMENT MORTGAGE AND LOAN INSURANCE PROGRAMS UNDER NATIONAL HOUSING ACT AND OTHER AUTHORITIES TITLE I PROPERTY IMPROVEMENT AND MANUFACTURED HOME LOANS Insurance of Loans § 201.31 Insurance charge. (a...

  16. Brain SPECT with Tl-201 DDC

    International Nuclear Information System (INIS)

    Bruine, J.F. de.

    1988-01-01

    The development, animal and human experiments and the first clinical results of a new blood flow tracer thallium-201 diethyldithiocarbamate (Tl-201 DDC) are discussed for functional brain imaging with single-photon emission computed tomography (SPECT). 325 refs.; 43 figs.; 22 tabs

  17. 7 CFR 201.51 - Inert matter.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 3 2010-01-01 2010-01-01 false Inert matter. 201.51 Section 201.51 Agriculture Regulations of the Department of Agriculture (Continued) AGRICULTURAL MARKETING SERVICE (Standards... other sclerotia. (2) Soil particles, sand, stone, chaff, stems, leaves, flowers, loose coating material...

  18. 24 CFR 201.24 - Security requirements.

    Science.gov (United States)

    2010-04-01

    ... manufactured home. (c) Recording and perfection of security. The lender shall assure that the legal description... 24 Housing and Urban Development 2 2010-04-01 2010-04-01 false Security requirements. 201.24... TITLE I PROPERTY IMPROVEMENT AND MANUFACTURED HOME LOANS Eligibility and Disbursement Requirements § 201...

  19. Commercial production of thallium-201 chloride

    International Nuclear Information System (INIS)

    Sokolov, S.V.; Volkova, N.M.; Skokov, V.S.

    1989-01-01

    Thallium-201 chloride pharmaceuticals production practice at the Medradiopreparat factory under USSR Ministry of Public Health is described. The factory is carried out series-produced supplies of the compound prepared according to a new practice from September, 1985. Thallium-201 extraction from cyclotron targets irradiated is carried out by the extraction method

  20. 31 CFR 0.201 - Political activity.

    Science.gov (United States)

    2010-07-01

    ... EMPLOYEE RULES OF CONDUCT Rules of Conduct § 0.201 Political activity. (a) Employees may: (1) Take an active part in political management or in political campaigns to the extent permitted by law (5 U.S.C... 31 Money and Finance: Treasury 1 2010-07-01 2010-07-01 false Political activity. 0.201 Section 0...

  1. Production of Thallium 201 for medical applications

    International Nuclear Information System (INIS)

    Braghirolli, A.M.S.

    1981-12-01

    With the purpose of producing high purity carrier-free 201 Tl, for medical use, a production and separation method was developed using the CV-28 Cyclotron of the Nuclear Engineering Institute in Rio de Janeiro, Brazil. 201 Pb was produced by 24 MeV proton bombardment of natural Tl and allowed to decay to 201 Tl. In the separation process the target is dissolved in HNO 3 , the 201 Pb produced is separated by Fe(OH) 3 coprecipitation, and the Fe is latter separated by anion exchange. The 201 Pb is permited to decay during 32 hrs. 201 Tl is then separated from remaining Pb by anion exchange. The chemical separation is done in a remote processing cell using manipulators, tongs, electric and pneumatic systems. The thick target yield of 201 Pb is 1.7 mCi/μAhr. At the moment the production is restricted to 4 mCi of 201 Tl for each irradiation. (Author) [pt

  2. 48 CFR 50.201 - Definitions.

    Science.gov (United States)

    2010-10-01

    ... EXTRAORDINARY CONTRACTUAL ACTIONS AND THE SAFETY ACT Support Anti-terrorism by Fostering Effective Technologies Act of 2002 50.201 Definitions. Act of terrorism means any act determined to have met the following... 48 Federal Acquisition Regulations System 1 2010-10-01 2010-10-01 false Definitions. 50.201...

  3. 19 CFR 201.206 - Administrative offset.

    Science.gov (United States)

    2010-04-01

    ... 19 Customs Duties 3 2010-04-01 2010-04-01 false Administrative offset. 201.206 Section 201.206 Customs Duties UNITED STATES INTERNATIONAL TRADE COMMISSION GENERAL RULES OF GENERAL APPLICATION Debt...; (iii) That the agency has prescribed regulations for the exercise of administrative offset; and (iv...

  4. 18 CFR 154.201 - Filing requirements.

    Science.gov (United States)

    2010-04-01

    ... 18 Conservation of Power and Water Resources 1 2010-04-01 2010-04-01 false Filing requirements. 154.201 Section 154.201 Conservation of Power and Water Resources FEDERAL ENERGY REGULATORY COMMISSION... progressive calculations, any discontinuity between one working paper and another must be explained. [Order...

  5. 22 CFR 1203.735-201 - General.

    Science.gov (United States)

    2010-04-01

    ... 22 Foreign Relations 2 2010-04-01 2010-04-01 true General. 1203.735-201 Section 1203.735-201 Foreign Relations UNITED STATES INTERNATIONAL DEVELOPMENT COOPERATION AGENCY EMPLOYEE RESPONSIBILITIES AND... this part, which might result in, or create the appearance of: (1) Using public office for private gain...

  6. 49 CFR 179.201-11 - Insulation.

    Science.gov (United States)

    2010-10-01

    ...) Insulation shall be of sufficient thickness so that the thermal conductance at 60 °F. is not more than 0.075... 49 Transportation 2 2010-10-01 2010-10-01 false Insulation. 179.201-11 Section 179.201-11 Transportation Other Regulations Relating to Transportation PIPELINE AND HAZARDOUS MATERIALS SAFETY...

  7. 9 CFR 205.201 - System operator.

    Science.gov (United States)

    2010-01-01

    ... 9 Animals and Animal Products 2 2010-01-01 2010-01-01 false System operator. 205.201 Section 205.201 Animals and Animal Products GRAIN INSPECTION, PACKERS AND STOCKYARDS ADMINISTRATION (PACKERS AND STOCKYARDS PROGRAMS), DEPARTMENT OF AGRICULTURE CLEAR TITLE-PROTECTION FOR PURCHASERS OF FARM PRODUCTS...

  8. 24 CFR 201.16 - Default provision.

    Science.gov (United States)

    2010-04-01

    ... 24 Housing and Urban Development 2 2010-04-01 2010-04-01 false Default provision. 201.16 Section... PROPERTY IMPROVEMENT AND MANUFACTURED HOME LOANS Loan and Note Provisions § 201.16 Default provision. The... default by the borrower. ...

  9. 9 CFR 201.3 - Authority.

    Science.gov (United States)

    2010-01-01

    ... 9 Animals and Animal Products 2 2010-01-01 2010-01-01 false Authority. 201.3 Section 201.3 Animals and Animal Products GRAIN INSPECTION, PACKERS AND STOCKYARDS ADMINISTRATION (PACKERS AND STOCKYARDS....3 Authority. The Administrator shall perform such duties as the Secretary may require in enforcing...

  10. 21 CFR 155.201 - Canned mushrooms.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 2 2010-04-01 2010-04-01 false Canned mushrooms. 155.201 Section 155.201 Food and... mushrooms. (a) Identity—(1) Definition. Canned mushrooms is the food properly prepared from the caps and stems of succulent mushrooms conforming to the characteristics of the species Agaricus (Psalliota...

  11. 46 CFR 199.201 - Survival craft.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 7 2010-10-01 2010-10-01 false Survival craft. 199.201 Section 199.201 Shipping COAST... craft. (a) Each survival craft must be approved and equipped as follows: (1) Each lifeboat must be... addition to the survival craft required in paragraph (b)(1) of this section, additional liferafts must be...

  12. 17 CFR 242.201 - Price test.

    Science.gov (United States)

    2010-04-01

    ... 17 Commodity and Securities Exchanges 3 2010-04-01 2010-04-01 false Price test. 242.201 Section...-Regulation of Short Sales § 242.201 Price test. Link to an amendment published at 75 FR 11323, Mar. 10, 2010. (a) No short sale price test, including any short sale price test of any self-regulatory organization...

  13. 33 CFR 135.201 - Applicability.

    Science.gov (United States)

    2010-07-01

    ... 33 Navigation and Navigable Waters 2 2010-07-01 2010-07-01 false Applicability. 135.201 Section 135.201 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) MARINE POLLUTION FINANCIAL RESPONSIBILITY AND COMPENSATION OFFSHORE OIL POLLUTION COMPENSATION FUND...

  14. 13 CFR 105.201 - Definitions.

    Science.gov (United States)

    2010-01-01

    ... 13 Business Credit and Assistance 1 2010-01-01 2010-01-01 false Definitions. 105.201 Section 105.201 Business Credit and Assistance SMALL BUSINESS ADMINISTRATION STANDARDS OF CONDUCT AND EMPLOYEE..., grant, managerial or other aid, including size determinations, section 8(a) participation, licensing...

  15. 48 CFR 2030.201-5 - Waiver.

    Science.gov (United States)

    2010-10-01

    ... REQUIREMENTS COST ACCOUNTING STANDARDS CAS Program Requirements 2030.201-5 Waiver. Requests to waive Cost Accounting Standards (CAS) requirements must be submitted to the Chairman, CAS Board by the Competition... supporting documentation and rationale in accordance with FAR 30.201-5. ...

  16. 48 CFR 419.201-73 - Reports.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 4 2010-10-01 2010-10-01 false Reports. 419.201-73... SMALL BUSINESS PROGRAMS Policies 419.201-73 Reports. The Director, OSDBU, shall be responsible for submitting reports concerning USDA's progress and achievements in the procurement preference program. ...

  17. 42 CFR 93.201 - Allegation.

    Science.gov (United States)

    2010-10-01

    ... 42 Public Health 1 2010-10-01 2010-10-01 false Allegation. 93.201 Section 93.201 Public Health PUBLIC HEALTH SERVICE, DEPARTMENT OF HEALTH AND HUMAN SERVICES HEALTH ASSESSMENTS AND HEALTH EFFECTS STUDIES OF HAZARDOUS SUBSTANCES RELEASES AND FACILITIES PUBLIC HEALTH SERVICE POLICIES ON RESEARCH...

  18. 49 CFR 179.201-4 - Material.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 2 2010-10-01 2010-10-01 false Material. 179.201-4 Section 179.201-4 Transportation Other Regulations Relating to Transportation PIPELINE AND HAZARDOUS MATERIALS SAFETY ADMINISTRATION, DEPARTMENT OF TRANSPORTATION HAZARDOUS MATERIALS REGULATIONS SPECIFICATIONS FOR TANK CARS...

  19. 17 CFR 201.222 - Prehearing submissions.

    Science.gov (United States)

    2010-04-01

    ....222 Section 201.222 Commodity and Securities Exchanges SECURITIES AND EXCHANGE COMMISSION RULES OF PRACTICE Rules of Practice Initiation of Proceedings and Prehearing Rules § 201.222 Prehearing submissions... qualifications, a listing of other proceedings in which the expert has given expert testimony, and a list of...

  20. 7 CFR 1430.201 - Administration.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 10 2010-01-01 2010-01-01 false Administration. 1430.201 Section 1430.201 Agriculture Regulations of the Department of Agriculture (Continued) COMMODITY CREDIT CORPORATION, DEPARTMENT OF... Administration. (a) This program is administered under the general supervision of the Executive Vice President...

  1. 17 CFR 201.221 - Prehearing conference.

    Science.gov (United States)

    2010-04-01

    ... 17 Commodity and Securities Exchanges 2 2010-04-01 2010-04-01 false Prehearing conference. 201.221... Rules of Practice Initiation of Proceedings and Prehearing Rules § 201.221 Prehearing conference. (a) Purposes of conference. The purposes of a prehearing conference include, but are not limited to: (1...

  2. Mercury's Magnetic Field

    Science.gov (United States)

    Johnson, C. L.

    2014-12-01

    Mercury is the only inner solar system body other than Earth to possess an active core dynamo-driven magnetic field and the only planet with a small, highly dynamic magnetosphere. Measurements made by the MErcury Surface, Space ENvironment, GEochemistry, and Ranging (MESSENGER) spacecraft have provided a wealth of data on Mercury's magnetic field environment. Mercury's weak magnetic field was discovered 40 years ago by the Mariner 10 spacecraft, but its large-scale geometry, strength and origin could not be definitively established. MESSENGER data have shown that the field is dynamo-generated and can be described as an offset axisymmetric dipole field (hereafter OAD): the magnetic equator lies ~0.2 RM (RM = 2440 km) north of the geographic equator and the dipole moment is 2.8 x1019 Am2 (~0.03% that of Earth's). The weak internal field and the high, but variable, solar wind ram pressure drive vigorous magnetospheric dynamics and result in an average distance from the planet center to the sub-solar magnetopause of only 1.42 RM. Magnetospheric models developed with MESSENGER data have allowed re-analysis of the Mariner 10 observations, establishing that there has been no measureable secular variation in the internal field over 40 years. Together with spatial power spectra for the OAD, this provides critical constraints for viable dynamo models. Time-varying magnetopause fields induce secondary core fields, the magnitudes of which confirm the core radius estimated from MESSENGER gravity and Earth-based radar data. After accounting for large-scale magnetospheric fields, residual signatures are dominated by additional external fields that are organized in the local time frame and that vary with magnetospheric activity. Birkeland currents have been identified, which likely close in the planetary interior at depths below the base of the crust. Near-periapsis magnetic field measurements at altitudes greater than 200 km have tantalizing hints of crustal fields, but crustal

  3. Mechanisms of thallium-201 myocardial accumulation

    International Nuclear Information System (INIS)

    Wackers, F.J.Th.; Samson, G.

    1980-01-01

    The practical advantages of 201 Tl over other suitable myocardial imaging agents such as potassium-43 ( 43 K), rubidium-81 ( 81 Rb), and cesium-129 ( 129 Cs), are its relatively low energy photons which makes it possible to employ high-resolution low-energy collimators and its physical half-life of 73 hr which provides sufficiently long shelf-life for practical clinical imaging. Toxicological considerations do not play a role using 201 Tl as thallous chloride. The concentration of thallous chloride in a dose of 2 mCi of 201 Tl is less than 4μg. The LD 50 of thallous chloride is a factor 10 4 more. The minimal lethal dose in man is reported to be 12 mg/kg. The kinetics of 201 Tl, its tissue distributions and radiation doses are assessed, and the effect of cardiac drugs on thallium-201 uptake are discussed. (Auth.)

  4. Mercury: Exploration of a Planet

    Science.gov (United States)

    1976-01-01

    The flight of the Mariner 10 spacecraft to Venus and Mercury is detailed in animation and photography. Views of Mercury are featured. Also included is animation on the origin of the solar system. Dr. Bruce C. Murray, director of the Jet Propulsion Laboratory, comments on the mission.

  5. Rotation of the planet mercury.

    Science.gov (United States)

    Jefferys, W H

    1966-04-08

    The equations of motion for the rotation of Mercury are solved for the general case by an asymptotic expansion. The findings of Liu and O'Keefe, obtained by numerical integration of a special case, that it is possible for Mercury's rotation to be locked into a 2:3 resonance with its revolution, are confirmed in detail. The general solution has further applications.

  6. 49 CFR 173.164 - Mercury (metallic and articles containing mercury).

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 2 2010-10-01 2010-10-01 false Mercury (metallic and articles containing mercury... Than Class 1 and Class 7 § 173.164 Mercury (metallic and articles containing mercury). (a) For transportation by aircraft, mercury must be packaged in packagings which meet the requirements of part 178 of...

  7. Mercury concentration in bivalve molluscs

    Directory of Open Access Journals (Sweden)

    Szkoda Józef

    2015-09-01

    Full Text Available A total of 85 mussel samples of eight species were examined. Analysis of mercury in the freeze-dried samples was carried out by atomic absorption spectrometry method using direct mercury analyser AMA 254. The analytical procedure for determination of mercury was covered by the quality assurance programme of research and participation in national and international proficiency tests. Concentrations of total mercury in all investigated samples were found to be generally low, in the range of 0.033-0.577 mg/kg of dry weight and of 0.003-0.045 mg/kg of wet weight. The results indicate that obtained levels of mercury in bivalve molluscs are not likely to pose a risk to the health of consumers.

  8. Mercury: Beethoven Quadrangle, H-7

    Science.gov (United States)

    2000-01-01

    Mercury: Computer Photomosaic of the Beethoven Quadrangle, H-7 The Beethoven Quadrangle, named for the 19th century classical German composer, lies in Mercury's Equatorial Mercator located between longitude 740 to 1440. The Mariner 10 spacecraft imaged the region during its initial flyby of the planet. The Image Processing Lab at NASA's Jet Propulsion Laboratory produced this photomosaic using computer software and techniques developed for use in processing planetary data. The images used to construct the Beethoven Quadrangle were taken as Mariner 10 flew passed Mercury. The Mariner 10 spacecraft was launched in 1974. The spacecraft took images of Venus in February 1974 on the way to three encounters with Mercury in March and September 1974 and March 1975. The spacecraft took more than 7,000 images of Mercury, Venus, the Earth and the Moon during its mission. The Mariner 10 Mission was managed by the Jet Propulsion Laboratory for NASA's Office of Space Science in Washington, D.C.

  9. Human Exposure and Health Effects of Inorganic and Elemental Mercury

    OpenAIRE

    Park, Jung-Duck; Zheng, Wei

    2012-01-01

    Mercury is a toxic and non-essential metal in the human body. Mercury is ubiquitously distributed in the environment, present in natural products, and exists extensively in items encountered in daily life. There are three forms of mercury, i.e., elemental (or metallic) mercury, inorganic mercury compounds, and organic mercury compounds. This review examines the toxicity of elemental mercury and inorganic mercury compounds. Inorganic mercury compounds are water soluble with a bioavailability o...

  10. Methods for dispensing mercury into devices

    Science.gov (United States)

    Grossman, Mark W.; George, William A.

    1987-04-28

    A process for dispensing mercury into devices which requires mercury. Mercury is first electrolytically separated from either HgO or Hg.sub.2 Cl.sub.2 and plated onto a cathode wire. The cathode wire is then placed into a device requiring mercury.

  11. 21 CFR 872.3700 - Dental mercury.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 8 2010-04-01 2010-04-01 false Dental mercury. 872.3700 Section 872.3700 Food and... DENTAL DEVICES Prosthetic Devices § 872.3700 Dental mercury. (a) Identification. Dental mercury is a device composed of mercury intended for use as a component of amalgam alloy in the restoration of a...

  12. Fluorescent sensor for mercury

    Science.gov (United States)

    Wang, Zidong [Urbana, IL; Lee, Jung Heon [Evanston, IL; Lu, Yi [Champaign, IL

    2011-11-22

    The present invention provides a sensor for detecting mercury, comprising: a first polynucleotide, comprising a first region, and a second region, a second polynucleotide, a third polynucleotide, a fluorophore, and a quencher, wherein the third polynucleotide is optionally linked to the second region; the fluorophore is linked to the first polynucleotide and the quencher is linked to the second polynucleotide, or the fluorophore is linked to the second polynucleotide and the quencher is linked to the first polynucleotide; the first region and the second region hybridize to the second polynucleotide; and the second region binds to the third polynucleotide in the presence of Hg.sup.2+ ions.

  13. 4 CFR 201.7 - Timing of responses to requests.

    Science.gov (United States)

    2010-01-01

    ... 4 Accounts 1 2010-01-01 2010-01-01 false Timing of responses to requests. 201.7 Section 201.7 Accounts RECOVERY ACCOUNTABILITY AND TRANSPARENCY BOARD PUBLIC INFORMATION AND REQUESTS § 201.7 Timing of... letter or an e-mail confirming the requestor's agreement to pay fees under § 201.8 and providing a...

  14. 41 CFR 50-201.4 - Statutory exemptions.

    Science.gov (United States)

    2010-07-01

    ... 41 Public Contracts and Property Management 1 2010-07-01 2010-07-01 true Statutory exemptions. 50-201.4 Section 50-201.4 Public Contracts and Property Management Other Provisions Relating to Public Contracts PUBLIC CONTRACTS, DEPARTMENT OF LABOR 201-GENERAL REGULATIONS § 50-201.4 Statutory exemptions...

  15. 41 CFR 50-201.101 - Employees affected.

    Science.gov (United States)

    2010-07-01

    ... 41 Public Contracts and Property Management 1 2010-07-01 2010-07-01 true Employees affected. 50-201.101 Section 50-201.101 Public Contracts and Property Management Other Provisions Relating to Public Contracts PUBLIC CONTRACTS, DEPARTMENT OF LABOR 201-GENERAL REGULATIONS § 50-201.101 Employees...

  16. Increased mercury emissions from modern dental amalgams

    OpenAIRE

    Bengtsson, Ulf G.; Hylander, Lars D.

    2017-01-01

    All types of dental amalgams contain mercury, which partly is emitted as mercury vapor. All types of dental amalgams corrode after being placed in the oral cavity. Modern high copper amalgams exhibit two new traits of increased instability. Firstly, when subjected to wear/polishing, droplets rich in mercury are formed on the surface, showing that mercury is not being strongly bonded to the base or alloy metals. Secondly, high copper amalgams emit substantially larger amounts of mercury vapor ...

  17. Dicty_cDB: VHO201 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHO201 (Link to dictyBase) - - - Contig-U12425-1 VHO201P (Link... to Original site) VHO201F 596 VHO201Z 398 VHO201P 974 - - Show VHO201 Library VH (Link to library) Clone ID VHO201 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U12425-1 Original site URL http://dict...SGSQMEIQNRRGIVNLGDYSTSR DDNPHVLTVLLKQFLRDLPEPICTNALYDLFLAASDQINFQQCKENGFEVLKKLINS...CKREXMELRIPTFVSNILNTLFLHSLGVEGLFRISGSQMEIQNRRGIVNLGDYSTSR DDNPHVLTVLLKQFLRDLPEPICT

  18. Mercury toxicity and neurodegenerative effects.

    Science.gov (United States)

    Carocci, Alessia; Rovito, Nicola; Sinicropi, Maria Stefania; Genchi, Giuseppe

    2014-01-01

    Mercury is among the most toxic heavy metals and has no known physiological role in humans. Three forms of mercury exist: elemental, inorganic and organic. Mercury has been used by man since ancient times. Among the earliest were the Chinese and Romans, who employed cinnabar (mercury sulfide) as a red dye in ink (Clarkson et al. 2007). Mercury has also been used to purify gold and silver minerals by forming amalgams. This is a hazardous practice, but is still widespread in Brazil's Amazon basin, in Laos and in Venezuela, where tens of thousands of miners are engaged in local mining activities to find and purify gold or silver. Mercury compounds were long used to treat syphilis and the element is still used as an antiseptic,as a medicinal preservative and as a fungicide. Dental amalgams, which contain about 50% mercury, have been used to repair dental caries in the U.S. since 1856.Mercury still exists in many common household products around the world.Examples are: thermometers, barometers, batteries, and light bulbs (Swain et al.2007). In small amounts, some organo mercury-compounds (e.g., ethylmercury tiosalicylate(thimerosal) and phenylmercury nitrate) are used as preservatives in some medicines and vaccines (Ballet al. 2001).Each mercury form has its own toxicity profile. Exposure to Hg0 vapor and MeHg produce symptoms in CNS, whereas, the kidney is the target organ when exposures to the mono- and di-valent salts of mercury (Hg+ and Hg++, respectively)occur. Chronic exposure to inorganic mercury produces stomatitis, erethism and tremors. Chronic MeHg exposure induced symptoms similar to those observed in ALS, such as the early onset of hind limb weakness (Johnson and Atchison 2009).Among the organic mercury compounds, MeHg is the most biologically available and toxic (Scheuhammer et a!. 2007). MeHg is neurotoxic, reaching high levels of accumulation in the CNS; it can impair physiological function by disrupting endocrine glands (Tan et a!. 2009).The most

  19. Mercury kinetics in marine zooplankton

    International Nuclear Information System (INIS)

    Fowler, S.W.; Heyraud, M.; LaRosa, J.

    1976-01-01

    Mercury, like many other heavy metals, is potentially available to marine animals by uptake directly from water and/or through the organisms food. Furthermore, bioavailability, assimilation and subsequent retention in biota may be affected by the chemical species of the element in sea water. While mercury is known to exist in the inorganic form in sea water, recent work has indicated that, in certain coastal areas, a good portion of the total mercury appears to be organically bound; however, the exact chemical nature of the organic fraction has yet to be determined. Methyl mercury may be one constituent of the natural organically bound fraction since microbial mechanisms for in situ methylation of mercury have been demonstrated in the aquatic environment. Despite the fact that naturally produced methyl mercury probably comprises only a small fraction of an aquatic ecosystem, the well-documented toxic effects of this organo-mercurial, caused by man-made introductions into marine food chains, make it an important compound to study

  20. Atmospheric mercury footprints of nations.

    Science.gov (United States)

    Liang, Sai; Wang, Yafei; Cinnirella, Sergio; Pirrone, Nicola

    2015-03-17

    The Minamata Convention was established to protect humans and the natural environment from the adverse effects of mercury emissions. A cogent assessment of mercury emissions is required to help implement the Minamata Convention. Here, we use an environmentally extended multi-regional input-output model to calculate atmospheric mercury footprints of nations based on upstream production (meaning direct emissions from the production activities of a nation), downstream production (meaning both direct and indirect emissions caused by the production activities of a nation), and consumption (meaning both direct and indirect emissions caused by final consumption of goods and services in a nation). Results show that nations function differently within global supply chains. Developed nations usually have larger consumption-based emissions than up- and downstream production-based emissions. India, South Korea, and Taiwan have larger downstream production-based emissions than their upstream production- and consumption-based emissions. Developed nations (e.g., United States, Japan, and Germany) are in part responsible for mercury emissions of developing nations (e.g., China, India, and Indonesia). Our findings indicate that global mercury abatement should focus on multiple stages of global supply chains. We propose three initiatives for global mercury abatement, comprising the establishment of mercury control technologies of upstream producers, productivity improvement of downstream producers, and behavior optimization of final consumers.

  1. Method for removal and stabilization of mercury in mercury-containing gas streams

    Science.gov (United States)

    Broderick, Thomas E.

    2005-09-13

    The present invention is directed to a process and apparatus for removing and stabilizing mercury from mercury-containing gas streams. A gas stream containing vapor phase elemental and/or speciated mercury is contacted with reagent, such as an oxygen-containing oxidant, in a liquid environment to form a mercury-containing precipitate. The mercury-containing precipitate is kept or placed in solution and reacts with one or more additional reagents to form a solid, stable mercury-containing compound.

  2. Exploring Mercury: The Iron Planet

    OpenAIRE

    Stevenson, David J.

    2004-01-01

    Planet Mercury is both difficult to observe and difficult to reach by spacecraft. Just one spacecraft, Mariner 10, flew by the planet 30 years ago. An upcoming NASA mission, MESSENGER, will be launched this year and will go into orbit around Mercury at the end of this decade. A European mission is planned for the following decade. It's worth going there because Mercury is a strange body and the history of planetary exploration has taught us that strangeness gives us insight into planetary ori...

  3. MESSENGER'S First Flyby of Mercury

    Science.gov (United States)

    Slavin, James A.

    2008-01-01

    The MESSENGER mission to Mercury offers our first opportunity to explore this planet's miniature magnetosphere since Mariner 10's brief fly-bys in 1974-5. The magnetosphere of Mercury is the smallest in the solar system with its magnetic field typically standing off the solar wind only - 1000 to 2000 km above the surface. An overview of the MESSENGER mission and its January 14th close flyby of Mercury will be provided. Primary science objectives and the science instrumentation will be described. Initial results from MESSENGER'S first flyby on January 14th, 2008 will be discussed with an emphasis on the magnetic field and charged particle measurements.

  4. Quantitative analysis of thallium-201 myocardial scintigraphy

    International Nuclear Information System (INIS)

    Kanemoto, Nariaki; Hoer, G.; Johost, S.; Maul, F.-D.; Standke, R.

    1981-01-01

    The method of quantitative analysis of thallium-201 myocardial scintigraphy using computer assisted technique was described. Calculated indices are washout factor, vitality index and redistribution factor. Washout factor is the ratio of counts at certain period of time after exercise and immediately after exercise. This value is neccessary for the evaluation of redistribution to the ischemic areas in serial imagings to correct the Tl-201 washout from the myocardium under the assumption that the washout is constant in the whole myocardium. Vitality index is the ratio between the Tl-201 uptake in the region of interest and that of the maximum. Redistribution factor is the ratio of the redistribution in the region of interest in serial imagings after exercise to that of immediately after exercise. Four examples of exercise Tl-201 myocardial scintigrams and the quantitative analyses before and after the percutaneous transluminal coronary angioplasty were presented. (author)

  5. 48 CFR 430.201-5 - Waiver.

    Science.gov (United States)

    2010-10-01

    ... REQUIREMENTS COST ACCOUNTING STANDARDS ADMINISTRATION CAS Program Requirements 430.201-5 Waiver. The Senior... Accounting Standards Board to waive the application of the Cost Accounting Standards (CAS). Contracting...

  6. 5 CFR 412.201 - Management succession.

    Science.gov (United States)

    2010-01-01

    ..., MANAGEMENT, AND EXECUTIVE DEVELOPMENT Succession Planning § 412.201 Management succession. The head of each... learning experiences throughout an employee's career, such as details, mentoring, coaching, learning groups...

  7. 48 CFR 3019.201 - General policy.

    Science.gov (United States)

    2010-10-01

    ... meet public policy objectives concerning small business participation in departmental procurements. The... ACQUISITION REGULATION (HSAR) SOCIOECONOMIC PROGRAMS SMALL BUSINESS PROGRAMS Policies 3019.201 General policy. (d) DHS is committed to a unified team approach involving senior management, small business...

  8. Production of thallium 201 for medical use

    International Nuclear Information System (INIS)

    Venikov, N.I.; Konyakhin, N.A.; Kozlova, M.D.; Volkova, N.M.

    1986-01-01

    An important product among the radiopharmaceuticals currently used in cardiology is T1 201 chloride, due to its nuclear-physical properties and its clinical value as a diagnostic tool. The authors explain and discuss the basic characteristics which determine the radiopharmaceutical quality of T1 201: its radiochemical purity and its chemical impurity content, which depend on the target-irradiation conditions - type of nuclear reaction, target material and design, particle energy, irradiation time - and the reprocessing technology. A production flow chart is presented which shows that ions are accelerated within a wide mass and energy range suitable for the production of T1 201 in different nuclear reactions. Cyclotron reconstruction for T1 201 production is discussed

  9. Distribution and retention of organic and inorganic mercury in methyl mercury-treated neonatal rats

    International Nuclear Information System (INIS)

    Thomas, D.J.; Fisher, H.L.; Sumler, M.R.; Hall, L.L.; Mushak, P.

    1988-01-01

    Seven-day-old Long Evans rats received one mumol of 203 Hg-labeled methyl mercury/kg sc and whole body retention and tissue distribution of organic and inorganic mercury were examined for 32 days postdosing. Neonates cleared mercury slowly until 10 days postdosing when the clearance rate abruptly increased. During the interval when whole body clearance of mercury was extremely slow, methyl mercury was metabolized to inorganic mercury. Peak concentration of mercury in kidney occurred at 2 days postdosing. At 32 days postdosing, 8% of mercury in kidney was in an organic from. Liver mercury concentration peaked at 2 days postdosing and organic mercury accounted for 38% at 32 days postdosing. Brain concentrations of mercury peaked at 2 days postdosing. At 10 days postdosing, organic mercury accounted for 86% of the brain mercury burden, and, at 32 days postdosing, for 60%. The percentage of mercury body burden in pelt rose from 30 to 70% between 1 and 10 days postdosing. At 32 days postdosing pelt contained 85% of the body burden of mercury. At all time points, about 95% of mercury in pelt was in an organic form. Compartmental analysis of these data permitted development of a model to describe the distribution and excretion of organic and inorganic mercury in methyl mercury-treated neonatal rats

  10. Value of thyroid scintigraphy using thallium 201

    International Nuclear Information System (INIS)

    Hermans, J.; Parmentier, S.; Beauduin, M.; Schmitz, A.; Therasse, G.

    1986-01-01

    The value of thallium-201 scintigraphy in the differential diagnosis of cold thyroid nodules demonstrated on the thyroid scan with technetium-99m was emphasized. From the clinical results it can be deduced that if a cold nodule is positive with thallium-201 the lesion has a high percentage of being a high risk of malignancy. This information might be quite valuable in selecting patients for operation [fr

  11. Thallium-201 stress imaging in hypertensive patients

    International Nuclear Information System (INIS)

    Schulman, D.S.; Francis, C.K.; Black, H.R.; Wackers, F.J.

    1987-01-01

    To assess the potential effect of hypertension on the results of thallium-201 stress imaging in patients with chest pain, 272 thallium-201 stress tests performed in 133 hypertensive patients and 139 normotensive patients over a 1-year period were reviewed. Normotensive and hypertensive patients were similar in age, gender distribution, prevalence of cardiac risk factors (tobacco smoking, hyperlipidemia, and diabetes mellitus), medications, and clinical symptoms of coronary disease. Electrocardiographic criteria for left ventricular hypertrophy were present in 16 hypertensive patients. Stepwise probability analysis was used to determine the likelihood of coronary artery disease for each patient. In patients with mid to high likelihood of coronary disease (greater than 25% probability), abnormal thallium-201 stress images were present in 54 of 60 (90%) hypertensive patients compared with 51 of 64 (80%) normotensive patients. However, in 73 patients with a low likelihood of coronary disease (less than or equal to 25% probability), abnormal thallium-201 stress images were present in 21 patients (29%) of the hypertensive group compared with only 5 of 75 (7%) of the normotensive patients (p less than 0.001). These findings suggest that in patients with a mid to high likelihood of coronary artery disease, coexistent hypertension does not affect the results of thallium-201 exercise stress testing. However, in patients with a low likelihood of coronary artery disease, abnormal thallium-201 stress images are obtained more frequently in hypertensive patients than in normotensive patients

  12. Elimination of mercury in health care facilities.

    Science.gov (United States)

    2000-03-01

    Mercury is a persistent, bioaccumulative toxin that has been linked to numerous health effects in humans and wildlife. It is a potent neurotoxin that may also harm the brain, kidneys, and lungs. Unborn children and young infants are at particular risk for brain damage from mercury exposure. Hospitals' use of mercury in chemical solutions, thermometers, blood pressure gauges, batteries, and fluorescent lamps makes these facilities large contributors to the overall emission of mercury into the environment. Most hospitals recognize the dangers of mercury. In a recent survey, four out of five hospitals stated that they have policies in place to eliminate the use of mercury-containing products. Sixty-two percent of them require vendors to disclose the presence of mercury in chemicals that the hospitals purchase. Only 12 percent distribute mercury-containing thermometers to new parents. Ninety-two percent teach their employees about the health and environmental effects of mercury, and 46 percent teach all employees how to clean up mercury spills. However, the same study showed that many hospitals have not implemented their policies. Forty-two percent were not aware whether they still purchased items containing mercury. In addition, 49 percent still purchase mercury thermometers, 44 percent purchase mercury gastrointestinal diagnostic equipment, and 64 percent still purchase mercury lab thermometers.

  13. NZG 201 portable spectrometric unit

    International Nuclear Information System (INIS)

    Jursa, P.; Novakova, O.; Slezak, V.

    The NZG 201 spectrometric unit is a portable single-channel processing unit supplied from the mains or a battery which allows the qualitative and quantitative measurement of different types of ionizing radiation when connected to a suitable detection unit. The circuit layout and the choice of control elements makes the spectrometric unit suitable for use with scintillation detector units. The spectrometric unit consists of a pulse amplifier, an amplitude pulse analyzer, a pulse counter, a pulse rate counter with an output for a recorder, a high voltage source and a low voltage source. The block diagram is given. All circuits are modular and are mounted on PCB's. The apparatus is built in a steel cabinet with a raised edge which protects the control elements. The linear pulse amplifier has a maximum gain of 1024, the pulse counter has a maximum capacity of 10 6 -1 imp and time resolution better than 0.5 μs. The temperature interval at which the apparatus is operational is 0 to 45 degC, its weight is 12.5 kg and dimensions 36x280x310 mm, energy range O.025 to 2.5 MeV, for 137 Cs the energy resolution is 8 to 10%. The spectrometric unit NZG 2O1 may, with regard to its parameters, number and range of control elements, be used as a universal measuring unit. (J.P.)

  14. Mercury pollution: a transdisciplinary treatment

    National Research Council Canada - National Science Library

    Zuber, Sharon L; Newman, Michael C

    2012-01-01

    .... Also included are smaller case studies, such as the Minamata tragedy, fish consumption, and international treaties"-- "Mercury is the gravest chemical pollutant problem of our time, and this is...

  15. Origin and composition of Mercury

    International Nuclear Information System (INIS)

    Lewis, J.S.

    1988-01-01

    The predictions of the expected range of composition of Mercury at the time of its formation made on the basis of a suite of condensation-accretion models of Mercury spanning a range of condensation temperature and accretion sampling functions appropriate to Mercury are examined. It is concluded that these compositonal models can, if modified to take into account the nonselective loss of most of the silicate component of the planet during accretion, provide compositional predictions for the Weidenschilling (1978, 1980) mechanism for the accretion of a metal-rich Mercury. The silicate portion would, in this case, contain 3.6 to 4.5 percent alumina, roughly 1 percent of alkali oxides, and between 0.5 and 6 percent FeO

  16. Localized surface plasmon resonance mercury detection system and methods

    Science.gov (United States)

    James, Jay; Lucas, Donald; Crosby, Jeffrey Scott; Koshland, Catherine P.

    2016-03-22

    A mercury detection system that includes a flow cell having a mercury sensor, a light source and a light detector is provided. The mercury sensor includes a transparent substrate and a submonolayer of mercury absorbing nanoparticles, e.g., gold nanoparticles, on a surface of the substrate. Methods of determining whether mercury is present in a sample using the mercury sensors are also provided. The subject mercury detection systems and methods find use in a variety of different applications, including mercury detecting applications.

  17. Mercury Toolset for Spatiotemporal Metadata

    Science.gov (United States)

    Devarakonda, Ranjeet; Palanisamy, Giri; Green, James; Wilson, Bruce; Rhyne, B. Timothy; Lindsley, Chris

    2010-06-01

    Mercury (http://mercury.ornl.gov) is a set of tools for federated harvesting, searching, and retrieving metadata, particularly spatiotemporal metadata. Version 3.0 of the Mercury toolset provides orders of magnitude improvements in search speed, support for additional metadata formats, integration with Google Maps for spatial queries, facetted type search, support for RSS (Really Simple Syndication) delivery of search results, and enhanced customization to meet the needs of the multiple projects that use Mercury. It provides a single portal to very quickly search for data and information contained in disparate data management systems, each of which may use different metadata formats. Mercury harvests metadata and key data from contributing project servers distributed around the world and builds a centralized index. The search interfaces then allow the users to perform a variety of fielded, spatial, and temporal searches across these metadata sources. This centralized repository of metadata with distributed data sources provides extremely fast search results to the user, while allowing data providers to advertise the availability of their data and maintain complete control and ownership of that data. Mercury periodically (typically daily)harvests metadata sources through a collection of interfaces and re-indexes these metadata to provide extremely rapid search capabilities, even over collections with tens of millions of metadata records. A number of both graphical and application interfaces have been constructed within Mercury, to enable both human users and other computer programs to perform queries. Mercury was also designed to support multiple different projects, so that the particular fields that can be queried and used with search filters are easy to configure for each different project.

  18. Mercury Toolset for Spatiotemporal Metadata

    Science.gov (United States)

    Wilson, Bruce E.; Palanisamy, Giri; Devarakonda, Ranjeet; Rhyne, B. Timothy; Lindsley, Chris; Green, James

    2010-01-01

    Mercury (http://mercury.ornl.gov) is a set of tools for federated harvesting, searching, and retrieving metadata, particularly spatiotemporal metadata. Version 3.0 of the Mercury toolset provides orders of magnitude improvements in search speed, support for additional metadata formats, integration with Google Maps for spatial queries, facetted type search, support for RSS (Really Simple Syndication) delivery of search results, and enhanced customization to meet the needs of the multiple projects that use Mercury. It provides a single portal to very quickly search for data and information contained in disparate data management systems, each of which may use different metadata formats. Mercury harvests metadata and key data from contributing project servers distributed around the world and builds a centralized index. The search interfaces then allow the users to perform a variety of fielded, spatial, and temporal searches across these metadata sources. This centralized repository of metadata with distributed data sources provides extremely fast search results to the user, while allowing data providers to advertise the availability of their data and maintain complete control and ownership of that data. Mercury periodically (typically daily) harvests metadata sources through a collection of interfaces and re-indexes these metadata to provide extremely rapid search capabilities, even over collections with tens of millions of metadata records. A number of both graphical and application interfaces have been constructed within Mercury, to enable both human users and other computer programs to perform queries. Mercury was also designed to support multiple different projects, so that the particular fields that can be queried and used with search filters are easy to configure for each different project.

  19. Phytoremediation of Ionic and Methyl Mercury Pollution

    Energy Technology Data Exchange (ETDEWEB)

    Meagher, Richard B.

    2005-06-01

    Phytoremediation is defined as the use of plants to extract, resist, detoxify, and/or sequester toxic environmental pollutants. The long-term goal of the proposed research is to develop and test highly productive, field-adapted plant species that have been engineered for the phytoremediation of mercury. A variety of different genes, which should enable plants to clean mercury polluted sites are being tested as tools for mercury phytoremediation, first in model laboratory plants and then in potential field species. Several of these genes have already been shown to enhance mercury phytoremediation. Mercury pollution is a serious, world-wide problem affecting the health of human and wildlife populations. Environmentally, the most serious mercury threat is the production of methylmercury (CH3Hg+) by native bacteria at mercury contaminated wetland sites. Methylmercury is inherently more toxic than metallic (Hg(0)) or ionic (Hg(II)) mercury, and because methylmercury is prolifically biomagnified up the food chain, it poses the most immediate danger to animal populations. We have successfully engineered two model plants, Arabidopsis and tobacco, to use the bacterial merB gene to convert methylmercury to less toxic ionic mercury and to use the bacterial merA gene to further detoxify ionic mercury to the least toxic form of mercury, metallic mercury. Plants expressing both MerA and MerB proteins detoxify methylmercury in two steps to the metallic form. These plants germinate, grow, and set seed at normal growth rates on levels of methylmercury or ionic mercury that are lethal to normal plants. Our newest efforts involve engineering plants with several additional bacterial and plant genes that allow for higher levels of mercury resistance and mercury hyperaccumulation. The potential for these plants to hyperaccumulate mercury was further advanced by developing constitutive, aboveground, and root-specific gene expression systems. Our current strategy is to engineer plants to

  20. Autometallographic tracing of mercury in frog liver

    International Nuclear Information System (INIS)

    Loumbourdis, N.S.; Danscher, G.

    2004-01-01

    The distribution of mercury in the liver of the frog Rana ridibunda with the autometallographic method was investigated. The mercury specific autometallographic (HgS/Se AMG ) technique is a sensitive histochemical approach for tracing mercury in tissues from mercury-exposed organisms. Mercury accumulates in vivo as mercury sulphur/mercury selenium nanocrystals that can be silver-enhanced. Thus, only a fraction of the Hg can be visualized. Six animals were exposed for one day and another group of six animals for 6 days in 1 ppm mercury (as HgCI 2 ) dissolved in fresh water. A third group of six animals, served as controls, were sacrificed the day of arrival at the laboratory. First, mercury appears in the blood plasma and erythrocytes. Next, mercury moves to hepatocytes and in the apical part of the cells, that facing bile canaliculi. In a next step, mercury appears in the endothelial and Kupffer cells. It seems likely that, the mercury of hepatocytes moves through bile canaliculi to the gut, most probably bound to glutathione and/or other similar ligands. Most probably, the endothelial and Kupffer cells comprise the first line of defense against metal toxicity. - Frogs can be good bioindicators of mercury

  1. Mercury: Aspects of its ecology and environmental toxicity. [physiological effects of mercury compound contamination of environment

    Science.gov (United States)

    Siegel, S. M.

    1973-01-01

    A study was conducted to determine the effects of mercury pollution on the environment. The possible sources of mercury contamination in sea water are identified. The effects of mercury on food sources, as represented by swordfish, are analyzed. The physiological effects of varying concentrations of mercury are reported. Emphasis is placed on the situation existing in the Hawaiian Islands.

  2. Groundwater Modeling Of Mercury Pollution At A Former Mercury Cell Chlor Alkali Facility In Pavoldar, Kazakhstan

    Science.gov (United States)

    In Kazakhstan, there is a serious case of mercury pollution near the city of Pavlodar from an old mercury cell chlor-alkali plant. The soil, sediment, and water is severly contaminated with mercury and mercury compounds as a result of the industrial activity of this chemical pla...

  3. Bayesian analysis of stress thallium-201 scintigraphy

    International Nuclear Information System (INIS)

    The variation of the diagnostic value of stress T1-201 scintigraphy with prevalence of coronary heart disease (CHD) in the population has been investigated using Bayesian reasoning. From scintigraphic and arteriographic data obtained in 100 consecutive patients presenting with chest pain, the sensitivity of stress T1-201 scintigraphy for the detection of significant CHD was 90% and the specificity was 88%. From Bayes' Theorem, the posterior probability of having CHD for a given test result was calculated for prevalences of CHD ranging from 1% to 99%. the discriminant value of stress T1-201 scintigraphy was best when the prevalence of CHD lay between 30% and 70% and maximum for a prevalence of 52%. Thus, stress T1-201 scintigraphy would be an unsuitable diagnostic test where the prior probability of CHD is low, e.g., population screening programmes, and would add little where the clinical probability of having CHD is intermediate stress T1-201 scintigraphy may provide valuable diagnostic information. (orig.)

  4. Sorption of mercury on chemically synthesized polyaniline

    International Nuclear Information System (INIS)

    Remya Devi, P.S.; Verma, R.; Sudersanan, M.

    2006-01-01

    Sorption of inorganic mercury (Hg 2+ ) and methyl mercury, on chemically synthesized polyaniline, in 0.1-10N HCl solutions has been studied. Hg 2+ is strongly sorbed at low acidities and the extent of sorption decreases with increase in acidity. The sorption of methyl mercury is very low in the HCl concentration range studied. Sorption of Hg 2+ on polyaniline in 0.1-10N LiCl and H 2 SO 4 solutions has also been studied. The analysis of the data indicates that the sorption of Hg 2+ depends on the degree of protonation of polyaniline and the nature of mercury(II) chloride complexes in solution. X-ray photoelectron spectroscopy analysis (XPS) of polyaniline sorbed with mercury show that mercury is bound as Hg 2+ . Sorbed mercury is quantitatively eluted from polyaniline with 0.5N HNO 3 . Polyaniline can be used for separation and pre-concentration of inorganic mercury from aqueous samples. (author)

  5. EPA Leadership in the Global Mercury Partnership

    Science.gov (United States)

    The Global Mercury Partnership is a voluntary multi-stakeholder partnership initiated in 2005 to take immediate actions to protect human health and the environment from the releases of mercury and its compounds to the environment.

  6. Mercury-Containing Devices and Demolition

    Science.gov (United States)

    Some items inside residential buildings contain mercury, which poses a persistent and toxic human health and environmental threat. These materials should be carefully salvaged for proper recycling to prevent mercury contamination prior to demolition.

  7. Health Effects of Exposures to Mercury

    Science.gov (United States)

    ... Mercury in Your Environment Contact Us Share Health Effects of Exposures to Mercury Related Health Information for ... About PDF ; discussion starts on page 20) Methylmercury Effects Effects on People of All Ages Exposure to ...

  8. The effect of longterm exposure to mercury on the bacterial community in marine sediment

    DEFF Research Database (Denmark)

    Rasmussen, Lasse Dam; Sørensen, Søren Johannes

    1998-01-01

    Mercury pollution, bacteria, diversity, mercury resistance, antibiotic resistance, plasmid abundance......Mercury pollution, bacteria, diversity, mercury resistance, antibiotic resistance, plasmid abundance...

  9. Method for the removal and recovery of mercury

    Science.gov (United States)

    Easterly, Clay E.; Vass, Arpad A.; Tyndall, Richard L.

    1997-01-01

    The present invention is an enhanced method for the removal and recovery of mercury from mercury-contaminated matrices. The method involves contacting a mercury-contaminated matrix with an aqueous dispersant solution derived from specific intra-amoebic isolates to release the mercury from the mercury-contaminated matrix and emulsify the mercury; then, contacting the matrix with an amalgamating metal from a metal source to amalgamate the mercury to the amalgamating metal; removing the metallic source from the mercury-contaminated matrix; and heating the metallic source to vaporize the mercury in a closed system to capture the mercury vapors.

  10. Phytoremediation of Ionic and Methyl Mercury Pollution

    Energy Technology Data Exchange (ETDEWEB)

    Meagher, Richard B.

    2004-12-01

    Phytoremediation is defined as the use of plants to extract, resist, detoxify, and/or sequester toxic environmental pollutants. The long-term goal of the proposed research is to develop and test highly productive, field-adapted plant species that have been engineered for the phytoremediation of mercury. A variety of different genes, which should enable plants to clean mercury polluted sites are being tested as tools for mercury phytoremediation, first in model laboratory plants and then in potential field species. Several of these genes have already been shown to enhance mercury phytoremediation. Mercury pollution is a serious, world-wide problem affecting the health of human and wildlife populations. Environmentally, the most serious mercury threat is the production of methylmercury (CH3Hg+) by native bacteria at mercury contaminated wetland sites. Methylmercury is inherently more toxic than metallic (Hg(0)) or ionic (Hg(II)) mercury, and because methylmercury is prolifically biomagnified up the food chain, it poses the most immediate danger to animal populations. We have successfully engineered two model plants, Arabidopsis and tobacco, to use the bacterial merB gene to convert methylmercury to less toxic ionic mercury and to use the bacterial merA gene to further detoxify ionic mercury to the least toxic form of mercury, metallic mercury. Plants expressing both MerA and MerB proteins detoxify methylmercury in two steps to the metallic form. These plants germinate, grow, and set seed at normal growth rates on levels of methylmercury or ionic mercury that are lethal to normal plants. Our newest efforts involve engineering plants with several additional bacterial and plant genes that allow for higher levels of mercury resistance and mercury hyperaccumulation. The potential for these plants to hyperaccumulate mercury was further advanced by developing constitutive, aboveground, and root-specific gene expression systems.

  11. Mercury Continuous Emmission Monitor Calibration

    Energy Technology Data Exchange (ETDEWEB)

    John Schabron; Eric Kalberer; Ryan Boysen; William Schuster; Joseph Rovani

    2009-03-12

    Mercury continuous emissions monitoring systems (CEMs) are being implemented in over 800 coal-fired power plant stacks throughput the U.S. Western Research Institute (WRI) is working closely with the Electric Power Research Institute (EPRI), the National Institute of Standards and Technology (NIST), and the Environmental Protection Agency (EPA) to facilitate the development of the experimental criteria for a NIST traceability protocol for dynamic elemental mercury vapor calibrators/generators. These devices are used to calibrate mercury CEMs at power plant sites. The Clean Air Mercury Rule (CAMR) which was published in the Federal Register on May 18, 2005 and vacated by a Federal appeals court in early 2008 required that calibration be performed with NIST-traceable standards. Despite the vacature, mercury emissions regulations in the future will require NIST traceable calibration standards, and EPA does not want to interrupt the effort towards developing NIST traceability protocols. The traceability procedures will be defined by EPA. An initial draft traceability protocol was issued by EPA in May 2007 for comment. In August 2007, EPA issued a conceptual interim traceability protocol for elemental mercury calibrators. The protocol is based on the actual analysis of the output of each calibration unit at several concentration levels ranging initially from about 2-40 {micro}g/m{sup 3} elemental mercury, and in the future down to 0.2 {micro}g/m{sup 3}, and this analysis will be directly traceable to analyses by NIST. The EPA traceability protocol document is divided into two separate sections. The first deals with the qualification of calibrator models by the vendors for use in mercury CEM calibration. The second describes the procedure that the vendors must use to certify the calibrators that meet the qualification specifications. The NIST traceable certification is performance based, traceable to analysis using isotope dilution inductively coupled plasma

  12. Mercury detection with thermal neutrons

    International Nuclear Information System (INIS)

    Bell, Z.W.

    1994-01-01

    This report describes the work performed to design a gauge to detect mercury concealed within walls, floors, pipes, and equipment inside a building. The project arose out of a desire to decontaminate and decommission (D ampersand D) a building in which mercury had been used as part of a chemical process. The building contains plumbing and equipment, some with residual mercury even after draining, sumps, and hollow walls. So that releases of mercury to the environment might be minimized during D ampersand D activities, it was considered advisable to locate pockets of mercury that may have collected in concealed spaces so that they might be drained in a controlled fashion prior to the application of the wrecking ball or sledge hammer. The detection of such pockets within a building presents some problems not ordinarily encountered in a laboratory environment. Often, only a single side of a wall or pipe is accessible. This condition disqualifies transmission gauges (such as conventional x radiography) in which a probe is sent through the volume under test (VUT) from one side and its passage or attenuation is detected on the opposite side. A robust, one-sided system was needed

  13. Mercury bioaccumulation in the Mediterranean

    Directory of Open Access Journals (Sweden)

    Cinnirella S.

    2013-04-01

    Full Text Available This study details mercury pollution within the food chain of the Mediterranean by analysing the most comprehensive mercury dataset available for biota and water measurements. In this study we computed a bioaccumulation factor (BAF for datasets in the existing mercury-related scientific literature, in on-going programs, and in past measurement campaigns. Preliminary results indicate a major lack of information, making the outcome of any assessment very uncertain. Importantly, not all marine eco-regions are (or have ever been covered by measurement campaigns. Most lacking is information associated with the South-Eastern part of the Mediterranean, and in several eco-regions it is still impossible to reconstruct a trophic net, as the required species were not accounted for when mercury measurements were taken. The datasets also have additional temporal sampling problems, as species were often not sampled systematically (but only sporadically during any given sampling period. Moreover, datasets composed of mercury concentrations in water also suffer from similar geographic limitations, as they are concentrated in the North-Western Mediterranean. Despite these concerns, we found a very clear bioaccumulation trend in 1999, the only year where comprehensive information on both methylmercury concentrations in water and biota was available.

  14. Studies on 201Th myocardial scintiscanning

    International Nuclear Information System (INIS)

    Buchner, U.

    1979-01-01

    The diagnostical evidence of myocardial scintiscanning with thallium-201 was tested on 98 patients with coronary heart disease. 2 mCi thallium-201 were injected into an arm vene and then scintigrams of the heart were registered partly with a scanner, partly with a gamma camera in several views. The healthy myocardium was found in the thallium-201-scintigram to be a rather homogeneous, horeshoe-shaped activity pattern with intramyocardial activity differences of up to 20% of the maximal thallium-201-activity above the myocard which can be declared to be physiological. In dependency on the local blood flow conditions, thallium-201 is stored only in the healthy, but not in the ischaemic or infarcted myocardium. In the scintigram, these regions are seen as regions with reduced radioactivity. A comparison of the localisation of the infarction in the scintigram with those in the electrocardiagram and coronary angiogram showed a good congrucucy. Scintigrams taken at different times after the infarction brought a decrease in the number of diagnosed storage failures, from 90% to 68% in infarctions older than 6 weeks. A scintigraphical differentiation between fresh and old infarctions was not possible. In cases of angiographically established coronary heart disease without infarction, pathological storage reductions were observed. By comparing the findings obtained by scintiscanning with the results of laevocardiography it was seen that hypokinetic regions in the thallium-201-myocardial scintigram showed in only 6% of the cases a pathological storage defect; akinetic, dyskinetic, and aneurysmatic regions, however, were seen in 65% of the cases as clear activity reductions or failures. (orig./MG) [de

  15. Mineral resource of the month: mercury

    Science.gov (United States)

    ,

    2012-01-01

    The article offers information on mercury, a mineral commodity used in industrial and small-scale gold mining applications. Mercury has been reported to be used for amalgamation with gold since the Roman times. Mercury from cinnabar from Almadén, Spain has been used by Romans and has been continued to be used through the Middle Ages and the Colonial era.

  16. 40 CFR 721.10068 - Elemental mercury.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 30 2010-07-01 2010-07-01 false Elemental mercury. 721.10068 Section... Substances § 721.10068 Elemental mercury. (a) Definitions. The definitions in § 721.3 apply to this section... elemental mercury (CAS. No. 7439-97-6) is subject to reporting under this section for the significant new...

  17. 47 CFR 2.201 - Emission, modulation, and transmission characteristics.

    Science.gov (United States)

    2010-10-01

    ... characteristics. 2.201 Section 2.201 Telecommunication FEDERAL COMMUNICATIONS COMMISSION GENERAL FREQUENCY..., and transmission characteristics. The following system of designating emission, modulation, and transmission characteristics shall be employed. (a) Emissions are designated according to their classification...

  18. A method for the production of thallium-201

    International Nuclear Information System (INIS)

    Ageev, V.A.; Kljuchnikov, A.A.; Linev, A.F.; Khalkin, V.A.; Zaitseva, N.G.

    1987-01-01

    For the production of thallium-201 a target of at least 95% enriched pure lead-206 is irradiated by a proton beam of an energy of between 50 and 70 MeV. During irradiation the reaction 206 Pb(p,6n) 201 Bi takes place. The target is kept sufficiently long for the transition 201 Bi- 201 Pb- 201 Tl to take place. The target is then dissolved in acid. The thallium-201 contained in the acid is oxidized to the trivalent state followed by precipitation of the lead. Lead traces remaining in solution are separated from the thallium-201 through cation exchange following which the thallium-201 is eluted using hydrochloric acid

  19. How Tiny Collisions Shape Mercury

    Science.gov (United States)

    Kohler, Susanna

    2017-07-01

    If space rocks are unpleasant to encounter, space dust isnt much better. Mercurys cratered surface tells of billions of years of meteoroid impacts but its thin atmosphere is what reveals its collisional history with smaller impactors. Now new research is providing a better understanding of what were seeing.Micrometeoroids Ho!The inner solar system is bombarded by micrometeoroids, tiny particles of dust (on the scale of a tenth of a millimeter) emitted by asteroids and comets as they make their closest approach to the Sun. This dust doesnt penetrateEarths layers of atmosphere, but the innermost planet of our solar system, Mercury, doesnt have this convenient cushioning.Just as Mercury is affected by the impacts of large meteoroids, its also shaped by the many smaller-scale impacts it experiences. These tiny collisions are thought to vaporize atoms and molecules from the planets surface, which quickly dissociate. This process adds metals to Mercurys exosphere, the planets extremely tenuous atmosphere.Modeling PopulationsDistribution of the directions from which meteoroids originate before impacting Mercurys surface, as averaged over its entire orbit. Local time of 12 hr corresponds to the Sun-facing side. A significant asymmetry is seen between the dawn (6 hrs) and dusk (18 hrs) rates. [Pokorn et al. 2017]The metal distribution in the exosphere provides a way for us to measure the effect of micrometeoroid impacts on Mercury but this only works if we have accurate models of the process. A team of scientists led by Petr Pokorn (The Catholic University of America and NASA Goddard SFC) has now worked to improve our picture of micrometeoroid impact vaporization on Mercury.Pokorn and collaborators argue that two meteoroid populations Jupiter-family comets (short-period) and Halley-type comets (long-period) contribute the dust for the majority of micrometeoroid impacts on Mercury. The authors model the dynamics and evolution of these two populations, reproducing the

  20. Control of mercury emissions: policies, technologies, and future trends

    OpenAIRE

    Rhee, Seung-Whee

    2015-01-01

    Seung-Whee Rhee Department of Environmental Engineering, Kyonggi University, Suwon, Republic of Korea Abstract: Owing to the Minamata Convention on Mercury and the Global Mercury Partnership, policies and regulations on mercury management in advanced countries were intensified by a mercury phaseout program in the mercury control strategy. In developing countries, the legislative or regulatory frameworks on mercury emissions are not established specifically, but mercury management is designed...

  1. Canadian mercury inventories: the missing pieces

    Energy Technology Data Exchange (ETDEWEB)

    Hagreen, L.A.; Lourie, B.A. [Summerhill Group, Toronto, ON (Canada)

    2004-07-01

    Research was conducted to determine the significance of the deliberate use of mercury in products in Canada and the associated releases from these sources. Through a combination of literature review and new calculations, the reservoir, flux, and releases of mercury from eight product sources were calculated, and these results compared to historical Canadian inventories. Mercury contributions from the waste sector were also assessed and compared to total Canadian mercury releases and to mercury releases from coal-fired generating stations. Results suggest the use and release of mercury associated with its use in products is 4.5 times what previous inventories indicate. Including dental amalgam and sewage sludge, the total releases of mercury to all environmental compartments in Canada totals 20 tonnes per year. This accounts for less than one-half of the 44 tonnes per year of mercury released from mercury waste disposal each year in Canada. Waste mercury contributions from hazardous waste imports, unknown product sources, and incomplete information on the use of mercury in known products may account for this discrepancy. Waste-related mercury releases and transfers for disposal and recycling are 11 times greater than that of electricity generation in Canada. Results indicate that Canadian inventories have underestimated the significance of mercury use and release associated with products, calling into question the current priorities for mercury management. This paper was developed as part of a panel session at the International Joint Commission 'Mercury in the Ecosystem' workshop, February 26-27, 2003, Windsor, ON, Canada, as a complement to the information on Canadian Inventories presented by Luke Trip (Senes Consulting, Ottawa, ON, Canada).

  2. Sodium Velocity Maps on Mercury

    Science.gov (United States)

    Potter, A. E.; Killen, R. M.

    2011-01-01

    The objective of the current work was to measure two-dimensional maps of sodium velocities on the Mercury surface and examine the maps for evidence of sources or sinks of sodium on the surface. The McMath-Pierce Solar Telescope and the Stellar Spectrograph were used to measure Mercury spectra that were sampled at 7 milliAngstrom intervals. Observations were made each day during the period October 5-9, 2010. The dawn terminator was in view during that time. The velocity shift of the centroid of the Mercury emission line was measured relative to the solar sodium Fraunhofer line corrected for radial velocity of the Earth. The difference between the observed and calculated velocity shift was taken to be the velocity vector of the sodium relative to Earth. For each position of the spectrograph slit, a line of velocities across the planet was measured. Then, the spectrograph slit was stepped over the surface of Mercury at 1 arc second intervals. The position of Mercury was stabilized by an adaptive optics system. The collection of lines were assembled into an images of surface reflection, sodium emission intensities, and Earthward velocities over the surface of Mercury. The velocity map shows patches of higher velocity in the southern hemisphere, suggesting the existence of sodium sources there. The peak earthward velocity occurs in the equatorial region, and extends to the terminator. Since this was a dawn terminator, this might be an indication of dawn evaporation of sodium. Leblanc et al. (2008) have published a velocity map that is similar.

  3. 27 CFR 26.201 - Products exempt from tax.

    Science.gov (United States)

    2010-04-01

    ... 27 Alcohol, Tobacco Products and Firearms 1 2010-04-01 2010-04-01 false Products exempt from tax. 26.201 Section 26.201 Alcohol, Tobacco Products and Firearms ALCOHOL AND TOBACCO TAX AND TRADE BUREAU... Coming Into the United States From the Virgin Islands § 26.201 Products exempt from tax. (a) General...

  4. Thallium-201 accumulation in cerebral candidiasis: Unexpected finding on SPECT

    International Nuclear Information System (INIS)

    Tonami, N.; Matsuda, H.; Ooba, H.; Yokoyama, K.; Hisada, K.; Ikeda, K.; Yamashita, J.

    1990-01-01

    The authors present an unexpected finding of Tl-201 uptake in the intracerebral lesions due to candidiasis. SPECT demonstrated the extent of the lesions and a high target-to-background ratio. The regions where abnormal Tl-201 accumulation was seen were nearly consistent with CT scans of those enhanced by a contrast agent. After treatment, most of the abnormal Tl-201 accumulation disappeared

  5. Thallium-201 accumulation in cerebral candidiasis: Unexpected finding on SPECT

    Energy Technology Data Exchange (ETDEWEB)

    Tonami, N.; Matsuda, H.; Ooba, H.; Yokoyama, K.; Hisada, K.; Ikeda, K.; Yamashita, J. (Kanazawa Univ. (Japan))

    1990-06-01

    The authors present an unexpected finding of Tl-201 uptake in the intracerebral lesions due to candidiasis. SPECT demonstrated the extent of the lesions and a high target-to-background ratio. The regions where abnormal Tl-201 accumulation was seen were nearly consistent with CT scans of those enhanced by a contrast agent. After treatment, most of the abnormal Tl-201 accumulation disappeared.

  6. 46 CFR 201.117 - Inclusion in record.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 8 2010-10-01 2010-10-01 false Inclusion in record. 201.117 Section 201.117 Shipping MARITIME ADMINISTRATION, DEPARTMENT OF TRANSPORTATION POLICY, PRACTICE AND PROCEDURE RULES OF PRACTICE AND PROCEDURE Discovery and Depositions (Rule 11) § 201.117 Inclusion in record. No deposition or part thereof...

  7. 7 CFR 1494.201 - Definitions of terms.

    Science.gov (United States)

    2010-01-01

    ... high value agricultural product. For purposes of this definition, fish entirely produced in the United... 7 Agriculture 10 2010-01-01 2010-01-01 false Definitions of terms. 1494.201 Section 1494.201... Program Operations § 1494.201 Definitions of terms. Terms used in this subpart, Invitations issued...

  8. 5 CFR 250.201 - Coverage and purpose.

    Science.gov (United States)

    2010-01-01

    ... 5 Administrative Personnel 1 2010-01-01 2010-01-01 false Coverage and purpose. 250.201 Section 250.201 Administrative Personnel OFFICE OF PERSONNEL MANAGEMENT CIVIL SERVICE REGULATIONS PERSONNEL MANAGEMENT IN AGENCIES Strategic Human Capital Management § 250.201 Coverage and purpose. The Chief Human...

  9. 14 CFR 1203.201 - Information security objectives.

    Science.gov (United States)

    2010-01-01

    ... 14 Aeronautics and Space 5 2010-01-01 2010-01-01 false Information security objectives. 1203.201 Section 1203.201 Aeronautics and Space NATIONAL AERONAUTICS AND SPACE ADMINISTRATION INFORMATION SECURITY PROGRAM NASA Information Security Program § 1203.201 Information security objectives. The objectives of...

  10. 7 CFR 201.13 - Lot number or other identification.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 3 2010-01-01 2010-01-01 false Lot number or other identification. 201.13 Section 201... ACT FEDERAL SEED ACT REGULATIONS Labeling Agricultural Seeds § 201.13 Lot number or other identification. The lot number or other identification shall be shown on the label and shall be the same as that...

  11. 7 CFR 868.201 - Definition of rough rice.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 7 2010-01-01 2010-01-01 false Definition of rough rice. 868.201 Section 868.201... FOR CERTAIN AGRICULTURAL COMMODITIES United States Standards for Rough Rice Terms Defined § 868.201 Definition of rough rice. Rice (Oryza sativa L.) which consists of 50 percent or more of paddy kernels (see...

  12. 46 CFR 201.6 - Documents in foreign languages.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 8 2010-10-01 2010-10-01 false Documents in foreign languages. 201.6 Section 201.6... PRACTICE AND PROCEDURE General Information (Rule 1) § 201.6 Documents in foreign languages. Every document, exhibit, or other paper written in a language other than English and filed with the Administration or...

  13. 17 CFR 201.460 - Record before the Commission.

    Science.gov (United States)

    2010-04-01

    ... 17 Commodity and Securities Exchanges 2 2010-04-01 2010-04-01 false Record before the Commission. 201.460 Section 201.460 Commodity and Securities Exchanges SECURITIES AND EXCHANGE COMMISSION RULES OF PRACTICE Rules of Practice Appeal to the Commission and Commission Review § 201.460 Record before the...

  14. 21 CFR 201.61 - Statement of identity.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 4 2010-04-01 2010-04-01 false Statement of identity. 201.61 Section 201.61 Food...: GENERAL LABELING Labeling Requirements for Over-the-Counter Drugs § 201.61 Statement of identity. (a) The... features a statement of the identity of the commodity. (b) Such statement of identity shall be in terms of...

  15. 45 CFR 201.11 - Personnel merit system review.

    Science.gov (United States)

    2010-10-01

    ... 45 Public Welfare 2 2010-10-01 2010-10-01 false Personnel merit system review. 201.11 Section 201... STATES FOR PUBLIC ASSISTANCE PROGRAMS Review and Audits § 201.11 Personnel merit system review. A personnel merit system review is carried out by the Office of State Merit Systems of the Office of the...

  16. 27 CFR 20.201 - Liability and responsibility of carrier.

    Science.gov (United States)

    2010-04-01

    ... Losses § 20.201 Liability and responsibility of carrier. (a) A person or carrier transporting specially... 27 Alcohol, Tobacco Products and Firearms 1 2010-04-01 2010-04-01 false Liability and responsibility of carrier. 20.201 Section 20.201 Alcohol, Tobacco Products and Firearms ALCOHOL AND TOBACCO TAX...

  17. 7 CFR 766.201 - Shared Appreciation Agreement.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 7 2010-01-01 2010-01-01 false Shared Appreciation Agreement. 766.201 Section 766.201 Agriculture Regulations of the Department of Agriculture (Continued) FARM SERVICE AGENCY, DEPARTMENT OF AGRICULTURE SPECIAL PROGRAMS DIRECT LOAN SERVICING-SPECIAL Servicing Shared Appreciation Agreements and Net Recovery Buyout Agreements § 766.201...

  18. 49 CFR 179.201-9 - Gauging device.

    Science.gov (United States)

    2010-10-01

    ... Specifications for Non-Pressure Tank Car Tanks (Classes DOT-111AW and 115AW) § 179.201-9 Gauging device. A gauging device of an approved design must be applied to permit determining the liquid level of the lading... 49 Transportation 2 2010-10-01 2010-10-01 false Gauging device. 179.201-9 Section 179.201-9...

  19. 19 CFR 201.5 - Attendance fees and mileage.

    Science.gov (United States)

    2010-04-01

    ... 19 Customs Duties 3 2010-04-01 2010-04-01 false Attendance fees and mileage. 201.5 Section 201.5 Customs Duties UNITED STATES INTERNATIONAL TRADE COMMISSION GENERAL RULES OF GENERAL APPLICATION Miscellaneous § 201.5 Attendance fees and mileage. (a) Deponents and witnesses. Any person compelled to appear...

  20. 46 CFR 201.8 - Use of gender and number.

    Science.gov (United States)

    2010-10-01

    ... PROCEDURE General Information (Rule 1) § 201.8 Use of gender and number. Words importing the singular number may extend and be applied to several persons or things; words importing the plural number may include... 46 Shipping 8 2010-10-01 2010-10-01 false Use of gender and number. 201.8 Section 201.8 Shipping...

  1. 37 CFR 201.25 - Visual Arts Registry.

    Science.gov (United States)

    2010-07-01

    ... 37 Patents, Trademarks, and Copyrights 1 2010-07-01 2010-07-01 false Visual Arts Registry. 201.25 Section 201.25 Patents, Trademarks, and Copyrights COPYRIGHT OFFICE, LIBRARY OF CONGRESS COPYRIGHT OFFICE AND PROCEDURES GENERAL PROVISIONS § 201.25 Visual Arts Registry. (a) General. This section prescribes the procedures relating to the submission...

  2. 46 CFR 201.144 - Offer of proof.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 8 2010-10-01 2010-10-01 false Offer of proof. 201.144 Section 201.144 Shipping... PROCEDURE Evidence (Rule 14) § 201.144 Offer of proof. An offer of proof made in connection with an... accompany the record as the offer of proof. ...

  3. 49 CFR 234.201 - Location of plans.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 4 2010-10-01 2010-10-01 false Location of plans. 234.201 Section 234.201..., Inspection, and Testing Maintenance Standards § 234.201 Location of plans. Plans required for proper maintenance and testing shall be kept at each highway-rail grade crossing warning system location. Plans shall...

  4. 46 CFR 201.183 - Ex parte communications.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 8 2010-10-01 2010-10-01 false Ex parte communications. 201.183 Section 201.183... PRACTICE AND PROCEDURE Judicial Standards of Practice (Rule 19) § 201.183 Ex parte communications. (a) Requests for expeditious treatment of matters pending with the Administration are deemed communications on...

  5. 30 CFR 77.201 - Methane content in surface installations.

    Science.gov (United States)

    2010-07-01

    ... 30 Mineral Resources 1 2010-07-01 2010-07-01 false Methane content in surface installations. 77.201 Section 77.201 Mineral Resources MINE SAFETY AND HEALTH ADMINISTRATION, DEPARTMENT OF LABOR COAL... UNDERGROUND COAL MINES Surface Installations § 77.201 Methane content in surface installations. The methane...

  6. 48 CFR 450.201 - Delegation of authority.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 4 2010-10-01 2010-10-01 false Delegation of authority. 450.201 Section 450.201 Federal Acquisition Regulations System DEPARTMENT OF AGRICULTURE CONTRACT MANAGEMENT EXTRAORDINARY CONTRACTUAL ACTIONS Delegation of and Limitations on Exercise of Authority 450.201 Delegation of authority. The Assistant...

  7. 33 CFR 401.201 - Delegation of authority.

    Science.gov (United States)

    2010-07-01

    ... 33 Navigation and Navigable Waters 3 2010-07-01 2010-07-01 false Delegation of authority. 401.201 Section 401.201 Navigation and Navigable Waters SAINT LAWRENCE SEAWAY DEVELOPMENT CORPORATION, DEPARTMENT OF TRANSPORTATION SEAWAY REGULATIONS AND RULES Assessment, Mitigation or Remission of Penalties § 401.201 Delegation of authority. (a) The...

  8. 7 CFR 201.54 - Number of seeds for germination.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 3 2010-01-01 2010-01-01 false Number of seeds for germination. 201.54 Section 201.54... REGULATIONS Germination Tests in the Administration of the Act § 201.54 Number of seeds for germination. At least 400 seeds shall be tested for germination; except that in mixtures, 200 seeds of each of those...

  9. 7 CFR 201.53 - Source of seeds for germination.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 3 2010-01-01 2010-01-01 false Source of seeds for germination. 201.53 Section 201.53... REGULATIONS Germination Tests in the Administration of the Act § 201.53 Source of seeds for germination. (a) When both purity and germination tests are required, seeds for germination shall be taken from the...

  10. 7 CFR 201.31a - Labeling treated seed.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 3 2010-01-01 2010-01-01 false Labeling treated seed. 201.31a Section 201.31a..., Inspections, Marketing Practices), DEPARTMENT OF AGRICULTURE (CONTINUED) FEDERAL SEED ACT FEDERAL SEED ACT REGULATIONS Labeling in General § 201.31a Labeling treated seed. (a) Contents of label. Any agricultural seed...

  11. 7 CFR 201.69 - Classes of certified seed.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 3 2010-01-01 2010-01-01 false Classes of certified seed. 201.69 Section 201.69..., Inspections, Marketing Practices), DEPARTMENT OF AGRICULTURE (CONTINUED) FEDERAL SEED ACT FEDERAL SEED ACT REGULATIONS Certified Seed § 201.69 Classes of certified seed. (a) Classes of certified seed are as follows...

  12. 7 CFR 201.64 - Pure live seed.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 3 2010-01-01 2010-01-01 false Pure live seed. 201.64 Section 201.64 Agriculture..., Inspections, Marketing Practices), DEPARTMENT OF AGRICULTURE (CONTINUED) FEDERAL SEED ACT FEDERAL SEED ACT REGULATIONS Tolerances § 201.64 Pure live seed. The tolerance for pure live seed shall be determined by...

  13. 7 CFR 201.49 - Other crop seed.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 3 2010-01-01 2010-01-01 false Other crop seed. 201.49 Section 201.49 Agriculture..., Inspections, Marketing Practices), DEPARTMENT OF AGRICULTURE (CONTINUED) FEDERAL SEED ACT FEDERAL SEED ACT REGULATIONS Purity Analysis in the Administration of the Act § 201.49 Other crop seed. (a) Seeds of plants...

  14. 7 CFR 201.47a - Seed unit.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 3 2010-01-01 2010-01-01 false Seed unit. 201.47a Section 201.47a Agriculture..., Inspections, Marketing Practices), DEPARTMENT OF AGRICULTURE (CONTINUED) FEDERAL SEED ACT FEDERAL SEED ACT REGULATIONS Purity Analysis in the Administration of the Act § 201.47a Seed unit. The seed unit is the...

  15. 7 CFR 201.7a - Treated seed.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 3 2010-01-01 2010-01-01 false Treated seed. 201.7a Section 201.7a Agriculture..., Inspections, Marketing Practices), DEPARTMENT OF AGRICULTURE (CONTINUED) FEDERAL SEED ACT FEDERAL SEED ACT REGULATIONS Records for Agricultural and Vegetable Seeds § 201.7a Treated seed. The complete record for any...

  16. 7 CFR 201.24a - Inoculated seed.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 3 2010-01-01 2010-01-01 false Inoculated seed. 201.24a Section 201.24a Agriculture..., Inspections, Marketing Practices), DEPARTMENT OF AGRICULTURE (CONTINUED) FEDERAL SEED ACT FEDERAL SEED ACT REGULATIONS Labeling Agricultural Seeds § 201.24a Inoculated seed. Seed claimed to be inoculated shall be...

  17. SPET brain imaging with 201 diethyldithiocarbamate in acute ischaemic stroke

    NARCIS (Netherlands)

    de Bruïne, J. F.; Limburg, M.; van Royen, E. A.; Hijdra, A.; Hill, T. C.; van der Schoot, J. B.

    1990-01-01

    Thirty-five patients with acute ischaemic stroke were studied within 24 h after hospital admission with thallium 201 diethyldithiocarbamate single photon emission tomography (201Tl-DDC SPET) and X-ray computed tomography (CT). 201Tl-DDC is a non-redistributing agent that allows postponed imaging

  18. 21 CFR 201.60 - Principal display panel.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 4 2010-04-01 2010-04-01 false Principal display panel. 201.60 Section 201.60...: GENERAL LABELING Labeling Requirements for Over-the-Counter Drugs § 201.60 Principal display panel. The term principal display panel, as it applies to over-the-counter drugs in package form and as used in...

  19. 7 CFR 201.52 - Noxious-weed seeds.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 3 2010-01-01 2010-01-01 false Noxious-weed seeds. 201.52 Section 201.52 Agriculture... REGULATIONS Purity Analysis in the Administration of the Act § 201.52 Noxious-weed seeds. (a) The determination of the number of seeds, bulblets, or tubers of individual noxious weeds present per unit weight...

  20. 41 CFR 50-201.1101 - Minimum wages.

    Science.gov (United States)

    2010-07-01

    ... 41 Public Contracts and Property Management 1 2010-07-01 2010-07-01 true Minimum wages. 50-201... Contracts PUBLIC CONTRACTS, DEPARTMENT OF LABOR 201-GENERAL REGULATIONS § 50-201.1101 Minimum wages. Determinations of prevailing minimum wages or changes therein will be published in the Federal Register by the...

  1. 17 CFR 201.67 - Applications by legal guardians.

    Science.gov (United States)

    2010-04-01

    ... guardians. 201.67 Section 201.67 Commodity and Securities Exchanges SECURITIES AND EXCHANGE COMMISSION RULES... Securities Exchange Act of 1934 § 201.67 Applications by legal guardians. An application pursuant to this... information that may be subject to a bounty payment, or by the parent or guardian of such a person if that...

  2. 22 CFR 201.31 - Suppliers of commodities.

    Science.gov (United States)

    2010-04-01

    ... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Suppliers of commodities. 201.31 Section 201.31 Foreign Relations AGENCY FOR INTERNATIONAL DEVELOPMENT RULES AND PROCEDURES APPLICABLE TO COMMODITY TRANSACTIONS FINANCED BY USAID Responsibilities of Suppliers § 201.31 Suppliers of commodities. (a) Performance...

  3. 22 CFR 201.11 - Eligibility of commodities.

    Science.gov (United States)

    2010-04-01

    ... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Eligibility of commodities. 201.11 Section 201... COMMODITY TRANSACTIONS FINANCED BY USAID Conditions Governing the Eligibility of Procurement Transactions for USAID Financing § 201.11 Eligibility of commodities. To qualify for USAID financing, a commodity...

  4. Apparatus for control of mercury

    Science.gov (United States)

    Downs, William; Bailey, Ralph T.

    2001-01-01

    A method and apparatus for reducing mercury in industrial gases such as the flue gas produced by the combustion of fossil fuels such as coal adds hydrogen sulfide to the flue gas in or just before a scrubber of the industrial process which contains the wet scrubber. The method and apparatus of the present invention is applicable to installations employing either wet or dry scrubber flue gas desulfurization systems. The present invention uses kraft green liquor as a source for hydrogen sulfide and/or the injection of mineral acids into the green liquor to release vaporous hydrogen sulfide in order to form mercury sulfide solids.

  5. Coal fired flue gas mercury emission controls

    CERN Document Server

    Wu, Jiang; Pan, Weiguo; Pan, Weiping

    2015-01-01

    Mercury (Hg) is one of the most toxic heavy metals, harmful to both the environment and human health. Hg is released into the atmosphere from natural and anthropogenic sources and its emission control has caused much concern. This book introduces readers to Hg pollution from natural and anthropogenic sources and systematically describes coal-fired flue gas mercury emission control in industry, especially from coal-fired power stations. Mercury emission control theory and experimental research are demonstrated, including how elemental mercury is oxidized into oxidized mercury and the effect of

  6. Marine biogeochemistry of mercury

    International Nuclear Information System (INIS)

    Gill, G.A.

    1986-01-01

    Noncontaminating sample collection and handling procedures and accurate and sensitive analysis methods were developed to measure sub-picomolar Hg concentrations in seawater. Reliable and diagnostic oceanographic Hg distributions were obtained, permitting major processes governing the marine biogeochemistry of Hg to be identified. Mercury concentrations in the northwest Atlantic, central Pacific, southeast Pacific, and Tasman Sea ranged from 0.5 to 12 pM. Vertical Hg distributions often exhibited a maximum within or near the main thermocline. At similar depths, Hg concentrations in the northwest Atlantic Ocean were elevated compared to the N. Pacific Ocean. This pattern appears to result from a combination of enhanced supply of Hg to the northwest Atlantic by rainfall and scavenging removal along deep water circulation pathways. These observations are supported by geochemical steady-state box modelling which predicts a relatively short mean residence time for Hg in the oceans; demonstrating the reactive nature of Hg in seawater and precluding significant involvement in nutrient-type recyclic. Evidence for the rapid removal of Hg from seawater was obtained at two locations. Surface seawater Hg measurements along 160 0 W (20 0 N to 20 0 S) showed a depression in the equatorial upwelling area which correlated well with the transect region exhibiting low 234 Th/ 238 U activity ratios. This relationship implies that Hg will be scavenged and removed from surface seawater in biologically productive oceanic zones. Further, a broad minimum in the vertical distribution of Hg was observed to coincide with the intense oxygen minimum zone in the water column in coastal waters off Peru

  7. Natural stable isotopic compositions of mercury in aerosols and wet precipitations around a coal-fired power plant in Xiamen, southeast China

    Science.gov (United States)

    Huang, Shuyuan; Sun, Lumin; Zhou, Tingjin; Yuan, Dongxing; Du, Bing; Sun, Xiuwu

    2018-01-01

    In this study, samples of 18 wet precipitations (WPs) and 38 aerosols were collected around a coal-fired power plant (CFPP) located in Xiamen, southeast China, which was equipped with a seawater flue gas desulfurization system. Total particulate mercury (TPM) in aerosol samples, and total mercury (WP-TM), dissolved mercury (WP-DM) and particulate mercury (WP-PM) in WP samples were analyzed for the natural isotopic compositions of mercury. For the first time, both mass dependent fractionation (MDF) and mass independent fractionation of odd (odd-MIF) and even (even-MIF) isotopes of WP-DM and WP-PM were reported and discussed. Both WP-TM and TPM displayed negative MDF and slightly positive even-MIF. Negative odd-MIF was observed in TPM and WP-PM, whereas positive odd-MIF was observed in WP-TM and WP-DM. It was found that the mercury budget in WP-PM samples was mainly controlled by atmospheric particles. Potential sources of mercury in samples were identified via analysis of mercury isotopic signatures and meteorological data with the NOAA HYSPLIT model. The results showed that TPM and WP-PM in solid samples were homologous and the isotopic compositions of WP-TM depended on those of WP-DM. The ratios of Δ199Hg/Δ201Hg resulting from photochemical reactions and positive Δ200Hg values (from -0.06‰ to 0.27‰) in all samples indicated that the mercury coming from local emission of the CFPP together with long-distance transportation were the two main contributing sources.

  8. 41 CFR 50-201.102 - Overtime.

    Science.gov (United States)

    2010-07-01

    ... 41 Public Contracts and Property Management 1 2010-07-01 2010-07-01 true Overtime. 50-201.102... computed and paid under section 7 of the Fair Labor Standards Act of 1938, as amended. The basic hourly... the case of any employee employed as provided in section 7(b) of the Fair Labor Standards Act of 1938...

  9. 47 CFR 201.3 - Policy.

    Science.gov (United States)

    2010-10-01

    ... OFFICE OF SCIENCE AND TECHNOLOGY POLICY AND NATIONAL SECURITY COUNCIL EXECUTIVE POLICY § 201.3 Policy. (a..., disaster or national emergency or a need to preserve the neutrality of the U.S.) and (2) Wire... and recovery. (g) The Director of the Office of Science and Technology Policy will serve as the...

  10. 48 CFR 419.201 - General policy.

    Science.gov (United States)

    2010-10-01

    ... SMALL BUSINESS PROGRAMS Policies 419.201 General policy. It is the policy of USDA to provide maximum practicable contracting and subcontracting opportunities to small business (SB), small disadvantaged business (SDB), HUBZone small business, women-owned business (WOB), veteran-owned small business (VOSB), and...

  11. 48 CFR 1313.201 - General.

    Science.gov (United States)

    2010-10-01

    ... 1313.201 Federal Acquisition Regulations System DEPARTMENT OF COMMERCE CONTRACTING METHODS AND CONTRACT... General. DOC employees, other than warranted contracting officers, must be delegated micro-purchase authority by the designee set forth in CAM 1301.70 according to FAR 1.603-3(b), and must be trained pursuant...

  12. 7 CFR 1901.201 - Purpose.

    Science.gov (United States)

    2010-01-01

    ... PROGRAM-RELATED INSTRUCTIONS Civil Rights Compliance Requirements § 1901.201 Purpose. This subpart... pursuant to Title VI of the Civil Rights Act of 1964, title VIII of the Civil Rights Act of 1968, Executive Order 11246 and the Equal Credit Opportunity Act of 1974, as they relate to the Farmers Home...

  13. 48 CFR 49.201 - General.

    Science.gov (United States)

    2010-10-01

    ....201 Federal Acquisition Regulations System FEDERAL ACQUISITION REGULATION CONTRACT MANAGEMENT... compensation is a matter of judgment and cannot be measured exactly. In a given case, various methods may be... strict accounting principles, is the heart of a settlement. (b) The primary objective is to negotiate a...

  14. 5 CFR 295.201 - General prohibition.

    Science.gov (United States)

    2010-01-01

    ... EMPLOYEES RELATING TO OFFICIAL INFORMATION AND PRODUCTION OF OFFICIAL RECORDS IN LEGAL PROCEEDINGS Requests for Testimony and Production of Documents § 295.201 General prohibition. No employee may produce... demand or request without the prior, written approval of the General Counsel. ...

  15. 5 CFR 2608.201 - General prohibition.

    Science.gov (United States)

    2010-01-01

    ... OGE EMPLOYEES RELATING TO OFFICIAL INFORMATION AND PRODUCTION OF OFFICIAL RECORDS IN LEGAL PROCEEDINGS Requests for Testimony and Production of Documents § 2608.201 General prohibition. No employee may produce... demand or request without the prior, written approval of the General Counsel. ...

  16. 10 CFR 1707.201 - General prohibition.

    Science.gov (United States)

    2010-01-01

    ... DEFENSE NUCLEAR FACILITIES SAFETY BOARD TESTIMONY BY DNFSB EMPLOYEES AND PRODUCTION OF OFFICIAL RECORDS IN LEGAL PROCEEDINGS Requests for Testimony and Production of Documents § 1707.201 General prohibition. No... information in response to a demand or request without the prior, written approval of the General Counsel. ...

  17. 5 CFR 591.201 - Definitions.

    Science.gov (United States)

    2010-01-01

    ... Cost-of-Living Allowance and Post Differential-Nonforeign Areas § 591.201 Definitions. In this subpart... the BLS survey of the change of consumer prices over time. Cost-of-living allowance (COLA) means an... nonforeign area where living costs are substantially higher than in the Washington, DC, area. Cost-of-living...

  18. 48 CFR 241.201 - Policy.

    Science.gov (United States)

    2010-10-01

    ..., practices, and decisions of independent regulatory bodies as a matter of comity is not a substitute for the....201 Policy. (1) DoD, as a matter of comity, generally complies with the current regulations, practices, and decisions of independent regulatory bodies. This policy does not extend to nonindependent...

  19. 23 CFR 650.201 - Purpose.

    Science.gov (United States)

    2010-04-01

    ... HIGHWAY ADMINISTRATION, DEPARTMENT OF TRANSPORTATION ENGINEERING AND TRAFFIC OPERATIONS BRIDGES, STRUCTURES, AND HYDRAULICS Erosion and Sediment Control on Highway Construction Projects § 650.201 Purpose..., abatement of water pollution, and prevention of damage by sediment deposition from all construction projects...

  20. 48 CFR 2419.201 - General policy.

    Science.gov (United States)

    2010-10-01

    ...-owned small businesses. (d) Each head of a contracting activity shall designate a small business...; (6) Advise such businesses with respect to the financial assistance available under existing laws and... SOCIOECONOMIC PROGRAMS SMALL BUSINESS PROGRAMS Policies 2419.201 General policy. (c) The Director, Office of...

  1. 40 CFR 201.10 - Applicability.

    Science.gov (United States)

    2010-07-01

    ... level emitted by rail cars and locomotives operated under the conditions specified, including the sound produced by refrigeration and air conditioning units which are an integral element of such equipment. The... Standards § 201.10 Applicability. The provisions of this subpart apply to all rail cars and all locomotives...

  2. 48 CFR 201.301 - Policy.

    Science.gov (United States)

    2010-10-01

    ... significant effect beyond the internal operating procedures of DoD or a significant cost or administrative... Logistics) (USD (AT&L)) approval for use of the policy, procedure, clause, or form (see 201.304(1)) must include an analysis of the public comments in the request for approval. ...

  3. 40 CFR 60.201 - Definitions.

    Science.gov (United States)

    2010-07-01

    ...-Process Phosphoric Acid Plants § 60.201 Definitions. As used in this subpart, all terms not defined herein shall have the meaning given them in the Act and in subpart A of this part. (a) Wet-process phosphoric acid plant means any facility manufacturing phosphoric acid by reacting phosphate rock and acid. (b...

  4. 14 CFR 415.201 - General.

    Science.gov (United States)

    2010-01-01

    ... TRANSPORTATION LICENSING LAUNCH LICENSE Environmental Review § 415.201 General. An applicant shall provide the FAA with information for the FAA to analyze the environmental impacts associated with a proposed... Environmental Quality Regulations for Implementing the Procedural Provisions of NEPA, 40 CFR parts 1500-1508...

  5. 7 CFR 97.201 - Protest proceedings.

    Science.gov (United States)

    2010-01-01

    ... PLANT VARIETY AND PROTECTION Protest Proceedings § 97.201 Protest proceedings. (a) Opposition shall be... affidavits and shall show the reason or reasons for opposing the application or certificate. The petition and accompanying papers shall be filed in duplicate. If it appears to an examiner that a variety involved in a...

  6. 24 CFR 100.201 - Definitions.

    Science.gov (United States)

    2010-04-01

    ... definition: (a) Physical or mental impairment includes: (1) Any physiological disorder or condition, cosmetic... 24 Housing and Urban Development 1 2010-04-01 2010-04-01 false Definitions. 100.201 Section 100... DISCRIMINATORY CONDUCT UNDER THE FAIR HOUSING ACT Prohibition Against Discrimination Because of Handicap § 100...

  7. 48 CFR 23.201 - Authorities.

    Science.gov (United States)

    2010-10-01

    ... PROGRAMS ENVIRONMENT, ENERGY AND WATER EFFICIENCY, RENEWABLE ENERGY TECHNOLOGIES, OCCUPATIONAL SAFETY, AND DRUG-FREE WORKPLACE Energy and Water Efficiency and Renewable Energy 23.201 Authorities. (a) Energy... U.S.C. 6901, et seq.). (b) National Energy Conservation Policy Act (42 U.S.C. 8253, 8259b, 8262g...

  8. 24 CFR 880.201 - Definitions.

    Science.gov (United States)

    2010-04-01

    ...) OFFICE OF THE ASSISTANT SECRETARY FOR HOUSING-FEDERAL HOUSING COMMISSIONER, DEPARTMENT OF HOUSING AND... SUPPORTIVE HOUSING FOR THE ELDERLY PROGRAM AND SECTION 811 SUPPORTIVE HOUSING FOR PERSONS WITH DISABILITIES... Requirements § 880.201 Definitions. Annual Contributions Contract (ACC). As defined in part 5 of this title...

  9. 5 CFR 630.201 - Definitions.

    Science.gov (United States)

    2010-01-01

    ..., examination, or treatment, or to the period of disability while the patient was receiving professional... Administrative Personnel OFFICE OF PERSONNEL MANAGEMENT CIVIL SERVICE REGULATIONS ABSENCE AND LEAVE Definitions and General Provisions for Annual and Sick Leave § 630.201 Definitions. (a) In section 6301(2)(iii) of...

  10. 48 CFR 201.404 - Class deviations.

    Science.gov (United States)

    2010-10-01

    ..., and the Defense Logistics Agency, may approve any class deviation, other than those described in 201...) Diminish any preference given small business concerns by the FAR or DFARS; or (D) Extend to requirements imposed by statute or by regulations of other agencies such as the Small Business Administration and the...

  11. 30 CFR 75.201 - Definitions.

    Science.gov (United States)

    2010-07-01

    ... SAFETY STANDARDS-UNDERGROUND COAL MINES Roof Support § 75.201 Definitions. Automated temporary roof support (ATRS) system. A device to provide temporary roof support from a location where the equipment operator is protected from roof falls. Pillar recovery. Any reduction in pillar size during retreat mining. ...

  12. Environmental contamination and risk assessment of mercury from a historic mercury mine located in southwestern China.

    Science.gov (United States)

    Li, Yonghua

    2013-02-01

    A field survey of mercury pollution in environmental media and human hair samples obtained from residents living in the area surrounding the Chatian mercury mine (CMM) of southwestern China was conducted to evaluate the health risks of mercury to local residents. The results showed that mine waste, and tailings in particular, contained high levels of mercury and that the maximum mercury concentration was 88.50 μg g(-1). Elevated mercury levels were also found in local surface water, paddy soil, and paddy grain, which may cause severe health problems. The mercury concentration of hair samples from the inhabitants of the CMM exceeded 1.0 μg g(-1), which is the limit recommended by the US EPA. Mercury concentrations in paddy soil were positively correlated with mercury concentrations in paddy roots, stalks, and paddy grains, which suggested that paddy soil was the major source of mercury in paddy plant tissue. The average daily dose (ADD) of mercury for local adults and preschool children via oral exposure reached 0.241 and 0.624 μg kg(-1) body weight per day, respectively, which is approaching or exceeds the provisional tolerable daily intake. Among the three oral exposure routes, the greatest contributor to the ADD of mercury was the ingestion of rice grain. Open-stacked mine tailings have resulted in heavy mercury contamination in the surrounding soil, and the depth of appreciable soil mercury concentrations exceeded 100 cm.

  13. Mercury accumulation plant Cyrtomium macrophyllum and its potential for phytoremediation of mercury polluted sites.

    Science.gov (United States)

    Xun, Yu; Feng, Liu; Li, Youdan; Dong, Haochen

    2017-12-01

    Cyrtomium macrophyllum naturally grown in 225.73 mg kg -1 of soil mercury in mining area was found to be a potential mercury accumulator plant with the translocation factor of 2.62 and the high mercury concentration of 36.44 mg kg -1 accumulated in its aerial parts. Pot experiments indicated that Cyrtomium macrophyllum could even grow in 500 mg kg -1 of soil mercury with observed inhibition on growth but no obvious toxic effects, and showed excellent mercury accumulation and translocation abilities with both translocation and bioconcentration factors greater than 1 when exposed to 200 mg kg -1 and lower soil mercury, indicating that it could be considered as a great mercury accumulating species. Furthermore, the leaf tissue of Cyrtomium macrophyllum showed high resistance to mercury stress because of both the increased superoxide dismutase activity and the accumulation of glutathione and proline induced by mercury stress, which favorited mercury translocation from the roots to the aerial parts, revealing the possible reason for Cyrtomium macrophyllum to tolerate high concentration of soil mercury. In sum, due to its excellent mercury accumulation and translocation abilities as well as its high resistance to mercury stress, the use of Cyrtomium macrophyllum should be a promising approach to remediating mercury polluted soils. Copyright © 2017 Elsevier Ltd. All rights reserved.

  14. Mercury emission monitoring on municipal waste combustion

    International Nuclear Information System (INIS)

    Braun, H.; Gerig, A.

    1991-01-01

    In waste incineration, mercury is the only heavy metal to be released as a gas, mostly as mercury(II) chloride, because of its high volatility. Continuous emission monitoring is possible only when mercury occurs in its elemental form. This paper reports on various possibilities of converting Hg(II) into Hg(0) that has been studied and tested on a laboratory scale and in the TAMARA refuse incineration pilot facility. Continuous mercury emission measurement appears to be possible, provided mercury is converted in the flue gas condensate precipitated. The measuring results obtained on two municipal solid waste and on one sewage treatment sludge incineration plants show that the mercury monitor is a highly sensitive and selective continuously working instrument for mercury emission monitoring

  15. Fate of mercury in the Arctic (FOMA)

    DEFF Research Database (Denmark)

    Skov, H.; Christensen, J.; Asmund, G.

    This report is the final reporting of the project FONA, funded by the Danish Environmental Protection Agency with means from the MIKA/DANCEA funds for Environmental Support to the Arctic Region. The aim of the project is to study the intercompartment mercury transport chain in the arctic area. From...... atmospheric deposition of mercury on sea surfaces to uptake in marine organisms, bio-accumulation, and finally mercury levels in mammals. The studies in the project are focused on the behaviour of mercury during the spring period where special phenomena lead to an enhanced deposition of mercury in the Arctic...... environment, at a time where the marine ecosystem is particularly active. The studies also include a comprehensive time trend study of mercury in top carnivore species. Each of these studies contributes towards establishing the knowledge necessary to develop a general model for transport and uptake of mercury...

  16. Mercury in the environment : a review

    International Nuclear Information System (INIS)

    Goodarzi, F.

    2000-01-01

    Both geogenic and anthropogenic sources are responsible for the input of mercury into the environment. However, mercury comes mostly from geogenic sources and is found naturally in air, water and soil. Crustal degassing results in emission of mercury into the atmosphere. Mercury in water and soil is due mostly to input from sedimentary rocks. Mercury in lake sediments is related mainly to input by country rock and anthropogenic activities such as agriculture. The mercury content of coal is similar to or less than the amount found in the earths crust. Natural charcoal is also able to capture mercury at low temperature combustion. The amount of mercury emitted from the stack of coal-fired power plants is related to the nature of the milled coal and its mineralogical and elemental content. Mercury emissions originating from the combustion of coal from electric utility power plants are considered to be among the greatest contributors to global mercury air emissions. In order to quantify the impact the electric power industry has on the environment, information regarding mercury concentrations in coal and their speciation is needed. For this reason the author examined the behaviour of mercury in three coal samples ashed at increasing temperatures. Mercury removal from coal-fired power plants ranges from 10 to 50 per cent by fabric filters and 20 to 95 per cent by FGD systems. This data will help in regulating emissions of hazardous air pollutants from electric utility steam generating units and will potentially provide insight into the industry's contribution to the global mercury burden. 50 refs

  17. Mercury biogeochemistry: Paradigm shifts, outstanding issues and research needs

    Science.gov (United States)

    Sonke, Jeroen E.; Heimbürger, Lars-Eric; Dommergue, Aurélien

    2013-05-01

    Half a century of mercury research has provided scientists and policy makers with a detailed understanding of mercury toxicology, biogeochemical cycling and past and future impacts on human exposure. The complexity of the global biogeochemical mercury cycle has led to repeated and ongoing paradigm shifts in numerous mercury-related disciplines and outstanding questions remain. In this review, we highlight some of the paradigm shifts and questions on mercury toxicity, the risks and benefits of seafood consumption, the source of mercury in seafood, and the Arctic mercury cycle. We see a continued need for research on mercury toxicology and epidemiology, for marine mercury dynamics and ecology, and for a closer collaboration between observational mercury science and mercury modeling in general. As anthropogenic mercury emissions are closely tied to the energy cycle (in particular coal combustion), mercury exposure to humans and wildlife are likely to persist unless drastic emission reductions are put in place.

  18. Mercury erosion experiments for spallation target system

    International Nuclear Information System (INIS)

    Kinoshita, Hidetaka; Kaminaga, Masanori; Haga, Katsuhiro; Hino, Ryutaro

    2003-01-01

    The Japan Atomic Energy Research Institute (JAERI) and the High Energy Accelerator Research Organization (KEK) are promoting a plan to construct the spallation neutron source at the Tokai Research Establishment, JAERI, under the High-Intensity Proton Accelerator Project (J-PARC). A mercury circulation system has been designed so as to supply mercury to the target stably under the rated flow rate of 41 m 3 /hr. Then, it was necessary to confirm a mercury pump performance from the viewpoint of making the mercury circulation system feasible, and more, to investigate erosion rate under the mercury flow as well as an amount of mercury remained on the surface after drain from the viewpoints of mechanical strength relating to the lifetime and remote handling of mercury components. The mercury pump performance was tested under the mercury flow conditions by using an experimental gear pump, which had almost the same structure as a practical mercury pump to be expected in the mercury circulation system, and the erosion rates in a mercury pipeline as well as the amount of mercury remained on the surface were also investigated. The discharged flow rates of the experimental gear pump increased linearly with the rotation speed, so that the gear pump would work as the flow meter. Erosion rates obtained under the mercury velocity less than 1.6 m/s was found to be so small that decrease of pipeline wall thickness would be 390 μm after 30-year operation under the rated mercury velocity of 0.7 m/s. For the amount of remaining mercury on the pipeline, remaining rates of weight and volume were estimated at 50.7 g/m 2 and 3.74 Hg-cm 3 /m 2 , respectively. Applying these remaining rates of weight and volume to the mercury target, the remaining mercury was estimated at about 106.5 g and 7.9 cm 3 . Radioactivity of this remaining mercury volume was found to be three-order lower than that of the target casing. (author)

  19. 201Tl-thallium chloride injections for cardiological applications

    International Nuclear Information System (INIS)

    Kopecky, P.; Zdrazil, K.; Svihla, P.

    1985-01-01

    The production is being prepared by the Nuclear Research Institute at Rez of the cardiovascular diagnostic agent, 201 Tl-thallium chloride. The 201 Tl radionuclide will be produced by irradiating a thallium target in the U-120 M cyclotron at Rez. For this purpose, the 201 Tl production rate was measured in the proton energy range of 27 to 31 MeV, and the production conditions were optimized with respect to parasitic production of radionuclide contaminants 200 Tl and 202 Tl. A method was developed of chemically separating 201 Tl from the irradiated target. This will allow the production of 201 Tl-thallium chloride injections in the required quality. (author)

  20. Touchstones and mercury at Hedeby

    Czech Academy of Sciences Publication Activity Database

    Ježek, Martin; Holub, M.

    2014-01-01

    Roč. 89, č. 1 (2014), s. 193-204 ISSN 0079-4848 Institutional support: RVO:67985912 Keywords : Hedeby * Viking Age * grave goods * touchstone * precious metal * mercury * chemical microanalysis * archaeometallurgy Subject RIV: AC - Archeology, Anthropology, Ethnology Impact factor: 0.278, year: 2014

  1. PERCEPTION OF MERCURY RISK INFORMATION

    Science.gov (United States)

    Approximately 8% of American women have blood Mercury levels exceeding the EPA reference dose (a dose below which symptoms would be unlikely). The children of these women are at risk of neurological deficits (lower IQ scores) primarily because of the mother's consumption of conta...

  2. A downstream voyage with mercury

    Science.gov (United States)

    Heinz, Gary

    2016-01-01

    Retrospective essay for the Bulletin of Environmental Contamination and Toxicology.As I look back on my paper, “Effects of Low Dietary Levels of Methyl Mercury on Mallard Reproduction,” published in 1974 in the Bulletin of Environmental Contamination and Toxicology, a thought sticks in my mind. I realize just how much my mercury research was not unlike a leaf in a stream, carried this way and that, sometimes stalled in an eddy, restarted, and carried downstream at a pace and path that was not completely under my control. I was hired in 1969 by the Patuxent Wildlife Research Center to study the effects of environmental pollutants on the behavior of wildlife. A colleague was conducting a study on the reproductive effects of methylmercury on mallards (Anas platyrhynchos), and he offered to give me some of the ducklings. I conducted a pilot study, testing how readily ducklings approached a tape-recorded maternal call. Sample sizes were small, but the results suggested that ducklings from mercury-treated parents behaved differently than controls. That’s how I got into mercury research—pretty much by chance.

  3. Venus and Mercury as Planets

    Science.gov (United States)

    1974-01-01

    A general evolutionary history of the solar planetary system is given. The previously observed characteristics of Venus and Mercury (i.e. length of day, solar orbit, temperature) are discussed. The role of the Mariner 10 space probe in gathering scientific information on the two planets is briefly described.

  4. Venus and Mercury as planets

    International Nuclear Information System (INIS)

    1974-01-01

    A general evolutionary history of the solar planetary system is given. The previously observed characteristics of Venus and Mercury (i.e. length of day, solar orbit, temperature) are discussed. The role of the Mariner 10 space probe in gathering scientific information on the two planets is briefly described

  5. 76 FR 75446 - Amendment of Class E Airspace; Mercury, NV

    Science.gov (United States)

    2011-12-02

    ...-0894; Airspace Docket No. 11-AWP-14] Amendment of Class E Airspace; Mercury, NV AGENCY: Federal... Mercury, Desert Rock Airport, Mercury, NV. Decommissioning of the Mercury Non-Directional Beacon (NDB) at Mercury, Desert Rock Airport has made this action necessary for the safety and management of Instrument...

  6. The Plasma Environment at Mercury

    Science.gov (United States)

    Raines, James M.; Gershman, Daniel J.; Zurbuchen, Thomas H.; Gloeckler, George; Slavin, James A.; Anderson, Brian J.; Korth, Haje; Krimigis, Stamatios M.; Killen, Rosemary M.; Sarantos, Menalos; hide

    2011-01-01

    Mercury is the least explored terrestrial planet, and the one subjected to the highest flux of solar radiation in the heliosphere. Its highly dynamic, miniature magnetosphere contains ions from the exosphere and solar wind, and at times may allow solar wind ions to directly impact the planet's surface. Together these features create a plasma environment that shares many features with, but is nonetheless very different from, that of Earth. The first in situ measurements of plasma ions in the Mercury space environment were made only recently, by the Fast Imaging Plasma Spectrometer (FIPS) during the MESSENGER spacecraft's three flybys of the planet in 2008-2009 as the probe was en route to insertion into orbit about Mercury earlier this year. Here. we present analysis of flyby and early orbital mission data with novel techniques that address the particular challenges inherent in these measurements. First. spacecraft structures and sensor orientation limit the FIPS field of view and allow only partial sampling of velocity distribution functions. We use a software model of FIPS sampling in velocity space to explore these effects and recover bulk parameters under certain assumptions. Second, the low densities found in the Mercury magnetosphere result in a relatively low signal-to-noise ratio for many ions. To address this issue, we apply a kernel density spread function to guide removal of background counts according to a background-signature probability map. We then assign individual counts to particular ion species with a time-of-flight forward model, taking into account energy losses in the carbon foil and other physical behavior of ions within the instrument. Using these methods, we have derived bulk plasma properties and heavy ion composition and evaluated them in the context of the Mercury magnetosphere.

  7. Chemical form matters: differential accumulation of mercury following inorganic and organic mercury exposures in zebrafish larvae.

    Science.gov (United States)

    Korbas, Malgorzata; Macdonald, Tracy C; Pickering, Ingrid J; George, Graham N; Krone, Patrick H

    2012-02-17

    Mercury, one of the most toxic elements, exists in various chemical forms each with different toxicities and health implications. Some methylated mercury forms, one of which exists in fish and other seafood products, pose a potential threat, especially during embryonic and early postnatal development. Despite global concerns, little is known about the mechanisms underlying transport and toxicity of different mercury species. To investigate the impact of different mercury chemical forms on vertebrate development, we have successfully combined the zebrafish, a well-established developmental biology model system, with synchrotron-based X-ray fluorescence imaging. Our work revealed substantial differences in tissue-specific accumulation patterns of mercury in zebrafish larvae exposed to four different mercury formulations in water. Methylmercury species not only resulted in overall higher mercury burdens but also targeted different cells and tissues than their inorganic counterparts, thus revealing a significant role of speciation in cellular and molecular targeting and mercury sequestration. For methylmercury species, the highest mercury concentrations were in the eye lens epithelial cells, independent of the formulation ligand (chloride versusl-cysteine). For inorganic mercury species, in absence of l-cysteine, the olfactory epithelium and kidney accumulated the greatest amounts of mercury. However, with l-cysteine present in the treatment solution, mercuric bis-l-cysteineate species dominated the treatment, significantly decreasing uptake. Our results clearly demonstrate that the common differentiation between organic and inorganic mercury is not sufficient to determine the toxicity of various mercury species.

  8. Chemical Form Matters: Differential Accumulation of Mercury Following Inorganic and Organic Mercury Exposures in Zebrafish Larvae

    Energy Technology Data Exchange (ETDEWEB)

    Korbas, Malgorzata; MacDonald, Tracy C.; Pickering, Ingrid J.; George, Graham N.; Krone, Patrick H. (Saskatchewan)

    2013-04-08

    Mercury, one of the most toxic elements, exists in various chemical forms each with different toxicities and health implications. Some methylated mercury forms, one of which exists in fish and other seafood products, pose a potential threat, especially during embryonic and early postnatal development. Despite global concerns, little is known about the mechanisms underlying transport and toxicity of different mercury species. To investigate the impact of different mercury chemical forms on vertebrate development, we have successfully combined the zebrafish, a well-established developmental biology model system, with synchrotron-based X-ray fluorescence imaging. Our work revealed substantial differences in tissue-specific accumulation patterns of mercury in zebrafish larvae exposed to four different mercury formulations in water. Methylmercury species not only resulted in overall higher mercury burdens but also targeted different cells and tissues than their inorganic counterparts, thus revealing a significant role of speciation in cellular and molecular targeting and mercury sequestration. For methylmercury species, the highest mercury concentrations were in the eye lens epithelial cells, independent of the formulation ligand (chloride versus L-cysteine). For inorganic mercury species, in absence of L-cysteine, the olfactory epithelium and kidney accumulated the greatest amounts of mercury. However, with L-cysteine present in the treatment solution, mercuric bis-L-cysteineate species dominated the treatment, significantly decreasing uptake. Our results clearly demonstrate that the common differentiation between organic and inorganic mercury is not sufficient to determine the toxicity of various mercury species.

  9. Mercury emission from crematories in Japan

    Directory of Open Access Journals (Sweden)

    M. Takaoka

    2010-04-01

    Full Text Available Anthropogenic sources of mercury emissions have a significant impact on global pollution. Therefore, finding uncharacterised sources and assessing the emissions from these sources are important. However, limited data are available worldwide on mercury emissions from crematories. In Japan, 99.9% of dead bodies are cremated, which is the highest percentage in the world, and more than 1600 crematories are in operation. We thus focused on emissions from crematories in Japan. The number of targeted facilities was seven, and we used continuous emission monitoring to measure the mercury concentrations and investigate mercury behaviour. The total mercury concentrations in stack gases were a few μg/Nm3 (normal cubic meters. Considering the time profile of mercury and its species in cremations, the findings confirmed that the mercury in stack gas originated from dental amalgam. The amount of mercury emissions was calculated using the total concentration and gas flow rate. Furthermore, the annual amount of mercury emission from crematories in Japan was estimated by using the total number of corpses. The emission amount was considerably lower than that estimated in the United Kingdom. From statistical analyses on population demographics and measurements, future total emissions from crematories were also predicted. As a result, the amount of mercury emitted by crematories will likely increase by 2.6-fold from 2007 to 2037.

  10. Environmental Mercury and Its Toxic Effects

    Directory of Open Access Journals (Sweden)

    Kevin M. Rice

    2014-03-01

    Full Text Available Mercury exists naturally and as a man-made contaminant. The release of processed mercury can lead to a progressive increase in the amount of atmospheric mercury, which enters the atmospheric-soil-water distribution cycles where it can remain in circulation for years. Mercury poisoning is the result of exposure to mercury or mercury compounds resulting in various toxic effects depend on its chemical form and route of exposure. The major route of human exposure to methylmercury (MeHg is largely through eating contaminated fish, seafood, and wildlife which have been exposed to mercury through ingestion of contaminated lower organisms. MeHg toxicity is associated with nervous system damage in adults and impaired neurological development in infants and children. Ingested mercury may undergo bioaccumulation leading to progressive increases in body burdens. This review addresses the systemic pathophysiology of individual organ systems associated with mercury poisoning. Mercury has profound cellular, cardiovascular, hematological, pulmonary, renal, immunological, neurological, endocrine, reproductive, and embryonic toxicological effects.

  11. Mercury emissions from municipal solid waste combustors

    Energy Technology Data Exchange (ETDEWEB)

    1993-05-01

    This report examines emissions of mercury (Hg) from municipal solid waste (MSW) combustion in the United States (US). It is projected that total annual nationwide MSW combustor emissions of mercury could decrease from about 97 tonnes (1989 baseline uncontrolled emissions) to less than about 4 tonnes in the year 2000. This represents approximately a 95 percent reduction in the amount of mercury emitted from combusted MSW compared to the 1989 mercury emissions baseline. The likelihood that routinely achievable mercury emissions removal efficiencies of about 80 percent or more can be assured; it is estimated that MSW combustors in the US could prove to be a comparatively minor source of mercury emissions after about 1995. This forecast assumes that diligent measures to control mercury emissions, such as via use of supplemental control technologies (e.g., carbon adsorption), are generally employed at that time. However, no present consensus was found that such emissions control measures can be implemented industry-wide in the US within this time frame. Although the availability of technology is apparently not a limiting factor, practical implementation of necessary control technology may be limited by administrative constraints and other considerations (e.g., planning, budgeting, regulatory compliance requirements, etc.). These projections assume that: (a) about 80 percent mercury emissions reduction control efficiency is achieved with air pollution control equipment likely to be employed by that time; (b) most cylinder-shaped mercury-zinc (CSMZ) batteries used in hospital applications can be prevented from being disposed into the MSW stream or are replaced with alternative batteries that do not contain mercury; and (c) either the amount of mercury used in fluorescent lamps is decreased to an industry-wide average of about 27 milligrams of mercury per lamp or extensive diversion from the MSW stream of fluorescent lamps that contain mercury is accomplished.

  12. Mercury exposure from interior latex paint.

    Science.gov (United States)

    Agocs, M M; Etzel, R A; Parrish, R G; Paschal, D C; Campagna, P R; Cohen, D S; Kilbourne, E M; Hesse, J L

    1990-10-18

    Many paint companies have used phenylmercuric acetate as a preservative to prolong the shelf life of interior latex paint. In August 1989, acrodynia, a form of mercury poisoning, occurred in a child exposed to paint fumes in a home recently painted with a brand containing 4.7 mmol of mercury per liter (at that time the Environmental Protection Agency's recommended limit was 1.5 mmol or less per liter). To determine whether the recent use of that brand of paint containing phenylmercuric acetate was associated with elevated indoor-air and urinary mercury concentrations, we studied 74 "exposed" persons living in 19 homes recently painted with the brand and 28 "unexposed" persons living in 10 homes not recently painted with paint containing mercury. The paint samples from the homes of exposed persons contained a median of 3.8 mmol of mercury per liter, and air samples from the homes had a median mercury content of 10.0 nmol per cubic meter (range, less than 0.5 to 49.9). No mercury was detected in paint or air samples from the homes of unexposed persons. The median urinary mercury concentration was higher in the exposed persons (4.7 nmol of mercury per millimole of creatinine; range, 1.4 to 66.5) than in the unexposed persons (1.1 nmol per millimole; range, 0.02 to 3.9; P less than 0.001). Urinary mercury concentrations within the range that we found in exposed persons have been associated with symptomatic mercury poisoning. We found that potentially hazardous exposure to mercury had occurred among persons whose homes were painted with a brand of paint containing mercury at concentrations approximately 2 1/2 times the Environmental Protection Agency's recommended limit.

  13. RECOVERY OF MERCURY FROM CONTAMINATED LIQUID WASTES

    Energy Technology Data Exchange (ETDEWEB)

    Robin M. Stewart

    1999-09-29

    Mercury was widely used in U.S. Department of Energy (DOE) weapons facilities, resulting in a broad range of mercury-contaminated wastes and wastewaters. Some of the mercury contamination has escaped to the local environment, particularly at the Y-12 Plant in Oak Ridge, Tennessee, where approximately 330 metric tons of mercury were discharged to the environment between 1953 and 1963 (TN & Associates, 1998). Effective removal of mercury contamination from water is a complex and difficult problem. In particular, mercury treatment of natural waters is difficult because of the low regulatory standards. For example, the Environmental Protection Agency has established a national ambient water quality standard of 12 parts-per-trillion (ppt), whereas the standard is 1.8 ppt in the Great Lakes Region. In addition, mercury in the environment is typically present in several different forms, but sorption processes are rarely effective with more than one or two of these forms. To meet the low regulatory discharge limits, an effective sorption process must be able to address all forms of mercury present in the water. One approach is to apply different sorbents in series depending on the mercury speciation and the regulatory discharge limits. ADA Technologies, Inc. has developed four new sorbents to address the variety of mercury species present in industrial discharges and natural waters. Three of these sorbents have been field tested on contaminated creek water at the Y-12 Plant. Two of these sorbents have been successfully demonstrated very high removal efficiencies for soluble mercury species, reducing mercury concentrations at the outlet of a pilot-scale system to less than 12 ppt for as long as six months. The other sorbent tested at the Y-12 Plant targeted colloidal mercury not removed by standard sorption or filtration processes. At the Y-12 Plant, colloidal mercury appears to be associated with iron, so a sorbent that removes mercury-iron complexes in the presence of a

  14. An Epidemiological Study of Mercury Sensitization

    Directory of Open Access Journals (Sweden)

    Kazuhiro Sato

    1997-01-01

    Full Text Available Mercury sensitization has been historically in question and may be related to recent increases of type I allergic diseases. To clarify the epidemiological factors of mercury sensitization, we investigated factors relating to mercury sensitization in 215 medical students. Their allergic symptoms, family histories and lifestyles were studied by questionnaire. Patch tests were performed with HgCI2 (0.05% aq. and NiS04 (5% aq.. Anti- Dermatophagoides and anti-Crypfomeria pollen IgE antibodies in sera were also measured. Urinary mercury concentrations were measured in 25 mercury sensitized and 44 non-sensitized subjects (controls. Hair mercury concentrations were also measured in 19 sensitized and 22 non-sensitized subjects. While the positive rate of nickel was 6.0% (13/215, that of mercury was high (13.0%; 28/215. The subjects' individual histories of allergic rhinitis, eczema, urticaria and allergic conjunctivitis were significantly associated with family histories of these conditions (P<0.01, P<0.005 and P<0.005, respectively, as reported in the literature. However, no allergen- specific antibody positivity or past history of allergic disease was associated with mercury sensitization. Mercury sensitized subjects had experienced eczema caused by cosmetics, shampoos, soaps and haircreams significantly more frequently (P<0.05. The history of mercurochrome usage was not associated with mercury sensitization. The number of teeth treated with metals in mercury sensitized subjects was significantly higher than that in the control group (6.8±4.3 vs 4.8±1; P<0.05. There were significant differences in urinary mercury concentrations (specific gravity adjusted levels between mercury sensitized subjects and non-sensitized subjects (2.0±0.9 and 1.3±0.6 (xg/L, respectively; P<0.001. There were also significant differences in hair mercury concentrations between mercury sensitized and non-sensitized subjects (2.0±0.9 and 1.2±0.5 μg/g, respectively; P<0

  15. Mercury Phase II Study - Mercury Behavior across the High-Level Waste Evaporator System

    Energy Technology Data Exchange (ETDEWEB)

    Bannochie, C. J. [Savannah River Site (SRS), Aiken, SC (United States). Savannah River National Lab. (SRNL); Crawford, C. L. [Savannah River Site (SRS), Aiken, SC (United States). Savannah River National Lab. (SRNL); Jackson, D. G. [Savannah River Site (SRS), Aiken, SC (United States). Savannah River National Lab. (SRNL); Shah, H. B. [Savannah River Remediation, LLC., Aiken, SC (United States); Jain, V. [Savannah River Remediation, LLC., Aiken, SC (United States); Occhipinti, J. E. [Savannah River Remediation, LLC., Aiken, SC (United States); Wilmarth, W. R. [Savannah River Site (SRS), Aiken, SC (United States). Savannah River National Lab. (SRNL)

    2016-06-17

    The Mercury Program team’s effort continues to develop more fundamental information concerning mercury behavior across the liquid waste facilities and unit operations. Previously, the team examined the mercury chemistry across salt processing, including the Actinide Removal Process/Modular Caustic Side Solvent Extraction Unit (ARP/MCU), and the Defense Waste Processing Facility (DWPF) flowsheets. This report documents the data and understanding of mercury across the high level waste 2H and 3H evaporator systems.

  16. Assessing Mercury and Methylmercury Bioavailability in Sediment Pore Water Using Mercury-Specific Hydrogels

    Science.gov (United States)

    2015-06-01

    FINAL REPORT Assessing Mercury and Methylmercury Bioavailability in Sediment Pore Water Using Mercury -Specific Hydrogels SERDP Project ER-1771...From - To) 2010-2015 4. TITLE AND SUBTITLE Assessing Mercury and Methylmercury Bioavailability in 5a. CONTRACT NUMBER W912HQ-10-C-0069 Sediment...Using Mercury -Specific DGTs 5b. GRANT NUMBER ER-1771 5c. PROGRAM ELEMENT NUMBER NA 6. AUTHOR(S) Magar, Victor S.*, Steenhaut, Nicholas

  17. Mercury concentrations at a historically mercury-contaminated site in KwaZulu-Natal, South Africa

    CSIR Research Space (South Africa)

    Williams, CR

    2011-02-01

    Full Text Available . Biogeochem., 43:237?257 Barrat GJ, Combrink J (2002) An Assessment of the degree of mercury (Hg) bio-transformation in two river systems following discharges from a mercury recovery plant. Water SA Special Edition: WISA Proceedings 2002 Benoit JM... in mercury and methylmercury biogeochemical cycling and bioaccumulation within shallow estuaries. PhD thesis, University of Maryland, College Park Kim E-H, Mason RP, Porter ET, Soulen HL (2006) The impact of resuspension on sediment mercury dynamics...

  18. Amended Silicated for Mercury Control

    Energy Technology Data Exchange (ETDEWEB)

    James Butz; Thomas Broderick; Craig Turchi

    2006-12-31

    Amended Silicates{trademark}, a powdered, noncarbon mercury-control sorbent, was tested at Duke Energy's Miami Fort Station, Unit 6 during the first quarter of 2006. Unit 6 is a 175-MW boiler with a cold-side electrostatic precipitator (ESP). The plant burns run-of-the-river eastern bituminous coal with typical ash contents ranging from 8-15% and sulfur contents from 1.6-2.6% on an as-received basis. The performance of the Amended Silicates sorbent was compared with that for powdered activated carbon (PAC). The trial began with a period of baseline monitoring during which no sorbent was injected. Sampling during this and subsequent periods indicated mercury capture by the native fly ash was less than 10%. After the baseline period, Amended Silicates sorbent was injected at several different ratios, followed by a 30-day trial at a fixed injection ratio of 5-6 lb/MMACF. After this period, PAC was injected to provide a comparison. Approximately 40% mercury control was achieved for both the Amended Silicates sorbent and PAC at injection ratios of 5-6 lbs/MMACF. Higher injection ratios did not achieve significantly increased removal. Similar removal efficiencies have been reported for PAC injection trials at other plants with cold-side ESPs, most notably for plants using medium to high sulfur coal. Sorbent injection did not detrimentally impact plant operations and testing confirmed that the use of Amended Silicates sorbent does not degrade fly ash quality (unlike PAC). The cost for mercury control using either PAC or Amended Silicates sorbent was estimated to be equivalent if fly ash sales are not a consideration. However, if the plant did sell fly ash, the effective cost for mercury control could more than double if those sales were no longer possible, due to lost by-product sales and additional cost for waste disposal. Accordingly, the use of Amended Silicates sorbent could reduce the overall cost of mercury control by 50% or more versus PAC for locations where

  19. 7 CFR 201.10 - Variety.

    Science.gov (United States)

    2010-01-01

    ... labeled as to variety and shall be labeled to show the variety name or the words “Variety Not Stated... with or without the words “kind and variety.” The percentage in such case, which may be shown as “pure... § 201.11a. If separate percentages for the kind and the variety or hybrid are shown, the name of the...

  20. Thallium-201 myocardial imaging in children.

    Science.gov (United States)

    Sty, J R; Starshak, R J

    1985-01-01

    The clinical applications of thallium-201 scintigraphy are less well defined in children than in adults. However, the published data indicate several potential applications including assessment of: 1) deficit in left ventricular myocardial perfusion, 2) early right ventricular volume or pressure overload, or both, and 3) the right ventricle in both cyanotic and acyanotic congenital heart disease. In this report, the applications of thallium imaging to pediatric diseases are described and the advantages and disadvantages of the procedure are enumerated.

  1. Percolation of cadmium across a mercury film

    International Nuclear Information System (INIS)

    Malek, K.; Gobal, F.

    2003-01-01

    Electrodeposition/dissolution of cadmium onto a film of mercury shows some deviations from the natural liquidity of mercury caused by the reduction of Cd onto it. Percolation and fractal analyzes were done on the surface and the bulk of the mercury film during diffusion of Cd species (atoms). These show that the fractal dimensions of the Cd-inserted mercury film are about 2.11 and 2.54 near the surface of the mercury film and at deeper points inside the film, respectively. The insertion process has a negligible effect on the surface morphology of the mercury film and there is a phase transition in the bulk, as well as a geometrical transition during the Cd-insertion (de-insertion) process. This corresponds to a percolation threshold of about 0.2 mol l -1 Cd content

  2. Mercury in dated Greenland marine sediments

    DEFF Research Database (Denmark)

    Asmund, G.; Nielsen, S.P.

    2000-01-01

    Twenty marine sediment cores from Greenland were analysed for mercury, and dated by the lead-210 method. In general the cores exhibit a mercury profile with higher mercury concentrations in the upper centimetres of the core. The cores were studied by linear regression of In Hg vs, age...... of the sediment for the youngest 100 years. As a rule the mercury decreased with depth in the sediment with various degrees of significance. The increase of the mercury flux during the last 100 years is roughly a doubling. The increase may be of anthropogenic origin as it is restricted to the last 100 years....... In four cores the concentration of manganese was found also to increase in the top layers indicating diagenesis. In the other cases the higher concentrations were not accompanied by higher manganese concentrations. The mercury flux to the sediment surface was generally proportional to the Pb-210 flux...

  3. Human accumulation of mercury in Greenland

    DEFF Research Database (Denmark)

    Johansen, P.; Mulvad, G.; Pedersen, H. S.

    2007-01-01

    In the Arctic, the traditional diet exposes its people to a high intake of mercury especially from marine mammals. To determine whether the mercury is accumulated in humans, we analyzed autopsy samples of liver, kidney and spleen from adult ethnic Greenlanders who died between 1990 and 1994 from...... a wide range of causes, natural and violent. Liver, kidney and spleen samples from between 33 and 71 case subjects were analyzed for total mercury and methylmercury, and liver samples also for selenium. Metal levels in men and women did not differ and were not related to age except in one case, i.......e. for total mercury in liver, where a significant declining concentration with age was observed. The highest total mercury levels were found in kidney followed by liver and spleen. Methylmercury followed the same pattern, but levels were much lower, constituting only 19% of the total mercury concentration...

  4. Acclimation of subsurface microbial communities to mercury

    DEFF Research Database (Denmark)

    de Lipthay, Julia R; Rasmussen, Lasse D; Øregaard, Gunnar

    2008-01-01

    We studied the acclimation to mercury of bacterial communities of different depths from contaminated and noncontaminated floodplain soils. The level of mercury tolerance of the bacterial communities from the contaminated site was higher than those of the reference site. Furthermore, the level...... of mercury tolerance and functional versatility of bacterial communities in contaminated soils initially were higher for surface soil, compared with the deeper soils. However, following new mercury exposure, no differences between bacterial communities were observed, which indicates a high adaptive potential...... of the subsurface communities, possibly due to differences in the availability of mercury. IncP-1 trfA genes were detected in extracted community DNA from all soil depths of the contaminated site, and this finding was correlated to the isolation of four different mercury-resistance plasmids, all belonging...

  5. Assessing the Behavior of Typically Lithophile Elements Under Highly Reducing Conditions Relevant to the Planet Mercury

    Science.gov (United States)

    Rowland, Rick, II; Vander Kaaden, Kathleen E.; McCubbin, Francis M.; Danielson, Lisa R.

    2017-01-01

    With the data returned from the MErcury Surface, Space ENvironment, GEochemistry, and Ranging (MESSENGER) mission, there are now numerous constraints on the physical and chemical properties of Mercury, including its surface composition (e.g., Evans et al. 2012; Nittler et al. 201 l; Peplowski et al. 2012; Weider et al. 2012). The high Sand low FeO contents observed from MESSENGER on the planet's surface suggests a low oxygen fugacity of the present planetary materials. Estimates of the oxygen fugacity for Mercurian magmas are approximately 3- 7 log units below the Iron-Wiistite (Fe-FeO) oxygen buffer (McCubbin et al. 2012; Zolotov et al. 2013), several orders of magnitude more reducing than other terrestrial bodies we have data from such as the Earth, Moon, or Mars (Herd 2008; Sharp, McCubbin, and Shearer 2013; Wadhwa 2008). Most of our understanding of elemental partitioning behavior comes from observations made on terrestrial rocks, but Mercury's oxygen fugacity is far outside the conditions of those samples. With limited oxygen available, lithophile elements may instead exhibit chalcophile, halophile, or siderophile behaviors. Furthermore, very few natural samples of rocks that formed under reducing conditions are available in our collections (e.g., enstatite chondrites, achondrites, aubrites). The goal of this study is to conduct experiments at high pressure and temperature conditions to determine the elemental partitioning behavior of typically lithophile elements as a function of decreasing oxygen fugacity.

  6. Reproducibility of 201Tl myocardial imaging

    International Nuclear Information System (INIS)

    McLaughlin, P.R.; Martin, R.P.; Doherty, P.; Daspit, S.; Goris, M.; Haskell, W.; Lewis, S.; Kriss, J.P.; Harrison, D.C.

    1977-01-01

    Seventy-six thallium-201 myocardial perfusion studies were performed on twenty-five patients to assess their reproducibility and the effect of varying the level of exercise on the results of imaging. Each patient had a thallium-201 study at rest. Fourteen patients had studies on two occasions at maximum exercise, and twelve patients had studies both at light and at maximum exercise. Of 70 segments in the 14 patients assessed on each of two maximum exercise tests, 64 (91 percent) were reproducible. Only 53 percent (16/30) of the ischemic defects present at maximum exercise were seen in the light exercise study in the 12 patients assessed at two levels of exercise. Correlation of perfusion defects with arteriographically proven significant coronary stenosis was good for the left anterior descending and right coronary arteries, but not as good for circumflex artery disease. Thallium-201 myocardial imaging at maximum exercise is reproducible within acceptable limits, but careful attention to exercise technique is essential for valid comparative studies

  7. Thiosulphate assisted phytoextraction of mercury contaminated soils at the Wanshan Mercury Mining District, Southwest China

    Directory of Open Access Journals (Sweden)

    J. Wang

    2013-10-01

    Full Text Available Wanshan, known as the “Mercury Capital” of China, is located in the Southwest of China. Due to the extensive mining and smelting works in the Wanshan area, the local ecosystem has been serious contaminated with mercury. In the present study, a number of soil samples were taken from the Wanshan mercury mining area and the mercury fractionations in soils were analyzed using sequential extraction procedure technique. The obtained results showed that the dominate mercury fractions (represent 95% of total mercury were residual and organic bound mercury. A field trial was conducted in a mercury polluted farmland at the Wanshan mercury mine. Four plant species Brassica juncea Czern. et Coss.var. ASKYC (ASKYC, Brassica juncea Czern. et Coss.var.DPDH (DPDH, Brassica juncea Czern. et Coss.var.CHBD(CHBD, Brassica juncea Czern. et Coss.var.LDZY (LDZY were tested their ability to extract mercury from soil with thiosulphate amendment. The results indicated that the mercury concentration in the roots and shoots of the four plants were significantly increased with thiosulphate treatment. The mercury phytoextraction yield of ASKYC, DPDH, CHBD and LDZY were 92, 526, 294 and 129 g/ha, respectively

  8. Blood Mercury Levels of Zebra Finches Are Heritable: Implications for the Evolution of Mercury Resistance.

    Directory of Open Access Journals (Sweden)

    Kenton A Buck

    Full Text Available Mercury is a ubiquitous metal contaminant that negatively impacts reproduction of wildlife and has many other sub-lethal effects. Songbirds are sensitive bioindicators of mercury toxicity and may suffer population declines as a result of mercury pollution. Current predictions of mercury accumulation and biomagnification often overlook possible genetic variation in mercury uptake and elimination within species and the potential for evolution in affected populations. We conducted a study of dietary mercury exposure in a model songbird species, maintaining a breeding population of zebra finches (Taeniopygia guttata on standardized diets ranging from 0.0-2.4 μg/g methylmercury. We applied a quantitative genetics approach to examine patterns of variation and heritability of mercury accumulation within dietary treatments using a method of mixed effects modeling known as the 'animal model'. Significant variation in blood mercury accumulation existed within each treatment for birds exposed at the same dietary level; moreover, this variation was highly repeatable for individuals. We observed substantial genetic variation in blood mercury accumulation for birds exposed at intermediate dietary concentrations. Taken together, this is evidence that genetic variation for factors affecting blood mercury accumulation could be acted on by selection. If similar heritability for mercury accumulation exists in wild populations, selection could result in genetic differentiation for populations in contaminated locations, with possible consequences for mercury biomagnification in food webs.

  9. Radioactive mercury distribution in biological fluids and excretion in human subjects after inhalation of mercury vapor

    International Nuclear Information System (INIS)

    Cherian, M.G.; Hursh, J.B.; Clarkson, T.W.; Allen, J.

    1978-01-01

    The distribution of mercury in red blood cells (RBCs) and plasma, and its excretion in urine and feces are described in five human subjects during the first 7 days following inhalation of radioactive mercury vapor. A major portion (98%) of radioactive mercury in whole blood is initially accumulated in the RBCs and is transferred partly to the plasma compartment until the ratio of mercury in RBCs to plasma is about 2 within 20 h. The cumulative urinary and fecal excretion of mercury for 7 days is about 11.6% of the retained dose, and is closely related to the percent decline in body burden of mercury. There is little correlation between either the urinary excretion and plasma radioactivity of mercury, or the specific activities of urine and plasma mercury, suggesting a mechanism other than a direct glomerular filtration involved in the urinary excretion of recently exposed mercury. These studies suggest that blood mercury levels can be used as an index of recent exposure, while urinary levels may be an index of renal concentration of mercury. However, there is no reliable index for mercury concentration in the brain

  10. Thiosulphate assisted phytoextraction of mercury contaminated soils at the Wanshan Mercury Mining District, Southwest China

    Directory of Open Access Journals (Sweden)

    J Wang

    2013-10-01

    Full Text Available Wanshan, known as the “Mercury Capital” of China, is located in the Southwest of China. Due to the extensive mining and smelting works in the Wanshan area, the local ecosystem has been serious contaminated with mercury. In the present study, a number of soil samples were taken from the Wanshan mercury mining area and the mercury fractionations in soils were analyzed using sequential extraction procedure technique. The obtained results showed that the dominate mercury fractions (represent 95% of total mercury were residual and organic bound mercury. A field trial was conducted in a mercury polluted farmland at the Wanshan mercury mine. Four plant species Brassica juncea Czern. et Coss.var. ASKYC (ASKYC, Brassica juncea Czern. et Coss.var.DPDH (DPDH, Brassica juncea Czern. et Coss.var.CHBD(CHBD, Brassica juncea Czern. et Coss.var.LDZY (LDZY were tested their ability to extract mercury from soil with thiosulphate amendment. The results indicated that the mercury concentration in the roots and shoots of the four plants were significantly increased with thiosulphate treatment. The mercury phytoextraction yield of ASKYC, DPDH, CHBD and LDZY were 92, 526, 294 and 129 g/ha, respectively.

  11. Fractionation of mercury stable isotopes during coal combustion and seawater flue gas desulfurization

    International Nuclear Information System (INIS)

    Huang, Shuyuan; Yuan, Dongxing; Lin, Haiying; Sun, Lumin; Lin, Shanshan

    2017-01-01

    In the current study, fractionation of mercury isotopes during coal combustion and seawater flue gas desulfurization (SFGD) in a coal-fired power plant using a SFGD system was investigated. Fourteen samples were collected from the power plant. The samples were pretreated with a combustion-trapping method and were analyzed with a multi-collector inductively coupled plasma mass spectrometer (MC-ICP-MS). Compared with the raw coal, the bottom ash was enriched with lighter mercury isotopes with δ 202 Hg values ranging from −0.45 to −0.03‰. The fly ash was enriched with lighter mercury isotopes with δ 202 Hg values ranging from −1.49 to −0.73‰ for Chinese coal and from −1.47 to −0.62‰ for Indonesian coal. The δ 202 Hg of fresh seawater and desulfurized seawater was found to be −1.32 and −0.32‰ respectively. These δ 202 Hg values indicated that the desulfurized seawater was enriched with heavier mercury isotopes. Based upon the calculated results obtained from the mass balance equation, it was suggested that the stack emissions were enriched with lighter mercury isotopes. Mass independent fractionation was observed in most of the samples with a Δ 199 Hg/Δ 201 Hg ratio of approximately 0.96. The results help in improving the understanding of mercury isotope fractionation during coal combustion and SFGD, and are also useful in tracing the mercury emissions from coal fired power plants. - Highlights: • Spread of 1.5‰ was observed in δ 202 Hg values of raw coals and coal related samples. • The δ 202 Hg values were more negative in fly ash than those in the raw coal. • The flue gas had a significant Hg fractionation after desulfurization. • The stack emissions were enriched with lighter isotopes compared with the raw coal.

  12. STRESS SENSITIVITY OF MERCURY INJECTION MEASUREMENTS

    OpenAIRE

    Guise, P; Grattoni, C; Allshorn, S; Fisher, QJ; Schiffer, A

    2017-01-01

    Many petrophysical properties (e.g. permeability, electrical resistivity etc.) of tight rocks are very stress sensitive. However, most mercury injection measurements are made using an instrument that does not apply a confining pressure to the samples. Here we further explore the implications of the use and analysis of data from mercury injection porosimetry or mercury capillary pressure measurements (MICP). Two particular aspects will be discussed. First, the effective stress acting on sample...

  13. Mercury in polar bears from Alaska

    Energy Technology Data Exchange (ETDEWEB)

    Lentfer, J.W.; Galster, W.A.

    1987-04-01

    Alaskan polar bear (Ursus maritimus) muscle and liver samples collected in 1972 were analyzed for total mercury. Bears north of Alaska had more mercury than bears west of Alaska. The only difference between young and adult animals was in the northern area where adults had more mercury in liver tissue than young animals. Levels were probably not high enough to be a serious threat to bears.

  14. Process for removing mercury from aqueous solutions

    Science.gov (United States)

    Googin, John M.; Napier, John M.; Makarewicz, Mark A.; Meredith, Paul F.

    1986-01-01

    A process for removing mercury from water to a level not greater than two parts per billion wherein an anion exchange material that is insoluble in water is contacted first with a sulfide containing compound and second with a compound containing a bivalent metal ion forming an insoluble metal sulfide. To this treated exchange material is contacted water containing mercury. The water containing not more than two parts per billion of mercury is separated from the exchange material.

  15. Surface composition of Mercury from reflectance spectrophotometry

    Science.gov (United States)

    Vilas, Faith

    1988-01-01

    The controversies surrounding the existing spectra of Mercury are discussed together with the various implications for interpretations of Mercury's surface composition. Special attention is given to the basic procedure used for reducing reflectance spectrophotometry data, the factors that must be accounted for in the reduction of these data, and the methodology for defining the portion of the surface contributing the greatest amount of light to an individual spectrum. The application of these methodologies to Mercury's spectra is presented.

  16. Accumulation of mercury in selected plant species grown in soils contaminated with different mercury compounds

    International Nuclear Information System (INIS)

    Su, Yi; Han, Fengxiang; Shiyab, Safwan; Chen, Jian; Monts, David L.

    2007-01-01

    The objective of our research is to screen and search for suitable plant species for phyto-remediation of mercury-contaminated soil. Currently our effort is specifically focused on mercury removal from the U.S. Department of Energy (DOE) sites, where mercury contamination is a major concern. In order to cost effectively implement mercury remediation efforts, it is necessary now to obtain an improved understanding of biological means of removing mercury and mercury compounds.. Phyto-remediation is a technology that uses various plants to degrade, extract, contain, or immobilize contaminants from soil and water. In particular, phyto-extraction is the uptake of contaminants by plant roots and translocation within the plants to shoots or leaves. Contaminants are generally removed by harvesting the plants. We have investigated phyto-extraction of mercury from contaminated soil by using some of the known metal-accumulating plants since no natural plant species with mercury hyper-accumulating properties has yet been identified. Different natural plant species have been studied for mercury uptake, accumulation, toxicity and overall mercury removal efficiency. Various mercury compounds, such as HgS, HgCl 2 , and Hg(NO 3 ) 2 , were used as contaminant sources. Different types of soil were examined and chosen for phyto-remediation experiments. We have applied microscopy and diffuse reflectance spectrometry as well as conventional analytical chemistry to monitor the phyto-remediation processes of mercury uptake, translocation and accumulation, and the physiological impact of mercury contaminants on selected plant species. Our results indicate that certain plant species, such as beard grass (Polypogon monospeliensis), accumulated a very limited amount of mercury in the shoots ( 2 powder, respectively; no visual stress symptoms were observed. We also studied mercury phyto-remediation using aged soils that contained HgS, HgCl 2 , or Hg(NO 3 ) 2 . We have found that up to hundreds

  17. The Messenger Mission to Mercury

    CERN Document Server

    Domingue, D. L

    2007-01-01

    NASA’s MESSENGER mission, launched on 3 August, 2004 is the seventh mission in the Discovery series. MESSENGER encounters the planet Mercury four times, culminating with an insertion into orbit on 18 March 2011. It carries a comprehensive package of geophysical, geological, geochemical, and space environment experiments to complete the complex investigations of this solar-system end member, which begun with Mariner 10. The articles in this book, written by the experts in each area of the MESSENGER mission, describe the mission, spacecraft, scientific objectives, and payload. The book is of interest to all potential users of the data returned by the MESSENGER mission, to those studying the nature of the planet Mercury, and by all those interested in the design and implementation of planetary exploration missions.

  18. Augustus as Mercury at last

    Directory of Open Access Journals (Sweden)

    Paulo Martins

    2017-07-01

    Full Text Available My purpose in this paper is to investigate and to analyse the representation of Augustus as Mercury, and what this association may suggest and mean to the Romans from both the urbs and the prouinciae, focusing the epigraphy, the numismatic, and the literature. Furthermore, I review three researches that someway work this problem: Bandinelli, Zanker and Martins. Even though the associations between divinities and rulers were very common – Augustus represented as Apollo, Jupiter or Neptune; Tiberius as Apollo; Claudius as Jupiter; or Commodus as Hercules –, the discussion on the relationship between Augustus and Mercury is very rare in recent bibliography. The latest relevant research on this subject dates back to the first half of the twentieth century. Chittenden’s work on numismatic and Grether’s article on epigraphy are both very important. Thus, new evidences must be considered, so that we can further investigate these representations in the Roman world.

  19. Mercury dosing solutions for fluorescent lamps

    Energy Technology Data Exchange (ETDEWEB)

    Corazza, A; Boffito, C [SAES Getters S.p.A., Viale Italia 77, Lainate (MI) 20020 (Italy)], E-mail: alessio_corazza@saes-group.com

    2008-07-21

    A review of the different technologies used to dose mercury in fluorescent lamps is presented. Conventional liquid mercury dosing is gradually being replaced with more reliable and environmentally friendly solutions that enable a significant reduction of the amount of mercury introduced in the lamp, so as to cope with more stringent regulations issued to minimize the environmental impact of exhausted lamps. This paper will review the most advanced novel methods to assure an accurate and fine dosing of mercury in fluorescent lamps, especially focusing on solutions based on the use of solid alloys.

  20. Sorbents for mercury removal from flue gas

    Energy Technology Data Exchange (ETDEWEB)

    Granite, Evan J.; Hargis, Richard A.; Pennline, Henry W.

    1998-01-01

    A review of the various promoters and sorbents examined for the removal of mercury from flue gas is presented. Commercial sorbent processes are described along with the chemistry of the various sorbent-mercury interactions. Novel sorbents for removing mercury from flue gas are suggested. Since activated carbons are expensive, alternate sorbents and/or improved activated carbons are needed. Because of their lower cost, sorbent development work can focus on base metal oxides and halides. Additionally, the long-term sequestration of the mercury on the sorbent needs to be addressed. Contacting methods between the flue gas and the sorbent also merit investigation.

  1. Risk assessment of mercury contaminated sites

    International Nuclear Information System (INIS)

    Hempel, M.

    1993-01-01

    At two sites, highly contaminated with mercury, risk assessment was executed. Methods were developed to determine organomercury compounds in water, air and soil. Toxicity tests demonstrated the high toxicity of organomercury compounds compared to inorganic mercury. Besides highly toxic methylmercury, ethylmercury was found in soils close to a chemical plant in Marktredwitz. In ultrafiltration-experiments mercury showed great affinity to high molecular substances in water. Lysimeter-experiments proved, that organomercury compounds are adsorbed and transformed to inorganic and elemental mercury. (orig.) [de

  2. Alkaline sorbent injection for mercury control

    Science.gov (United States)

    Madden, Deborah A.; Holmes, Michael J.

    2002-01-01

    A mercury removal system for removing mercury from combustion flue gases is provided in which alkaline sorbents at generally extremely low stoichiometric molar ratios of alkaline earth or an alkali metal to sulfur of less than 1.0 are injected into a power plant system at one or more locations to remove at least between about 40% and 60% of the mercury content from combustion flue gases. Small amounts of alkaline sorbents are injected into the flue gas stream at a relatively low rate. A particulate filter is used to remove mercury-containing particles downstream of each injection point used in the power plant system.

  3. Apparatus for isotopic alteration of mercury vapor

    Science.gov (United States)

    Grossman, Mark W.; George, William A.; Marcucci, Rudolph V.

    1988-01-01

    An apparatus for enriching the isotopic Hg content of mercury is provided. The apparatus includes a reactor, a low pressure electric discharge lamp containing a fill including mercury and an inert gas. A filter is arranged concentrically around the lamp. In a preferred embodiment, constant mercury pressure is maintained in the filter by means of a water-cooled tube that depends from it, the tube having a drop of mercury disposed in it. The reactor is arranged around the filter, whereby radiation from said lamp passes through the filter and into said reactor. The lamp, the filter and the reactor are formed of a material which is transparent to ultraviolet light.

  4. Identification of elemental mercury in the subsurface

    Science.gov (United States)

    Jackson, Dennis G

    2015-01-06

    An apparatus and process is provided for detecting elemental mercury in soil. A sacrificial electrode of aluminum is inserted below ground to a desired location using direct-push/cone-penetrometer based equipment. The insertion process removes any oxides or previously found mercury from the electrode surface. Any mercury present adjacent the electrode can be detected using a voltmeter which indicates the presence or absence of mercury. Upon repositioning the electrode within the soil, a fresh surface of the aluminum electrode is created allowing additional new measurements.

  5. Coal fired flue gas mercury emission controls

    International Nuclear Information System (INIS)

    Wu, Jiang; Pan, Weiguo; Cao, Yan; Pan, Weiping

    2015-01-01

    Mercury (Hg) is one of the most toxic heavy metals, harmful to both the environment and human health. Hg is released into the atmosphere from natural and anthropogenic sources and its emission control has caused much concern. This book introduces readers to Hg pollution from natural and anthropogenic sources and systematically describes coal-fired flue gas mercury emission control in industry, especially from coal-fired power stations. Mercury emission control theory and experimental research are demonstrated, including how elemental mercury is oxidized into oxidized mercury and the effect of flue gas contents on the mercury speciation transformation process. Mercury emission control methods, such as existing APCDs (air pollution control devices) at power stations, sorbent injection, additives in coal combustion and photo-catalytic methods are introduced in detail. Lab-scale, pilot-scale and full-scale experimental studies of sorbent injection conducted by the authors are presented systematically, helping researchers and engineers to understand how this approach reduces the mercury emissions in flue gas and to apply the methods in mercury emission control at coal-fired power stations.

  6. Ocular disorders among workers exposed to mercury.

    Science.gov (United States)

    Gabal, M S; Raslan, O A

    1995-01-01

    Mercury vapor exposed workers may show ocular changes, as well as other systems affection. A sample of 84 workers in preparing mercury fulminate were examined for conjunctival corneal and lenticular manifestation of long duration exposure, together with mercury urinary output. Lens changes were found in 50% of the involved workers while keratopathy as recorded in 34.5% of them. No statistically significant association was found between the occurrence of eye lesions and levels of urinary elimination of mercury. These results suggest local absorption of this element is most probably the underlying cause of ocular affection.

  7. Increased mercury emissions from modern dental amalgams.

    Science.gov (United States)

    Bengtsson, Ulf G; Hylander, Lars D

    2017-04-01

    All types of dental amalgams contain mercury, which partly is emitted as mercury vapor. All types of dental amalgams corrode after being placed in the oral cavity. Modern high copper amalgams exhibit two new traits of increased instability. Firstly, when subjected to wear/polishing, droplets rich in mercury are formed on the surface, showing that mercury is not being strongly bonded to the base or alloy metals. Secondly, high copper amalgams emit substantially larger amounts of mercury vapor than the low copper amalgams used before the 1970s. High copper amalgams has been developed with focus on mechanical strength and corrosion resistance, but has been sub-optimized in other aspects, resulting in increased instability and higher emission of mercury vapor. This has not been presented to policy makers and scientists. Both low and high copper amalgams undergo a transformation process for several years after placement, resulting in a substantial reduction in mercury content, but there exist no limit for maximum allowed emission of mercury from dental amalgams. These modern high copper amalgams are nowadays totally dominating the European, US and other markets, resulting in significant emissions of mercury, not considered when judging their suitability for dental restoration.

  8. Side effects of mercury in dental amalgam

    Directory of Open Access Journals (Sweden)

    Titiek Berniyanti

    2008-03-01

    Full Text Available Dental amalgam is an alloy composed of mixture of approximately equal parts of elemental liquid mercury and an alloy powder. The popularity of amalgam arises from excellent long term performance, ease of use and low cost. Despite the popularity of dental amalgam as restorative material, there have been concerns regarding the potential adverse health and environmental effects arising from exposure to mercury in amalgam. They have long been believed to be of little significance as contributors to the overall body burden of mercury, because the elemental form of mercury is rapidly consumed in the setting reaction of the restoration. In 1997, 80% of dentist in Indonesia still using amalgam as an alternative material, and 60% of them treat the rest of unused amalgam carelessly. In recent years, the possible environmental and health impact caused by certain routines in dental practice has attracted attention among regulators. As part of point source reduction strategies, the discharge of mercury/amalgam-contaminated wastes has been regulated in a number of countries, even though it has been documented that by adopting appropriate mercury hygiene measures, the impact of amalgam use in dentistry is minimal. The purpose of this paper is to examine on studies that relate mercury levels in human to the presence of dental amalgams. It is concluded that even though mercury used in filling is hazardous, if normal occupational recommendations for proper mercury hygiene routines and source of reduction strategies are followed, no occupational health risk can be assumed.

  9. Observations of Mercury in 1988 and 1989

    International Nuclear Information System (INIS)

    Schmude, R.W. Jr.

    1990-01-01

    A visual study of the planet Mercury was carried out in May 1988 and in April and May 1989. Most of the observations were made with the 35.5-cm telescope at the Texas A ampersand M University Observatory. This report presents drawings and a map of Mercury that covers the longitude range of 195-285 deg. One important finding was that a polarizing filter combined with color filters gives a sharper view of the planet. It is also concluded that high-resolution images of Mercury's terminator, either as seen from the earth or with the Hubble Space Telescope, can provide information about Mercury's topography. 10 refs

  10. Phytoremediation of Ionic and Methyl Mercury Pollution

    Energy Technology Data Exchange (ETDEWEB)

    Meagher, Richard B.

    2005-06-01

    Phytoremediation is defined as the use of plants to extract, resist, detoxify, and/or sequester toxic environmental pollutants. The long-term goal of the proposed research is to develop and test highly productive, field-adapted plant species that have been engineered for the phytoremediation of mercury. A variety of different genes, which should enable plants to clean mercury polluted sites are being tested as tools for mercury phytoremediation, first in model laboratory plants and then in potential field species. Several of these genes have already been shown to enhance mercury phytoremediation. Mercury pollution is a serious, world-wide problem affecting the health of human and wildlife populations. Environmentally, the most serious mercury threat is the production of methylmercury (CH3Hg+) by native bacteria at mercury contaminated wetland sites. Methylmercury is inherently more toxic than metallic (Hg(0)) or ionic (Hg(II)) mercury, and because methylmercury is prolifically biomagnified up the food chain, it poses the most immediate danger to animal populations. We have successfully engineered two model plants, Arabidopsis and tobacco, to use the bacterial merB gene to convert methylmercury to less toxic ionic mercury and to use the bacterial merA gene to further detoxify ionic mercury to the least toxic form of mercury, metallic mercury. Plants expressing both MerA and MerB proteins detoxify methylmercury in two steps to the metallic form. These plants germinate, grow, and set seed at normal growth rates on levels of methylmercury or ionic mercury that are lethal to normal plants. Our newest efforts involve engineering plants with several additional bacterial and plant genes that allow for higher levels of mercury resistance and mercury hyperaccumulation. The potential for these plants to hyperaccumulate mercury was further advanced by developing constitutive, aboveground, and root-specific gene expression systems. Our current strategy is to engineer plants to

  11. EDITORIAL: Mercury-free discharges for lighting

    Science.gov (United States)

    Haverlag, M.

    2007-07-01

    This special Cluster of articles in Journal of Physics D: Applied Physics covers the subject of mercury-free discharges that are being investigated by different light source researchers, as an alternative to existing mercury-containing lamps. The main driving force to move away from mercury-containing discharge light sources is connected to the environmentally unfriendly nature of mercury. After inhalation or direct contact, severe mercury exposure can lead to damage to human brain cells, the kidneys, the liver and the nervous system. For this reason, the use of mercury in products is becoming more and more restricted by different governmental bodies. In the lighting industry, however, many products still make use of mercury, for different reasons. The main reason is that mercury-containing products are, in most cases, more efficient than mercury-free products. For a realistic comparison of the environmental impact, the mercury-contamination due to electricity production must be taken into account, which depends on the type of fuel being used. For an average European fuel-mix, the amount of mercury that is released into the environment is around 29 μg kWh-1. This means that a typical 30 W TL lamp during a lifetime of 20,000 hours will release a total of about 20 mg mercury due to electricity production, which exceeds the total mercury dose in the lamp (more and more of which is being recycled) by a factor of 5-10 for a modern TL lamp. This illustrates that, quite apart from other environmental arguments like increased CO2 production, mercury-free alternatives that use more energy can in fact be detrimental for the total mercury pollution over the lifetime of the lamp. For this reason, the lighting industry has concentrated on lowering the mercury content in lamps as long as no efficient alternatives exist. Nevertheless, new initiatives for HID lamps and fluorescent lamps with more or less equal efficiency are underway, and a number of them are described in this

  12. Rapid Monitoring of Mercury in Air from an Organic Chemical Factory in China Using a Portable Mercury Analyzer

    OpenAIRE

    Yasutake, Akira; Cheng, Jin Ping; Kiyono, Masako; Uraguchi, Shimpei; Liu, Xiaojie; Miura, Kyoko; Yasuda, Yoshiaki; Mashyanov, Nikolay

    2011-01-01

    A chemical factory, using a production technology of acetaldehyde with mercury catalysis, was located southeast of Qingzhen City in Guizhou Province, China. Previous research showed heavy mercury pollution through an extensive downstream area. A current investigation of the mercury distribution in ambient air, soils, and plants suggests that mobile mercury species in soils created elevated mercury concentrations in ambient air and vegetation. Mercury concentrations of up to 600 ng/m3 in air o...

  13. Multiscale geomorphometric modeling of Mercury

    Science.gov (United States)

    Florinsky, I. V.

    2018-02-01

    Topography is one of the key characteristics of a planetary body. Geomorphometry deals with quantitative modeling and analysis of the topographic surface and relationships between topography and other natural components of landscapes. The surface of Mercury is systematically studied by interpretation of images acquired during the MErcury Surface, Space ENvironment, GEochemistry, and Ranging (MESSENGER) mission. However, the Mercurian surface is still little explored by methods of geomorphometry. In this paper, we evaluate the Mercury MESSENGER Global DEM MSGR_DEM_USG_SC_I_V02 - a global digital elevation model (DEM) of Mercury with the resolution of 0.015625° - as a source for geomorphometric modeling of this planet. The study was performed at three spatial scales: the global, regional (the Caloris basin), and local (the Pantheon Fossae area) ones. As the initial data, we used three DEMs of these areas with resolutions of 0.25°, 0.0625°, and 0.015625°, correspondingly. The DEMs were extracted from the MESSENGER Global DEM. From the DEMs, we derived digital models of several fundamental morphometric variables, such as: slope gradient, horizontal curvature, vertical curvature, minimal curvature, maximal curvature, catchment area, and dispersive area. The morphometric maps obtained represent peculiarities of the Mercurian topography in different ways, according to the physical and mathematical sense of a particular variable. Geomorphometric models are a rich source of information on the Mercurian surface. These data can be utilized to study evolution and internal structure of the planet, for example, to visualize and quantify regional topographic differences as well as to refine geological boundaries.

  14. Evaluation of thallium-201 exercise scintigraphy in coronary heart disease

    International Nuclear Information System (INIS)

    Murray, R.G.; McKillop, J.H.; Bessent, R.G.; Turner, J.G.; Lorimer, A.R.; Hutton, I.; Greig, W.R.; Lawrie, T.D.V.

    1979-01-01

    Thallium-201 myocardial imaging provides a non-invasive technique in the investigation of patients with suspected coronary heart disease. This study was designed to evaluate thallium-201 ( 201 Tl) scintigraphy in predicting the presence or absence of coronary heart disease in 50 patients presenting with chest pain. The results suggest that computer analysed 201 Tl exercise scintigraphy is a valuable technique for identifying patients with significant coronary artery disease. 201 Tl image data were highly sensitive for detecting the presence of coronary artery disease though accuracy in predicting the extent of disease was limited in patients with multiple vessel disease. The data provides further justification for the use of exercise 201 Tl scintigraphy especially in conjunction with exercise electrocardiography in the investigation of patients with chest pain. (author)

  15. Tl-201 per rectum scintigraphy in chronic liver disease: assessment of Tl-201 uptake indices

    International Nuclear Information System (INIS)

    Moon, Won Jin; Choi, Yun Young; Cho, Suk Shin; Lee, Min Ho

    1999-01-01

    Heart to liver ratio on Tl-201 per rectal scintigraphy (shunt index) is known to be useful in the assessment of portal systemic shunt. We assessed Tl-201 uptake pattern and early liver/heart uptake rate of Tl-201 and correlated with shunt index in patients with chronic active hepatitis (CAH) and liver cirrhosis (LC). Fifty eight patients with biopsy-proven chronic liver disease (35 with CAH, 23 with LC) underwent Tl-201 per rectum scintigraphy after instillation of 18.5 MBq of Tl-201 into the upper rectum. We evaluated hepatic uptake (type 1: homogeneous, 2: inhomogeneous segmental, 3: inhomogeneous nonsegmental) and extrahepatic uptake of spleen, heart and kidney (grade 0: no uptake, 1: less than liver, 2: equal to liver, 3: greater than liver). We measured the early liver/heart uptake rate (the slope of the liver to heart uptake ratio for 10 mim) and shunt index (heart to liver uptake ratio). Tl-201 uptake pattern and early liver/heart uptake rate of Tl-201 was correlated with the pathologic diagnosis and shunt index. Hepatic uptake patterns of type 1 and 2 were dominant in CAH (CAH: 27/35, LC: 8/23), and type 3 in LC (CAH: 8/35, LC: 15/23)(p<0.005). The grades of extrahepatic uptake were higher in LC than in CAH (spleen: p<0.001, other soft tissue: p<0.005). The early liver/heart uptake rate of CAH (0.110±0.111) was significantly higher than that of LC (0.014±0.090)(p<0.001). The sensitivity and specificity of the early liver/heart uptake rate were 77.7% and 67.7% in differentiating LC from CAH. There was negative correlation between early liver/heart uptake rate and shunt index (r=-0.3347, p<0.01). Hepatic and extrahepatic uptake pattern and early liver/heart uptake rate on Tl-201 per rectum scintigraphy are useful in the assessment of portal systemic shunt in patients with chronic liver disease

  16. 7 CFR 201.26 - Kind, variety, and hybrid.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 3 2010-01-01 2010-01-01 false Kind, variety, and hybrid. 201.26 Section 201.26... REGULATIONS Labeling Vegetable Seeds § 201.26 Kind, variety, and hybrid. The label shall bear the name of each... kind or variety named on the label is “hybrid” seed, it shall be so designated on the label. If two or...

  17. 7 CFR 201.16 - Noxious-weed seeds.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 3 2010-01-01 2010-01-01 false Noxious-weed seeds. 201.16 Section 201.16 Agriculture... REGULATIONS Labeling Agricultural Seeds § 201.16 Noxious-weed seeds. (a) Except for those kinds of noxious-weed seeds shown in paragraph (b) of this section, the names of the kinds of noxious-weed seeds and the...

  18. Maternal transfer of mercury to songbird eggs.

    Science.gov (United States)

    Ackerman, Joshua T; Hartman, C Alex; Herzog, Mark P

    2017-11-01

    We evaluated the maternal transfer of mercury to eggs in songbirds, determined whether this relationship differed between songbird species, and developed equations for predicting mercury concentrations in eggs from maternal blood. We sampled blood and feathers from 44 house wren (Troglodytes aedon) and 34 tree swallow (Tachycineta bicolor) mothers and collected their full clutches (n = 476 eggs) within 3 days of clutch completion. Additionally, we sampled blood and feathers from 53 tree swallow mothers and randomly collected one egg from their clutches (n = 53 eggs) during mid to late incubation (6-10 days incubated) to evaluate whether the relationship varied with the timing of sampling the mother's blood. Mercury concentrations in eggs were positively correlated with mercury concentrations in maternal blood sampled at (1) the time of clutch completion for both house wrens (R 2  = 0.97) and tree swallows (R 2  = 0.97) and (2) during mid to late incubation for tree swallows (R 2  = 0.71). The relationship between mercury concentrations in eggs and maternal blood did not differ with the stage of incubation when maternal blood was sampled. Importantly, the proportion of mercury transferred from mothers to their eggs decreased substantially with increasing blood mercury concentrations in tree swallows, but increased slightly with increasing blood mercury concentrations in house wrens. Additionally, the proportion of mercury transferred to eggs at the same maternal blood mercury concentration differed between species. Specifically, tree swallow mothers transferred 17%-107% more mercury to their eggs than house wren mothers over the observed mercury concentrations in maternal blood (0.15-1.92 μg/g ww). In contrast, mercury concentrations in eggs were not correlated with those in maternal feathers and, likewise, mercury concentrations in maternal blood were not correlated with those in feathers (all R 2  mercury concentrations from maternal blood to eggs

  19. Recovery of Mercury From Contaminated Liquid Wastes

    International Nuclear Information System (INIS)

    1998-01-01

    The Base Contract program emphasized the manufacture and testing of superior sorbents for mercury removal, testing of the sorption process at a DOE site, and determination of the regeneration conditions in the laboratory. During this project, ADA Technologies, Inc. demonstrated the following key elements of a successful regenerable mercury sorption process: (1) sorbents that have a high capacity for dissolved, ionic mercury; (2) removal of ionic mercury at greater than 99% efficiency; and (3) thermal regeneration of the spent sorbent. ADA's process is based on the highly efficient and selective sorption of mercury by noble metals. Contaminated liquid flows through two packed columns that contain microporous sorbent particles on which a noble metal has been finely dispersed. A third column is held in reserve. When the sorbent is loaded with mercury to the point of breakthrough at the outlet of the second column, the first column is taken off-line and the flow of contaminated liquid is switched to the second and third columns. The spent column is regenerated by heating. A small flow of purge gas carries the desorbed mercury to a capture unit where the liquid mercury is recovered. Laboratory-scale tests with mercuric chloride solutions demonstrated the sorbents' ability to remove mercury from contaminated wastewater. Isotherms on surrogate wastes from DOE's Y-12 Plant in Oak Ridge, Tennessee showed greater than 99.9% mercury removal. Laboratory- and pilot-scale tests on actual Y-12 Plant wastes were also successful. Mercury concentrations were reduced to less than 1 ppt from a starting concentration of 1,000 ppt. The treatment objective was 50 ppt. The sorption unit showed 10 ppt discharge after six months. Laboratory-scale tests demonstrated the feasibility of sorbent regeneration. Results show that sorption behavior is not affected after four cycles

  20. Worldwide trend of atmospheric mercury since 1995

    Directory of Open Access Journals (Sweden)

    F. Slemr

    2011-05-01

    Full Text Available Concern about the adverse effects of mercury on human health and ecosystems has led to tightening emission controls since the mid 1980s. But the resulting mercury emissions reductions in many parts of the world are believed to be offset or even surpassed by the increasing emissions in rapidly industrializing countries. Consequently, concentrations of atmospheric mercury are expected to remain roughly constant. Here we show that the worldwide atmospheric mercury concentrations have decreased by about 20 to 38 % since 1996 as indicated by long-term monitoring at stations in the Southern and Northern Hemispheres combined with intermittent measurements of latitudinal distribution over the Atlantic Ocean. The total reduction of the atmospheric mercury burden of this magnitude within 14 years is unusually large among most atmospheric trace gases and is at odds with the current mercury emission inventories with nearly constant anthropogenic emissions over this period. This suggests a major shift in the biogeochemical cycle of mercury including oceans and soil reservoirs. Decreasing reemissions from the legacy of historical mercury emissions are the most likely explanation for this decline since the hypothesis of an accelerated oxidation rate of elemental mercury in the atmosphere is not supported by the observed trends of other trace gases. Acidification of oceans, climate change, excess nutrient input and pollution may also contribute by their impact on the biogeochemistry of ocean and soils. Consequently, models of the atmospheric mercury cycle have to include soil and ocean mercury pools and their dynamics to be able to make projections of future trends.

  1. Clinical evaluation of Tl-201 SPECT in nasopharyngeal carcinoma

    Energy Technology Data Exchange (ETDEWEB)

    Togawa, Takashi; Yui, Nobuharu; Shimada, Fumiyuki; Omura, Ken; Katahashi, Tatsuaki; Hatano, Kazuo [Chiba Cancer Center (Japan). Hospital

    1995-03-01

    Tl-201 SPECT was performed on 19 patients, 13 males and 6 females aged 28 to 73 yrs (mean 51), with nasopharyngeal carcinoma (NPC) histologically proven to evaluate whether or not Tl-201 SPECT was useful and reliable for assessing the tumor viability of NPC. Thirty eight Tl-201 SPECT studies were performed for the follow-up study after radiation therapy in 9 of 19 patients and for the assessment of tumor extent before treatment in the other 10 patients. Data acquisition was started 5 min after the intravenous injection of 111 MBq of Tl-201 chloride using a three-head rotating gamma camera (Toshiba GCA 9300A) equipped with fan-beam collimators. Tl-201 clearly accumulated to the tumor in 10 patients before radiation treatment and increased Tl-201 uptake by the lesion disappeared after the treatment. Three of 9 patients who were followed up after radiotherapy developed apparent local recurrence and Tl-201 SPECT could definitely visualize these recurrent lesions. Tl-201 SPECT was very useful for detecting local recurrent tumor. High resolution SPECT system with the use of Tl-201 chloride is a new reliable and accurate diagnostic tool for assessing the tumor viability of NPC. (author).

  2. Mercury Methylation and Detoxification by Novel Microorganisms in Mercury Enriched Mesothermal Springs

    Science.gov (United States)

    Gionfriddo, C. M.; Krabbenhoft, D. P.; Stott, M.; Wick, R. R.; Schultz, M. B.; Holt, K. E.; Moreau, J. W.

    2015-12-01

    Hot springs and fumaroles release significant quantities of aqueous and gaseous mercury into the environment. Yet few studies have looked at the microbial underpinnings of mercury transformations in geothermal settings. Recent advancements in culture-independent molecular techniques, such as ultra-high-throughput sequencing, allow us to delve deeply into the functional and phylogenetic make-up of these extreme environments. Here we present results from deep metagenomic sequencing of geothermal microbial communities cycling mercury, focussing on the connections between putative metabolisms and mercury methylation, and the evolution of the mer-operon. Presented are data from two adjacent, acidic (pHNew Zealand), extremely enriched in total mercury (>1000 ng L-1), and varying methylmercury concentrations (1-10 ng L-1). Microbial communities of both springs are dominated by mercury resistant acidophilic, sulfur- and iron-cycling microbes: Acidithiobacillus, Thiomonas, and Thermoplasma. Mercury methylation genes (hgcAB) were only detected in the cooler spring (ΔT~10 °C), with an order of magnitude greater methylmercury (10 ng L-1). The hgcAB genes have no known closest relatives (40°C), and methylmercury concentration. We conclude that the relative amount of mercury methylation in each hot spring is controlled by the presence of methylating bacteria and archaea, the release of bioavailable mercury species from sulfide minerals, counterbalanced by microbial mercury demethylation and reduction and mercury sulfide mineralization.

  3. Mercury rising : mercury emissions from Ontario Power Generation's coal-fired plants

    International Nuclear Information System (INIS)

    Rang, S.

    2004-09-01

    Ontario Power Generation (OPG) operates 5 coal-fired power plants which are the largest single source of mercury emissions in Ontario. Mercury is a persistent, bioaccumulative neurotoxin which is considered toxic under the Canadian Environmental Protection Act. This report examines the health and environmental impacts of mercury, and the trends for mercury emission in Ontario. In 2002, the 5 coal-fired plants emitted 527 kg of mercury into the atmosphere and contributed 39 per cent of the total amount of mercury emitted into the air. While many other sectors have reduced their mercury emissions since 1988, Ontario's coal-fired plants have lagged behind and have actually increased mercury emissions by 16 per cent since 1988. This paper suggests that phasing out OPG coal-fired plants by 2007 could lead to a 39 per cent reduction in airborne mercury emissions. It would also allow Ontario to achieve the Canada Wide Standard for mercury emissions 3 years early, and would help both Ontario and Canada meet air pollution reduction commitments under international agreements. It was noted that phasing out coal-fired power plants by one-third will help Ontario achieve its goal of a 90 per cent reduction in mercury emissions by 2010. It was suggested that alternative power sources can offer a wide range of environmental advantages. 16 refs., 3 tabs., 2 figs

  4. Mercury(II) and methyl mercury speciation on Streptococcus pyogenes loaded Dowex Optipore SD-2

    Energy Technology Data Exchange (ETDEWEB)

    Tuzen, Mustafa, E-mail: m.tuzen@gmail.com [Gaziosmanpasa University, Faculty of Science and Arts, Chemistry Department, 60250 Tokat (Turkey); Uluozlu, Ozgur Dogan [Gaziosmanpasa University, Faculty of Science and Arts, Chemistry Department, 60250 Tokat (Turkey); Karaman, Isa [Gaziosmanpasa University, Faculty of Science and Arts, Biology Department, 60250 Tokat (Turkey); Soylak, Mustafa [Erciyes University, Faculty of Science and Arts, Chemistry Department, 38039 Kayseri (Turkey)

    2009-09-30

    A solid phase extraction procedure based on speciation of mercury(II) and methyl mercury on Streptococcus pyogenes immobilized on Dowex Optipore SD-2 has been established. Selective and sequential elution with 0.1 mol L{sup -1} HCl for methyl mercury and 2 mol L{sup -1} HCl for mercury(II) were performed at pH 8. The determination of mercury levels was performed by cold vapour atomic absorption spectrometry (CVAAS). Optimal analytical conditions including pH, amounts of biosorbent, sample volumes, etc., were investigated. The influences of the some alkaline and earth alkaline ions and some transition metals on the recoveries were also investigated. The capacity of biosorbent for mercury(II) and methyl mercury was 4.8 and 3.4 mg g{sup -1}. The detection limit (3 sigma) of the reagent blank for mercury(II) and methyl mercury was 2.1 and 1.5 ng L{sup -1}. Preconcentration factor was calculated as 25. The relative standard deviations of the procedure were below 7%. The validation of the presented procedure is performed by the analysis of standard reference material (NRCC-DORM 2 Dogfish Muscle). The procedure was successfully applied to the speciation of mercury(II) and methyl mercury in natural water and environmental samples.

  5. Mercury(II) and methyl mercury speciation on Streptococcus pyogenes loaded Dowex Optipore SD-2

    International Nuclear Information System (INIS)

    Tuzen, Mustafa; Uluozlu, Ozgur Dogan; Karaman, Isa; Soylak, Mustafa

    2009-01-01

    A solid phase extraction procedure based on speciation of mercury(II) and methyl mercury on Streptococcus pyogenes immobilized on Dowex Optipore SD-2 has been established. Selective and sequential elution with 0.1 mol L -1 HCl for methyl mercury and 2 mol L -1 HCl for mercury(II) were performed at pH 8. The determination of mercury levels was performed by cold vapour atomic absorption spectrometry (CVAAS). Optimal analytical conditions including pH, amounts of biosorbent, sample volumes, etc., were investigated. The influences of the some alkaline and earth alkaline ions and some transition metals on the recoveries were also investigated. The capacity of biosorbent for mercury(II) and methyl mercury was 4.8 and 3.4 mg g -1 . The detection limit (3 sigma) of the reagent blank for mercury(II) and methyl mercury was 2.1 and 1.5 ng L -1 . Preconcentration factor was calculated as 25. The relative standard deviations of the procedure were below 7%. The validation of the presented procedure is performed by the analysis of standard reference material (NRCC-DORM 2 Dogfish Muscle). The procedure was successfully applied to the speciation of mercury(II) and methyl mercury in natural water and environmental samples.

  6. Human Exposure and Health Effects of Inorganic and Elemental Mercury

    Science.gov (United States)

    Zheng, Wei

    2012-01-01

    Mercury is a toxic and non-essential metal in the human body. Mercury is ubiquitously distributed in the environment, present in natural products, and exists extensively in items encountered in daily life. There are three forms of mercury, i.e., elemental (or metallic) mercury, inorganic mercury compounds, and organic mercury compounds. This review examines the toxicity of elemental mercury and inorganic mercury compounds. Inorganic mercury compounds are water soluble with a bioavailability of 7% to 15% after ingestion; they are also irritants and cause gastrointestinal symptoms. Upon entering the body, inorganic mercury compounds are accumulated mainly in the kidneys and produce kidney damage. In contrast, human exposure to elemental mercury is mainly by inhalation, followed by rapid absorption and distribution in all major organs. Elemental mercury from ingestion is poorly absorbed with a bioavailability of less than 0.01%. The primary target organs of elemental mercury are the brain and kidney. Elemental mercury is lipid soluble and can cross the blood-brain barrier, while inorganic mercury compounds are not lipid soluble, rendering them unable to cross the blood-brain barrier. Elemental mercury may also enter the brain from the nasal cavity through the olfactory pathway. The blood mercury is a useful biomarker after short-term and high-level exposure, whereas the urine mercury is the ideal biomarker for long-term exposure to both elemental and inorganic mercury, and also as a good indicator of body burden. This review discusses the common sources of mercury exposure, skin lightening products containing mercury and mercury release from dental amalgam filling, two issues that happen in daily life, bear significant public health importance, and yet undergo extensive debate on their safety. PMID:23230464

  7. Sexual differences in the excretion of organic and inorganic mercury by methyl mercury-treated rats

    International Nuclear Information System (INIS)

    Thomas, D.J.; Fisher, H.L.; Sumler, M.R.; Mushak, P.; Hall, L.L.

    1987-01-01

    Adult male and female Long Evans rats received 1 mumole of methyl ( 203 Hg) mercuric chloride per kilogram sc. Whole-body retention of mercury and excretion of organic and inorganic mercury in urine and feces were monitored for 98 days after dosing. Females cleared mercury from the body more rapidly than did males. The major route of mercury excretion was feces. By 98 days after dosing, cumulative mercury excretion in feces accounted for about 51% of the dose in males and about 54% of the dose in females. For both sexes, about 33% of the dose was excreted in feces as inorganic mercury. Cumulative excretion of organic mercury in feces accounted for about 18 and 21% of the dose in males and females, respectively. Urinary excretion of mercury was quantitatively a smaller route for mercury clearance but important sexual differences in loss by this route were found. Over the 98-day experimental period, males excreted in urine about 3.2% of the dose and females excreted 7.5%. Cumulative organic Hg excretion in urine accounted for 1.8% of the dose in males and 5.3% of the dose in females. These sexual differences in urinary and fecal excretion of organic and inorganic mercury following methyl mercury treatment were consistent with previous reports of sexual differences in mercury distribution and retention in methyl mercury-treated rats, particularly sexual differences in organic mercury uptake and retention in the kidney. Relationships between body burdens of organic or inorganic Hg and output of these forms of Hg in urine and feces were also found to be influenced by the interval after MeHg treatment and by sex. Relationship between concentration of Hg in liver and feces and in kidney and urine differed for organic and inorganic Hg and depended upon sexual status and interval after MeHg treatment

  8. Neonatal nonepileptic myoclonus is a prominent clinical feature of KCNQ2 gain-of-function variants R201C and R201H

    NARCIS (Netherlands)

    Mulkey, S.B.; Ben-Zeev, B.; Nicolai, J.; Carroll, J.L.; Gronborg, S.; Jiang, Y.H.; Joshi, N.; Kelly, M.; Koolen, D.A.; Mikati, M.A.; Park, K.; Pearl, P.L.; Scheffer, I.E.; Spillmann, R.C.; Taglialatela, M.; Vieker, S.; Weckhuysen, S.; Cooper, E.C.; Cilio, M.R.

    2017-01-01

    OBJECTIVE: To analyze whether KCNQ2 R201C and R201H variants, which show atypical gain-of-function electrophysiologic properties in vitro, have a distinct clinical presentation and outcome. METHODS: Ten children with heterozygous, de novo KCNQ2 R201C or R201H variants were identified worldwide,

  9. Increased Mercury Bioaccumulation Follows Water Quality Improvement

    Energy Technology Data Exchange (ETDEWEB)

    Bogle, M.A.; Peterson, M.J.; Smith, J.G.; Southworth, G.R.

    1999-09-15

    Changes in physical and chemical characteristics of aquatic habitats made to reduce or eliminate ecological risks can sometimes have unforeseen consequences. Environmental management activities on the U.S. Dept. of Energy reservation in Oak Ridge, Tennessee,have succeeded in improving water quality in streams impacted by discharges fi-om industrial facilities and waste disposal sites. The diversity and abundance of pollution-sensitive components of the benthic macroinvertebrate communities of three streams improved after new waste treatment systems or remedial actions reduced inputs of various toxic chemicals. Two of the streams were known to be mercury-contaminated from historical spills and waste disposal practices. Waterborne mercury concentrations in the third were typical of uncontaminated systems. In each case, concentrations of mercury in fish, or the apparent biological availability of mercury increased over the period during which ecological metrics indicated improved water quality. In the system where waterborne mercury concentrations were at background levels, increased mercury bioaccumulation was probably a result of reduced aqueous selenium concentrations; however, the mechanisms for increased mercury accumulation in the other two streams remain under investigation. In each of the three systems, reduced inputs of metals and inorganic anions was followed by improvements in the health of aquatic invertebrate communities. However, this reduction in risk to aquatic invertebrates was accompanied by increased risk to humans and piscivorous wildlife related to increased mercury concentrations in fish.

  10. Increased Mercury Bioaccumulation Follows Water Quality Improvement

    International Nuclear Information System (INIS)

    Bogle, M.A.; Peterson, M.J.; Smith, J.G.; Southworth, G.R.

    1999-01-01

    Changes in physical and chemical characteristics of aquatic habitats made to reduce or eliminate ecological risks can sometimes have unforeseen consequences. Environmental management activities on the U.S. Dept. of Energy reservation in Oak Ridge, Tennessee,have succeeded in improving water quality in streams impacted by discharges fi-om industrial facilities and waste disposal sites. The diversity and abundance of pollution-sensitive components of the benthic macroinvertebrate communities of three streams improved after new waste treatment systems or remedial actions reduced inputs of various toxic chemicals. Two of the streams were known to be mercury-contaminated from historical spills and waste disposal practices. Waterborne mercury concentrations in the third were typical of uncontaminated systems. In each case, concentrations of mercury in fish, or the apparent biological availability of mercury increased over the period during which ecological metrics indicated improved water quality. In the system where waterborne mercury concentrations were at background levels, increased mercury bioaccumulation was probably a result of reduced aqueous selenium concentrations; however, the mechanisms for increased mercury accumulation in the other two streams remain under investigation. In each of the three systems, reduced inputs of metals and inorganic anions was followed by improvements in the health of aquatic invertebrate communities. However, this reduction in risk to aquatic invertebrates was accompanied by increased risk to humans and piscivorous wildlife related to increased mercury concentrations in fish

  11. A Challenging Case of Acute Mercury Toxicity

    Directory of Open Access Journals (Sweden)

    Ali Nayfeh

    2018-01-01

    Full Text Available Background. Mercury exists in multiple forms: elemental, organic, and inorganic. Its toxic manifestations depend on the type and magnitude of exposure. The role of colonoscopic decompression in acute mercury toxicity is still unclear. We present a case of acute elemental mercury toxicity secondary to mercury ingestion, which markedly improved with colonoscopic decompression. Clinical Case. A 54-year-old male presented to the ED five days after ingesting five ounces (148 cubic centimeters of elemental mercury. Examination was only significant for a distended abdomen. Labs showed elevated serum and urine mercury levels. An abdominal radiograph showed radiopaque material throughout the colon. Succimer and laxatives were initiated. The patient had recurrent bowel movements, and serial radiographs showed interval decrease of mercury in the descending colon with interval increase in the cecum and ascending colon. Colonoscopic decompression was done successfully. The colon was evacuated, and a repeat radiograph showed decreased hyperdense material in the colon. Three months later, a repeat radiograph showed no hyperdense material in the colon. Conclusion. Ingested elemental mercury can be retained in the colon. Although there are no established guidelines for colonoscopic decompression, our patient showed significant improvement. We believe further studies on this subject are needed to guide management practices.

  12. The influence of floodplains on mercury availability

    Energy Technology Data Exchange (ETDEWEB)

    Wallschlaeger, D.; Wilken, R.D. [GKSS Research Center, Geesthacht (Germany). Inst. of Physical and Chemical Analytics

    1997-09-01

    The floodplains of the German river Elbe affect the mercury distribution in the river system in two different ways: they act both as a medium-term sink and as a long-term source. The large amounts of mercury deposited onto the floodplains during annual floodings are first effectively fixed in the soils, rendering them basically unavailable. Sequential extraction experiments reveal that only a small fraction of the mercury (< 3%) is present in available forms, whereas the vast majority is associated with humic substances or present in sulfidic binding forms. After deposition, a small fraction of the total mercury is gradually remobilized into the aqueous phase bound passively to water-soluble humic acids. The availability of mercury in these complexes is still low, since environmental influences such as changes in pH or redox potential and competition with other cations do not cause any mercury liberation. In the next step, reactions in the aqueous phase lead to the formation of the highly available volatile species Hg{sup 0} and dimethylmercury (DMM). Their evaporation gives rise to a strong mercury flux from the floodplains into the atmosphere. Preliminary mass balances indicate that the majority of the deposited mercury stays bound in the floodplain soils, while small amounts are emitted back into the river`s ecosystem. Atmospheric emission is more important as a remobilization pathway than aquatic export.

  13. OCCURENCE OF MERCURY IN PET FOOD

    Directory of Open Access Journals (Sweden)

    M.C. Abete

    2013-02-01

    Full Text Available Mercury levels in 61 complete pet feed containing fish were evaluated. In five samples a mercury content exceeding the maximum residues level (0.4 mg/kg was detected. The statistical evaluation didn’t show a significant correlation between the percentage of fish in feedingstuffs and the contamination level.

  14. Hair mercury measurement in Egyptian autistic children

    African Journals Online (AJOL)

    Farida El-baz

    Abstract Background: A review of medical literature has shown that exposure to mercury, whether organic or inorganic, can give rise to the symptoms and traits defining or commonly found in autism spectrum disorders (ASD). Mercury can cause impairments in social interaction, commu- nication difficulties, and repetitive ...

  15. Terahertz oscillations in mercury cuprate superconductors

    Indian Academy of Sciences (India)

    Abstract. It has been recently reported that the three-dimensional Bose–Einstein con- densation of the quasi-particles is valid for the mercury cuprates at liquid helium tem- perature. In this study, the validity of the interlayer theory in three dimensions has been investigated for optimally oxygen-doped mercury cuprates at the ...

  16. Mercury poisoning | Shamley | South African Medical Journal

    African Journals Online (AJOL)

    The diagnosis of mercury poisoning requires a high index of suspicion. Mercury poisoning in a patient involved in illicit gold extraction is reported and 6 other cases considered. Some of the clinical features and treatment of this condition are discussed. S Afr Med J 1989; 76: 114-116 ...

  17. Mercury soil surveys: a good reconnaissance tool

    Energy Technology Data Exchange (ETDEWEB)

    Stone, C.; Ruscetta, C.A.; Foley, D. (eds.)

    1981-05-01

    Three examples of mercury soil surveys are discussed, along with the gravity data. An excellent correlation was found in southern Arizona between buried structures revealed by gravity and mercury soil surveys. The advantages of the latter over the former as a reconnaissance tool are listed. (MHR)

  18. Intentional intravenous mercury injection | Yudelowitz | South African ...

    African Journals Online (AJOL)

    Intravenous mercury injection is rarely seen, with few documented cases. Treatment strategies are not clearly defined for such cases, although a few options do show benefit. This case report describes a 29-year-old man suffering from bipolar disorder, who presented following self-inflicted intravenous injection of mercury.

  19. Pneumonitis after Inhalation of Mercury Vapours

    Directory of Open Access Journals (Sweden)

    JD Glezos

    2006-01-01

    Full Text Available A 43-year-old man presented to hospital with pneumonia but only after discharge from hospital did he admit to deliberate prior inhalation of mercury. His pulmonary involvement appeared to resolve almost completely with antibiotics and supportive care. Nevertheless, persisting elevated urinary excretion of mercury required two courses of chelation therapy. No serious systemic sequelae were observed.

  20. Recent Advances in Atmospheric Chemistry of Mercury

    Directory of Open Access Journals (Sweden)

    Lin Si

    2018-02-01

    Full Text Available Mercury is one of the most toxic metals and has global importance due to the biomagnification and bioaccumulation of organomercury via the aquatic food web. The physical and chemical transformations of various mercury species in the atmosphere strongly influence their composition, phase, transport characteristics and deposition rate back to the ground. Modeling efforts to assess global cycling of mercury require an accurate understanding of atmospheric mercury chemistry. Yet, there are several key uncertainties precluding accurate modeling of physical and chemical transformations. We focus this article on recent studies (since 2015 on improving our understanding of the atmospheric chemistry of mercury. We discuss recent advances in determining the dominant atmospheric oxidant of elemental mercury (Hg0 and understanding the oxidation reactions of Hg0 by halogen atoms and by nitrate radical (NO3—in the aqueous reduction of oxidized mercury compounds (HgII as well as in the heterogeneous reactions of Hg on atmospheric-relevant surfaces. The need for future research to improve understanding of the fate and transformation of mercury in the atmosphere is also discussed.

  1. Urban artisanal gold shops and mercury emissions

    International Nuclear Information System (INIS)

    Cordy, P.; Veiga, M.; Carrasco, V.H.G.

    2008-01-01

    Artisanal miners in developing countries use mercury amalgamation processes to extract gold. The amalgams are then refined before being sold on to urban gold shops. The amalgams can often contain between 2 to 40 per cent mercury. Unburned amalgams are also often sold directly to gold shops. There are serious health risks for shop employees and nearby populations when the gold is melted and further purified. Studies have shown that mercury concentrations in the ambient air of gold shops often exceeds World Health Organization (WHO) limits by an order of magnitude or more. This study examined the practices and technologies used to refine gold in Latin America and Indonesia. The study compared and contrasted various refining methods and their resulting mercury emissions. Methods of reducing mercury emissions were also investigated, including a filtration system designed to capture 80 per cent of mercury emissions. Barriers to implementing mercury emissions reduction plans were also investigated. It was concluded that the design of urban gold shops must include condensers, fume hoods, and efficient mercury capture systems. 15 refs

  2. Mercury cycling in peatland watersheds. Chapter 11.

    Science.gov (United States)

    Randall K. Kolka; Carl P.J. Mitchell; Jeffrey D. Jeremiason; Neal A. Hines; David F. Grigal; Daniel R. Engstrom; Jill K. Coleman-Wasik; Edward A. Nater; Edward B. Swain; Bruce A. Monson; Jacob A. Fleck; Brian Johnson; James E. Almendinger; Brian A. Branfireun; Patrick L. Brezonik; James B. Cotner

    2011-01-01

    Mercury (Hg) is of great environmental concern due to its transformation into the toxic methylmercury (MeHg) form that bioaccumulates within the food chain and causes health concerns for both humans and wildlife (U.S. Environmental Protection Agency 2002). Mercury can affect neurological development in fetuses and young children. In adults, exposure to Hg can lead to...

  3. Mercury in tropical and subtropical coastal environments

    Science.gov (United States)

    Costa, Monica F.; Landing, William M.; Kehrig, Helena A.; Barletta, Mário; Holmes, Christopher D.; Barrocas, Paulo R. G.; Evers, David C.; Buck, David G.; Vasconcellos, Ana Claudia; Hacon, Sandra S.; Moreira, Josino C.; Malm, Olaf

    2012-01-01

    Anthropogenic activities influence the biogeochemical cycles of mercury, both qualitatively and quantitatively, on a global scale from sources to sinks. Anthropogenic processes that alter the temporal and spatial patterns of sources and cycling processes are changing the impacts of mercury contamination on aquatic biota and humans. Human exposure to mercury is dominated by the consumption of fish and products from aquaculture operations. The risk to society and to ecosystems from mercury contamination is growing, and it is important to monitor these expanding risks. However, the extent and manner to which anthropogenic activities will alter mercury sources and biogeochemical cycling in tropical and sub-tropical coastal environments is poorly understood. Factors as (1) lack of reliable local/regional data; (2) rapidly changing environmental conditions; (3) governmental priorities and; (4) technical actions from supra-national institutions, are some of the obstacles to overcome in mercury cycling research and policy formulation. In the tropics and sub-tropics, research on mercury in the environment is moving from an exploratory “inventory” phase towards more process-oriented studies. Addressing biodiversity conservation and human health issues related to mercury contamination of river basins and tropical coastal environments are an integral part of paragraph 221 paragraph of the United Nations document “The Future We Want” issued in Rio de Janeiro in June 2012. PMID:22901765

  4. Episodic bioavailability of environmental mercury: implications for ...

    African Journals Online (AJOL)

    Perennial wildfires in Africa and other continents contribute an estimated 8 x 105 kg of mercury to the global atmosphere with a residence time of approximately one year. This phenomenon changes the flux of biologically available mercury in natural microbial communities where enzymatic actions, including mercuric ...

  5. Terahertz oscillations in mercury cuprate superconductors

    Indian Academy of Sciences (India)

    It has been recently reported that the three-dimensional Bose–Einstein condensation of the quasi-particles is valid for the mercury cuprates at liquid helium temperature. In this study, the validity of the interlayer theory in three dimensions has been investigated for optimally oxygen-doped mercury cuprates at the temperature ...

  6. Mercury in Thana creek, Bombay harbour

    Digital Repository Service at National Institute of Oceanography (India)

    Zingde, M.D.; Desai, B.N.

    Mercury content of the water column estimated along Thana Creek/Bombay Harbour gave a standing stock of about 77 kg in excess of the expected background. Mercury concentration in sediment from 23 locations which varied from 0.17 to 8.21 ppm (dry...

  7. Urban artisanal gold shops and mercury emissions

    Energy Technology Data Exchange (ETDEWEB)

    Cordy, P.; Veiga, M.; Carrasco, V.H.G. [British Columbia Univ., Vancouver, BC (Canada). Dept. of Mining and Mineral Process Engineering

    2008-07-01

    Artisanal miners in developing countries use mercury amalgamation processes to extract gold. The amalgams are then refined before being sold on to urban gold shops. The amalgams can often contain between 2 to 40 per cent mercury. Unburned amalgams are also often sold directly to gold shops. There are serious health risks for shop employees and nearby populations when the gold is melted and further purified. Studies have shown that mercury concentrations in the ambient air of gold shops often exceeds World Health Organization (WHO) limits by an order of magnitude or more. This study examined the practices and technologies used to refine gold in Latin America and Indonesia. The study compared and contrasted various refining methods and their resulting mercury emissions. Methods of reducing mercury emissions were also investigated, including a filtration system designed to capture 80 per cent of mercury emissions. Barriers to implementing mercury emissions reduction plans were also investigated. It was concluded that the design of urban gold shops must include condensers, fume hoods, and efficient mercury capture systems. 15 refs.

  8. Mercury Sorption onto Malt Spent Rootlets

    Science.gov (United States)

    Manariotis, I. D.; Anagnostopoulos, V.; Karapanagioti, H. K.; Chrysikopoulos, C.

    2011-12-01

    Mercury is a metal of particular concern due to its toxicity even at relatively low concentrations. The maximum permissible level for mercury in drinking water set by the European Union is 0.001 mg/L. Mercury is released into the environment via four principal pathways: (1) natural processes; i.e. a volcanic eruption, (2) incidental to some other activity; i.e. coal burning power plants, (3) accidentally during the manufacture, breakage or disposal of products that have mercury put into them deliberately, and (4) direct use in industrial settings. The present study focuses on the removal of mercury (II) from aqueous solutions via sorption onto Malt Spent Rootlets (MSR). Batch experiments were conducted employing MSR with size ranging from 0.18 to 1 mm. The effects of pH, mercury concentration, contact time, and solid to liquid ratio on mercury sorption onto MSR were investigated. The highest mercury removal from the aqueous phase, of 41%, was observed at pH of 5.

  9. Low dose mercury toxicity and human health.

    Science.gov (United States)

    Zahir, Farhana; Rizwi, Shamim J; Haq, Soghra K; Khan, Rizwan H

    2005-09-01

    Post Minamata incident there has been awareness about mercury toxicity even among the general public. Previous researches contributed a vast amount of data regarding acute mercury exposure, but gradually information about the low dose [Ninomiya, T., Ohmori, H., Hashimoto, K., Tsuruta, K., Ekino, S., 1995. Expansion of methylmercury poisoning outside minamata: an epidemiological study on chronic methylmercury poisoninig outside of Minamata. Environ. Res. 70 (1) 47-50; Lebel, J., Mergler, D., Lucotte, M., Amorim, M., Dolbec, J., Miranda, D., Arantes, G., Rheault, I., Pichet, P., 1996. Evidence of early nervous system dysfunction in Amazonian populations exposed to low-levels of methylmercury. Neurotoxicology 17 (1) 157-167] of mercury toxicity has been trickling in. With mercury contaminating rain-, ground- and sea-water no one is safe. Polluted water leads to mercury laced fish, meat and vegetable. In aquatic environments, inorganic mercury is microbiologically transformed into lipophilic organic compound 'methylmercury'. This transformation makes mercury more prone to biomagnification in food chains. Consequently, populations with traditionally high dietary intake of food originating from fresh or marine environment have highest dietary exposure to mercury. Extensive research done on locals across the globe have already established this, persons who routinely consume fish or a particular species of fish are at an increased risk of methylmercury poisoning. The easy access of the toxicant to man through multiple pathways air, water, food, cosmetic products and even vaccines increase the exposure. Foetus and children are more susceptible towards mercury toxicity. Mothers consuming diet containing mercury pass the toxicant to foetus and to infants through breast milk. Decreased performance in areas of motor function and memory has been reported among children exposed to presumably safe mercury levels. Similarly, disruption of attention, fine motor function and verbal

  10. Effect of salinity on methylation of mercury

    Energy Technology Data Exchange (ETDEWEB)

    Blum, J.E.; Bartha, R.

    1980-09-01

    Monomethyl and dimethylmercury are potent neurotoxins subject to biomagnification in food webs. This fact was tragically demonstrated by the Minamata and Niigata poisoning incidents in Japan in which 168 persons who ate seafood from mercury polluted waters were poisoned, 52 fatally. Shortly after these two incidents, work conducted in freshwater environments demonstrated the microbial conversion of inorganic and phenylmercury compounds to mono- and di-methylmercury. Consideration of some fragmentary evidence from the literature, however, indicates that the rate and the significance of microbial methylation of mercury in freshwater and saltwater environments may not be the same. A demonstrated relationship between mercury methylation rates and water salinity would greatly influence our thinking about mercury pollution effects in marine versus freshwater environments. Since we were unable to locate published reports on this subject, we are investigating the influence of salinity on the rate of mercury methylation in an estuarine sediment.

  11. High activity carbon sorbents for mercury capture

    Directory of Open Access Journals (Sweden)

    Stavropoulos George G.

    2006-01-01

    Full Text Available High efficiency activated carbons have been prepared for removing mercury from gas streams. Starting materials used were petroleum coke, lignite, charcoal and olive seed waste, and were chemically activated with KOH. Produced adsorbents were primarily characterized for their porosity by N2 adsorption at 77 K. Their mercury retention capacity was characterized based on the breakthrough curves. Compared with typical commercial carbons, they have exhibited considerably enhanced mercury adsorption capacity. An attempt has been made to correlate mercury entrapment and pore structure. It has been shown that physical surface area is increased during activation in contrast to the mercury adsorption capacity that initially increases and tends to decrease at latter stages. Desorption of active sites may be responsible for this behavior.

  12. Human accumulation of mercury in Greenland

    DEFF Research Database (Denmark)

    Johansen, Poul; Mulvad, Gert; Pedersen, Henning Sloth

    2007-01-01

    In the Arctic, the traditional diet exposes its people to a high intake of mercury especially from marine mammals. To determine whether the mercury is accumulated in humans, we analyzed autopsy samples of liver, kidney and spleen from adult ethnic Greenlanders who died between 1990 and 1994 from...... a wide range of causes, natural and violent. Liver, kidney and spleen samples from between 33 and 71 case subjects were analyzed for total mercury and methylmercury, and liver samples also for selenium. Metal levels in men and women did not differ and were not related to age except in one case, i...... in liver and spleen and as little as 3% in kidney. In liver selenium was found in surplus to mercury on a molar basis. Mercury concentrations in the liver and kidneys of Greenlanders were elevated compared to levels in the general population in Japan, Korea and several European countries, except...

  13. Autism: a novel form of mercury poisoning.

    Science.gov (United States)

    Bernard, S; Enayati, A; Redwood, L; Roger, H; Binstock, T

    2001-04-01

    Autism is a syndrome characterized by impairments in social relatedness and communication, repetitive behaviors, abnormal movements, and sensory dysfunction. Recent epidemiological studies suggest that autism may affect 1 in 150 US children. Exposure to mercury can cause immune, sensory, neurological, motor, and behavioral dysfunctions similar to traits defining or associated with autism, and the similarities extend to neuroanatomy, neurotransmitters, and biochemistry. Thimerosal, a preservative added to many vaccines, has become a major source of mercury in children who, within their first two years, may have received a quantity of mercury that exceeds safety guidelines. A review of medical literature and US government data suggests that: (i) many cases of idiopathic autism are induced by early mercury exposure from thimerosal; (ii) this type of autism represents an unrecognized mercurial syndrome; and (iii) genetic and non-genetic factors establish a predisposition whereby thimerosal's adverse effects occur only in some children. Copyright 2001 Harcourt Publishers Ltd.

  14. Removal of mercury by adsorption: a review.

    Science.gov (United States)

    Yu, Jin-Gang; Yue, Bao-Yu; Wu, Xiong-Wei; Liu, Qi; Jiao, Fei-Peng; Jiang, Xin-Yu; Chen, Xiao-Qing

    2016-03-01

    Due to natural and production activities, mercury contamination has become one of the major environmental problems over the world. Mercury contamination is a serious threat to human health. Among the existing technologies available for mercury pollution control, the adsorption process can get excellent separation effects and has been further studied. This review is attempted to cover a wide range of adsorbents that were developed for the removal of mercury from the year 2011. Various adsorbents, including the latest adsorbents, are presented along with highlighting and discussing the key advancements on their preparation, modification technologies, and strategies. By comparing their adsorption capacities, it is evident from the literature survey that some adsorbents have shown excellent potential for the removal of mercury. However, there is still a need to develop novel, efficient adsorbents with low cost, high stability, and easy production and manufacture for practical utility.

  15. 21 CFR 862.3600 - Mercury test system.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 8 2010-04-01 2010-04-01 false Mercury test system. 862.3600 Section 862.3600....3600 Mercury test system. (a) Identification. A mercury test system is a device intended to measure mercury, a heavy metal, in human specimens. Measurements obtained by this device are used in the diagnosis...

  16. 21 CFR 880.2920 - Clinical mercury thermometer.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 8 2010-04-01 2010-04-01 false Clinical mercury thermometer. 880.2920 Section 880... Devices § 880.2920 Clinical mercury thermometer. (a) Identification. A clinical mercury thermometer is a... mercury. (b) Classification. Class II (special controls). The device is exempt from the premarket...

  17. Mercury flow experiments. 4th report: Measurements of erosion rate caused by mercury flow

    International Nuclear Information System (INIS)

    Kinoshita, Hidetaka; Kaminaga, Masanori; Haga, Katsuhiro; Hino, Ryutaro

    2002-06-01

    The Japan Atomic Energy Research Institute (JAERI) and the High Energy Accelerator Research Organization (KEK) are promoting a construction plan of the Material-Life Science Facility, which is consisted of a Muon Science Facility and a Neutron Scattering Facility, in order to open up the new science fields. The Neutron Scattering Facility will be utilized for advanced fields of Material and Life science using high intensity neutron generated by the spallation reaction of a 1 MW pulsed proton beam and mercury target. Design of the spallation mercury target system aims to obtain high neutron performance with high reliability and safety. Since the target system is using mercury as the target material and contains large amount of radioactive spallation products, it is necessary to estimate reliability for strength of instruments in a mercury flow system during lifetime of the facility. Piping and components in the mercury flow system would be damaged by erosion with mercury flow, since these components will be weak by thickness decreasing. This report presents experimental results of wall thickness change by erosion using a mercury experimental loop. In the experiments, an erosion test section and coupons were installed in the mercury experimental loop, and their wall thickness was measured with an ultra sonic thickness gage after every 1000 hours. As a result, under 0.7 m/s of mercury velocity condition which is slightly higher than the practical velocity in mercury pipelines, the erosion is about 3 μm in 1000 hours. The wall thickness decrease during facility lifetime of 30 years is estimated to be less than 0.5 mm. According to the experimental result, it is confirmed that the effect of erosion on component strength is extremely small. Moreover, a measurement of residual mercury on the piping surface was carried out. As a result, 19 g/m 2 was obtained as the residual mercury for the piping surface. According to this result, estimated amount of residual mercury for

  18. Biomolecular Aspects of Mercury Transformations

    Science.gov (United States)

    Johs, A.; Shi, L.; Miller, S. M.; Summers, A. O.; Liang, L.

    2008-12-01

    Bacteria participate significantly in mercury transformation in natural and industrial environments. Previous studies have shown that bacterial mercury resistance is mediated by the mer operon, typically located on transposons or plasmids. It encodes specific genes that facilitate uptake of mercury species, cleavage of organomercurials, and reduction of Hg(II) to Hg(0). Expression of mer operon genes is regulated by MerR, a metal-responsive regulator protein on the level of transcription. In vitro studies have shown that MerR forms a non-transcribing pre-initiation complex with RNA polymerase and the promoter DNA. Binding of Hg(II) induces conformational changes in MerR and other components of the complex resulting in the transcription of mer operon genes. As part of ongoing investigations on allosteric conformational changes induced by Hg(II) in dimeric MerR, and the implications on the binding of RNA polymerase to the promoter of the mer operon, we applied small angle scattering to study the regulatory mechanism of MerR in the presence and absence of Hg(II). Our results show that in the presence of Hg(II) the MerR dimer undergoes a significant reorientation from a compact state to a conformation revealing two distinct domains. Bacterial reduction of Hg(II) can also occur at concentrations too low to induce mer operon functions. Dissimilatory metal reducing bacteria, such as Shewanella and Geobacter are able to reduce Hg(II) in the presence of mineral oxides. This process has been linked to the activity of outer membrane multiheme cytochromes. We isolated and purified a decaheme outer membrane cytochrome OmcA from Shewanella oneidensis MR-1 and characterized its envelope shape in solution by small angle x-ray scattering. Structural features were identified and compared to homology models. These results show that OmcA is an elongated macromolecule consisting of separate modules, which may be connected by flexible linkers.

  19. Mercury in food items from the Idrija Mercury Mine area.

    Science.gov (United States)

    Miklavčič, Ana; Mazej, Darja; Jaćimović, Radojko; Dizdarevi, Tatjana; Horvat, Milena

    2013-08-01

    As a consequence of over 500 years of mining and smelting activities (1490-1995), and of its natural geological occurrence, the soil in the Idrija region is highly contaminated with Hg. In order to assess the present situation regarding the Hg levels in local food samples, concentrations of total mercury (THg) and monomethyl mercury (MeHg) were determined in selected vegetables, mushrooms and fish from the Idrija Hg mine area. Hg levels in the foodstuffs analysed were not very high but were elevated compared to the levels in food from non-contaminated areas. The study showed that THg accumulates in mushrooms (X=5680ng/g dry weight, Min=346ng/g dry weight, Max=17,100 dry weight) and chicory (X=1950ng/g dry weight, Min=86ng/g dry weight, Max=17,100ng/g dry weight). In addition, Se and Cd concentrations were determined by ICP-MS in those vegetable and mushroom species in which the highest Hg levels were found. The levels of Cd and Se were below the threshold levels. Based on data from previous studies, we can conclude that the levels of Hg in food have not diminished significantly during the past 15 years after closure of the Hg mine. Special attention should be given to vegetables such as chicory, representing a local seasonal vegetable eaten frequently. Copyright © 2013 Elsevier Inc. All rights reserved.

  20. Estimating mercury emissions from a zinc smelter in relation to China's mercury control policies

    International Nuclear Information System (INIS)

    Wang, S.X.; Song, J.X.; Li, G.H.; Wu, Y.; Zhang, L.; Wan, Q.; Streets, D.G.; Chin, Conrad K.; Hao, J.M.

    2010-01-01

    Mercury concentrations of flue gas at inlet/outlet of the flue gas cleaning, electrostatic demister, reclaiming tower, acid plant, and mercury contents in zinc concentrate and by-products were measured in a hydrometallurgical zinc smelter. The removal efficiency of flue gas cleaning, electrostatic demister, mercury reclaiming and acid plant was about 17.4%, 30.3%, 87.9% and 97.4% respectively. Flue gas cleaning and electrostatic demister captured 11.7% and 25.3% of the mercury in the zinc concentrate, respectively. The mercury reclaiming tower captured 58.3% of the mercury in the zinc concentrate. About 4.2% of the mercury in the zinc concentrate was captured by the acid plant. Consequently, only 0.8% of the mercury in the zinc concentrate was emitted to the atmosphere. The atmospheric mercury emission factor was 0.5 g t -1 of zinc produced for the tested smelter, indicating that this process offers the potential to effectively reduce mercury emissions from zinc smelting. - Modern scale production equipped with acid plant and Hg reclaiming tower will significantly reduce Hg emissions from zinc smelters in China.

  1. Treatment of mercury containing waste

    Science.gov (United States)

    Kalb, Paul D.; Melamed, Dan; Patel, Bhavesh R; Fuhrmann, Mark

    2002-01-01

    A process is provided for the treatment of mercury containing waste in a single reaction vessel which includes a) stabilizing the waste with sulfur polymer cement under an inert atmosphere to form a resulting mixture and b) encapsulating the resulting mixture by heating the mixture to form a molten product and casting the molten product as a monolithic final waste form. Additional sulfur polymer cement can be added in the encapsulation step if needed, and a stabilizing additive can be added in the process to improve the leaching properties of the waste form.

  2. Geodesy at Mercury with MESSENGER

    Science.gov (United States)

    Smith, David E.; Zuber, Maria t.; Peale, Stanley J.; Phillips, Roger J.; Solomon, Sean C.

    2006-01-01

    In 2011 the MESSENGER (MErcury Surface, Space ENvironment, GEochemistry, and Ranging) spacecraft will enter Mercury orbit and begin the mapping phase of the mission. As part of its science objectives the MESSENGER mission will determine the shape and gravity field of Mercury. These observations will enable the topography and the crustal thickness to be derived for the planet and will determine the small libration of the planet about its axis, the latter critical to constraining the state of the core. These measurements require very precise positioning of the MESSENGER spacecraft in its eccentric orbit, which has a periapsis altitude as low as 200 km, an apoapsis altitude near 15,000 km, and a closest approach to the surface varying from latitude 60 to about 70 N. The X-band tracking of MESSENGER and the laser altimetry are the primary data that will be used to measure the planetary shape and gravity field. The laser altimeter, which has an expected range of 1000 to 1200 km, is expected to provide significant data only over the northern hemisphere because of MESSENGER's eccentric orbit. For the southern hemisphere, radio occultation measurements obtained as the spacecraft passes behind the planet as seen from Earth and images obtained with the imaging system will be used to provide the long-wavelength shape of the planet. Gravity, derived from the tracking data, will also have greater resolution in the northern hemisphere, but full global models for both topography and gravity will be obtained at low harmonic order and degree. The limiting factor for both gravity and topography is expected to be knowledge of the spacecraft location. Present estimations are that in a combined tracking, altimetry, and occultation solution the spacecraft position uncertainty is likely to be of order 10 m. This accuracy should be adequate for establishing an initial geodetic coordinate system for Mercury that will enable positioning of imaged features on the surface, determination of

  3. Mercury migration into ground water, a literature study

    Energy Technology Data Exchange (ETDEWEB)

    Carlton, W.H.; Carden, J.L.; Kury, R.; Eichholz, G.G.

    1994-11-01

    This report presents a broad review of the technical literature dealing with mercury migration in the soil. The approach followed was to identify relevant articles by searching bibliographic data bases, obtaining the promising articles and searching these articles for any additional relevant citations. Eight catagories were used to organize the literature, with a review and summary of each paper. Catagories used were the following: chemical states of mercury under environmental conditions; diffusion of mercury vapor through soil; solubility and stability of mercury in environmental waters; transport of mercury on colloids; models for mercury migration through the environment; analytical techniques; retention of mercury by soil components; formation of organomecurials.

  4. Study of high levels indoor air mercury contamination from mercury amalgam use in dentistry

    International Nuclear Information System (INIS)

    Khwaja, M.A.; Abbasi, M.S.; Mehmood, F.; Jahangir, S.

    2014-01-01

    In 2005, United Nations Environment Programme (UNEP) estimated that 362 tonnes of dental mercury are consumed annually worldwide. Dental mercury amalgams also called silver fillings and amalgam fillings are widely done. These fillings gave off mercury vapours. Estimated average absorbed concentrations of mercury vapours from dental fillings vary from 3,000 to 17,000 ng Hg. Mercury (Hg) also known as quick silver is an essential constituent of dental amalgam. It is a toxic substance of global concern. A persistent pollutant, mercury is not limited to its source but it travels, on time thousands of kilometers away from the source. Scientific evidence, including, UNEP Global Mercury report, establishes mercury as an extremely toxic substance, which is a major threat to wildlife, ecosystem and human health, at a global scale. Children are more at risk from mercury poisoning which affects their neurological development and brain. Mercury poisoning diminishes memory, attention, thinking and sight. In the past, a number of studies at dental sites in many countries have been carried out and reported which have been reviewed and briefly described. This paper describes and discusses the recent investigations, regarding mercury vapours level in air, carried out at 18 dental sites in Pakistan and other countries. It is evident from the data of 42 dental sites in 17 countries, including, selected dental sites in five main cities of Pakistan, described and discussed in this paper that at most dental sites in many countries including Pakistan, the indoor mercury vapours levels exceed far above the permissible limit, recommended for safe physical and mental health. At these sites, public, in general, and the medical, paramedical staff and vulnerable population, in particular, are at most serious risk to health resulting from exposure to toxic and hazardous mercury. (author)

  5. 21 CFR 201.100 - Prescription drugs for human use.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 4 2010-04-01 2010-04-01 false Prescription drugs for human use. 201.100 Section 201.100 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES... for human use. A drug subject to the requirements of section 503(b)(1) of the act shall be exempt from...

  6. 19 CFR 201.203 - Delegation of authority.

    Science.gov (United States)

    2010-04-01

    ... 19 Customs Duties 3 2010-04-01 2010-04-01 false Delegation of authority. 201.203 Section 201.203 Customs Duties UNITED STATES INTERNATIONAL TRADE COMMISSION GENERAL RULES OF GENERAL APPLICATION Debt... accordance with the policies contained herein and as otherwise provided by law. ...

  7. 21 CFR 201.55 - Statement of dosage.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 4 2010-04-01 2010-04-01 false Statement of dosage. 201.55 Section 201.55 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES (CONTINUED) DRUGS..., depending upon the conditions being treated, it may not be possible in all cases to present an informative...

  8. 21 CFR 201.23 - Required pediatric studies.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 4 2010-04-01 2010-04-01 false Required pediatric studies. 201.23 Section 201.23 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES (CONTINUED) DRUGS... neonates, infants, children, and adolescents, depending upon the known or appropriate use of the drug...

  9. 49 CFR 575.201 - Child restraint performance.

    Science.gov (United States)

    2010-10-01

    ... Recall Enhancement, Accountability, and Documentation Act; Consumer Information § 575.201 Child restraint... 49 Transportation 7 2010-10-01 2010-10-01 false Child restraint performance. 575.201 Section 575... performance of child restraints. The agency makes the information developed under this rating program...

  10. 29 CFR 530.201 - Conflict with State law.

    Science.gov (United States)

    2010-07-01

    ... 29 Labor 3 2010-07-01 2010-07-01 false Conflict with State law. 530.201 Section 530.201 Labor Regulations Relating to Labor (Continued) WAGE AND HOUR DIVISION, DEPARTMENT OF LABOR REGULATIONS EMPLOYMENT... Conflict with State law. No certificate will be issued pursuant to § 530.101 of subpart B above authorizing...

  11. A comparison of the clinical relevance of thallium201 and ...

    African Journals Online (AJOL)

    The myocardial distribution of 201TI and 99mTc_MIBI was compared in a group of 20 patients, who underwent both 201TI single photon emission computed tomography and 99mTc_MIBI study as well as coronary angiography. The sensitivity for predicting a lesion ranged from 25% to 88% in different areas of the heart and ...

  12. 5 CFR 2610.201 - Contents of application.

    Science.gov (United States)

    2010-01-01

    ... 5 Administrative Personnel 3 2010-01-01 2010-01-01 false Contents of application. 2610.201 Section 2610.201 Administrative Personnel OFFICE OF GOVERNMENT ETHICS ORGANIZATION AND PROCEDURES... Agricultural Marketing Act (12 U.S.C. 1141j(a)). (c) The application shall state the amount of fees and...

  13. 41 CFR 50-201.501 - Records of employment.

    Science.gov (United States)

    2010-07-01

    ... 41 Public Contracts and Property Management 1 2010-07-01 2010-07-01 true Records of employment. 50-201.501 Section 50-201.501 Public Contracts and Property Management Other Provisions Relating to... years from their last date of entry; (e) Basic employment and earnings records: All basic time and...

  14. 46 CFR 201.76 - Applications for Government aid.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 8 2010-10-01 2010-10-01 false Applications for Government aid. 201.76 Section 201.76... Government aid. Applications for operating-differential subsidies, charter of Government-owned vessels, and other types of Government aid shall conform to the requirements set forth in the various general orders...

  15. 45 CFR 201.70 - Treatment of replacement checks.

    Science.gov (United States)

    2010-10-01

    ... 45 Public Welfare 2 2010-10-01 2010-10-01 false Treatment of replacement checks. 201.70 Section... STATES FOR PUBLIC ASSISTANCE PROGRAMS Review and Audits § 201.70 Treatment of replacement checks. (a... (FFP) for replacement checks under titles I, VI-A, X, XIV, XVI (AABD) except under the circumstances...

  16. 48 CFR 27.201-2 - Contract clauses.

    Science.gov (United States)

    2010-10-01

    ... the patent indemnity clause. Exclusion from indemnity of identified patents, as distinguished from... 48 Federal Acquisition Regulations System 1 2010-10-01 2010-10-01 false Contract clauses. 27.201-2... REQUIREMENTS PATENTS, DATA, AND COPYRIGHTS Patents and Copyrights 27.201-2 Contract clauses. (a)(1) Insert the...

  17. 44 CFR 201.4 - Standard State Mitigation Plans.

    Science.gov (United States)

    2010-10-01

    ...-planning grants, a principal criterion for prioritizing grants shall be the extent to which benefits are... 44 Emergency Management and Assistance 1 2010-10-01 2010-10-01 false Standard State Mitigation Plans. 201.4 Section 201.4 Emergency Management and Assistance FEDERAL EMERGENCY MANAGEMENT AGENCY...

  18. 20 CFR 718.201 - Definition of pneumoconiosis.

    Science.gov (United States)

    2010-04-01

    ... purposes of this definition, “pneumoconiosis” is recognized as a latent and progressive disease which may... 20 Employees' Benefits 3 2010-04-01 2010-04-01 false Definition of pneumoconiosis. 718.201 Section... DEATH DUE TO PNEUMOCONIOSIS Determining Entitlement to Benefits § 718.201 Definition of pneumoconiosis...

  19. 21 CFR 201.50 - Statement of identity.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 4 2010-04-01 2010-04-01 false Statement of identity. 201.50 Section 201.50 Food... identity. (a) The label of prescription and insulin-containing drugs in package form shall bear as one of its principal features a statement of the identity of the drug. (b) Such statement of identity shall...

  20. Dependence of quality of Thallium-201 on irradiation data

    International Nuclear Information System (INIS)

    Sattari, I.; Aslani, G.; Dehghan, M. K.; Shirazi, B.; Shafie, M.; Shadanpour, N.; Winkel, P. V.

    2003-01-01

    Background: Thallium-201 is produced through 203 Tl (p,3 n) 201 pb 201 Tl reaction by cyclotron. This radioisotope has known as one of the cyclotron radioisotopes which is used for myocardial perfusion in the coronary artery disease, Ti-201 after chemical purification and quality control in the form of 201 Tl-chloride is ready to send the hospitals. Materials and methods: In this work the effect of the proton energy on quality of a Ti-201, was studied. Radionuclidic purity was determined by high purity Ge (H P Ge) detector Gamma spectrometer, in production time and after one half-life (73 h). The targets were coated with Enriched Thallium-203 (97%). Results: The variation of thickness of targets was 18.3±1.3μm. The different energies of bombardment on quality of Tl-201 and Tl-200, Tl-202, and Pb-203 (as impurity) were studied. The results have been that optimum energy for proton was 28.5 MeV. Conclusion: The variation energy of bombardment can change the purity of Tl-201 but all results were in standard range according to the United States Pharmacopoeia (USP) and European Pharmacopoeia

  1. 7 CFR 201.56-3 - Mustard family, Brassicaceae (Cruciferae).

    Science.gov (United States)

    2010-01-01

    ...) FEDERAL SEED ACT FEDERAL SEED ACT REGULATIONS Germination Tests in the Administration of the Act § 201.56-3 Mustard family, Brassicaceae (Cruciferae). Kinds of seed: Broccoli, brussels sprouts, cabbage... 7 Agriculture 3 2010-01-01 2010-01-01 false Mustard family, Brassicaceae (Cruciferae). 201.56-3...

  2. 14 CFR 23.201 - Wings level stall.

    Science.gov (United States)

    2010-01-01

    ... 14 Aeronautics and Space 1 2010-01-01 2010-01-01 false Wings level stall. 23.201 Section 23.201 Aeronautics and Space FEDERAL AVIATION ADMINISTRATION, DEPARTMENT OF TRANSPORTATION AIRCRAFT AIRWORTHINESS.... Starting from a speed at least 10 knots above the stall speed, the elevator control must be pulled back so...

  3. 7 CFR 201.78 - Pollen control for hybrids.

    Science.gov (United States)

    2010-01-01

    ... control for hybrids. (a) Wheat and barley. Shedders in the seed parent, at any one inspection, are limited... 7 Agriculture 3 2010-01-01 2010-01-01 false Pollen control for hybrids. 201.78 Section 201.78... Line is a cytoplasmic male sterile female line used to produce hybrid seed. An R Line is a pollinator...

  4. 42 CFR 403.201 - State regulation of insurance policies.

    Science.gov (United States)

    2010-10-01

    ... 42 Public Health 2 2010-10-01 2010-10-01 false State regulation of insurance policies. 403.201 Section 403.201 Public Health CENTERS FOR MEDICARE & MEDICAID SERVICES, DEPARTMENT OF HEALTH AND HUMAN SERVICES GENERAL PROVISIONS SPECIAL PROGRAMS AND PROJECTS Medicare Supplemental Policies General Provisions...

  5. 19 CFR 201.4 - Performance of functions.

    Science.gov (United States)

    2010-04-01

    ... 19 Customs Duties 3 2010-04-01 2010-04-01 false Performance of functions. 201.4 Section 201.4 Customs Duties UNITED STATES INTERNATIONAL TRADE COMMISSION GENERAL RULES OF GENERAL APPLICATION... Commission constitutes a quorum. The Commission may meet and exercise its powers at any place, and may, by...

  6. Effect of thallium-201 blood levels on reversible myocardial defects

    International Nuclear Information System (INIS)

    Nelson, C.W.; Wilson, R.A.; Angello, D.A.; Palac, R.T.

    1989-01-01

    To determine if 201 Tl plasma blood levels correlate with the presence of reversible myocardial defects during exercise testing, 14 patients with stable coronary artery disease underwent two separate exercise 201 Tl stress tests. Between initial and delayed imaging, on one test the patients drank an instant breakfast drink (eating) and on the other they drank an equivalent volume of water as a control (H 2 O). Thallium-201 imaging was performed immediately postexercise, immediately after eating/H 2 O and 210 min after eating/H 2 O. Between initial and immediate post eating/H 2 O images 201Tl reversible defects occurred in 27/38 regions in the H 2 O test versus 15/38 regions in the eating test (p = 0.02). Over this early time period, plasma 201 Tl activity was significantly higher in the H 2 O test than eating test (p less than 0.05). In conclusion, early reversal of 201 Tl defects may, in part, be the result of higher plasma 201 Tl activity early after initial postexercise 201 Tl imaging

  7. 14 CFR 1262.201 - Contents of application.

    Science.gov (United States)

    2010-01-01

    ... 14 Aeronautics and Space 5 2010-01-01 2010-01-01 false Contents of application. 1262.201 Section 1262.201 Aeronautics and Space NATIONAL AERONAUTICS AND SPACE ADMINISTRATION EQUAL ACCESS TO JUSTICE... cooperative association as defined in section 15(a) of the Agricultural Marketing Act (12 U.S.C. 1141j(a)). (c...

  8. 22 CFR 201.74 - Additional documents for USAID.

    Science.gov (United States)

    2010-04-01

    ... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Additional documents for USAID. 201.74 Section... COMMODITY TRANSACTIONS FINANCED BY USAID Rights and Responsibilities of Banks § 201.74 Additional documents for USAID. In addition to the documents required for reimbursement, a bank shall retain in its files...

  9. 22 CFR 201.82 - Rights of USAID against suppliers.

    Science.gov (United States)

    2010-04-01

    ... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Rights of USAID against suppliers. 201.82... COMMODITY TRANSACTIONS FINANCED BY USAID Rights and Remedies of USAID, and Waiver Authority § 201.82 Rights of USAID against suppliers. Without limiting the responsibility of the borrower/grantee or other...

  10. 4 CFR 201.5 - Requests for Board records.

    Science.gov (United States)

    2010-01-01

    ... RECOVERY ACCOUNTABILITY AND TRANSPARENCY BOARD PUBLIC INFORMATION AND REQUESTS § 201.5 Requests for Board... Transparency Board, 1717 Pennsylvania Avenue, NW., Suite 700, Washington, DC 20006; (2) Send a request via e... pay applicable fees required under § 201.8 unless the requestor seeks a waiver of fees. When making a...

  11. 19 CFR 201.130 - General prohibitions against discrimination.

    Science.gov (United States)

    2010-04-01

    ... advisory boards; or (vi) Otherwise limit a qualified handicapped person in the enjoyment of any right....130 Section 201.130 Customs Duties UNITED STATES INTERNATIONAL TRADE COMMISSION GENERAL RULES OF... Conducted by the U.S. International Trade Commission § 201.130 General prohibitions against discrimination...

  12. 17 CFR 256.201 - Common stock issued.

    Science.gov (United States)

    2010-04-01

    ... 17 Commodity and Securities Exchanges 3 2010-04-01 2010-04-01 false Common stock issued. 256.201... COMPANY ACT OF 1935 Liabilities and Other Credit Accounts § 256.201 Common stock issued. This account shall include the par or stated value of all common capital stock issued and outstanding. ...

  13. 31 CFR 29.201 - Purpose and scope.

    Science.gov (United States)

    2010-07-01

    ... 31 Money and Finance: Treasury 1 2010-07-01 2010-07-01 false Purpose and scope. 29.201 Section 29.201 Money and Finance: Treasury Office of the Secretary of the Treasury FEDERAL BENEFIT PAYMENTS UNDER... Purpose and scope. This subpart contains information concerning the relationship between the Department...

  14. 46 CFR 201.16 - Authority for representation.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 8 2010-10-01 2010-10-01 false Authority for representation. 201.16 Section 201.16 Shipping MARITIME ADMINISTRATION, DEPARTMENT OF TRANSPORTATION POLICY, PRACTICE AND PROCEDURE RULES OF... representation. Any individual acting in a representative capacity in any proceeding before the Administration...

  15. 9 CFR 113.201 - Canine Distemper Vaccine, Killed Virus.

    Science.gov (United States)

    2010-01-01

    ... susceptibility. (i) A constant virus-varying serum neutralization test in tissue culture using 50 to 300 TCID50.... 113.201 Section 113.201 Animals and Animal Products ANIMAL AND PLANT HEALTH INSPECTION SERVICE..., Killed Virus, shall be prepared from virus-bearing cell culture fluids. Only Master Seed Virus which has...

  16. 48 CFR 871.201-4 - Letter contracts.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 5 2010-10-01 2010-10-01 false Letter contracts. 871.201... Rehabilitation and Employment Service 871.201-4 Letter contracts. Letter contracts are authorized for use in... formal contract with an approved educational institution before the enrollment of eligible veterans for...

  17. 17 CFR 201.1100 - Creation of Fair Fund.

    Science.gov (United States)

    2010-04-01

    ... PRACTICE Fair Fund and Disgorgement Plans § 201.1100 Creation of Fair Fund. In any agency process initiated... 17 Commodity and Securities Exchanges 2 2010-04-01 2010-04-01 false Creation of Fair Fund. 201... requiring the payment of disgorgement by a respondent and also assessing a civil money penalty against that...

  18. 22 CFR 201.21 - Notice to supplier.

    Science.gov (United States)

    2010-04-01

    ... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Notice to supplier. 201.21 Section 201.21 Foreign Relations AGENCY FOR INTERNATIONAL DEVELOPMENT RULES AND PROCEDURES APPLICABLE TO COMMODITY... supplier. The importer is responsible for providing the supplier with the following information (either...

  19. 17 CFR 201.500 - Expedited consideration of proceedings.

    Science.gov (United States)

    2010-04-01

    ... 17 Commodity and Securities Exchanges 2 2010-04-01 2010-04-01 false Expedited consideration of proceedings. 201.500 Section 201.500 Commodity and Securities Exchanges SECURITIES AND EXCHANGE COMMISSION... Expedited consideration of proceedings. Consistent with the Commission's or the hearing officer's other...

  20. 17 CFR 201.401 - Consideration of stays.

    Science.gov (United States)

    2010-04-01

    ... 17 Commodity and Securities Exchanges 2 2010-04-01 2010-04-01 false Consideration of stays. 201... PRACTICE Rules of Practice Appeal to the Commission and Commission Review § 201.401 Consideration of stays... consideration. Where the action complained of has already taken effect and the motion for stay is filed within...

  1. 41 CFR 50-201.3 - Insertion of stipulations.

    Science.gov (United States)

    2010-07-01

    ... 41 Public Contracts and Property Management 1 2010-07-01 2010-07-01 true Insertion of stipulations. 50-201.3 Section 50-201.3 Public Contracts and Property Management Other Provisions Relating to...) The foregoing stipulations shall be deemed inoperative if this contract is for a definite amount not...

  2. 14 CFR 201.5 - Advertising and sales by applicants.

    Science.gov (United States)

    2010-01-01

    ... 14 Aeronautics and Space 4 2010-01-01 2010-01-01 false Advertising and sales by applicants. 201.5... CODE-[AMENDED] Application Procedures § 201.5 Advertising and sales by applicants. (a) An applicant for... has been approved by the Department; or (2) Accept payment or issue tickets for the air transportation...

  3. 37 CFR 201.1 - Communication with the Copyright Office.

    Science.gov (United States)

    2010-07-01

    ... 37 Patents, Trademarks, and Copyrights 1 2010-07-01 2010-07-01 false Communication with the Copyright Office. 201.1 Section 201.1 Patents, Trademarks, and Copyrights COPYRIGHT OFFICE, LIBRARY OF...) Inquiries to Licensing Division. Inquiries about filings related to the compulsory licenses (17 U.S.C. 111...

  4. 19 CFR 201.27 - Special procedures: Medical records.

    Science.gov (United States)

    2010-04-01

    ... his or her medical or psychological records in the absence of a doctor's discussion and advice, the... 19 Customs Duties 3 2010-04-01 2010-04-01 false Special procedures: Medical records. 201.27... APPLICATION Safeguarding Individual Privacy Pursuant to 5 U.S.C. 552a § 201.27 Special procedures: Medical...

  5. 41 CFR 50-201.603 - Full administrative exemptions.

    Science.gov (United States)

    2010-07-01

    ... 41 Public Contracts and Property Management 1 2010-07-01 2010-07-01 true Full administrative exemptions. 50-201.603 Section 50-201.603 Public Contracts and Property Management Other Provisions Relating... contract for materials, supplies, articles, or equipment to be manufactured or furnished in part within and...

  6. Tl-201 SPECT in nasopharyngeal carcinoma for monitoring treatment response

    Energy Technology Data Exchange (ETDEWEB)

    Togawa, Takashi; Yui, Nobuharu; Hatano, Kazuo; Sekiya, Yuichi; Shimada, Fumiyuki; Omura, Ken; Takeuchi, Yosuke [Chiba Cancer Center Hospital (Japan); Katahashi, Tatsuaki

    1996-03-01

    A total of 43 Tl-201 SPECT studies were performed on 11 patients with nasopharyngeal carcinoma (NPC) histologically proven before and after treatment to evaluate whether or not Tl-201 SPECT was a useful diagnostic tool for assessing tumor viability. Data acquisition was started 5 min after the intravenous injection of 111 MBq of Tl-201 chloride using 3-head rotating gamma camera SPECT systems (GCA-9300A). Three patients received radiotherapy alone and the other 8 received radiotherapy and chemotherapy. Treatment response was classified as complete response (CR), partial response (PR), and no change (NC) based on the findings of MRI. Intense Tl-201 uptake by the tumor was seen in all patients before treatment. After treatment, MRI showed 1 CR and 10 PR patients, whereas Tl-201 uptake was decreased in 4 and disappeared in 7 patients. Follow-up MRI and Tl-201 SPECT studies of 4 PR patients revealed that tumor gradually decreased after the desappearance of Tl-201 uptake. Tl-201 SPECT was a very useful tool for monitoring radiotherapeutic effects. (author).

  7. 40 CFR 86.201-94 - General applicability.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 18 2010-07-01 2010-07-01 false General applicability. 86.201-94 Section 86.201-94 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) AIR PROGRAMS... 1994 and Later Model Year Gasoline-Fueled New Light-Duty Vehicles, New Light-Duty Trucks and New Medium...

  8. 40 CFR 86.201-11 - General applicability.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 18 2010-07-01 2010-07-01 false General applicability. 86.201-11 Section 86.201-11 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) AIR PROGRAMS... 1994 and Later Model Year Gasoline-Fueled New Light-Duty Vehicles, New Light-Duty Trucks and New Medium...

  9. 17 CFR 7.200-7.201 - [Reserved

    Science.gov (United States)

    2010-04-01

    ... 17 Commodity and Securities Exchanges 1 2010-04-01 2010-04-01 false [Reserved] 7.200-7.201 Section 7.200-7.201 Commodity and Securities Exchanges COMMODITY FUTURES TRADING COMMISSION CONTRACT MARKET RULES ALTERED OR SUPPLEMENTED BY THE COMMISSION Board of Trade of the City of Chicago Rules § 7.200-7...

  10. Serum Long-Chain n-3 Polyunsaturated Fatty Acids, Mercury, and Risk of Sudden Cardiac Death in Men: A Prospective Population-Based Study

    Science.gov (United States)

    Virtanen, Jyrki K.; Laukkanen, Jari A.; Mursu, Jaakko; Voutilainen, Sari; Tuomainen, Tomi-Pekka

    2012-01-01

    Objectives Fish consumption has been associated with reduced risk of cardiovascular diseases (CVD), especially sudden cardiac death (SCD). Fish is the major source of long-chain n-3 polyunsaturated fatty acids (PUFA) eicosapentaenoic acid and docosahexaenoic acid. It is also a major source of methylmercury, which was associated with increased risk of CVD in this study population. Impact of interaction between long-chain n-3 PUFA and methylmercury on the SCD risk is unknown. Methods A total of 1857 men from the prospective, population-based Kuopio Ischaemic Heart Disease Risk Factor study, aged 42–60 years and free of CVD at baseline in 1984–1989, were studied. Serum long-chain n-3 PUFA was used as the marker for long-chain n-3 PUFA intake and hair mercury as the marker for mercury exposure. Results During the mean follow-up of 20.1 years, 91 SCD events occurred. In the multivariate Cox proportional hazards regression models, serum long-chain n-3 PUFA concentration was not associated with the risk of SCD until hair mercury was accounted for; then the hazard ratio (HR) in the highest vs. lowest tertile was 0.54 [95% confidence interval (CI) 0.32 to 0.91, p for trend  = 0.046]. When the analyses were stratified by hair mercury content, among those with lower hair mercury, each 0.5 percentage unit increase in the serum long-chain n-3 PUFA was associated with HR of 0.77 (95% CI 0.64 to 0.93), whereas no association was seen among those with higher hair mercury (p for interaction  = 0.01). Among the individual long-chain n-3 PUFA, docosahexaenoic acid was most strongly associated with the risk. Conclusion High exposure to mercury may reduce the benefits of long-chain n-3 PUFA on SCD. PMID:22815906

  11. Substance Flow Analysis of Mercury in China

    Science.gov (United States)

    Hui, L. M.; Wang, S.; Zhang, L.; Wang, F. Y.; Wu, Q. R.

    2015-12-01

    In previous studies, the emission of anthropogenic atmospheric Hg in China as well as single sector have been examined a lot. However, there might have been more Hg released as solid wastes rather than air. Hg stored in solid wastes may be released to air again when the solid wastes experience high temperature process or cause local pollution if the solid wastes are stacked casually for a long time. To trace the fate of Hg in China, this study developed the substance flow of Hg in 2010 covering all the sectors summarized in table 1. Below showed in Figure 1, the total Hg input is 2825t. The unintentional input of Hg, mined Hg, and recycled Hg account for 57%, 32% and 11% respectively. Figure 2 provides the detail information of substance flow of Hg. Byproducts from one sector may be used as raw materials of another, causing cross Hg flow between sectors. The Hg input of cement production is 303 t, of which 34% comes from coal and limestone, 33% comes from non-ferrous smelting, 23% comes from coal combustion, 7% comes from iron and steel production and 3% comes from mercury mining. Hg flowing to recycledHg production is 639 t, mainly from Hg contained in waste active carbon and mercuric chloride catalyst from VCM production and acid sludge from non-ferrous smelting. There are 20 t mercury flowing from spent mercury adding products to incineration. Figure1 and Figure 2 also show that 46% of the output Hg belongs to "Lagged release", which means this part of mercury might be released later. The "Lagged release" Hg includes 809 t Hg contained in stacked byproducts form coal combustion, non-ferrous smelting, iron and steel production, Al production, cement production and mercury mining, 161t Hg stored in the pipeline of VCM producing, 10 t Hg in fluorescent lamps that are in use and 314 t mercury stored in materials waiting to be handled with in recycled mercury plants. There is 112 t Hg stored in landfill and 129 t Hg exported abroad with the export of mercury adding

  12. Mercury in the environment : a primer

    Energy Technology Data Exchange (ETDEWEB)

    Lourie, B.; Glenn, W. (ed.); Ogilvie, K.; Everhardus, E.; Friesen, K.; Rae, S.

    2003-06-01

    This report provides an overview of the occurrence and effects of mercury in the environment and its impacts on human health. Low levels of mercury occur naturally everywhere in the environment in plants, animals, rocks and air. Incidental emissions occur when natural mercury is released to the environment through human activity. In Canada, coal burning and metal processing are the two largest point sources of atmospheric mercury emissions. Energy facilities have the option to invest in expensive control technologies for coal plants, or they can generate electricity from alternative energy sources. Energy conservation, however, offers the greatest overall benefits for the environment and the public. Mercury can also be released when products containing mercury (such as electrical switches, thermostats, dental amalgam, and thermometers) are broken while in use, or when they are crushed in garbage trucks and dumped in landfills. Source separation is the best way to reduce waste-related emissions. Once mercury is released to the natural environment, it can be transported long distances through air or watercourses. It is volatile, therefore evaporates readily to the atmosphere where it may do one of three things: it may fall out near the point where it was emitted; it may be transported long distances to some point downwind; or, it may enter the global atmospheric mercury pool where it will circle the globe for a year or more within the Earth's major weather systems before being deposited. Data from Canada's National Pollutant Release Inventory indicates that mercury releases and transfers total 28,674 kg per year. The most critical component of the mercury cycle is the conversion of inorganic forms of mercury to the organic compound methylmercury which is more toxic to humans. Most concern about mercury focuses on lakes and other aquatic ecosystems. Fish in hydroelectric reservoirs have been found to contain elevated methylmercury levels because natural

  13. 40 CFR Appendix Xiii to Part 266 - Mercury Bearing Wastes That May Be Processed in Exempt Mercury Recovery Units

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 26 2010-07-01 2010-07-01 false Mercury Bearing Wastes That May Be Processed in Exempt Mercury Recovery Units XIII Appendix XIII to Part 266 Protection of Environment... XIII to Part 266—Mercury Bearing Wastes That May Be Processed in Exempt Mercury Recovery Units These...

  14. Groundwater Modeling of Mercury Pollution at a Former Mercury Cell Chlor Alkali Facility in Pavlodar City, Kazakhstan

    Science.gov (United States)

    In northern Kazakhstan, there is a serious case of mercury pollution near the city of Pavlodar from an old mercury cell chlor-alkali plant. The soil, sediment, and water is severely contaminated with mercury and mercury compounds as a result of the industrial activity of this ch...

  15. Dental amalgam and urinary mercury concentrations: a descriptive study

    OpenAIRE

    Nicolae, Alexandra; Ames, Harry; Qui?onez, Carlos

    2013-01-01

    Background Dental amalgam is a source of elemental and inorganic mercury. The safety of dental amalgam in individuals remains a controversial issue. Urinary mercury concentrations are used to assess chronic exposure to elemental mercury. At present, there are no indications of mercury-associated adverse effects at levels below 5??g Hg/g creatinine (Cr) or 7??g Hg/L (urine). The purpose of the present study is to determine the overall urinary mercury level in the Canadian general population in...

  16. Thallium-201 scintigraphy in complete left bundle branch block

    Energy Technology Data Exchange (ETDEWEB)

    Hirzel, H.O.; Senn, M.; Nuesch, K.; Buettner, C.; Pfeiffer, A.; Hess, O.M.; Krayenbuehl, H.P.

    1984-03-01

    Nineteen symptomatic patients with left bundle branch block (LBBB) were examined by thallium-201 (TI-201) exercise scintigraphy and selective coronary arteriography. All elicited significant anteroseptal perfusion defects in the exercise scintigrams, but in only 4 was coronary artery disease (CAD) involving the left anterior descending coronary artery present. To further elucidate the effect of LBBB on septal TI-201 uptake in the absence of CAD, TI-201 scintigrams combined with regional myocardial blood flow measurements using radioactive microspheres were carried out in 7 dogs during right atrial and right ventricular pacing (LBBB in the ECG) at similar heart rates. During right atrial pacing, TI-201 uptake was homogeneous in the entire left ventricle, as were tissue flows. During right ventricular pacing, TI-201 activity was reduced to 69% of maximal TI-201 activity within the septum, whereas it averaged 90% in the lateral wall (p less than 0.05) in 6 dogs. Correspondingly, regional myocardial blood flow was lower within the septum as compared with that in the lateral wall, averaging 89 and 120 ml/min/100 g, respectively (p less than 0.005). In 1 dog, normal TI-201 distribution and tissue flows were found in both studies. Thus, symptomatic patients with LBBB may elicit abnormal TI-201 exercise scintigrams, suggesting anteroseptal ischemia despite normal coronary arteries. The electrical induction of LBBB in dogs results, in most instances, in a comparable reduction in septal TI-201 uptake associated with diminished septal blood flow. Therefore, exercise-induced septal perfusion defects in the presence of LBBB do not necessarily indicate CAD even in symptomatic patients, but may reflect functional ischemia due to asynchronous septal contraction.

  17. Mercury's magnetosphere and magnetotial revisited

    International Nuclear Information System (INIS)

    Bergan, S.; Engle, I.M.

    1981-01-01

    Magnetic observations which are not complicated by currents of trapped plasma are a good test of geomagnetopause and geomagnetotail predictions. Recent attempts to model the Hermean magnetospheric field based on a planet-centered magnetic multipole field with a quadrupole moment in addition to the planetary dipole field or a dipole field linearly displaced from planet center and no quadrupole moment have produced reasonably good fits to the Mercury magnetic field measurements. In this work we find a better fit for a dipole displacement from the planet center by making use of an improved representation of the magnetic field in the magnetotail, where many of the Mercury measurements were made. The rms deviation of the data was reduced from 10. or 11. γ to 9.3 γ by employing this new tail field representation. Also, by making use of this new tail field representation, we find a best fit for a dipole displacement of -0.0285 R/sub M/ (earlier, 0.026 R/sub M/) toward the dawn in the magnetic equatorial plane and 0.17 R/sub M/ (earlier, 0.189 R/sub M/ (earlier 0.189 R/sub M/) northward along the magnetic dipole axis, where R/sub M/ is the planet radius. Thus with only minor adjustments in the displacement vector of the dipole from the planet center we achieve a measurable improvement in the fit of the data by using the improved magnetotail field representation

  18. A thin, dense crust for Mercury

    Science.gov (United States)

    Sori, Michael M.

    2018-05-01

    Crustal thickness is a crucial geophysical parameter in understanding the geology and geochemistry of terrestrial planets. Recent development of mathematical techniques suggests that previous studies based on assumptions of isostasy overestimated crustal thickness on some of the solid bodies of the solar system, leading to a need to revisit those analyses. Here, I apply these techniques to Mercury. Using MESSENGER-derived elemental abundances, I calculate a map of grain density (average 2974 ± 89 kg/m3) which shows that Pratt isostasy is unlikely to be a major compensation mechanism of Mercury's topography. Assuming Airy isostasy, I find the best fit value for Mercury's mean crustal thickness is 26 ± 11 km, 25% lower than the most recently reported and previously thinnest number. Several geological implications follow from this relatively low value for crustal thickness, including showing that the largest impacts very likely excavated mantle material onto Mercury's surface. The new results also show that Mercury and the Moon have a similar proportion of their rocky silicates composing their crusts, and thus Mercury is not uniquely efficient at crustal production amongst terrestrial bodies. Higher resolution topography and gravity data, especially for the southern hemisphere, will be necessary to refine Mercury's crustal parameters further.

  19. Elimination of mercury from amalgam in rats

    Energy Technology Data Exchange (ETDEWEB)

    Galic, N. [Dept. of Dental Pathology, School of Dentistry, Zagreb (Croatia); Prpic-Mehicic, G.; Prester, Lj.; Blanusa, M. [Inst. for Medical Research and Occupational Health, Zagreb (Croatia); Krnic, Z.; Erceg, D. [Pliva Pharmaceutical Co., Biomedicine Research Inst. ' ' Pliva' ' , Zagreb (Croatia)

    2001-07-01

    The aim of this study was to measure the urinary mercury excretion in rats exposed to amalgam over a two months period. Animals were either exposed to mercury from 4 dental amalgams or fed the diet containing powdered amalgams. The results showed significantly higher mercury amount in urine of both exposed groups than in control. Even two months after the amalgam had been placed in rats teeth, the amount of mercury in the urine remained 4-5 times higher than in control, and 4 times higher than in rats exposed to diet containing powdered amalgam. The elevated urinary Hg amount was accompanied by an increased level of total protein in urine. In the same exposure period the excretion of total protein in urine of rats with amalgam fillings was 2 times higher than in control and 1.5 times higher than in rats exposed to amalgam through diet. Concentrations of mercury in the sera of all groups were below the detection limit of the method. The results show that amount of mercury and protein in the urine of rats were related to the mercury release from dental amalgam. (orig.)

  20. Mercury flow experiments. 4th report Measurements of erosion rate caused by mercury flow

    CERN Document Server

    Kinoshita, H; Hino, R; Kaminaga, M

    2002-01-01

    The Japan Atomic Energy Research Institute (JAERI) and the High Energy Accelerator Research Organization (KEK) are promoting a construction plan of the Material-Life Science Facility, which is consisted of a Muon Science Facility and a Neutron Scattering Facility, in order to open up the new science fields. The Neutron Scattering Facility will be utilized for advanced fields of Material and Life science using high intensity neutron generated by the spallation reaction of a 1 MW pulsed proton beam and mercury target. Design of the spallation mercury target system aims to obtain high neutron performance with high reliability and safety. Since the target system is using mercury as the target material and contains large amount of radioactive spallation products, it is necessary to estimate reliability for strength of instruments in a mercury flow system during lifetime of the facility. Piping and components in the mercury flow system would be damaged by erosion with mercury flow, since these components will be we...

  1. Concentration of mercury in wheat samples stored with mercury tablets as preservative

    International Nuclear Information System (INIS)

    Lalit, B.Y.; Ramachandran, T.V.

    1977-01-01

    Tablets consisting of mercury in the form of a dull grey powder made by triturating mercury with chalk and sugar are used in Indian household for storing food-grains. The contamination of wheat samples by mercury, when stored with mercury tablets for period of upto four years has been assessed by using non-destructive neutron activation analysis. The details of the analytical procedure used have also been briefly described. The concentration of mercury in wheat increases with storage period. Loss of weight of mercury tablet is proportional to the storage period to a first approximation. In the present experiment, the average weight loss at the and end of first year was 0.009716 g corresponding to 6 ppm in wheat. (T.G.)

  2. Hidden sources of mercury in clinical laboratories.

    Science.gov (United States)

    Alvarez-Chavez, C R; Federico-Perez, R A; Gomez-Alvarez, A; Velazquez-Contreras, L E; Perez-Rios, R

    2014-09-01

    The healthcare sector is an important contributor to mercury (Hg) pollution because of the potential presence of mercury in thermometers, blood pressure cuffs, amalgams, etc. There are also other potential sources of mercury in this sector which are used frequently and in high volumes where the presence of the metal is not obvious and which might be collectively contributing to pollution. For instance, some chemicals used for the clinical diagnosis of illness may contain mercury. The goal of this study was to investigate potential sources of mercury pollution, which originate from clinical laboratory discharges, using an exploratory approach. The focus was on the residue generated during automatic analysis of patients' bodily fluids at a medical center in Hermosillo, Sonora, Mexico. This study shows an overview of what might be happening in the region or the country related to non-obvious sources of mercury in the healthcare sector. The results showed measurable levels of mercury in the residues coming from urine sediment analysis. These amounts do not exceed the maximum allowed by Mexican environmental regulations; nevertheless, the frequency and cumulative volume of residues generated, combined with the potential for persistence and the bioaccumulation of mercury in the environment, warrant attention. The work carried out in this study is being taken as a model for future studies for pollution prevention in the healthcare sector with the goal of measuring mercury emissions to the environment from clinical laboratory wastewater, including identifying sources which--while not obvious--could be important given the frequency and volume of their use in the clinical diagnosis.

  3. The tropical African mercury anomaly: lower than expected mercury concentrations in fish and human hair.

    Science.gov (United States)

    Black, Frank J; Bokhutlo, Thethela; Somoxa, Aaron; Maethamako, Mothusi; Modisaemang, Ontlogetse; Kemosedile, Thebe; Cobb-Adams, Cristina; Mosepele, Ketlhatlogile; Chimbari, Moses

    2011-04-15

    Mercury is a neurotoxin and global pollutant, and wetlands and newly flooded areas are known to be sites of enhanced production of monomethylmercury, the form of mercury that is readily biomagnified in aquatic food chains to potentially toxic levels. The Okavango Delta in Botswana, Southern Africa, is the largest inland delta in the world and a wetland ecosystem that experiences dramatic annual flooding of large tracts of seasonal floodplains. The Delta was, therefore, expected to be home to high mercury levels in fish and to be an area where local subsistence fishing communities would be at substantial risk of mercury toxicity from fish consumption. Total mercury concentrations measured in 27 species of fish from the Okavango Delta averaged (mean±s.d., wet weight) 19±19ng g(-1) in non-piscivorous fish, and 59±53ng g(-1) in piscivorous fish. These mercury concentrations are similar to those reported for fish from lakes in other areas of tropical Africa, demonstrating that not all wetlands are sites of elevated mercury concentrations in biota. Even more intriguing is that concentrations of mercury in fish from across tropical Africa are systematically and substantially lower than those typically reported for fish from freshwater ecosystems elsewhere globally. The reasons for this apparent "African mercury anomaly" are unclear, but this finding poses a unique opportunity to improve our understanding of mercury's biogeochemical cycling in the environment. Mercury concentrations measured in human hair collected in subsistence fishing communities in the Okavango Delta were similarly low (0.21±0.22μg g(-1) dry weight) despite high levels of fish consumption, and reflect the low mercury concentrations in the fish here. Copyright © 2010 Elsevier B.V. All rights reserved.

  4. Methyl mercury, but not inorganic mercury, associated with higher blood pressure during pregnancy.

    Science.gov (United States)

    Wells, Ellen M; Herbstman, Julie B; Lin, Yu Hong; Hibbeln, Joseph R; Halden, Rolf U; Witter, Frank R; Goldman, Lynn R

    2017-04-01

    Prior studies addressing associations between mercury and blood pressure have produced inconsistent findings; some of this may result from measuring total instead of speciated mercury. This cross-sectional study of 263 pregnant women assessed total mercury, speciated mercury, selenium, and n-3 polyunsaturated fatty acids in umbilical cord blood and blood pressure during labor and delivery. Models with a) total mercury or b) methyl and inorganic mercury were evaluated. Regression models adjusted for maternal age, race/ethnicity, prepregnancy body mass index, neighborhood income, parity, smoking, n-3 fatty acids and selenium. Geometric mean total, methyl, and inorganic mercury concentrations were 1.40µg/L (95% confidence interval: 1.29, 1.52); 0.95µg/L (0.84, 1.07); and 0.13µg/L (0.10, 0.17), respectively. Elevated systolic BP, diastolic BP, and pulse pressure were found, respectively, in 11.4%, 6.8%, and 19.8% of mothers. In adjusted multivariable models, a one-tertile increase of methyl mercury was associated with 2.83mmHg (0.17, 5.50) higher systolic blood pressure and 2.99mmHg (0.91, 5.08) higher pulse pressure. In the same models, an increase of one tertile of inorganic mercury was associated with -1.18mmHg (-3.72, 1.35) lower systolic blood pressure and -2.51mmHg (-4.49, -0.53) lower pulse pressure. No associations were observed with diastolic pressure. There was a non-significant trend of higher total mercury with higher systolic blood pressure. We observed a significant association of higher methyl mercury with higher systolic and pulse pressure, yet higher inorganic mercury was significantly associated with lower pulse pressure. These results should be confirmed with larger, longitudinal studies. Copyright © 2017 Elsevier Inc. All rights reserved.

  5. Isolation, screening and identification of mercury resistant bacteria from mercury contaminated soil

    OpenAIRE

    Kowalczyk Anna; Wilińska Magdalena; Chyc Marek; Bojko Monika; Latowski Dariusz

    2016-01-01

    New bacterial strains resistant to high concentration of mercury were obtained and character iz ed focusing on their potential application in bioremediation. The biological material was isolated from soil contaminated with mercury. The ability to removal of Hg from the liquid medium and the effect of the various pH and mercury concentrations in the environment on bacterial strains growth kinetics were tested. The selected strains were identified by analysis of the 16S ribosome subunit coding ...

  6. Mercury fluxes through the sediment water interface and bioavailability of mercury in southern Baltic Sea sediments

    Directory of Open Access Journals (Sweden)

    Jacek Bełdowski

    2009-06-01

    Full Text Available Sediment cores collected in several areas of the southern Baltic were analysed for total mercury (HgTOT and five operationally defined mercury fractions: HgA - contained in pore waters, HgF - bound to fulvic acids, HgH - bound to humic acids, HgS - bound to sulphide, and HgR - residual. An effort was made to quantify mercury fluxes at the sediment/water interface in the study area. Net mercury input, calculated on the basis of sedimentation rate and concentration in the uppermost sediments, ranged from 1 to 5.5 ng cm-2 year-1. Mercury remobilisation from sediments due to diffusion and resuspension was calculated from the proportion of labile mercury and the velocity of near-bottom currents. The results showed that the return soluble and particulate fluxes of mercury from the sediments to the water column constitute a substantial proportion of the input (20-50%, and are slightly higher than those found in pristine areas, although they are less than the values recorded in areas with a history of mercury contamination. In addition, an index was developed to assess the methylation potential of mercury in sediments. Mercury contained in pore waters, and mercury bound to fulvic and humic acids together with Loss on Ignition were used to calculate the semi-quantitative methylation potential (Pm. Despite the simplicity of this approach, Pm correlates well with methyl mercury in fish from the study area.full, complete article (PDF - compatibile with Acrobat 4.0, 291.3 kB

  7. determination of mercury content in milk powder

    International Nuclear Information System (INIS)

    Jovchev, M.; Grigorov, T.; Apostolov, D.

    1985-01-01

    Four samples of humanized full cream cow milk powder of Bulgarian origin for new-born, sucklings, small children and soured milk powder were activated for 18-24 h in a neutron flux of 5.10 12 , resp. 2.10 13 n/cm 2 .sec in quartz ampules. The samples were activated without preliminary lyophilization, thus avoiding possible mistakes from mercury losses. Ag-110m, being eliminated in the amalgam, was not an obstacle to the mercury determination. The results obtained for the mercury content are in the same order as in other investigations and many times lower than the admissible norm for foodstuffs - 50 ppb

  8. Effect of mercury on algal growth rates

    Energy Technology Data Exchange (ETDEWEB)

    Hannan, P.J.; Patouillet, C.

    1972-01-01

    In experiments with one freshwater (Chlorella pyrenoidosa) and three marine organisms (Phaeodactylum tricornutum, Cyclotella nana, and Chaetoceras gavestonensis), mercury was more toxic than the other metals tested (silver, cadmium, lead, and copper); and its toxicity is comparatively irreversible. Growth was monitored by changes in fluorescence of the cultures over a 3-day test period. The toxicity of the mercury varied inversely with the concentrations of nutrients present. Preliminary experiments indicate that mercury in the form of mercuric chloride is more toxic than as dimethylmercury. 12 references, 3 figures, 1 table.

  9. Conditioning of spent mercury by amalgamation

    International Nuclear Information System (INIS)

    Yim, S. P.; Shon, J. S.; An, B. G.; Lee, H. J.; Lee, J. W.; Ji, C. G.; Kim, S. H.; Yoon, J. H.; Yang, M. S.

    2002-01-01

    Solidification by amalgamation was performed to immobilize and stabilize the liquid spent mercury. First, the appropriate metal and alloy which can convert liquid mercury into a solid form of amalgam were selected through initial tests. The amalgam form, formulated in optimum composition, was characterized and subjected to performance tests including compressive strength, water immersion, leachability and initial vaporization rate to evaluate mechanical integrity, durability and leaching properties. Finally, bench scale amalgamation trial was conducted with about 1 kg of spent mercury to verify the feasibility of amalgamation method

  10. A self-focusing mercury jet target

    CERN Document Server

    Johnson, C

    2002-01-01

    Mercury jet production targets have been studied in relation to antiproton production and, more recently, pion production for a neutrino factory. There has always been a temptation to include some self-focusing of the secondaries by passing a current through the mercury jet analogous to the already proven lithium lens. However, skin heating of the mercury causes fast vaporization leading to the development of a gliding discharge along the surface of the jet. This external discharge can, nevertheless, provide some useful focusing of the secondaries in the case of the neutrino factory. The technical complications must not be underestimated.

  11. Mercury Thermal Hydraulic Loop (MTHL) Summary Report

    Energy Technology Data Exchange (ETDEWEB)

    Felde, David K. [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States); Crye, Jason Michael [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States); Wendel, Mark W. [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States); Yoder, Jr, Graydon L. [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States); Farquharson, George [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States); Jallouk, Philip A. [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States); McFee, Marshall T. [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States); Pointer, William David [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States); Ruggles, Art E. [Univ. of Tennessee, Knoxville, TN (United States); Carbajo, Juan J. [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States)

    2017-03-01

    The Spallation Neutron Source (SNS) is a high-power linear accelerator built at Oak Ridge National Laboratory (ORNL) which incorporates the use of a flowing liquid mercury target. The Mercury Thermal Hydraulic Loop (MTHL) was constructed to investigate and verify the heat transfer characteristics of liquid mercury in a rectangular channel. This report provides a compilation of previously reported results from the water-cooled and electrically heated straight and curved test sections that simulate the geometry of the window cooling channel in the target nose region.

  12. Physical properties of the planet Mercury

    Science.gov (United States)

    Clark, Pamela E.

    1988-01-01

    The global physical properties of Mercury are summarized with attention given to its figure and orbital parameters. The combination of properties suggests that Mercury has an extensive iron-rich core, possibly with a still-functioning dynamo, which is 42 percent of the interior by volume. Mercury's three major axes are comparable in size, indicating that the planet is a triaxial ellipsoid rather than an oblate spheroid. In terms of the domination of its surface by an intermediate plains terrane, it is more Venus- or Mars-like; however, due to the presence of a large metallic magnetic core, its interior may be more earth-like.

  13. MESSENGER'S First and Second Flybys of Mercury

    Science.gov (United States)

    Slavin, James A.

    2009-01-01

    The MESSENGER mission to Mercury offers our first opportunity to explore this planet's miniature magnetosphere since Mariner 10's brief fly-bys in 1974-5. The magnetosphere of Mercury is the smallest in the solar system with its magnetic field typically standing off the solar wind only approximately 1000 km above the surface. An overview of the MESSENGER mission and its January 14th and October 6th, 2008 close flybys of Mercury will be provided. Primary science objectives and the science instrumentation will be described. Initial results from MESSENGER will be discussed with an emphasis on the magnetic field and charged particle measurements.

  14. Injurious effect of mercury vapor from bichloride of mercury in soil of rose houses

    Energy Technology Data Exchange (ETDEWEB)

    Zimmerman, P.W.; Crocker, W.

    1933-01-01

    Addition of mercuric chloride, or corrosive sublimate, to Rose soil for killing earthworms may injure the Roses. The organic matter of the soil reduces the bichloride to metallic mercury and the vapors of the mercury rise into the air and kill the buds and peduncles. When the soil is rich in tankage or other organic matter, the rate of reduction of the bichloride is increased and thereby the severity of the injury intensified. If a container of metallic mercury is set in an enclosed chamber with Rose plants, severe injuries of the type mentioned below soon appear. The Briarcliff Rose is especially susceptible to mercury injury. 1 figure.

  15. Mercury Information Clearinghouse. Quarterly 3: advanced and developmental mercury control technologies

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    2004-07-01

    Advanced mercury control technologies for coal-fired electric utilities are reviewed. The technologies evaluated are at various stages of development and most have been tested under limited operational conditions. The following technologies are described: K-Fuel and K-Fuel Plus pre-combustion technology, combustion modification and in situ generation of sorbents, new sorbent developments, direct bromine injection, MerCAP{sup {trademark}} (Mercury Control via Adsorption Process, Gore felt filter bag inserts, EnviroScrub Pahlman{sup {trademark}} process, combined oxidation of NO{sub x} and mercury, and mercury control with the Advanced Hybrid{trademark} filter. 36 refs., 1 fig.

  16. Solubility of helium in mercury for bubbling technology of the spallation neutron mercury target

    International Nuclear Information System (INIS)

    Hasegawa, S.; Naoe, T.; Futakawa, M.

    2010-01-01

    The pitting damage of mercury target container that originates in the pressure wave excited by the proton beam incidence becomes a large problem to reach the high-power neutron source in JSNS and SNS. The lifetime of mercury container is decreased remarkably by the pitting damage. As one of solutions, the pressure wave is mitigated by injecting the helium micro bubbles in mercury. In order to inject the helium micro bubbles into mercury, it is important to understand the characteristic of micro bubbles in mercury. The solubility of mercury-helium system is a key factor to decide bubbling conditions, because the disappearance behavior, i.e. the lifetime of micro bubbles, depends on the solubility. In addition, the bubble generation method is affected by it. Moreover, the experimental data related to the solubility of helium in mercury hardly exist. In this work, the solubility was obtained experimentally by measuring precisely the pressure drop of the gas that is facing to mercury surface. The pressure drop was attributed to the helium dissolution into mercury. Based on the measured solubility, the lifetime of micro bubbles and the method of the bubble generation is estimated using the solubility data.

  17. Inorganic mercury exposure, mercury-copper interaction, and DMPS treatment in rats.

    OpenAIRE

    Blanusa, M; Prester, L; Radić, S; Kargacin, B

    1994-01-01

    The aim of this study was to evaluate the efficiency of oral treatment with sodium 2,3-dimercaptopropane-1-sulfonate (DMPS) on reducing mercury deposits in rat kidney after chronic exposure to inorganic mercury. The effect on kidney copper levels was also evaluated. The results showed that after two months of exposure to 50 ppm of mercury (as mercuric chloride) the concentration of mercury in the kidney was 124 micrograms/g wet tissue. At the same time copper concentration rose from 11 to 77 ...

  18. Mercury nano-trap for effective and efficient removal of mercury(II) from aqueous solution

    Science.gov (United States)

    Li, Baiyan; Zhang, Yiming; Ma, Dingxuan; Shi, Zhan; Ma, Shengqian

    2014-11-01

    Highly effective and highly efficient decontamination of mercury from aqueous media remains a serious task for public health and ecosystem protection. Here we report that this task can be addressed by creating a mercury ‘nano-trap’ as illustrated by functionalizing a high surface area and robust porous organic polymer with a high density of strong mercury chelating groups. The resultant porous organic polymer-based mercury ‘nano-trap’ exhibits a record-high saturation mercury uptake capacity of over 1,000 mg g-1, and can effectively reduce the mercury(II) concentration from 10 p.p.m. to the extremely low level of smaller than 0.4 p.p.b. well below the acceptable limits in drinking water standards (2 p.p.b.), and can also efficiently remove >99.9% mercury(II) within a few minutes. Our work therefore presents a new benchmark for mercury adsorbent materials and provides a new perspective for removing mercury(II) and also other heavy metal ions from contaminated water for environmental remediation.

  19. Tundra uptake of atmospheric elemental mercury drives Arctic mercury pollution

    Science.gov (United States)

    Obrist, Daniel; Agnan, Yannick; Jiskra, Martin; Olson, Christine L.; Colegrove, Dominique P.; Hueber, Jacques; Moore, Christopher W.; Sonke, Jeroen E.; Helmig, Detlev

    2017-07-01

    Anthropogenic activities have led to large-scale mercury (Hg) pollution in the Arctic. It has been suggested that sea-salt-induced chemical cycling of Hg (through ‘atmospheric mercury depletion events’, or AMDEs) and wet deposition via precipitation are sources of Hg to the Arctic in its oxidized form (Hg(II)). However, there is little evidence for the occurrence of AMDEs outside of coastal regions, and their importance to net Hg deposition has been questioned. Furthermore, wet-deposition measurements in the Arctic showed some of the lowest levels of Hg deposition via precipitation worldwide, raising questions as to the sources of high Arctic Hg loading. Here we present a comprehensive Hg-deposition mass-balance study, and show that most of the Hg (about 70%) in the interior Arctic tundra is derived from gaseous elemental Hg (Hg(0)) deposition, with only minor contributions from the deposition of Hg(II) via precipitation or AMDEs. We find that deposition of Hg(0)—the form ubiquitously present in the global atmosphere—occurs throughout the year, and that it is enhanced in summer through the uptake of Hg(0) by vegetation. Tundra uptake of gaseous Hg(0) leads to high soil Hg concentrations, with Hg masses greatly exceeding the levels found in temperate soils. Our concurrent Hg stable isotope measurements in the atmosphere, snowpack, vegetation and soils support our finding that Hg(0) dominates as a source to the tundra. Hg concentration and stable isotope data from an inland-to-coastal transect show high soil Hg concentrations consistently derived from Hg(0), suggesting that the Arctic tundra might be a globally important Hg sink. We suggest that the high tundra soil Hg concentrations might also explain why Arctic rivers annually transport large amounts of Hg to the Arctic Ocean.

  20. Tundra uptake of atmospheric elemental mercury drives Arctic mercury pollution.

    Science.gov (United States)

    Obrist, Daniel; Agnan, Yannick; Jiskra, Martin; Olson, Christine L; Colegrove, Dominique P; Hueber, Jacques; Moore, Christopher W; Sonke, Jeroen E; Helmig, Detlev

    2017-07-12

    Anthropogenic activities have led to large-scale mercury (Hg) pollution in the Arctic. It has been suggested that sea-salt-induced chemical cycling of Hg (through 'atmospheric mercury depletion events', or AMDEs) and wet deposition via precipitation are sources of Hg to the Arctic in its oxidized form (Hg(ii)). However, there is little evidence for the occurrence of AMDEs outside of coastal regions, and their importance to net Hg deposition has been questioned. Furthermore, wet-deposition measurements in the Arctic showed some of the lowest levels of Hg deposition via precipitation worldwide, raising questions as to the sources of high Arctic Hg loading. Here we present a comprehensive Hg-deposition mass-balance study, and show that most of the Hg (about 70%) in the interior Arctic tundra is derived from gaseous elemental Hg (Hg(0)) deposition, with only minor contributions from the deposition of Hg(ii) via precipitation or AMDEs. We find that deposition of Hg(0)-the form ubiquitously present in the global atmosphere-occurs throughout the year, and that it is enhanced in summer through the uptake of Hg(0) by vegetation. Tundra uptake of gaseous Hg(0) leads to high soil Hg concentrations, with Hg masses greatly exceeding the levels found in temperate soils. Our concurrent Hg stable isotope measurements in the atmosphere, snowpack, vegetation and soils support our finding that Hg(0) dominates as a source to the tundra. Hg concentration and stable isotope data from an inland-to-coastal transect show high soil Hg concentrations consistently derived from Hg(0), suggesting that the Arctic tundra might be a globally important Hg sink. We suggest that the high tundra soil Hg concentrations might also explain why Arctic rivers annually transport large amounts of Hg to the Arctic Ocean.

  1. Thallium-201 scintigraphy in diagnosis of coronary stenosis

    International Nuclear Information System (INIS)

    Corne, R.A.; Gotsman, M.S.; Weiss, A.; Enlander, D.; Samuels, L.D.; Salomon, J.A.; Warshaw, B.; Atlan, H.

    1979-01-01

    The sensitivity of rest and exercise thallium-201 scintigraphy for the detection of significant coronary artery disease and myocardial ischaemia was compared with rest and exercise electrocardiography in 46 patients with chest pain. Of 26 patients with greater that 70 per cent coronary stenosis, 16 had abnormal rest thallium-201 scintigrams and 13 had Q waves. Myocardial perfusion defects in the resting scintigram correlated very well with evidence of previous myocardial infarction (16 of 17 patients, 94%) significant Q waves were present in 13 of these 17 patients (76%). After exercise, abnormal thallium-201 scintigrams consistent with ischaemia were found in 21 patients (81%). Abnormal exercise electrocardiograms were present in 15 patients (58%). The combination of abnormal exercise thallium-201 scintigrams or exercise electrocardiograms (23/26, 88%) exceeded abnormal exercise electrocardiograms alone (15/26, 58%). The two procedures were thus complementary. Abnormal rest or exercise thallium-201 scintigrams were obtained in 25/26 patients (96%) compared with abnormal rest or exercise electrocardiograms in 21/26 patients (84%). Twenty patients with less than 50 per cent coronary stenosis had normal rest thallium-201 scintigrams and no Q waves. Two had abnormal exercise thallium-201 scintigrams and 7 had abnormal exercise electrocardiograms. Thus,exercise thallium scintigraphy has higher sensitivity than exercise electrocardiography in detecting exercise induced ischaemia and is more specific. Scintigraphy appears to have a higher sensitivity than electrocardiography in detecting coronary artery disease. (author)

  2. Clinical use of 201Tl myocardial scintigraphy

    International Nuclear Information System (INIS)

    Senda, Kohei; Imaeda, Takeyoshi; Kato, Toshimitsu; Asada, Shuichi; Doi, Hidetaka

    1977-01-01

    Myocardial imaging with 201 Tl and scinticamera was studied experimentally using specially designed phantoms and clinically in 23 patients with myocardial infarction or other heart disease. In the phantom experiment, quality of image, accumulative count rate, and detectability of the defect were compared to obtain the best technique for their detection, using four different collimators, i.e., converging, pin-hole, 4000-hole, and 140 keV high-resolution, at two photopeak levels of 201 Tl of 75 and 167 keV, and combining a radiation absorber. In patient examination, myocardial images taken at different periods after injection, different detecting conditions of the scinticamera, and various detecting projections were compared. Images of the converging collimator at the 75 keV photopeak revealed considerably higher accumulative counts and relatively higher quality than those of other detecting conditions. It was necessary to take as many images as possible in various projections, in order to detect the location and size of the myocardial ischemic lesion because the lesion was demonstrated as a clear defect only in profile. It became evident that images taken between about 25 and 90 min delineated the myocardium more clearly than those taken in other periods. Normal images taken in 8 patients without ischemic heart disease appeared in the shape of a doughnut of horseshoe, demonstrating mainly the left venticular myocardium. The image was faint in the region of the aortic or mitral valve and thin in the region of the apical wall. A faint image of the right ventricular myocardium was sometimes seen. In 3 patients with valvular heart disease, findings suggested changes in the thickness of myocardium and the distribution of coronary blood flow. In 11 of 12 patients with old myocardial infarction, the location and size of the lesion was detected. (Evans, J.)

  3. Rethinking mercury: the role of selenium in the pathophysiology of mercury toxicity.

    Science.gov (United States)

    Spiller, Henry A

    2018-05-01

    There is increasing evidence that the pathophysiological target of mercury is in fact selenium, rather than the covalent binding of mercury to sulfur in the body's ubiquitous sulfhydryl groups. The role of selenium in mercury poisoning is multifaceted, bidirectional, and central to understanding the target organ toxicity of mercury. An initial search was performed using Medline/PubMed, Toxline, Google Scholar, and Google for published work on mercury and selenium. These searches yielded 2018 citations. Publications that did not evaluate selenium status or evaluated environmental status (e.g., lake or ocean sediment) were excluded, leaving approximately 500 citations. This initial selection was scrutinized carefully and 117 of the most relevant and representative references were selected for use in this review. Binding of mercury to thiol/sulfhydryl groups: Mercury has a lower affinity for thiol groups and higher affinity for selenium containing groups by several orders of magnitude, allowing for binding in a multifaceted way. The established binding of mercury to thiol moieties appears to primarily involve the transport across membranes, tissue distribution, and enhanced excretion, but does not explain the oxidative stress, calcium dyshomeostasis, or specific organ injury seen with mercury. Effects of mercury on selenium and the role this plays in the pathophysiology of mercury toxicity: Mercury impairs control of intracellular redox homeostasis with subsequent increased intracellular oxidative stress. Recent work has provided convincing evidence that the primary cellular targets are the selenoproteins of the thioredoxin system (thioredoxin reductase 1 and thioredoxin reductase 2) and the glutathione-glutaredoxin system (glutathione peroxidase). Mercury binds to the selenium site on these proteins and permanently inhibits their function, disrupting the intracellular redox environment. A number of other important possible target selenoproteins have been identified

  4. Mercury pollution in Wuchuan mercury mining area, Guizhou, Southwestern China: the impacts from large scale and artisanal mercury mining.

    Science.gov (United States)

    Li, Ping; Feng, Xinbin; Qiu, Guangle; Shang, Lihai; Wang, Shaofeng

    2012-07-01

    To evaluate the environmental impacts from large scale mercury mining (LSMM) and artisanal mercury mining (AMM), total mercury (THg) and methyl mercury (MeHg) were determined in mine waste, ambient air, stream water and soil samples collected from Wuchuan mercury (Hg) mining area, Guizhou, Southwestern China. Mine wastes from both LSMM and AMM contained high THg concentrations, which are important Hg contamination sources to the local environment. Total gaseous mercury (TGM) concentrations in the ambient air near AMM furnaces were highly elevated, which indicated that AMM retorting is a major source of Hg emission. THg concentrations in the stream water varied from 43 to 2100 ng/L, where the elevated values were mainly found in the vicinity of AMM and mine waste heaps of LSMM. Surface soils were seriously contaminated with Hg, and land using types and organic matter played an important role in accumulation and transportation of Hg in soil. The results indicated heavy Hg contaminations in the study area, which were resulted from both LSMM and AMM. The areas impacted by LSMM were concentrated in the historical mining and smelting facilities, while Hg pollution resulted from AMM can be distributed anywhere in the Hg mining area. Copyright © 2011 Elsevier Ltd. All rights reserved.

  5. Mercury content in electrum from artisanal mining site of Mongolia

    Energy Technology Data Exchange (ETDEWEB)

    Murao, Satoshi [Geological Survey of Japan, AIST, Higashi 1-1-1, No. 7, Tsukuba 305-8567 (Japan)]. E-mail: s.murao@aist.go.jp; Naito, Kazuki [Geological Survey of Japan, AIST, Higashi 1-1-1, No. 7, Tsukuba 305-8567 (Japan); Dejidmaa, Gunchin [Geological Information Center, Mineral and Petroleum Resources Authority of Mongolia, State Building No. 5, Ulaanbaatar (Mongolia); Sie, Soey H. [CSIRO, P.O. Box 136, North Ryde, NSW 1670 (Australia)

    2006-08-15

    In Mongolia, artisanal gold mining, modern gold rush, in which people use mercury to extract gold, is being proliferated rapidly and the mercury contamination of mining site is becoming a serious social issue. For the risk assessment of mercury, it is necessary to understand how much mercury is introduced to the environment from what kind of materials during mining activity. It is already known that major contribution of the contamination comes from mercury that was bought at shops and brought to mining sites by miners. However, no information is available on how much mercury is removed from electrum (natural gold grain) to the environment. Since gold deposit is always accompanied by mercury anomaly, it is anticipated that electrum grains contain some amount of mercury of natural origin, and this mercury (primary mercury) contributes to some extent to the contamination. In order to clarify how much mercury is incorporated in electrum grains, micro-PIXE at CSIRO was used for grain-by-grain analysis. The result showed that electrum from study area contains mercury up to 8260 ppm. It is concluded that for the risk management of mercury contamination, release of natural mercury from electrum grains during smelting must not be ignored.

  6. Mercury content in electrum from artisanal mining site of Mongolia

    Science.gov (United States)

    Murao, Satoshi; Naito, Kazuki; Dejidmaa, Gunchin; Sie, Soey H.

    2006-08-01

    In Mongolia, artisanal gold mining, modern gold rush, in which people use mercury to extract gold, is being proliferated rapidly and the mercury contamination of mining site is becoming a serious social issue. For the risk assessment of mercury, it is necessary to understand how much mercury is introduced to the environment from what kind of materials during mining activity. It is already known that major contribution of the contamination comes from mercury that was bought at shops and brought to mining sites by miners. However, no information is available on how much mercury is removed from electrum (natural gold grain) to the environment. Since gold deposit is always accompanied by mercury anomaly, it is anticipated that electrum grains contain some amount of mercury of natural origin, and this mercury (primary mercury) contributes to some extent to the contamination. In order to clarify how much mercury is incorporated in electrum grains, micro-PIXE at CSIRO was used for grain-by-grain analysis. The result showed that electrum from study area contains mercury up to 8260 ppm. It is concluded that for the risk management of mercury contamination, release of natural mercury from electrum grains during smelting must not be ignored.

  7. Bioavailability and stability of mercury sulfide in Armuchee (USA) soil

    International Nuclear Information System (INIS)

    Han, Fengxiang; Shiyab, Safwan; Su, Yi; Monts, David L.; Waggoner, Charles A.; Matta, Frank B.

    2007-01-01

    Because of the adverse effects of elemental mercury and mercury compounds upon human health, the U.S. Department of Energy (DOE) is engaged in an on-going effort to monitor and remediate mercury-contaminated DOE sites. In order to more cost effectively implement those extensive remediation efforts, it is necessary to obtain an improved understanding of the role that mercury and mercury compounds play in the ecosystem. We have conducted pilot scale experiments to study the bioavailability of mercury sulfide in an Armuchee (eastern US ) soil. The effects of plants and incubation time on chemical stability and bioavailability of HgS under simulated conditions of the ecosystem have been examined, as has the dynamics of the dissolution of mercury sulfide by various extractants. The results show that mercury sulfide in contaminated Armuchee soil was still to some extent bioavailable to plants. After planting, soil mercury sulfide is more easily dissolved by both 4 M and 12 M nitric acid than pure mercury sulfide reagent. Dissolution kinetics of soil mercury sulfide and pure chemical reagent by nitric acid are different. Mercury release by EDTA from HgS-contaminated soil increased with time of reaction and soil mercury level. Chelating chemicals increase the solubility and bioavailability of mercury in HgS-contaminated soil. (authors)

  8. Mercury content in electrum from artisanal mining site of Mongolia

    International Nuclear Information System (INIS)

    Murao, Satoshi; Naito, Kazuki; Dejidmaa, Gunchin; Sie, Soey H.

    2006-01-01

    In Mongolia, artisanal gold mining, modern gold rush, in which people use mercury to extract gold, is being proliferated rapidly and the mercury contamination of mining site is becoming a serious social issue. For the risk assessment of mercury, it is necessary to understand how much mercury is introduced to the environment from what kind of materials during mining activity. It is already known that major contribution of the contamination comes from mercury that was bought at shops and brought to mining sites by miners. However, no information is available on how much mercury is removed from electrum (natural gold grain) to the environment. Since gold deposit is always accompanied by mercury anomaly, it is anticipated that electrum grains contain some amount of mercury of natural origin, and this mercury (primary mercury) contributes to some extent to the contamination. In order to clarify how much mercury is incorporated in electrum grains, micro-PIXE at CSIRO was used for grain-by-grain analysis. The result showed that electrum from study area contains mercury up to 8260 ppm. It is concluded that for the risk management of mercury contamination, release of natural mercury from electrum grains during smelting must not be ignored

  9. Environmental chemistry and toxicology of mercury

    National Research Council Canada - National Science Library

    Liu, Guangliang; Cai, Yong; O'Driscoll, Nelson J

    2012-01-01

    ... employed in recent studies. The coverage discusses the environmental behavior and toxicological effects of mercury on organisms, including humans, and provides case studies at the end of each chapter...

  10. Filter for isotopic alteration of mercury vapor

    Science.gov (United States)

    Grossman, Mark W.; George, William A.

    1989-01-01

    A filter for enriching the .sup.196 Hg content of mercury, including a reactor, a low pressure electric discharge lamp containing a fill of mercury and an inert gas. A filter is arranged concentrically around the lamp. The reactor is arranged around said filter, whereby radiation from said lamp passes through the filter and into said reactor. The lamp, the filter and the reactor are formed of quartz, and are transparent to ultraviolet light. The .sup.196 Hg concentration in the mercury fill is less than that which is present in naturally occurring mercury, that is less than about 0.146 atomic weight percent. Hydrogen is also included in the fill and serves as a quenching gas in the filter, the hydrogen also serving to prevent disposition of a dark coating on the interior of the filter.

  11. Chemistry of impact events on Mercury

    Science.gov (United States)

    Berezhnoy, Alexey A.

    2018-01-01

    Based on the equilibrium thermochemical approach and quenching theory, formation of molecules and dust grains in impact-produced clouds formed after collisions between meteoroids and Mercury is considered. Based on observations of Al, Fe, and Mn atoms in the exosphere of Mercury and new results of studies of the elemental composition of the surface of Mercury, quenching temperatures and pressures of main chemical reactions and condensation of dust particles were estimated. The behavior of the main Na-, K-, Ca-, Fe-, Al-, Mn-, Mg-, Si-, Ti, Ni-, Cr-, Co, Zn-, O-, H-, S-, C-, Cl-, N-, and P-containing species delivered to the Hermean exosphere during meteoroid impacts was studied. The importance of meteoroid bombardment as a source of Na, K, Ca, Fe, Al, Mn, Mg, and O atoms in the exosphere of Mercury is discussed.

  12. Mercury in the South African environment

    CSIR Research Space (South Africa)

    Matooane, M

    2009-11-01

    Full Text Available ? Mercury, also known as quick silver, is ubiquitous in the environment ? Uses - Medical: medicines, thermometers, dental amalgam, etc. - Manufacturing industry: batteries, gold mining, chlorine production, cement production, etc. - Personal care...

  13. Mercury sorbent delivery system for flue gas

    Science.gov (United States)

    Klunder,; Edgar, B [Bethel Park, PA

    2009-02-24

    The invention presents a device for the removal of elemental mercury from flue gas streams utilizing a layer of activated carbon particles contained within the filter fabric of a filter bag for use in a flue gas scrubbing system.

  14. Environmental chemistry and toxicology of mercury

    National Research Council Canada - National Science Library

    Liu, Guangliang; Cai, Yong; O'Driscoll, Nelson J

    2012-01-01

    .... Bringing together information normally spread across several books, this text is unique in covering the entire mercury cycle and providing a baseline for what is known and what uncertainties remain...

  15. 21 CFR Appendix A to Part 201 - Examples of Graphic Enhancements Used by FDA

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 4 2010-04-01 2010-04-01 false Examples of Graphic Enhancements Used by FDA A... (CONTINUED) DRUGS: GENERAL LABELING Pt. 201, App. A Appendix A to Part 201—Examples of Graphic Enhancements.... Examples of § 201.66 Standard Labeling and Modified Labeling Formats A. Section 201.66 Standard Labeling...

  16. 21 CFR 201.125 - Drugs for use in teaching, law enforcement, research, and analysis.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 4 2010-04-01 2010-04-01 false Drugs for use in teaching, law enforcement, research, and analysis. 201.125 Section 201.125 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF... § 201.125 Drugs for use in teaching, law enforcement, research, and analysis. A drug subject to § 201...

  17. Mercury and halogens in coal--Their role in determining mercury emissions from coal combustion

    Science.gov (United States)

    Kolker, Allan; Quick, Jeffrey C.; Senior, Connie L.; Belkin, Harvey E.

    2012-01-01

    Mercury is a toxic pollutant. In its elemental form, gaseous mercury has a long residence time in the atmosphere, up to a year, allowing it to be transported long distances from emission sources. Mercury can be emitted from natural sources such as volcanoes, or from anthropogenic sources, such as coal-fired powerplants. In addition, all sources of mercury on the Earth's surface can re-emit it from land and sea back to the atmosphere, from which it is then redeposited. Mercury in the atmosphere is present in such low concentrations that it is not considered harmful. Once mercury enters the aquatic environment, however, it can undergo a series of biochemical transformations that convert a portion of the mercury originally present to methylmercury, a highly toxic organic form of mercury that accumulates in fish and birds. Many factors contribute to creation of methylmercury in aquatic ecosystems, including mercury availability, sediment and nutrient load, bacterial influence, and chemical conditions. In the United States, consumption of fish with high levels of methylmercury is the most common pathway for human exposure to mercury, leading the U.S. Environmental Protection Agency (EPA) to issue fish consumption advisories in every State. The EPA estimates that 50 percent of the mercury entering the atmosphere in the United States is emitted from coal-burning utility powerplants. An EPA rule, known as MATS (for Mercury and Air Toxics Standards), to reduce emissions of mercury and other toxic pollutants from powerplants, was signed in December 2011. The rule, which is currently under review, specifies limits for mercury and other toxic elements, such as arsenic, chromium, and nickel. MATS also places limits on emission of harmful acid gases, such as hydrochloric acid and hydrofluoric acid. These standards are the result of a 2010 detailed nationwide program by the EPA to sample stack emissions and thousands of shipments of coal to coal-burning powerplants. The United

  18. Gamma radiation stability studies of mercury fulminate

    International Nuclear Information System (INIS)

    Fondeur, F.F.

    2000-01-01

    Mercury fulminate completely decomposed in a gamma source (0.86 Mrad/h) after a dose of 208 Mrad. This exposure equates to approximately 2.4 years in Tank 15H and 4 years in Tank 12H, one of the vessels of concern. Since the tanks lost the supernatant cover layer more than a decade ago, this study suggests that any mercury fulminate or closely related energetic species decomposed long ago if ever formed

  19. Gamma radiation stability studies of mercury fulminate

    Energy Technology Data Exchange (ETDEWEB)

    Fondeur, F.F.

    2000-02-17

    Mercury fulminate completely decomposed in a gamma source (0.86 Mrad/h) after a dose of 208 Mrad. This exposure equates to approximately 2.4 years in Tank 15H and 4 years in Tank 12H, one of the vessels of concern. Since the tanks lost the supernatant cover layer more than a decade ago, this study suggests that any mercury fulminate or closely related energetic species decomposed long ago if ever formed.

  20. Stratigraphy and geologic history of Mercury

    International Nuclear Information System (INIS)

    Spudis, P.D.; Guest, J.E.

    1988-01-01

    The geologic evolution of Mercury based on the Mariner-10 mission data is discussed. As reconstructed through photogeological analysis of global geologic relations of rock-stratigraphic units, Mercury's geologic history is shown to involve intensive early impact bombardment and widespread resurfacing by volcanic lavas. Evidence is presented to indicate that this volcanic activity essentially ended as much as 3 Gyr ago, with most of the major geologic events being completed within the first 1 to 1.5 Gyr of Mercurian history