WorldWideScience

Sample records for mercury 196

  1. Method of controlling the mercury vapor pressure in a photo-chemical lamp or vapor filter used for Hg196 enrichment

    International Nuclear Information System (INIS)

    Grossman, M.W.

    1993-01-01

    The present invention is directed to a method of eliminating the cold spot zones presently used on Hg 196 isotope separation lamps and filters by the use of a mercury amalgams, preferably mercury - indium amalgams. The use of an amalgam affords optimization of the mercury density in the lamp and filter of a mercury enrichment reactor, particularly multilamp enrichment reactors. Moreover, the use of an amalgam in such lamps and/or filters affords the ability to control the spectral line width of radiation emitted from lamps, a requirement for mercury enrichment

  2. Method of controlling the mercury vapor pressure in a photo-chemical lamp or vapor filter used for Hg.sup.196 enrichment

    Science.gov (United States)

    Grossman, Mark W.

    1993-01-01

    The present invention is directed to a method of eliminating the cold spot zones presently used on Hg.sup.196 isotope separation lamps and filters by the use of a mercury amalgams, preferably mercury - indium amalgams. The use of an amalgam affords optimization of the mercury density in the lamp and filter of a mercury enrichment reactor, particularly multilamp enrichment reactors. Moreover, the use of an amalgam in such lamps and/or filters affords the ability to control the spectral line width of radiation emitted from lamps, a requirement for mercury enrichment.

  3. Method of controlling the mercury vapor pressure in a photo-chemical lamp or vapor filter used for Hg[sup 196] enrichment

    Science.gov (United States)

    Grossman, M.W.

    1993-02-16

    The present invention is directed to a method of eliminating the cold spot zones presently used on Hg[sup 196] isotope separation lamps and filters by the use of a mercury amalgams, preferably mercury - indium amalgams. The use of an amalgam affords optimization of the mercury density in the lamp and filter of a mercury enrichment reactor, particularly multilamp enrichment reactors. Moreover, the use of an amalgam in such lamps and/or filters affords the ability to control the spectral line width of radiation emitted from lamps, a requirement for mercury enrichment.

  4. Filter for isotopic alteration of mercury vapor

    Science.gov (United States)

    Grossman, Mark W.; George, William A.

    1989-01-01

    A filter for enriching the .sup.196 Hg content of mercury, including a reactor, a low pressure electric discharge lamp containing a fill of mercury and an inert gas. A filter is arranged concentrically around the lamp. The reactor is arranged around said filter, whereby radiation from said lamp passes through the filter and into said reactor. The lamp, the filter and the reactor are formed of quartz, and are transparent to ultraviolet light. The .sup.196 Hg concentration in the mercury fill is less than that which is present in naturally occurring mercury, that is less than about 0.146 atomic weight percent. Hydrogen is also included in the fill and serves as a quenching gas in the filter, the hydrogen also serving to prevent disposition of a dark coating on the interior of the filter.

  5. Apparatus for isotopic alteration of mercury vapor

    International Nuclear Information System (INIS)

    Grossman, M.W.; George, W.A.; Marcucci, R.V.

    1988-01-01

    This patent describes an apparatus for enriching the isotopic content of mercury. It comprises: a low pressure electric discharge lamp, the lamp comprising an envelope transparent to ultraviolet radiation and containing a fill comprising mercury and an inert gas; a filter concentrically arranged around the low pressure electric discharge lamp, the filter being transparent to ultraviolet radiation and containing mercury including 196 Hg isotope; means for controlling mercury pressure in the filter; and a reactor arranged around the filter such that radiation passes from the low pressure electric discharge lamp through the filter and into Said reactor, the reactor being transparent to ultraviolet light

  6. Apparatus for mercury refinement

    International Nuclear Information System (INIS)

    Grossman, M.W.; Speer, R.; George, W.A.

    1991-01-01

    The effluent from mercury collected during the photochemical separation of the 196 Hg isotope is often contaminated with particulate mercurous chloride, Hg 2 Cl 2 . The use of mechanical filtering via thin glass tubes, ultrasonic rinsing with acetone (dimethyl ketone) and a specially designed cold trap have been found effective in removing the particulate (i.e., solid) Hg 2 Cl 2 contaminant. The present invention is particularly directed to such filtering. 5 figures

  7. Method for mercury refinement

    International Nuclear Information System (INIS)

    Grossman, M.W.; Speer, R.; George, W.A.

    1991-01-01

    The effluent from mercury collected during the photochemical separation of the 196 Hg isotope is often contaminated with particulate mercurous chloride, Hg 2 Cl 2 . The use of mechanical filtering via thin glass tubes, ultrasonic rinsing with acetone (dimethyl ketone) and a specially designed cold trap have been found effective in removing the particulate (i.e., solid) Hg 2 Cl 2 contaminant. The present invention is particularly directed to such filtering. 5 figures

  8. Method for mercury refinement

    Science.gov (United States)

    Grossman, M.W.; Speer, R.; George, W.A.

    1991-04-09

    The effluent from mercury collected during the photochemical separation of the [sup 196]Hg isotope is often contaminated with particulate mercurous chloride, Hg[sub 2]Cl[sub 2]. The use of mechanical filtering via thin glass tubes, ultrasonic rinsing with acetone (dimethyl ketone) and a specially designed cold trap have been found effective in removing the particulate (i.e., solid) Hg[sub 2]Cl[sub 2] contaminant. The present invention is particularly directed to such filtering. 5 figures.

  9. Apparatus for mercury refinement

    Science.gov (United States)

    Grossman, M.W.; Speer, R.; George, W.A.

    1991-07-16

    The effluent from mercury collected during the photochemical separation of the [sup 196]Hg isotope is often contaminated with particulate mercurous chloride, Hg[sub 2]Cl[sub 2]. The use of mechanical filtering via thin glass tubes, ultrasonic rinsing with acetone (dimethyl ketone) and a specially designed cold trap have been found effective in removing the particulate (i.e., solid) Hg[sub 2]Cl[sub 2] contaminant. The present invention is particularly directed to such filtering. 5 figures.

  10. Investigation of mercury-containing proteins by enriched stable isotopic tracer and size-exclusion chromatography hyphenated to inductively coupled plasma-isotope dilution mass spectrometry

    Energy Technology Data Exchange (ETDEWEB)

    Shi Junwen [Laboratory for Bio-Environmental Health Sciences of Nanoscale Materials and Key Laboratory of Nuclear Analytical Techniques, Institute of High Energy Physics, Chinese Academy of Sciences, Beijing 100049 (China)]|[Graduate School of the Chinese Academy of Sciences, Beijing 100049 (China); Feng Weiyue [Laboratory for Bio-Environmental Health Sciences of Nanoscale Materials and Key Laboratory of Nuclear Analytical Techniques, Institute of High Energy Physics, Chinese Academy of Sciences, Beijing 100049 (China)]. E-mail: fengwy@mail.ihep.ac.cn; Wang Meng [Laboratory for Bio-Environmental Health Sciences of Nanoscale Materials and Key Laboratory of Nuclear Analytical Techniques, Institute of High Energy Physics, Chinese Academy of Sciences, Beijing 100049 (China)]|[Graduate School of the Chinese Academy of Sciences, Beijing 100049 (China); Zhang Fang [Graduate School of the Chinese Academy of Sciences, Beijing 100049 (China); Li Bai [Laboratory for Bio-Environmental Health Sciences of Nanoscale Materials and Key Laboratory of Nuclear Analytical Techniques, Institute of High Energy Physics, Chinese Academy of Sciences, Beijing 100049 (China); Wang Bing; Zhu Motao [Laboratory for Bio-Environmental Health Sciences of Nanoscale Materials and Key Laboratory of Nuclear Analytical Techniques, Institute of High Energy Physics, Chinese Academy of Sciences, Beijing 100049 (China)]|[Graduate School of the Chinese Academy of Sciences, Beijing 100049 (China); Chai Zhifang [Laboratory for Bio-Environmental Health Sciences of Nanoscale Materials and Key Laboratory of Nuclear Analytical Techniques, Institute of High Energy Physics, Chinese Academy of Sciences, Beijing 100049 (China)]|[Institute of Nuclear Technology, Shenzhen University, Shenzhen 518060 (China)]|[Institute of Nanochemistry and Nanosafety, Shanghai University, Shanghai (China)

    2007-01-30

    In order to investigate trace mercury-containing proteins in maternal rat and their offspring, a method of enriched stable isotopic tracer ({sup 196}Hg and {sup 198}Hg) combined with size-exclusion chromatography (SEC) coupled to inductively coupled plasma-isotope dilution mass spectrometry (ICP-IDMS) was developed. Prior to the analysis, {sup 196}Hg- and {sup 198}Hg-enriched methylmercury was administrated to the pregnant rats. Then the mercury-containing proteins in serum and brain cytosol of the dam and pup rats were separated by size-exclusion columns and the mercury was detected by ICP-MS. The ICP-MS spectrogram of the tracing samples showed significantly elevated {sup 196}Hg and {sup 198}Hg isotopic signals compared with the natural ones, indicating that the detection sensitivity could be increased by the tracer method. The contents of mercury in chromatographic fractions of the dam and pup rat brain cytosol were quantitatively estimated by post-column reverse ID-ICP-MS. The quantitative speciation differences of mercury in brain cytosol between the dam and pup rats were observed, indicating that such studies could be useful for toxicological estimation. Additionally, the isotopic ratio measurement of {sup 198}Hg/{sup 202}Hg in the tracing samples could be used to identify the artifact mercury species caused in the analytical procedure. The study demonstrates that the tracer method combined with high-performance liquid chromatography (HPLC)-ICP-IDMS could provide reliably qualitative and quantitative information on mercury-containing proteins in organisms.

  11. Investigation of mercury-containing proteins by enriched stable isotopic tracer and size-exclusion chromatography hyphenated to inductively coupled plasma-isotope dilution mass spectrometry

    International Nuclear Information System (INIS)

    Shi Junwen; Feng Weiyue; Wang Meng; Zhang Fang; Li Bai; Wang Bing; Zhu Motao; Chai Zhifang

    2007-01-01

    In order to investigate trace mercury-containing proteins in maternal rat and their offspring, a method of enriched stable isotopic tracer ( 196 Hg and 198 Hg) combined with size-exclusion chromatography (SEC) coupled to inductively coupled plasma-isotope dilution mass spectrometry (ICP-IDMS) was developed. Prior to the analysis, 196 Hg- and 198 Hg-enriched methylmercury was administrated to the pregnant rats. Then the mercury-containing proteins in serum and brain cytosol of the dam and pup rats were separated by size-exclusion columns and the mercury was detected by ICP-MS. The ICP-MS spectrogram of the tracing samples showed significantly elevated 196 Hg and 198 Hg isotopic signals compared with the natural ones, indicating that the detection sensitivity could be increased by the tracer method. The contents of mercury in chromatographic fractions of the dam and pup rat brain cytosol were quantitatively estimated by post-column reverse ID-ICP-MS. The quantitative speciation differences of mercury in brain cytosol between the dam and pup rats were observed, indicating that such studies could be useful for toxicological estimation. Additionally, the isotopic ratio measurement of 198 Hg/ 202 Hg in the tracing samples could be used to identify the artifact mercury species caused in the analytical procedure. The study demonstrates that the tracer method combined with high-performance liquid chromatography (HPLC)-ICP-IDMS could provide reliably qualitative and quantitative information on mercury-containing proteins in organisms

  12. Novel methodology for the study of mercury methylation and reduction in sediments and water using 197Hg radiotracer

    International Nuclear Information System (INIS)

    Ribeiro Guevara, Sergio; Perez Catan, Soledad; Zizek, Suzana; Repinc, Urska; Jacimovic, Radojko; Horvat, Milena

    2007-01-01

    Mercury tracers are powerful tools that can be used to study mercury transformations in environmental systems, particularly mercury methylation, demethylation and reduction in sediments and water. However, mercury transformation studies using tracers can be subject to error, especially when used to assess methylation potential. The organic mercury extracted can be as low as 0.01% of the endogenous labeled mercury, and artefacts and contamination present during methylmercury (MeHg) extraction processes can cause interference. Solvent extraction methods based on the use of either KBr/H 2 SO 4 or HCl were evaluated in freshwater sediments using 197 Hg radiotracer. Values obtained for the 197 Hg tracer in the organic phase were up to 25-fold higher when HCl was used, which is due to the coextraction of 197 Hg 2+ into the organic phase during MeHg extraction. Evaluations of the production of MeHg gave similar results with both MeHg extraction procedures, but due to the higher Hg 2+ contamination of the controls, the uncertainty in the determination was higher when HCl was used. The Hg 2+ contamination of controls in the HCl extraction method showed a nonlinear correlation with the humic acid content of sediment pore water. Therefore, use of the KBr/H 2 SO 4 method is recommended, since it is free from these interferences. 197 Hg radiotracer (T 1/2 = 2.673 d) has a production rate that is about 50 times higher than that of 203 Hg (T 1/2 46.595 d), the most frequently used mercury radiotracer. Hence it is possible to obtain a similar level of performance to 203 Hg when it is used it in short-term experiments and produced by the irradiation of 196 Hg with thermal neutrons, using mercury targets with the natural isotopic composition. However, if the 0.15% natural abundance of the 196 Hg isotope is increased, the specific activity of the 197 Hg tracer can be significantly improved. In the present work, 197 Hg tracer was produced from mercury 51.58% enriched in the 196 Hg

  13. Application of atomic vapor laser isotope separation to the enrichment of mercury

    International Nuclear Information System (INIS)

    Crane, J.K.; Erbert, G.V.; Paisner, J.A.; Chen, H.L.; Chiba, Z.; Beeler, R.G.; Combs, R.; Mostek, S.D.

    1986-09-01

    Workers at GTE/Sylvania have shown that the efficiency of fluorescent lighting may be markedly improved using mercury that has been enriched in the 196 Hg isotope. A 5% improvement in the efficiency of fluorescent lighting in the United States could provide a savings of ∼ 1 billion dollars in the corresponding reduction of electrical power consumption. We will discuss the results of recent work done at our laboratory to develop a process for enriching mercury. The discussion will center around the results of spectroscopic measurements of excited state lifetimes, photoionization cross sections and isotope shifts. In addition, we will discuss the mercury separator and supporting laser mesurements of the flow properties of mercury vapor. We will describe the laser system which will provide the photoionization and finally discuss the economic details of producing enriched mercury at a cost that would be attractive to the lighting industry

  14. Application of atomic vapor laser isotope separation to the enrichment of mercury

    International Nuclear Information System (INIS)

    Crane, J.; Erbert, G.; Paisner, J.; Chen, H.; Chiba, Z.; Beeler, R.; Combs, R.; Mostek, S.

    1986-09-01

    Workers at GTE/Sylvania have shown that the efficiency of fluorescent lighting may be markedly improved using mercury that has been enriched in the 196 Hg isotope. A 5% improvement in the efficiency of fluorescent lighting in the United States could provide a savings of $450 million dollars in the corresponding reduction of electrical power consumption. We discuss the results of recent work done at our laboratory to develop a process for enriching mercury. The discussion centers around the results of spectroscopic measurements of excited-state lifetimes, photoionization cross sections, and isotope shifts

  15. Novel methodology for the study of mercury methylation and reduction in sediments and water using {sup 197}Hg radiotracer

    Energy Technology Data Exchange (ETDEWEB)

    Ribeiro Guevara, Sergio; Perez Catan, Soledad [Centro Atomico Bariloche, Laboratorio de Analisis por Activacion Neutronica, Bariloche (Argentina); Zizek, Suzana; Repinc, Urska; Jacimovic, Radojko; Horvat, Milena [Jozef Stefan Institute, Department of Environmental Sciences, Ljubljana (Slovenia)

    2007-03-15

    Mercury tracers are powerful tools that can be used to study mercury transformations in environmental systems, particularly mercury methylation, demethylation and reduction in sediments and water. However, mercury transformation studies using tracers can be subject to error, especially when used to assess methylation potential. The organic mercury extracted can be as low as 0.01% of the endogenous labeled mercury, and artefacts and contamination present during methylmercury (MeHg) extraction processes can cause interference. Solvent extraction methods based on the use of either KBr/H{sub 2}SO{sub 4} or HCl were evaluated in freshwater sediments using {sup 197}Hg radiotracer. Values obtained for the {sup 197}Hg tracer in the organic phase were up to 25-fold higher when HCl was used, which is due to the coextraction of {sup 197}Hg{sup 2+} into the organic phase during MeHg extraction. Evaluations of the production of MeHg gave similar results with both MeHg extraction procedures, but due to the higher Hg{sup 2+} contamination of the controls, the uncertainty in the determination was higher when HCl was used. The Hg{sup 2+} contamination of controls in the HCl extraction method showed a nonlinear correlation with the humic acid content of sediment pore water. Therefore, use of the KBr/H{sub 2}SO{sub 4} method is recommended, since it is free from these interferences. {sup 197}Hg radiotracer (T{sub 1/2} = 2.673 d) has a production rate that is about 50 times higher than that of {sup 203}Hg (T{sub 1/2} = 46.595 d), the most frequently used mercury radiotracer. Hence it is possible to obtain a similar level of performance to {sup 203}Hg when it is used it in short-term experiments and produced by the irradiation of {sup 196}Hg with thermal neutrons, using mercury targets with the natural isotopic composition. However, if the 0.15% natural abundance of the {sup 196}Hg isotope is increased, the specific activity of the {sup 197}Hg tracer can be significantly improved. In

  16. 32 CFR 196.310 - Recruitment.

    Science.gov (United States)

    2010-07-01

    ... 32 National Defense 2 2010-07-01 2010-07-01 false Recruitment. 196.310 Section 196.310 National... Discrimination on the Basis of Sex in Admission and Recruitment Prohibited § 196.310 Recruitment. (a) Nondiscriminatory recruitment. A recipient to which §§ 196.300 through 196.310 apply shall not discriminate on the...

  17. 32 CFR 196.405 - Housing.

    Science.gov (United States)

    2010-07-01

    ... 32 National Defense 2 2010-07-01 2010-07-01 false Housing. 196.405 Section 196.405 National... Discrimination on the Basis of Sex in Education Programs or Activities Prohibited § 196.405 Housing. (a... different fees or requirements, or offer different services or benefits related to housing, except as...

  18. 32 CFR 196.500 - Employment.

    Science.gov (United States)

    2010-07-01

    ... 32 National Defense 2 2010-07-01 2010-07-01 false Employment. 196.500 Section 196.500 National... Discrimination on the Basis of Sex in Employment in Education Programs or Activities Prohibited § 196.500 Employment. (a) General. (1) No person shall, on the basis of sex, be excluded from participation in, be...

  19. Mercury Production and Use in Colonial Andean Silver Production: Emissions and Health Implications

    Science.gov (United States)

    Hagan, Nicole A.

    2012-01-01

    Background: Colonial cinnabar mining and refining began in Huancavelica, Peru, in 1564. With a local source of mercury, the amalgamation process was adopted to refine silver in Potosí, Bolivia, in the early 1570s. As a result, large quantities of mercury were released into the environment. Objectives: We used archival, primary, and secondary sources to develop the first estimate of mercury emissions from cinnabar refining in Huancavelica and to revise previous estimates of emissions from silver refining in Potosí during the colonial period (1564–1810). Discussion: Although other estimates of historical mercury emissions have recognized Potosí as a significant source, Huancavelica has been overlooked. In addition, previous estimates of mercury emissions from silver refining under-estimated emissions because of unrecorded (contra-band) production and volatilization of mercury during processing and recovery. Archival descriptions document behavioral and health issues during the colonial period that are consistent with known effects of mercury intoxication. Conclusions: According to our calculations, between 1564 and 1810, an estimated 17,000 metric tons of mercury vapor were emitted from cinnabar smelting in Huancavelica, and an estimated 39,000 metric tons were released as vapor during silver refining operations in Potosí. Huancavelica and Potosí combined contributed > 25% of the 196,000 metric tons of mercury vapor emissions in all of Latin America between 1500 and 1800. The historical record is laden with evidence of mercury intoxication consistent with effects recognized today. Our estimates serve as the foundation of investigations of present-day contamination in Huancavelica and Potosí resulting from historical emissions of mercury. PMID:22334094

  20. Novel methodology for the study of mercury methylation and reduction in sediments and water using 197Hg radiotracer.

    Science.gov (United States)

    Ribeiro Guevara, Sergio; Zizek, Suzana; Repinc, Urska; Pérez Catán, Soledad; Jaćimović, Radojko; Horvat, Milena

    2007-03-01

    Mercury tracers are powerful tools that can be used to study mercury transformations in environmental systems, particularly mercury methylation, demethylation and reduction in sediments and water. However, mercury transformation studies using tracers can be subject to error, especially when used to assess methylation potential. The organic mercury extracted can be as low as 0.01% of the endogenous labeled mercury, and artefacts and contamination present during methylmercury (MeHg) extraction processes can cause interference. Solvent extraction methods based on the use of either KBr/H2SO4 or HCl were evaluated in freshwater sediments using 197Hg radiotracer. Values obtained for the 197Hg tracer in the organic phase were up to 25-fold higher when HCl was used, which is due to the coextraction of 197Hg2+ into the organic phase during MeHg extraction. Evaluations of the production of MeHg gave similar results with both MeHg extraction procedures, but due to the higher Hg2+ contamination of the controls, the uncertainty in the determination was higher when HCl was used. The Hg2+ contamination of controls in the HCl extraction method showed a nonlinear correlation with the humic acid content of sediment pore water. Therefore, use of the KBr/H2SO4 method is recommended, since it is free from these interferences. 197Hg radiotracer (T1/2=2.673 d) has a production rate that is about 50 times higher than that of 203Hg (T1/2=46.595 d), the most frequently used mercury radiotracer. Hence it is possible to obtain a similar level of performance to 203Hg when it is used it in short-term experiments and produced by the irradiation of 196Hg with thermal neutrons, using mercury targets with the natural isotopic composition. However, if the 0.15% natural abundance of the 196Hg isotope is increased, the specific activity of the 197Hg tracer can be significantly improved. In the present work, 197Hg tracer was produced from mercury 51.58% enriched in the 196Hg isotope, and a 340-fold

  1. 22 CFR 196.4 - Administering office.

    Science.gov (United States)

    2010-04-01

    ... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Administering office. 196.4 Section 196.4... AFFAIRS/GRADUATE FOREIGN AFFAIRS FELLOWSHIP PROGRAM § 196.4 Administering office. The Department of State's Bureau of Human Resources, Office of Recruitment is responsible for administering the Thomas R...

  2. Dicty_cDB: VSK196 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VS (Link to library) VSK196 (Link to dictyBase) - - - Contig-U10274-1 VSK196P (Link... to Original site) VSK196F 423 VSK196Z 453 VSK196P 876 - - Show VSK196 Library VS (Link to library) Clone ID VSK196 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U10274-1 Original site URL http://dict...TTATNAACAATTAAAAAAAA sequence update 2001. 3.22 Translated Amino Acid sequence kdgklvslkdfikdqkpivlyfypkdetsict...*NKIX--- ---KLKVGDQAPDFTCPDKDGKLVSLKDFIKDQKPIVLYFYPKDETSICTKEACEFRDKY QKFIEAGADVI

  3. 32 CFR 196.525 - Fringe benefits.

    Science.gov (United States)

    2010-07-01

    ... 32 National Defense 2 2010-07-01 2010-07-01 false Fringe benefits. 196.525 Section 196.525... Prohibited § 196.525 Fringe benefits. (a) “Fringe benefits” defined. For purposes of these Title IX regulations, fringe benefits means: Any medical, hospital, accident, life insurance, or retirement benefit...

  4. 21 CFR 211.196 - Distribution records.

    Science.gov (United States)

    2010-04-01

    ...: GENERAL CURRENT GOOD MANUFACTURING PRACTICE FOR FINISHED PHARMACEUTICALS Records and Reports § 211.196 Distribution records. Distribution records shall contain the name and strength of the product and description... 21 Food and Drugs 4 2010-04-01 2010-04-01 false Distribution records. 211.196 Section 211.196 Food...

  5. 46 CFR 196.15-10 - Sanitation.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 7 2010-10-01 2010-10-01 false Sanitation. 196.15-10 Section 196.15-10 Shipping COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) OCEANOGRAPHIC RESEARCH VESSELS OPERATIONS Test, Drills, and Inspections § 196.15-10 Sanitation. (a) It shall be the duty of the master and chief engineer...

  6. Mercury

    International Nuclear Information System (INIS)

    Vilas, F.; Chapman, C.R.; Matthews, M.S.

    1988-01-01

    Papers are presented on future observations of and missions to Mercury, the photometry and polarimetry of Mercury, the surface composition of Mercury from reflectance spectrophotometry, the Goldstone radar observations of Mercury, the radar observations of Mercury, the stratigraphy and geologic history of Mercury, the geomorphology of impact craters on Mercury, and the cratering record on Mercury and the origin of impacting objects. Consideration is also given to the tectonics of Mercury, the tectonic history of Mercury, Mercury's thermal history and the generation of its magnetic field, the rotational dynamics of Mercury and the state of its core, Mercury's magnetic field and interior, the magnetosphere of Mercury, and the Mercury atmosphere. Other papers are on the present bounds on the bulk composition of Mercury and the implications for planetary formation processes, the building stones of the planets, the origin and composition of Mercury, the formation of Mercury from planetesimals, and theoretical considerations on the strange density of Mercury

  7. Nuclear Data Sheets for A = 196

    International Nuclear Information System (INIS)

    Huang Xiaolong

    2007-01-01

    The 1998 version of nuclear data sheets for A = 196 has been revised and updated on the basis of the experimental results from various decay and reaction studies before January 2006. The experimental data for all known nuclei of A = 196 (Os,Ir,Pt,Au,Hg, Tl,Pb,Bi,Po,At,Rn) have been reevaluated. The experimental methods, references,Jπ arguments,and necessary comments are given in the text. Summary band structure drawings and level schemes from both radioactive decay and reaction studies are presented. Also of special interest are the new identification of superdeformed bands in 196 Pb and 196 Bi

  8. 32 CFR 196.540 - Advertising.

    Science.gov (United States)

    2010-07-01

    ... 32 National Defense 2 2010-07-01 2010-07-01 false Advertising. 196.540 Section 196.540 National Defense Department of Defense (Continued) OFFICE OF THE SECRETARY OF DEFENSE (CONTINUED) MISCELLANEOUS... Advertising. A recipient shall not in any advertising related to employment indicate preference, limitation...

  9. Contribution to the structure study of mercury isotopes with the (p,d) reaction

    International Nuclear Information System (INIS)

    Grafeuille, S.

    1985-10-01

    The mercury isotopes were studied by means of the two pick-up reactions (p,d) and (p,t). Enriched targets of 204 Hg, 202 Hg, 201 Hg, 200 Hg, 199 Hg, 198 Hg and 196 Hg were bombarded by a 25 MeV proton beam from the Orsay MP tandem accelerator. Emitted particles were analyzed by a split-pole magnetic spectrometer. We present all the results (nearly 150 states) of the analysis of the (p,d) reactions. Our (p,d) and (p,t) study show new discontinuities around 200 Hg in systematics of mercury isotopes. Part of the results are compared to the U(5) limits of Interacting Bosons (and Fermions) Models. The light nuclei can be considered reasonably described but this could be somewhat fortuitous. (71 refs) [fr

  10. Measurement of mercury isotopic ratio in stone meteorites by neutron activation analysis

    International Nuclear Information System (INIS)

    Thakur, A.N.

    1997-01-01

    196 Hg and 202 Hg isotopes have been measured by neutron activation analysis in samples of twelve stone meteorites. Hg is extracted from an irradiated sample by stepwise heating. The mercury concentrations vary from 0.07 to 33 ppm. While most of the samples give 196 Hg/ 202 Hg ratios similar to terrestrial value within error limits, in some cases large anomalies are observed. A number of control experiments have been devised, that show the absence of experimental artifacts, during sample preparation, neutron irradiation, chemical separation and counting stages. Several anomalous and normal Hg distillate have been re-irradiated as Hg-diethyl-dithio-carbamate complex to eliminate the influence of neutron self shielding and interfering reactions from matrix elements. The isotopic ratio patterns persist in the distillates too proving that any artifacts during meteorite irradiation and measurement are essentially absent. Both positive and negative anomalies are observed: however, the negative anomalies are much more frequent and abundant. In an extreme case of fine grained magnetic particles of Ambapur Nagla the 196 Hg is apparently absent in the Hg released at 100 deg C. A 2σ 196 Hg/ 202 Hg value is only 6% relative to the monitor. This experiment shows the robustness of neutron activation analysis and suggest some constrains on the formation history of stone meteorites. (author)

  11. 32 CFR 196.510 - Recruitment.

    Science.gov (United States)

    2010-07-01

    ... 32 National Defense 2 2010-07-01 2010-07-01 false Recruitment. 196.510 Section 196.510 National... Recruitment. (a) Nondiscriminatory recruitment and hiring. A recipient shall not discriminate on the basis of sex in the recruitment and hiring of employees. Where a recipient has been found to be presently...

  12. 46 CFR 196.40-5 - Hull markings.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 7 2010-10-01 2010-10-01 false Hull markings. 196.40-5 Section 196.40-5 Shipping COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) OCEANOGRAPHIC RESEARCH VESSELS OPERATIONS Markings on Vessels § 196.40-5 Hull markings. Vessels shall be marked as required by parts 67 and 69 of this chapter...

  13. Dicty_cDB: VFI196 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VF (Link to library) VFI196 (Link to dictyBase) - - - Contig-U16512-1 - (Link to Or...iginal site) - - VFI196Z 168 - - - - Show VFI196 Library VF (Link to library) Clone ID VFI196 (Link to dicty...Base) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16512-1 Original site URL http://dictycdb.b...ces. 40 8.8 1 CK407044 |CK407044.1 AUF_IfLvr_212_p04 Ictalurus furcatus liver cDNA library Ictalurus furcatu...%: nuclear 36.0 %: mitochondrial 16.0 %: cytoplasmic 4.0 %: cytoskeletal >> prediction for VFI196 is nuc 5'

  14. Mercury Report-Children's exposure to elemental mercury

    Science.gov (United States)

    ... gov . Mercury Background Mercury Report Additional Resources Mercury Report - Children's Exposure to Elemental Mercury Recommend on Facebook ... I limit exposure to mercury? Why was the report written? Children attending a daycare in New Jersey ...

  15. 32 CFR 196.520 - Job classification and structure.

    Science.gov (United States)

    2010-07-01

    ... 32 National Defense 2 2010-07-01 2010-07-01 false Job classification and structure. 196.520 Section 196.520 National Defense Department of Defense (Continued) OFFICE OF THE SECRETARY OF DEFENSE... Activities Prohibited § 196.520 Job classification and structure. A recipient shall not: (a) Classify a job...

  16. 27 CFR 28.196 - Consignment, shipment, and delivery.

    Science.gov (United States)

    2010-04-01

    ... delivery. 28.196 Section 28.196 Alcohol, Tobacco Products and Firearms ALCOHOL AND TOBACCO TAX AND TRADE... Benefit of Drawback Filing of Notice and Removal § 28.196 Consignment, shipment, and delivery. The consignment, shipment, and delivery of distilled spirits removed under this subpart for export, use on vessels...

  17. Short-time variation of mercury speciation in the urban of Goteborg during GOTE-2005

    Energy Technology Data Exchange (ETDEWEB)

    Li, J.; Sommar, J.; Wangberg, I.; Lindqvist, O.; Wei, S.Q. [Southwest University, Chongqing (China). College of Resources and Environment

    2008-11-15

    Mercury species samples for gaseous elemental mercury (GEM) with a temporal resolution of 5 min, 5 h and 20 min integrated measurements of reactive gaseous mercury (RGM), and 24-h sampling of particulate mercury (HgP) at urban Femman and total gaseous mercury (TGM) at rural Rorvik were conducted during the measurement campaign GOTE-2005 in Goteborg, Sweden. Results showed that average concentrations for GEM, RGM, HgP and TGM were 1.96 {+-} 0.38 ng m{sup -3}, 2.53 {+-} 4.09 pg m{sup -3}, 12.50 {+-} 5.88 pg m{sup -3} and 1.63 {+-} 0.19 ng m{sup -3}, respectively. A reverse diurnal distribution pattern between GEM and RGM was observed, and early morning GEM concentration was elevated compared to daytime values which was likely due to activation of fossil fuel combustion, electric utilities, etc., by the formation of a nighttime inversion layer, less activity of GEM and reduced mixing. The subsequent decline and afternoon minimum were likely related to increase vertical mixing, photochemical reaction, and coupling with the coal combustion. However, the photochemical conversion from GEM during daytime and nocturnal behavior of 'sticky' gases under higher relative humidity may result in strong diurnal cycles for RGM. Sampling site was heavily affected by anthropogenic sources from two distinguished wind sectors. One was ESE-SSW sector which was likely impacted by long distance transport from south highly industrialized region; the other was likely tied with local sources from N-NE sector.

  18. Mercury

    Science.gov (United States)

    Mercury is an element that is found in air, water and soil. It has several forms. Metallic mercury is a shiny, silver-white, odorless liquid. If ... with other elements to form powders or crystals. Mercury is in many products. Metallic mercury is used ...

  19. 32 CFR 196.410 - Comparable facilities.

    Science.gov (United States)

    2010-07-01

    ... 32 National Defense 2 2010-07-01 2010-07-01 false Comparable facilities. 196.410 Section 196.410....410 Comparable facilities. A recipient may provide separate toilet, locker room, and shower facilities on the basis of sex, but such facilities provided for students of one sex shall be comparable to such...

  20. 46 CFR 196.37-47 - Portable magazine chests.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 7 2010-10-01 2010-10-01 false Portable magazine chests. 196.37-47 Section 196.37-47... Markings for Fire and Emergency Equipment, etc. § 196.37-47 Portable magazine chests. (a) Portable magazine chests shall be marked in letters at least 3 inches high: PORTABLE MAGAZINE CHEST — FLAMMABLE — KEEP...

  1. 46 CFR 196.95-1 - Pilot boarding operations.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 7 2010-10-01 2010-10-01 false Pilot boarding operations. 196.95-1 Section 196.95-1... Pilot Boarding Operations § 196.95-1 Pilot boarding operations. (a) The master shall ensure that pilot boarding equipment is maintained as follows: (1) The equipment must be kept clean and in good working order...

  2. 46 CFR 196.37-9 - Carbon dioxide alarm.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 7 2010-10-01 2010-10-01 false Carbon dioxide alarm. 196.37-9 Section 196.37-9 Shipping... Markings for Fire and Emergency Equipment, etc. § 196.37-9 Carbon dioxide alarm. (a) All carbon dioxide alarms shall be conspicuously identified: “WHEN ALARM SOUNDS—VACATE AT ONCE. CARBON DIOXIDE BEING...

  3. 46 CFR 196.30-5 - Accidents to machinery.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 7 2010-10-01 2010-10-01 false Accidents to machinery. 196.30-5 Section 196.30-5... Reports of Accidents, Repairs, and Unsafe Equipment § 196.30-5 Accidents to machinery. (a) In the event of an accident to a boiler, unfired pressure vessel, or machinery tending to render the further use of...

  4. Got Mercury?

    Science.gov (United States)

    Meyers, Valerie E.; McCoy, J. Torin; Garcia, Hector D.; James, John T.

    2009-01-01

    Many of the operational and payload lighting units used in various spacecraft contain elemental mercury. If these devices were damaged on-orbit, elemental mercury could be released into the cabin. Although there are plans to replace operational units with alternate light sources, such as LEDs, that do not contain mercury, mercury-containing lamps efficiently produce high quality illumination and may never be completely replaced on orbit. Therefore, exposure to elemental mercury during spaceflight will remain possible and represents a toxicological hazard. Elemental mercury is a liquid metal that vaporizes slowly at room temperature. However, it may be completely vaporized at the elevated operating temperatures of lamps. Although liquid mercury is not readily absorbed through the skin or digestive tract, mercury vapors are efficiently absorbed through the respiratory tract. Therefore, the amount of mercury in the vapor form must be estimated. For mercury releases from lamps that are not being operated, we utilized a study conducted by the New Jersey Department of Environmental Quality to calculate the amount of mercury vapor expected to form over a 2-week period. For longer missions and for mercury releases occurring when lamps are operating, we conservatively assumed complete volatilization of the available mercury. Because current spacecraft environmental control systems are unable to remove mercury vapors, both short-term and long-term exposures to mercury vapors are possible. Acute exposure to high concentrations of mercury vapors can cause irritation of the respiratory tract and behavioral symptoms, such as irritability and hyperactivity. Chronic exposure can result in damage to the nervous system (tremors, memory loss, insomnia, etc.) and kidneys (proteinurea). Therefore, the JSC Toxicology Group recommends that stringent safety controls and verifications (vibrational testing, etc.) be applied to any hardware that contains elemental mercury that could yield

  5. Combined determination of circulating miR-196a and miR-196b levels produces high sensitivity and specificity for early detection of oral cancer.

    Science.gov (United States)

    Lu, Ya-Ching; Chang, Joseph Tung-Chieh; Huang, Yu-Chen; Huang, Chi-Che; Chen, Wen-Ho; Lee, Li-Yu; Huang, Bing-Shen; Chen, Yin-Ju; Li, Hsiao-Fang; Cheng, Ann-Joy

    2015-02-01

    The aim of this study was to determine whether the oncogenic microRNA family members miR-196a and miR-196b can be circulating biomarkers for the early detection of oral cancer. To determine the stability of circulating miRNA, the blood sample was aliquot and stored at different temperature conditions for analysis. To assess the diagnostic efficacy, we determined the levels of miR-196s in plasma samples, including 53 from healthy individuals, 16 from pre-cancer patients, and 90 from oral cancer patients. In general, circulating miRNA was very stable when storing plasma samples at -20°C or below. In clinical study, both circulating miR-196a and miR-196b were substantially up-regulated in patients with oral pre-cancer lesions (5.9- and 14.8-fold, respectively; P oral cancer patients (9.3- and 17.0-fold, respectively; P cancer patients (AUC = 0.764 or 0.840, miR-196a or miR-196b, respectively), and between normal and cancer patients (AUC = 0.864 or 0.960, miR-196a or miR-196b, respectively). The combined determination of miR-196a and miR-196b levels produces excellent sensitivity and specificity in the diagnosis of patients with oral pre-cancer (AUC = 0.845) or oral cancer (AUC = 0.963), as well as in the prediction of potential malignancy (AUC = 0.950, sensitivity = 91%, specificity = 85%). Combined determination of circulating miR-196a and miR-196b levels may serve as panel plasma biomarkers for the early detection of oral cancer. Copyright © 2014 The Canadian Society of Clinical Chemists. Published by Elsevier Inc. All rights reserved.

  6. Heavy Metals (Mercury, Lead and Cadmium Determination in 17 Species of Fish Marketed in Khorramabad City, West of Iran

    Directory of Open Access Journals (Sweden)

    Ali Mortazavi

    2016-01-01

    Full Text Available Heavy metals entrance to fish body tissues and transferring to human body systems after their consuming makes numerous undesirable effects and health problems. The aim of this study was to determine some heavy metals (lead, cadmium and mercury in fresh fishes marketed in Khorramabad City, west of Iran. In this descriptive study, five samples of 17 fish species with high consumption were purchased randomly in 2014. Measurement of mercury, lead and cadmium was performed using atomic absorption spectrometry. All measurements were performed three times for each sample. Lead mean levels in fish samples was in the range 0.736 -1.005 ppm, cadmium range was from 0.196 to 0.015 ppm and mean content of mercury was  0.431 - 0.107 ppm. At present mean concentration of lead, mercury and cadmium in supplied fishes muscle is lower than maximum recommended levels according to WHO, EC and FDA guidelines. Based on the obtained results of this study and the importance of heavy metals in foods and their impacts on human health, continuous monitoring of heavy metals levels in foods is necessary.

  7. 22 CFR 19.6 - Court orders and divorce decrees.

    Science.gov (United States)

    2010-04-01

    ... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Court orders and divorce decrees. 19.6 Section 19.6 Foreign Relations DEPARTMENT OF STATE PERSONNEL BENEFITS FOR SPOUSES AND FORMER SPOUSES OF PARTICIPANTS IN THE FOREIGN SERVICE RETIREMENT AND DISABILITY SYSTEM § 19.6 Court orders and divorce decrees. ...

  8. Planet Mercury

    Science.gov (United States)

    1974-01-01

    Mariner 10's first image of Mercury acquired on March 24, 1974. During its flight, Mariner 10's trajectory brought it behind the lighted hemisphere of Mercury, where this image was taken, in order to acquire important measurements with other instruments.This picture was acquired from a distance of 3,340,000 miles (5,380,000 km) from the surface of Mercury. The diameter of Mercury (3,031 miles; 4,878 km) is about 1/3 that of Earth.Images of Mercury were acquired in two steps, an inbound leg (images acquired before passing into Mercury's shadow) and an outbound leg (after exiting from Mercury's shadow). More than 2300 useful images of Mercury were taken, both moderate resolution (3-20 km/pixel) color and high resolution (better than 1 km/pixel) black and white coverage.

  9. 40 CFR 98.196 - Data reporting requirements.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 20 2010-07-01 2010-07-01 false Data reporting requirements. 98.196 Section 98.196 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) AIR PROGRAMS... use in a purification process). If CO2 was used on-site, provide the information in paragraphs (b)(17...

  10. 16 CFR 1.96 - Compromise of penalty.

    Science.gov (United States)

    2010-01-01

    ... 16 Commercial Practices 1 2010-01-01 2010-01-01 false Compromise of penalty. 1.96 Section 1.96 Commercial Practices FEDERAL TRADE COMMISSION ORGANIZATION, PROCEDURES AND RULES OF PRACTICE GENERAL... may compromise any penalty or proposed penalty at any time, with leave of court when necessary, taking...

  11. 46 CFR 196.85-1 - Magazine operation and control.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 7 2010-10-01 2010-10-01 false Magazine operation and control. 196.85-1 Section 196.85... OPERATIONS Magazine Control § 196.85-1 Magazine operation and control. (a) Keys to magazine spaces and magazine chests shall be kept in the sole control or custody of the Master or one delegated qualified...

  12. Mercury

    NARCIS (Netherlands)

    de Vries, Irma

    2017-01-01

    Mercury is a naturally occurring metal that exists in several physical and chemical forms. Inorganic mercury refers to compounds formed after the combining of mercury with elements such as chlorine, sulfur, or oxygen. After combining with carbon by covalent linkage, the compounds formed are called

  13. 49 CFR 173.164 - Mercury (metallic and articles containing mercury).

    Science.gov (United States)

    2010-10-01

    ... ounces) of mercury per package; (iv) Tubes which are completely jacketed in sealed leakproof metal cases... 49 Transportation 2 2010-10-01 2010-10-01 false Mercury (metallic and articles containing mercury... Than Class 1 and Class 7 § 173.164 Mercury (metallic and articles containing mercury). (a) For...

  14. Recovery of mercury from mercury compounds via electrolytic methods

    Science.gov (United States)

    Grossman, Mark W.; George, William A.

    1988-01-01

    A process for electrolytically recovering mercury from mercury compounds is provided. In one embodiment, Hg is recovered from Hg.sub.2 Cl.sub.2 employing as the electrolyte solution a mixture of HCl and H.sub.2 O. In another embodiment, Hg is electrolytically recovered from HgO wherein the electrolyte solution is comprised of glacial acetic acid and H.sub.2 O. Also provided is an apparatus for producing isotopically enriched mercury compounds in a reactor and then transporting the dissolved compounds into an electrolytic cell where mercury ions are electrolytically reduced and elemental mercury recovered from the mercury compounds.

  15. Short-time variation of mercury speciation in the urban of Göteborg during GÖTE-2005

    Science.gov (United States)

    Li, Jing; Sommar, Jonas; Wängberg, Ingvar; Lindqvist, Oliver; Wei, Shi-qiang

    Mercury species samples for gaseous elemental mercury (GEM) with a temporal resolution of 5 min, 5 h and 20 min integrated measurements of reactive gaseous mercury (RGM), and 24-h sampling of particulate mercury (HgP) at urban Femman and total gaseous mercury (TGM) at rural Rörvik were conducted during the measurement campaign GÖTE-2005 in Göteborg, Sweden. Results showed that average concentrations for GEM, RGM, HgP and TGM were 1.96 ± 0.38 ng m -3, 2.53 ± 4.09 pg m -3, 12.50 ± 5.88 pg m -3 and 1.63 ± 0.19 ng m -3, respectively. A reverse diurnal distribution pattern between GEM and RGM was observed, and early morning GEM concentration was elevated compared to daytime values which was likely due to activation of fossil fuel combustion, electric utilities, etc., by the formation of a nighttime inversion layer, less activity of GEM and reduced mixing. The subsequent decline and afternoon minimum were likely related to increase vertical mixing, photochemical reaction, and coupling with the coal combustion. However, the photochemical conversion from GEM during daytime and nocturnal behavior of "sticky" gases under higher relative humidity may result in strong diurnal cycles for RGM. Sampling site was heavily affected by anthropogenic sources from two distinguished wind sectors. One was ESE-SSW sector which was likely impacted by long distance transport from south highly industrialized region; the other was likely tied with local sources from N-NE sector.

  16. 32 CFR 196.440 - Health and insurance benefits and services.

    Science.gov (United States)

    2010-07-01

    ... 32 National Defense 2 2010-07-01 2010-07-01 false Health and insurance benefits and services. 196... Activities Prohibited § 196.440 Health and insurance benefits and services. Subject to § 196.235(d), in providing a medical, hospital, accident, or life insurance benefit, service, policy, or plan to any of its...

  17. 21 CFR 19.6 - Code of ethics for government service.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 1 2010-04-01 2010-04-01 false Code of ethics for government service. 19.6 Section 19.6 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES GENERAL STANDARDS OF CONDUCT AND CONFLICTS OF INTEREST General Provisions § 19.6 Code of ethics for government...

  18. Mercury and Your Health

    Science.gov (United States)

    ... the Risk of Exposure to Mercury Learn About Mercury What is Mercury What is Metallic mercury? Toxicological Profile ToxFAQs Mercury Resources CDC’s National Biomonitoring Program Factsheet on Mercury ...

  19. 27 CFR 44.196a - To a foreign-trade zone.

    Science.gov (United States)

    2010-04-01

    ... 27 Alcohol, Tobacco Products and Firearms 2 2010-04-01 2010-04-01 false To a foreign-trade zone. 44.196a Section 44.196a Alcohol, Tobacco Products and Firearms ALCOHOL AND TOBACCO TAX AND TRADE... Shipment § 44.196a To a foreign-trade zone. Where tobacco products, and cigarette papers and tubes are...

  20. 32 CFR 196.455 - Textbooks and curricular material.

    Science.gov (United States)

    2010-07-01

    ... 32 National Defense 2 2010-07-01 2010-07-01 false Textbooks and curricular material. 196.455 Section 196.455 National Defense Department of Defense (Continued) OFFICE OF THE SECRETARY OF DEFENSE (CONTINUED) MISCELLANEOUS NONDISCRIMINATION ON THE BASIS OF SEX IN EDUCATION PROGRAMS OR ACTIVITIES RECEIVING FEDERAL FINANCIAL ASSISTANCE Discriminatio...

  1. Rethinking mercury: the role of selenium in the pathophysiology of mercury toxicity.

    Science.gov (United States)

    Spiller, Henry A

    2018-05-01

    There is increasing evidence that the pathophysiological target of mercury is in fact selenium, rather than the covalent binding of mercury to sulfur in the body's ubiquitous sulfhydryl groups. The role of selenium in mercury poisoning is multifaceted, bidirectional, and central to understanding the target organ toxicity of mercury. An initial search was performed using Medline/PubMed, Toxline, Google Scholar, and Google for published work on mercury and selenium. These searches yielded 2018 citations. Publications that did not evaluate selenium status or evaluated environmental status (e.g., lake or ocean sediment) were excluded, leaving approximately 500 citations. This initial selection was scrutinized carefully and 117 of the most relevant and representative references were selected for use in this review. Binding of mercury to thiol/sulfhydryl groups: Mercury has a lower affinity for thiol groups and higher affinity for selenium containing groups by several orders of magnitude, allowing for binding in a multifaceted way. The established binding of mercury to thiol moieties appears to primarily involve the transport across membranes, tissue distribution, and enhanced excretion, but does not explain the oxidative stress, calcium dyshomeostasis, or specific organ injury seen with mercury. Effects of mercury on selenium and the role this plays in the pathophysiology of mercury toxicity: Mercury impairs control of intracellular redox homeostasis with subsequent increased intracellular oxidative stress. Recent work has provided convincing evidence that the primary cellular targets are the selenoproteins of the thioredoxin system (thioredoxin reductase 1 and thioredoxin reductase 2) and the glutathione-glutaredoxin system (glutathione peroxidase). Mercury binds to the selenium site on these proteins and permanently inhibits their function, disrupting the intracellular redox environment. A number of other important possible target selenoproteins have been identified

  2. Mercury Quick Facts: Health Effects of Mercury Exposure

    Science.gov (United States)

    ... 2012 What are the Health Effects of Mercury Exposure? The health effects that can be caused by breathing mercury depend ... they breathe faster and have smaller lungs. Health effects caused by long-term exposure to mercury vapors • • Anxiety • • Excessive shyness • • Anorexia • • Sleeping ...

  3. Mercury balance analysis

    International Nuclear Information System (INIS)

    Maag, J.; Lassen, C.; Hansen, E.

    1996-01-01

    A detailed assessment of the consumption of mercury, divided into use areas, was carried out. Disposal and emissions to the environment were also qualified. The assessment is mainly based on data from 1992 - 1993. The most important source of emission of mercury to air is solid waste incineration which is assessed in particular to be due to the supply of mercury in batteries (most likely mercury oxide batteries from photo equipment) and to dental fillings. The second most important source of mercury emission to air is coal-fired power plants which are estimated to account for 200-500 kg of mercury emission p.a. Other mercury emissions are mainly related to waste treatment and disposal. The consumption of mercury is generally decreasing. During the period from 1982/83 - 1992-93, the total consumption of mercury in Denmark was about halved. This development is related to the fact that consumption with regard to several important use areas (batteries, dental fillings, thermometers etc.) has been significantly reduced, while for other purposes the use of mercury has completely, or almost disappeared, i.e. (fungicides for seed, tubes etc.). (EG)

  4. Mercury Phase II Study - Mercury Behavior in Salt Processing Flowsheet

    International Nuclear Information System (INIS)

    Jain, V.; Shah, H.; Wilmarth, W. R.

    2016-01-01

    Mercury (Hg) in the Savannah River Site Liquid Waste System (LWS) originated from decades of canyon processing where it was used as a catalyst for dissolving the aluminum cladding of reactor fuel. Approximately 60 metric tons of mercury is currently present throughout the LWS. Mercury has long been a consideration in the LWS, from both hazard and processing perspectives. In February 2015, a Mercury Program Team was established at the request of the Department of Energy to develop a comprehensive action plan for long-term management and removal of mercury. Evaluation was focused in two Phases. Phase I activities assessed the Liquid Waste inventory and chemical processing behavior using a system-by-system review methodology, and determined the speciation of the different mercury forms (Hg+, Hg++, elemental Hg, organomercury, and soluble versus insoluble mercury) within the LWS. Phase II activities are building on the Phase I activities, and results of the LWS flowsheet evaluations will be summarized in three reports: Mercury Behavior in the Salt Processing Flowsheet (i.e. this report); Mercury Behavior in the Defense Waste Processing Facility (DWPF) Flowsheet; and Mercury behavior in the Tank Farm Flowsheet (Evaporator Operations). The evaluation of the mercury behavior in the salt processing flowsheet indicates, inter alia, the following: (1) In the assembled Salt Batches 7, 8 and 9 in Tank 21, the total mercury is mostly soluble with methylmercury (MHg) contributing over 50% of the total mercury. Based on the analyses of samples from 2H Evaporator feed and drop tanks (Tanks 38/43), the source of MHg in Salt Batches 7, 8 and 9 can be attributed to the 2H evaporator concentrate used in assembling the salt batches. The 2H Evaporator is used to evaporate DWPF recycle water. (2) Comparison of data between Tank 21/49, Salt Solution Feed Tank (SSFT), Decontaminated Salt Solution Hold Tank (DSSHT), and Tank 50 samples suggests that the total mercury as well as speciated

  5. The Association Between Blood Mercury Levels and Risk for Overweight in a General Adult Population: Results from the Korean National Health and Nutrition Examination Survey.

    Science.gov (United States)

    Lee, Seunghyun; Yoon, Jin-Ha; Won, Jong-Uk; Lee, Wanhyung; Lee, June-Hee; Seok, Hongdeok; Kim, Yeong-Kwang; Kim, Chi-Nyon; Roh, Jaehoon

    2016-06-01

    The primary objective of this study was to estimate the association between blood mercury levels and overweight in Korean adults. We analyzed cross-sectional data from 9228 participants (4283 men and 4945 women) who completed the Korean National Health and Nutrition Examination Survey (KNHANES), 2007-2013. The population was divided into two groups according to the body mass index (BMI) and waist circumference (WC). Blood mercury levels were analyzed using a gold amalgam method with a DMA-80 instrument, categorized into quartiles, and stratified by sex. After adjusting for all covariates, blood mercury was significantly associated with overweight in all subjects. According to the BMI criteria, the adjusted odds ratio of being in the highest blood mercury quartile was 1.75 (95 % confidence interval [CI], 1.53-2.01) overall, 2.09 (95 % CI, 1.71-2.55) in men, and 1.58 (95 % CI, 1.32-1.89) in women. According to the WC criteria, the adjusted odds ratio of being in the highest blood mercury quartile was 1.85 (95 % CI, 1.49-2.30) in men and 1.96 (95 % CI, 1.62-2.36) in women compared to the lowest quartile. Additionally, a trend in overweight across increasing blood mercury levels was observed by the p for trend test in the multiple diagnostic criteria.

  6. Distribution and retention of organic and inorganic mercury in methyl mercury-treated neonatal rats

    International Nuclear Information System (INIS)

    Thomas, D.J.; Fisher, H.L.; Sumler, M.R.; Hall, L.L.; Mushak, P.

    1988-01-01

    Seven-day-old Long Evans rats received one mumol of 203 Hg-labeled methyl mercury/kg sc and whole body retention and tissue distribution of organic and inorganic mercury were examined for 32 days postdosing. Neonates cleared mercury slowly until 10 days postdosing when the clearance rate abruptly increased. During the interval when whole body clearance of mercury was extremely slow, methyl mercury was metabolized to inorganic mercury. Peak concentration of mercury in kidney occurred at 2 days postdosing. At 32 days postdosing, 8% of mercury in kidney was in an organic from. Liver mercury concentration peaked at 2 days postdosing and organic mercury accounted for 38% at 32 days postdosing. Brain concentrations of mercury peaked at 2 days postdosing. At 10 days postdosing, organic mercury accounted for 86% of the brain mercury burden, and, at 32 days postdosing, for 60%. The percentage of mercury body burden in pelt rose from 30 to 70% between 1 and 10 days postdosing. At 32 days postdosing pelt contained 85% of the body burden of mercury. At all time points, about 95% of mercury in pelt was in an organic form. Compartmental analysis of these data permitted development of a model to describe the distribution and excretion of organic and inorganic mercury in methyl mercury-treated neonatal rats

  7. Method for removal and stabilization of mercury in mercury-containing gas streams

    Science.gov (United States)

    Broderick, Thomas E.

    2005-09-13

    The present invention is directed to a process and apparatus for removing and stabilizing mercury from mercury-containing gas streams. A gas stream containing vapor phase elemental and/or speciated mercury is contacted with reagent, such as an oxygen-containing oxidant, in a liquid environment to form a mercury-containing precipitate. The mercury-containing precipitate is kept or placed in solution and reacts with one or more additional reagents to form a solid, stable mercury-containing compound.

  8. Mercury-impacted scrap metal: Source and nature of the mercury.

    Science.gov (United States)

    Finster, Molly E; Raymond, Michelle R; Scofield, Marcienne A; Smith, Karen P

    2015-09-15

    The reuse and recycling of industrial solid wastes such as scrap metal is supported and encouraged both internationally and domestically, especially when such wastes can be used as substitutes for raw material. However, scrap metal processing facilities, such as mini-mills, have been identified as a source of mercury (Hg) emissions in the United States. This research aims to better define some of the key issues related to the source and nature of mercury in the scrap metal waste stream. Overall, it is difficult to pinpoint the key mercury sources feeding into scrap metal recycling facilities, quantify their associated mercury concentrations, or determine which chemical forms are most significant. Potential sources of mercury in scrap metal include mercury switches from discarded vehicles, electronic-based scrap from household appliances and related industrial systems, and Hg-impacted scrap metal from the oil and gas industry. The form of mercury associated with scrap metal varies and depends on the source type. The specific amount of mercury that can be adsorbed and retained by steel appears to be a function of both metallurgical and environmental factors. In general, the longer the steel is in contact with a fluid or condensate that contains measurable concentrations of elemental mercury, the greater the potential for mercury accumulation in that steel. Most mercury compounds are thermally unstable at elevated temperatures (i.e., above 350 °C). As such, the mercury associated with impacted scrap is expected to be volatilized out of the metal when it is heated during processing (e.g., shredding or torch cutting) or melted in a furnace. This release of fugitive gas (Hg vapor) and particulates, as well as Hg-impacted bag-house dust and control filters, could potentially pose an occupational exposure risk to workers at a scrap metal processing facility. Thus, identifying and characterizing the key sources of Hg-impacted scrap, and understanding the nature and extent

  9. Mercury contamination extraction

    Science.gov (United States)

    Fuhrmann, Mark [Silver Spring, MD; Heiser, John [Bayport, NY; Kalb, Paul [Wading River, NY

    2009-09-15

    Mercury is removed from contaminated waste by firstly applying a sulfur reagent to the waste. Mercury in the waste is then permitted to migrate to the reagent and is stabilized in a mercury sulfide compound. The stable compound may then be removed from the waste which itself remains in situ following mercury removal therefrom.

  10. Global Trends in Mercury Management

    Science.gov (United States)

    Choi, Kyunghee

    2012-01-01

    The United Nations Environmental Program Governing Council has regulated mercury as a global pollutant since 2001 and has been preparing the mercury convention, which will have a strongly binding force through Global Mercury Assessment, Global Mercury Partnership Activities, and establishment of the Open-Ended Working Group on Mercury. The European Union maintains an inclusive strategy on risks and contamination of mercury, and has executed the Mercury Export Ban Act since December in 2010. The US Environmental Protection Agency established the Mercury Action Plan (1998) and the Mercury Roadmap (2006) and has proposed systematic mercury management methods to reduce the health risks posed by mercury exposure. Japan, which experienced Minamata disease, aims vigorously at perfection in mercury management in several ways. In Korea, the Ministry of Environment established the Comprehensive Plan and Countermeasures for Mercury Management to prepare for the mercury convention and to reduce risks of mercury to protect public health. PMID:23230466

  11. Mercurial poisoning

    Energy Technology Data Exchange (ETDEWEB)

    Gorton, B

    1924-01-01

    Cats which had been kept in a thermometer factory to catch rats were afflicted with mercury poisoning. So were the rats they were supposed to eat. The symptoms of mercury poisoning were the same in both species. The source of mercury for these animals is a fine film of the metal which coats floors, a result of accidental spills during the manufacturing process.

  12. Atmospheric mercury in Changbai Mountain area, northeastern China II. The distribution of reactive gaseous mercury and particulate mercury and mercury deposition fluxes.

    Science.gov (United States)

    Wan, Qi; Feng, Xinbin; Lu, Julia; Zheng, Wei; Song, Xinjie; Li, Ping; Han, Shijie; Xu, Hao

    2009-08-01

    Reactive gaseous mercury (RGM) and particulate mercury (Hgp) concentrations in ambient air from a remote site at Changbai Mountain area in northeastern China were intermittently monitored from August 2005 to July 2006 totaling 93 days representing fall, winter-spring and summer season, respectively. Rainwater and snow samples were collected during a whole year, and total mercury (THg) in rain samples were used to calculate wet depositional flux. A throughfall method and a model method were used to estimate dry depositional flux. Results showed mean concentrations of RGM and Hgp are 65 and 77 pg m(-3). Compared to background concentrations of atmospheric mercury species in Northern Hemisphere, RGM and Hgp are significantly elevated in Changbai area. Large values for standard deviation indicated fast reactivity and a low residence time for these mercury species. Seasonal variability is also important, with lower mercury levels in summer compared to other seasons, which is attributed to scavenging by rainfall and low local mercury emissions in summer. THg concentrations ranged from 11.5 to 15.9 ng L(-1) in rainwater samples and 14.9-18.6 ng L(-1) in throughfall samples. Wet depositional flux in Changbai area is calculated to be 8.4 microg m(-2) a(-1), and dry deposition flux is estimated to be 16.5 microg m(-2) a(-1) according to a throughfall method and 20.2 microg m(-2) a(-1) using a model method.

  13. Mercury accumulation plant Cyrtomium macrophyllum and its potential for phytoremediation of mercury polluted sites.

    Science.gov (United States)

    Xun, Yu; Feng, Liu; Li, Youdan; Dong, Haochen

    2017-12-01

    Cyrtomium macrophyllum naturally grown in 225.73 mg kg -1 of soil mercury in mining area was found to be a potential mercury accumulator plant with the translocation factor of 2.62 and the high mercury concentration of 36.44 mg kg -1 accumulated in its aerial parts. Pot experiments indicated that Cyrtomium macrophyllum could even grow in 500 mg kg -1 of soil mercury with observed inhibition on growth but no obvious toxic effects, and showed excellent mercury accumulation and translocation abilities with both translocation and bioconcentration factors greater than 1 when exposed to 200 mg kg -1 and lower soil mercury, indicating that it could be considered as a great mercury accumulating species. Furthermore, the leaf tissue of Cyrtomium macrophyllum showed high resistance to mercury stress because of both the increased superoxide dismutase activity and the accumulation of glutathione and proline induced by mercury stress, which favorited mercury translocation from the roots to the aerial parts, revealing the possible reason for Cyrtomium macrophyllum to tolerate high concentration of soil mercury. In sum, due to its excellent mercury accumulation and translocation abilities as well as its high resistance to mercury stress, the use of Cyrtomium macrophyllum should be a promising approach to remediating mercury polluted soils. Copyright © 2017 Elsevier Ltd. All rights reserved.

  14. Toward a Unified Understanding of Mercury and Methylated Mercury from the World's Oceans

    Science.gov (United States)

    McNutt, M. K.; Krabbenhoft, D. P.; Landing, W. M.; Sunderland, E. M.

    2012-12-01

    Marine fish and shellfish are the main source of toxic methylmercury exposure for humans. As recently as decade ago, very limited aqueous methylated mercury data were available from marine settings, resulting in a generally poor understanding of the processes controlling mercury in pelagic marine food webs. Recent oceanographic cruises have significantly improved availability of reliable measurements of methylated mercury and total mercury in seawater. This presentation will focus on vertical seawater profiles collected to depths 1000 m from three recent sampling efforts in collaboration with the CLIVAR Repeat Hydrography Program sponsored by NOAA including: 1) the northeastern Pacific (P16N cruise from Honolulu, Hawaii to Kodiak, Alaska); (2) the southern Indian Ocean (I5 cruise from Cape Town, South Africa, to Fremantle, Australia); and, (3) the Southern Ocean cruise (S4P from McMurdo, Antarctica, to Punta Arenas, Chile). Analytical results presented were all derived from the USGS Mercury Research Lab (http://wi.water.usgs.gov/mercury-lab). Supporting data derived from these cruises on water mass ages, nutrients, carbon and dissolved oxygen provide an opportunity to develop a stronger understanding of the biogeochemical factors controlling oceanic distributions of mercury and methylated mercury. Whole-water, median total mercury, and methylated mercury concentrations for the northern Pacific, southern Indian, and Southern Ocean were 1.10, 0.80, and 1.65 pM, , and 0.11, 0.08, and 0.32 pM, respectively. For all three oceans, vertical profiles of total mercury generally show the lowest concentrations in the surface mixed layer, and concentration maxima at the 700-1000 m depths. Surface depletion of total mercury is attributed to photo-chemical reduction and evasion of gaseous elemental mercury as well as scavenging by settling particulate matter, the main vector of transport to the subsurface ocean. Methylated mercury in all the ocean profiles reveal distinct mid

  15. Excretion and distribution of mercury in rats, antidotes for mercury and effects of egg production and fertility of hens after mercury administration

    Energy Technology Data Exchange (ETDEWEB)

    Ulfvarson, U

    1973-01-01

    The results of investigations of the distribution and excretion of organic and inorganic mercury compounds in albino rats and white leghorn hens conducted over a period of ten years are surveyed. The storage of mercury in eggs as well as its effects on the egg-lay-frequency and hatchability of the eggs have also been studied. All investigated mercury compounds were labelled with the radioactive mercury isotope /sup 203/Hg and the mercury level was measured with a scintillation technique. Since antidotes used in the treatment of mercury poisoning influence not only the excretion of mercury, but also its distribution in the body, the effects of nine antidotes on the metabolism of different mercury compounds were also investigated. The results of the survey are presented graphically. 6 references, 15 figures, 1 table.

  16. Mercury's exosphere: observations during MESSENGER's First Mercury flyby.

    Science.gov (United States)

    McClintock, William E; Bradley, E Todd; Vervack, Ronald J; Killen, Rosemary M; Sprague, Ann L; Izenberg, Noam R; Solomon, Sean C

    2008-07-04

    During MESSENGER's first Mercury flyby, the Mercury Atmospheric and Surface Composition Spectrometer measured Mercury's exospheric emissions, including those from the antisunward sodium tail, calcium and sodium close to the planet, and hydrogen at high altitudes on the dayside. Spatial variations indicate that multiple source and loss processes generate and maintain the exosphere. Energetic processes connected to the solar wind and magnetospheric interaction with the planet likely played an important role in determining the distributions of exospheric species during the flyby.

  17. 32 CFR 196.450 - Athletics.

    Science.gov (United States)

    2010-07-01

    ... NONDISCRIMINATION ON THE BASIS OF SEX IN EDUCATION PROGRAMS OR ACTIVITIES RECEIVING FEDERAL FINANCIAL ASSISTANCE Discrimination on the Basis of Sex in Education Programs or Activities Prohibited § 196.450 Athletics. (a... time; (iv) Travel and per diem allowance; (v) Opportunity to receive coaching and academic tutoring...

  18. A mercury transport and fate model (LM2-mercury) for mass budget assessment of mercury cycling in Lake Michigan

    Science.gov (United States)

    LM2-Mercury, a mercury mass balance model, was developed to simulate and evaluate the transport, fate, and biogeochemical transformations of mercury in Lake Michigan. The model simulates total suspended solids (TSS), disolved organic carbon (DOC), and total, elemental, divalent, ...

  19. Mercury Emission Measurement in Coal-Fired Boilers by Continuous Mercury Monitor and Ontario Hydro Method

    Science.gov (United States)

    Zhu, Yanqun; Zhou, Jinsong; He, Sheng; Cai, Xiaoshu; Hu, Changxin; Zheng, Jianming; Zhang, Le; Luo, Zhongyang; Cen, Kefa

    2007-06-01

    The mercury emission control approach attaches more importance. The accurate measurement of mercury speciation is a first step. Because OH method (accepted method) can't provide the real-time data and 2-week time for results attained, it's high time to seek on line mercury continuous emission monitors(Hg-CEM). Firstly, the gaseous elemental and oxidized mercury were conducted to measure using OH and CEM method under normal operation conditions of PC boiler after ESP, the results between two methods show good consistency. Secondly, through ESP, gaseous oxidized mercury decrease a little and particulate mercury reduce a little bit, but the elemental mercury is just the opposite. Besides, the WFGD system achieved to gaseous oxidized mercury removal of 53.4%, gaseous overall mercury and elemental mercury are 37.1% and 22.1%, respectively.

  20. Biomarkers of mercury exposure at a mercury recycling facility in Ukraine

    Science.gov (United States)

    Gibb, H.J.; Kozlov, K.; Buckley, J.P.; Centeno, J.; Jurgenson, V.; Kolker, A.; Conko, K.; Landa, E.; Panov, B.; Panov, Y.; Xu, H.

    2008-01-01

    This study evaluates biomarkers of occupational mercury exposure among workers at a mercury recycling operation in Gorlovka, Ukraine. The 29 study participants were divided into three occupational categories for analysis: (1) those who worked in the mercury recycling operation (Group A, n = 8), (2) those who worked at the facility but not in the yard where the recycling was done (Group B, n = 14), and (3) those who did not work at the facility (Group C, n = 7). Urine, blood, hair, and nail samples were collected from the participants, and a questionnaire was administered to obtain data on age, gender, occupational history, smoking, alcohol consumption, fish consumption, tattoos, dental amalgams, home heating system, education, source of drinking water, and family employment in the former mercury mine/smelter located on the site of the recycling facility. Each factor was tested in a univariate regression with total mercury in urine, blood, hair, and nails. Median biomarker concentrations were 4.04 ??g/g-Cr (urine), 2.58 ??g/L (blood), 3.95 ??g/g (hair), and 1.16 ??g/g (nails). Occupational category was significantly correlated (p < 0.001) with both blood and urinary mercury concentrations but not with hair or nail mercury. Four individuals had urinary mercury concentrations in a range previously found to be associated with subtle neurological and subjective symptoms (e.g., fatigue, loss of appetite, irritability), and one worker had a urinary mercury concentration in a range associated with a high probability of neurological effects and proteinuria. Comparison of results by occupational category found that workers directly involved with the recycling operation had the highest blood and urinary mercury levels. Those who worked at the facility but were not directly involved with the recycling operation had higher levels than those who did not work at the facility. Copyright ?? 2008 JOEH, LLC.

  1. The 2016 Transit of Mercury Observed from Major Solar Telescopes and Satellites

    Science.gov (United States)

    Pasachoff, Jay M.; Schneider, Glenn; Gary, Dale; Chen, Bin; Sterling, Alphonse C.; Reardon, Kevin P.; Dantowitz, Ronald; Kopp, Greg A.

    2016-10-01

    We report observations from the ground and space of the 9 May 2016 transit of Mercury. We build on our explanation of the black-drop effect in transits of Venus based on spacecraft observations of the 1999 transit of Mercury (Schneider, Pasachoff, and Golub, Icarus 168, 249, 2004). In 2016, we used the 1.6-m New Solar Telescope at the Big Bear Solar Observatory with active optics to observe Mercury's transit at high spatial resolution. We again saw a small black-drop effect as 3rd contact neared, confirming the data that led to our earlier explanation as a confluence of the point-spread function and the extreme solar limb darkening (Pasachoff, Schneider, and Golub, in IAU Colloq. 196, 2004). We again used IBIS on the Dunn Solar Telescope of the Sacramento Peak Observatory, as A. Potter continued his observations, previously made at the 2006 transit of Mercury, at both telescopes of the sodium exosphere of Mercury (Potter, Killen, Reardon, and Bida, Icarus 226, 172, 2013). We imaged the transit with IBIS as well as with two RED Epic IMAX-quality cameras alongside it, one with a narrow passband. We show animations of our high-resolution ground-based observations along with observations from XRT on JAXA's Hinode and from NASA's Solar Dynamics Observatory. Further, we report on the limit of the transit change in the Total Solar Irradiance, continuing our interest from the transit of Venus TSI (Schneider, Pasachoff, and Willson, ApJ 641, 565, 2006; Pasachoff, Schneider, and Willson, AAS 2005), using NASA's SORCE/TIM and the Air Force's TCTE/TIM. See http://transitofvenus.info and http://nicmosis.as.arizona.edu.Acknowledgments: We were glad for the collaboration at Big Bear of Claude Plymate and his colleagues of the staff of the Big Bear Solar Observatory. We also appreciate the collaboration on the transit studies of Robert Lucas (Sydney, Australia) and Evan Zucker (San Diego, California). JMP appreciates the sabbatical hospitality of the Division of Geosciences and

  2. Concentration of mercury in wheat samples stored with mercury tablets as preservative

    International Nuclear Information System (INIS)

    Lalit, B.Y.; Ramachandran, T.V.

    1977-01-01

    Tablets consisting of mercury in the form of a dull grey powder made by triturating mercury with chalk and sugar are used in Indian household for storing food-grains. The contamination of wheat samples by mercury, when stored with mercury tablets for period of upto four years has been assessed by using non-destructive neutron activation analysis. The details of the analytical procedure used have also been briefly described. The concentration of mercury in wheat increases with storage period. Loss of weight of mercury tablet is proportional to the storage period to a first approximation. In the present experiment, the average weight loss at the and end of first year was 0.009716 g corresponding to 6 ppm in wheat. (T.G.)

  3. Mercury Flow Through the Mercury-Containing Lamp Sector of the Economy of the United States

    Science.gov (United States)

    Goonan, Thomas G.

    2006-01-01

    Introduction: This Scientific Investigations Report examines the flow of mercury through the mercury-containing lamp sector of the U.S. economy in 2001 from lamp manufacture through disposal or recycling. Mercury-containing lamps illuminate commercial and industrial buildings, outdoor areas, and residences. Mercury is an essential component in fluorescent lamps and high-intensity discharge lamps (high-pressure sodium, mercury-vapor, and metal halide). A typical fluorescent lamp is composed of a phosphor-coated glass tube with electrodes located at either end. Only a very small amount of the mercury is in vapor form. The remainder of the mercury is in the form of either liquid mercury metal or solid mercury oxide (mercury oxidizes over the life of the lamp). When voltage is applied, the electrodes energize the mercury vapor and cause it to emit ultraviolet energy. The phosphor coating absorbs the ultraviolet energy, which causes the phosphor to fluoresce and emit visible light. Mercury-containing lamps provide more lumens per watt than incandescent lamps and, as a result, require from three to four times less energy to operate. Mercury is persistent and toxic within the environment. Mercury-containing lamps are of environmental concern because they are widely distributed throughout the environment and are easily broken in handling. The magnitude of lamp sector mercury emissions, estimated to be 2.9 metric tons per year (t/yr), is small compared with the estimated mercury losses of the U.S. coal-burning and chlor-alkali industries, which are about 70 t/yr and about 90 t/yr, respectively.

  4. Estimating mercury emissions from a zinc smelter in relation to China's mercury control policies

    International Nuclear Information System (INIS)

    Wang, S.X.; Song, J.X.; Li, G.H.; Wu, Y.; Zhang, L.; Wan, Q.; Streets, D.G.; Chin, Conrad K.; Hao, J.M.

    2010-01-01

    Mercury concentrations of flue gas at inlet/outlet of the flue gas cleaning, electrostatic demister, reclaiming tower, acid plant, and mercury contents in zinc concentrate and by-products were measured in a hydrometallurgical zinc smelter. The removal efficiency of flue gas cleaning, electrostatic demister, mercury reclaiming and acid plant was about 17.4%, 30.3%, 87.9% and 97.4% respectively. Flue gas cleaning and electrostatic demister captured 11.7% and 25.3% of the mercury in the zinc concentrate, respectively. The mercury reclaiming tower captured 58.3% of the mercury in the zinc concentrate. About 4.2% of the mercury in the zinc concentrate was captured by the acid plant. Consequently, only 0.8% of the mercury in the zinc concentrate was emitted to the atmosphere. The atmospheric mercury emission factor was 0.5 g t -1 of zinc produced for the tested smelter, indicating that this process offers the potential to effectively reduce mercury emissions from zinc smelting. - Modern scale production equipped with acid plant and Hg reclaiming tower will significantly reduce Hg emissions from zinc smelters in China.

  5. Total Mercury and Methylmercury Contamination in Fish from Sites along the Elbe River

    Directory of Open Access Journals (Sweden)

    P. Maršálek

    2006-01-01

    Full Text Available The aim of the study was to evaluate total mercury Hg and methylmercury MeHg contamination in muscle tissues of fish collected in 2002 from the Labe (Elbe river at sites upstream of Pardubice and downstream of Pardubice and Hřensko, and in 2004 from the Labe river upstream and downstream of the Spolana factory in Neratovice, and from the Vltava river downstream of Lenora. Eighty eight fish of the following species were sampled: bream (Abramis brama L., perch (Perca fluviatilis L., chub (Leuciscus cephalus L. and barbel (Barbus barbus L.. Total mercury content in chub, perch and bream was in the range of 0.05 - 1.96 mg kg-1 w.w., 0. 09 - 1.46 mg kg-1 w.w. and 0.35 - 0.82 mg kg-1 w.w., respectively. Methylmercury content in chub, perch and bream was in the range of 0.04 - 2.11 mg kg-1 w.w., 0.1 - 1.73 mg kg-1 w.w. and 0.371 - 0.650 mg kg-1 w.w., respectively. Significant correlation (p p < 0.05 between THg and MeHg contents were found between individual sites. In 2002, for example, the most contaminated fish were found downstream of Pardubice, followed by fish from upstream of Pardubice and from Hřensko. In 2004, fish from downstream and upstream of the Spolana factory in Neratovice were more contaminated than fish from the Vltava river downstream of Lenora. The methylmercury-tototal mercury ratio in muscle tissue was close to 1.0.

  6. Spatial variation of mercury bioaccumulation in bats of Canada linked to atmospheric mercury deposition.

    Science.gov (United States)

    Chételat, John; Hickey, M Brian C; Poulain, Alexandre J; Dastoor, Ashu; Ryjkov, Andrei; McAlpine, Donald; Vanderwolf, Karen; Jung, Thomas S; Hale, Lesley; Cooke, Emma L L; Hobson, Dave; Jonasson, Kristin; Kaupas, Laura; McCarthy, Sara; McClelland, Christine; Morningstar, Derek; Norquay, Kaleigh J O; Novy, Richard; Player, Delanie; Redford, Tony; Simard, Anouk; Stamler, Samantha; Webber, Quinn M R; Yumvihoze, Emmanuel; Zanuttig, Michelle

    2018-06-01

    Wildlife are exposed to neurotoxic mercury at locations distant from anthropogenic emission sources because of long-range atmospheric transport of this metal. In this study, mercury bioaccumulation in insectivorous bat species (Mammalia: Chiroptera) was investigated on a broad geographic scale in Canada. Fur was analyzed (n=1178) for total mercury from 43 locations spanning 20° latitude and 77° longitude. Total mercury and methylmercury concentrations in fur were positively correlated with concentrations in internal tissues (brain, liver, kidney) for a small subset (n=21) of little brown bats (Myotis lucifugus) and big brown bats (Eptesicus fuscus), validating the use of fur to indicate internal mercury exposure. Brain methylmercury concentrations were approximately 10% of total mercury concentrations in fur. Three bat species were mainly collected (little brown bats, big brown bats, and northern long-eared bats [M. septentrionalis]), with little brown bats having lower total mercury concentrations in their fur than the other two species at sites where both species were sampled. On average, juvenile bats had lower total mercury concentrations than adults but no differences were found between males and females of a species. Combining our dataset with previously published data for eastern Canada, median total mercury concentrations in fur of little brown bats ranged from 0.88-12.78μg/g among 11 provinces and territories. Highest concentrations were found in eastern Canada where bats are most endangered from introduced disease. Model estimates of atmospheric mercury deposition indicated that eastern Canada was exposed to greater mercury deposition than central and western sites. Further, mean total mercury concentrations in fur of adult little brown bats were positively correlated with site-specific estimates of atmospheric mercury deposition. This study provides the largest geographic coverage of mercury measurements in bats to date and indicates that atmospheric

  7. Metallic mercury recycling. Final report

    Energy Technology Data Exchange (ETDEWEB)

    Beck, M.A.

    1994-07-01

    Metallic mercury is known to be a hazardous material and is regulated as such. The disposal of mercury, usually by landfill, is expensive and does not remove mercury from the environment. Results from the Metallic Mercury Recycling Project have demonstrated that metallic mercury is a good candidate for reclamation and recycling. Most of the potential contamination of mercury resides in the scum floating on the surface of the mercury. Pinhole filtration was demonstrated to be an inexpensive and easy way of removing residues from mercury. The analysis method is shown to be sufficient for present release practices, and should be sufficient for future release requirements. Data from tests are presented. The consistently higher level of activity of the filter residue versus the bulk mercury is discussed. Recommendations for the recycling procedure are made.

  8. Metallic mercury recycling. Final report

    International Nuclear Information System (INIS)

    Beck, M.A.

    1994-01-01

    Metallic mercury is known to be a hazardous material and is regulated as such. The disposal of mercury, usually by landfill, is expensive and does not remove mercury from the environment. Results from the Metallic Mercury Recycling Project have demonstrated that metallic mercury is a good candidate for reclamation and recycling. Most of the potential contamination of mercury resides in the scum floating on the surface of the mercury. Pinhole filtration was demonstrated to be an inexpensive and easy way of removing residues from mercury. The analysis method is shown to be sufficient for present release practices, and should be sufficient for future release requirements. Data from tests are presented. The consistently higher level of activity of the filter residue versus the bulk mercury is discussed. Recommendations for the recycling procedure are made

  9. Mercury(II) and methyl mercury speciation on Streptococcus pyogenes loaded Dowex Optipore SD-2

    International Nuclear Information System (INIS)

    Tuzen, Mustafa; Uluozlu, Ozgur Dogan; Karaman, Isa; Soylak, Mustafa

    2009-01-01

    A solid phase extraction procedure based on speciation of mercury(II) and methyl mercury on Streptococcus pyogenes immobilized on Dowex Optipore SD-2 has been established. Selective and sequential elution with 0.1 mol L -1 HCl for methyl mercury and 2 mol L -1 HCl for mercury(II) were performed at pH 8. The determination of mercury levels was performed by cold vapour atomic absorption spectrometry (CVAAS). Optimal analytical conditions including pH, amounts of biosorbent, sample volumes, etc., were investigated. The influences of the some alkaline and earth alkaline ions and some transition metals on the recoveries were also investigated. The capacity of biosorbent for mercury(II) and methyl mercury was 4.8 and 3.4 mg g -1 . The detection limit (3 sigma) of the reagent blank for mercury(II) and methyl mercury was 2.1 and 1.5 ng L -1 . Preconcentration factor was calculated as 25. The relative standard deviations of the procedure were below 7%. The validation of the presented procedure is performed by the analysis of standard reference material (NRCC-DORM 2 Dogfish Muscle). The procedure was successfully applied to the speciation of mercury(II) and methyl mercury in natural water and environmental samples.

  10. Mercury(II) and methyl mercury speciation on Streptococcus pyogenes loaded Dowex Optipore SD-2

    Energy Technology Data Exchange (ETDEWEB)

    Tuzen, Mustafa, E-mail: m.tuzen@gmail.com [Gaziosmanpasa University, Faculty of Science and Arts, Chemistry Department, 60250 Tokat (Turkey); Uluozlu, Ozgur Dogan [Gaziosmanpasa University, Faculty of Science and Arts, Chemistry Department, 60250 Tokat (Turkey); Karaman, Isa [Gaziosmanpasa University, Faculty of Science and Arts, Biology Department, 60250 Tokat (Turkey); Soylak, Mustafa [Erciyes University, Faculty of Science and Arts, Chemistry Department, 38039 Kayseri (Turkey)

    2009-09-30

    A solid phase extraction procedure based on speciation of mercury(II) and methyl mercury on Streptococcus pyogenes immobilized on Dowex Optipore SD-2 has been established. Selective and sequential elution with 0.1 mol L{sup -1} HCl for methyl mercury and 2 mol L{sup -1} HCl for mercury(II) were performed at pH 8. The determination of mercury levels was performed by cold vapour atomic absorption spectrometry (CVAAS). Optimal analytical conditions including pH, amounts of biosorbent, sample volumes, etc., were investigated. The influences of the some alkaline and earth alkaline ions and some transition metals on the recoveries were also investigated. The capacity of biosorbent for mercury(II) and methyl mercury was 4.8 and 3.4 mg g{sup -1}. The detection limit (3 sigma) of the reagent blank for mercury(II) and methyl mercury was 2.1 and 1.5 ng L{sup -1}. Preconcentration factor was calculated as 25. The relative standard deviations of the procedure were below 7%. The validation of the presented procedure is performed by the analysis of standard reference material (NRCC-DORM 2 Dogfish Muscle). The procedure was successfully applied to the speciation of mercury(II) and methyl mercury in natural water and environmental samples.

  11. Thiosulphate assisted phytoextraction of mercury contaminated soils at the Wanshan Mercury Mining District, Southwest China

    Directory of Open Access Journals (Sweden)

    J. Wang

    2013-10-01

    Full Text Available Wanshan, known as the “Mercury Capital” of China, is located in the Southwest of China. Due to the extensive mining and smelting works in the Wanshan area, the local ecosystem has been serious contaminated with mercury. In the present study, a number of soil samples were taken from the Wanshan mercury mining area and the mercury fractionations in soils were analyzed using sequential extraction procedure technique. The obtained results showed that the dominate mercury fractions (represent 95% of total mercury were residual and organic bound mercury. A field trial was conducted in a mercury polluted farmland at the Wanshan mercury mine. Four plant species Brassica juncea Czern. et Coss.var. ASKYC (ASKYC, Brassica juncea Czern. et Coss.var.DPDH (DPDH, Brassica juncea Czern. et Coss.var.CHBD(CHBD, Brassica juncea Czern. et Coss.var.LDZY (LDZY were tested their ability to extract mercury from soil with thiosulphate amendment. The results indicated that the mercury concentration in the roots and shoots of the four plants were significantly increased with thiosulphate treatment. The mercury phytoextraction yield of ASKYC, DPDH, CHBD and LDZY were 92, 526, 294 and 129 g/ha, respectively

  12. Thiosulphate assisted phytoextraction of mercury contaminated soils at the Wanshan Mercury Mining District, Southwest China

    Directory of Open Access Journals (Sweden)

    J Wang

    2013-10-01

    Full Text Available Wanshan, known as the “Mercury Capital” of China, is located in the Southwest of China. Due to the extensive mining and smelting works in the Wanshan area, the local ecosystem has been serious contaminated with mercury. In the present study, a number of soil samples were taken from the Wanshan mercury mining area and the mercury fractionations in soils were analyzed using sequential extraction procedure technique. The obtained results showed that the dominate mercury fractions (represent 95% of total mercury were residual and organic bound mercury. A field trial was conducted in a mercury polluted farmland at the Wanshan mercury mine. Four plant species Brassica juncea Czern. et Coss.var. ASKYC (ASKYC, Brassica juncea Czern. et Coss.var.DPDH (DPDH, Brassica juncea Czern. et Coss.var.CHBD(CHBD, Brassica juncea Czern. et Coss.var.LDZY (LDZY were tested their ability to extract mercury from soil with thiosulphate amendment. The results indicated that the mercury concentration in the roots and shoots of the four plants were significantly increased with thiosulphate treatment. The mercury phytoextraction yield of ASKYC, DPDH, CHBD and LDZY were 92, 526, 294 and 129 g/ha, respectively.

  13. Mercury CEM Calibration

    Energy Technology Data Exchange (ETDEWEB)

    John Schabron; Joseph Rovani; Mark Sanderson

    2008-02-29

    Mercury continuous emissions monitoring systems (CEMS) are being implemented in over 800 coal-fired power plant stacks. The power industry desires to conduct at least a full year of monitoring before the formal monitoring and reporting requirement begins on January 1, 2009. It is important for the industry to have available reliable, turnkey equipment from CEM vendors. Western Research Institute (WRI) is working closely with the Electric Power Research Institute (EPRI), the National Institute of Standards and Technology (NIST), and the Environmental Protection Agency (EPA) to facilitate the development of the experimental criteria for a NIST traceability protocol for dynamic elemental mercury vapor generators. The generators are used to calibrate mercury CEMs at power plant sites. The Clean Air Mercury Rule (CAMR) which was published in the Federal Register on May 18, 2005 requires that calibration be performed with NIST-traceable standards (Federal Register 2007). Traceability procedures will be defined by EPA. An initial draft traceability protocol was issued by EPA in May 2007 for comment. In August 2007, EPA issued an interim traceability protocol for elemental mercury generators (EPA 2007). The protocol is based on the actual analysis of the output of each calibration unit at several concentration levels ranging initially from about 2-40 {micro}g/m{sup 3} elemental mercury, and in the future down to 0.2 {micro}g/m{sup 3}, and this analysis will be directly traceable to analyses by NIST. The document is divided into two separate sections. The first deals with the qualification of generators by the vendors for use in mercury CEM calibration. The second describes the procedure that the vendors must use to certify the generator models that meet the qualification specifications. The NIST traceable certification is performance based, traceable to analysis using isotope dilution inductively coupled plasma/mass spectrometry performed by NIST in Gaithersburg, MD. The

  14. Accumulation of mercury in selected plant species grown in soils contaminated with different mercury compounds

    International Nuclear Information System (INIS)

    Su, Yi; Han, Fengxiang; Shiyab, Safwan; Chen, Jian; Monts, David L.

    2007-01-01

    The objective of our research is to screen and search for suitable plant species for phyto-remediation of mercury-contaminated soil. Currently our effort is specifically focused on mercury removal from the U.S. Department of Energy (DOE) sites, where mercury contamination is a major concern. In order to cost effectively implement mercury remediation efforts, it is necessary now to obtain an improved understanding of biological means of removing mercury and mercury compounds.. Phyto-remediation is a technology that uses various plants to degrade, extract, contain, or immobilize contaminants from soil and water. In particular, phyto-extraction is the uptake of contaminants by plant roots and translocation within the plants to shoots or leaves. Contaminants are generally removed by harvesting the plants. We have investigated phyto-extraction of mercury from contaminated soil by using some of the known metal-accumulating plants since no natural plant species with mercury hyper-accumulating properties has yet been identified. Different natural plant species have been studied for mercury uptake, accumulation, toxicity and overall mercury removal efficiency. Various mercury compounds, such as HgS, HgCl 2 , and Hg(NO 3 ) 2 , were used as contaminant sources. Different types of soil were examined and chosen for phyto-remediation experiments. We have applied microscopy and diffuse reflectance spectrometry as well as conventional analytical chemistry to monitor the phyto-remediation processes of mercury uptake, translocation and accumulation, and the physiological impact of mercury contaminants on selected plant species. Our results indicate that certain plant species, such as beard grass (Polypogon monospeliensis), accumulated a very limited amount of mercury in the shoots ( 2 powder, respectively; no visual stress symptoms were observed. We also studied mercury phyto-remediation using aged soils that contained HgS, HgCl 2 , or Hg(NO 3 ) 2 . We have found that up to hundreds

  15. 28 CFR 0.196 - Procedures for resolving disagreements concerning mail or case assignments.

    Science.gov (United States)

    2010-07-01

    ... concerning mail or case assignments. 0.196 Section 0.196 Judicial Administration DEPARTMENT OF JUSTICE ORGANIZATION OF THE DEPARTMENT OF JUSTICE Jurisdictional Disagreements § 0.196 Procedures for resolving... assigned, the disagreement, together with a statement of the view of the unit or units involved, shall be...

  16. Methyl mercury, but not inorganic mercury, associated with higher blood pressure during pregnancy.

    Science.gov (United States)

    Wells, Ellen M; Herbstman, Julie B; Lin, Yu Hong; Hibbeln, Joseph R; Halden, Rolf U; Witter, Frank R; Goldman, Lynn R

    2017-04-01

    Prior studies addressing associations between mercury and blood pressure have produced inconsistent findings; some of this may result from measuring total instead of speciated mercury. This cross-sectional study of 263 pregnant women assessed total mercury, speciated mercury, selenium, and n-3 polyunsaturated fatty acids in umbilical cord blood and blood pressure during labor and delivery. Models with a) total mercury or b) methyl and inorganic mercury were evaluated. Regression models adjusted for maternal age, race/ethnicity, prepregnancy body mass index, neighborhood income, parity, smoking, n-3 fatty acids and selenium. Geometric mean total, methyl, and inorganic mercury concentrations were 1.40µg/L (95% confidence interval: 1.29, 1.52); 0.95µg/L (0.84, 1.07); and 0.13µg/L (0.10, 0.17), respectively. Elevated systolic BP, diastolic BP, and pulse pressure were found, respectively, in 11.4%, 6.8%, and 19.8% of mothers. In adjusted multivariable models, a one-tertile increase of methyl mercury was associated with 2.83mmHg (0.17, 5.50) higher systolic blood pressure and 2.99mmHg (0.91, 5.08) higher pulse pressure. In the same models, an increase of one tertile of inorganic mercury was associated with -1.18mmHg (-3.72, 1.35) lower systolic blood pressure and -2.51mmHg (-4.49, -0.53) lower pulse pressure. No associations were observed with diastolic pressure. There was a non-significant trend of higher total mercury with higher systolic blood pressure. We observed a significant association of higher methyl mercury with higher systolic and pulse pressure, yet higher inorganic mercury was significantly associated with lower pulse pressure. These results should be confirmed with larger, longitudinal studies. Copyright © 2017 Elsevier Inc. All rights reserved.

  17. Mercury and halogens in coal--Their role in determining mercury emissions from coal combustion

    Science.gov (United States)

    Kolker, Allan; Quick, Jeffrey C.; Senior, Connie L.; Belkin, Harvey E.

    2012-01-01

    Mercury is a toxic pollutant. In its elemental form, gaseous mercury has a long residence time in the atmosphere, up to a year, allowing it to be transported long distances from emission sources. Mercury can be emitted from natural sources such as volcanoes, or from anthropogenic sources, such as coal-fired powerplants. In addition, all sources of mercury on the Earth's surface can re-emit it from land and sea back to the atmosphere, from which it is then redeposited. Mercury in the atmosphere is present in such low concentrations that it is not considered harmful. Once mercury enters the aquatic environment, however, it can undergo a series of biochemical transformations that convert a portion of the mercury originally present to methylmercury, a highly toxic organic form of mercury that accumulates in fish and birds. Many factors contribute to creation of methylmercury in aquatic ecosystems, including mercury availability, sediment and nutrient load, bacterial influence, and chemical conditions. In the United States, consumption of fish with high levels of methylmercury is the most common pathway for human exposure to mercury, leading the U.S. Environmental Protection Agency (EPA) to issue fish consumption advisories in every State. The EPA estimates that 50 percent of the mercury entering the atmosphere in the United States is emitted from coal-burning utility powerplants. An EPA rule, known as MATS (for Mercury and Air Toxics Standards), to reduce emissions of mercury and other toxic pollutants from powerplants, was signed in December 2011. The rule, which is currently under review, specifies limits for mercury and other toxic elements, such as arsenic, chromium, and nickel. MATS also places limits on emission of harmful acid gases, such as hydrochloric acid and hydrofluoric acid. These standards are the result of a 2010 detailed nationwide program by the EPA to sample stack emissions and thousands of shipments of coal to coal-burning powerplants. The United

  18. Modeling Mercury in Proteins

    Energy Technology Data Exchange (ETDEWEB)

    Smith, Jeremy C [ORNL; Parks, Jerry M [ORNL

    2016-01-01

    Mercury (Hg) is a naturally occurring element that is released into the biosphere both by natural processes and anthropogenic activities. Although its reduced, elemental form Hg(0) is relatively non-toxic, other forms such as Hg2+ and, in particular, its methylated form, methylmercury, are toxic, with deleterious effects on both ecosystems and humans. Microorganisms play important roles in the transformation of mercury in the environment. Inorganic Hg2+ can be methylated by certain bacteria and archaea to form methylmercury. Conversely, bacteria also demethylate methylmercury and reduce Hg2+ to relatively inert Hg(0). Transformations and toxicity occur as a result of mercury interacting with various proteins. Clearly, then, understanding the toxic effects of mercury and its cycling in the environment requires characterization of these interactions. Computational approaches are ideally suited to studies of mercury in proteins because they can provide a detailed picture and circumvent issues associated with toxicity. Here we describe computational methods for investigating and characterizing how mercury binds to proteins, how inter- and intra-protein transfer of mercury is orchestrated in biological systems, and how chemical reactions in proteins transform the metal. We describe quantum chemical analyses of aqueous Hg(II), which reveal critical factors that determine ligand binding propensities. We then provide a perspective on how we used chemical reasoning to discover how microorganisms methylate mercury. We also highlight our combined computational and experimental studies of the proteins and enzymes of the mer operon, a suite of genes that confers mercury resistance in many bacteria. Lastly, we place work on mercury in proteins in the context of what is needed for a comprehensive multi-scale model of environmental mercury cycling.

  19. Mercury is Moon's brother

    International Nuclear Information System (INIS)

    Ksanfomalifi, L.V.

    1976-01-01

    The latest information on Mercury planet is presented obtained by studying the planet with the aid of radar and space vehicles. Rotation of Mercury about its axis has been discovered; within 2/3 of its year it executes a complete revolution about its axis. In images obtained by the ''Mariner-10'' Mercurys surface differs little from that of the Moon. The ''Mariner-10'' has also discovered the Mercurys atmosphere, which consists of extremely rarefied helium. The helium is continuously supplied to the planet by the solar wind. The Mercury's magnetic field has been discovered, whose strength is 35 x 10 -4 at the Equator and 70 x 10 -4 E at the poles. The inclination of the dipole axis to the Mercury's rotation axis is 7 deg

  20. Mercury nano-trap for effective and efficient removal of mercury(II) from aqueous solution

    Science.gov (United States)

    Li, Baiyan; Zhang, Yiming; Ma, Dingxuan; Shi, Zhan; Ma, Shengqian

    2014-11-01

    Highly effective and highly efficient decontamination of mercury from aqueous media remains a serious task for public health and ecosystem protection. Here we report that this task can be addressed by creating a mercury ‘nano-trap’ as illustrated by functionalizing a high surface area and robust porous organic polymer with a high density of strong mercury chelating groups. The resultant porous organic polymer-based mercury ‘nano-trap’ exhibits a record-high saturation mercury uptake capacity of over 1,000 mg g-1, and can effectively reduce the mercury(II) concentration from 10 p.p.m. to the extremely low level of smaller than 0.4 p.p.b. well below the acceptable limits in drinking water standards (2 p.p.b.), and can also efficiently remove >99.9% mercury(II) within a few minutes. Our work therefore presents a new benchmark for mercury adsorbent materials and provides a new perspective for removing mercury(II) and also other heavy metal ions from contaminated water for environmental remediation.

  1. Mercury flow experiments. 4th report: Measurements of erosion rate caused by mercury flow

    International Nuclear Information System (INIS)

    Kinoshita, Hidetaka; Kaminaga, Masanori; Haga, Katsuhiro; Hino, Ryutaro

    2002-06-01

    The Japan Atomic Energy Research Institute (JAERI) and the High Energy Accelerator Research Organization (KEK) are promoting a construction plan of the Material-Life Science Facility, which is consisted of a Muon Science Facility and a Neutron Scattering Facility, in order to open up the new science fields. The Neutron Scattering Facility will be utilized for advanced fields of Material and Life science using high intensity neutron generated by the spallation reaction of a 1 MW pulsed proton beam and mercury target. Design of the spallation mercury target system aims to obtain high neutron performance with high reliability and safety. Since the target system is using mercury as the target material and contains large amount of radioactive spallation products, it is necessary to estimate reliability for strength of instruments in a mercury flow system during lifetime of the facility. Piping and components in the mercury flow system would be damaged by erosion with mercury flow, since these components will be weak by thickness decreasing. This report presents experimental results of wall thickness change by erosion using a mercury experimental loop. In the experiments, an erosion test section and coupons were installed in the mercury experimental loop, and their wall thickness was measured with an ultra sonic thickness gage after every 1000 hours. As a result, under 0.7 m/s of mercury velocity condition which is slightly higher than the practical velocity in mercury pipelines, the erosion is about 3 μm in 1000 hours. The wall thickness decrease during facility lifetime of 30 years is estimated to be less than 0.5 mm. According to the experimental result, it is confirmed that the effect of erosion on component strength is extremely small. Moreover, a measurement of residual mercury on the piping surface was carried out. As a result, 19 g/m 2 was obtained as the residual mercury for the piping surface. According to this result, estimated amount of residual mercury for

  2. Study of high levels indoor air mercury contamination from mercury amalgam use in dentistry

    International Nuclear Information System (INIS)

    Khwaja, M.A.; Abbasi, M.S.; Mehmood, F.; Jahangir, S.

    2014-01-01

    In 2005, United Nations Environment Programme (UNEP) estimated that 362 tonnes of dental mercury are consumed annually worldwide. Dental mercury amalgams also called silver fillings and amalgam fillings are widely done. These fillings gave off mercury vapours. Estimated average absorbed concentrations of mercury vapours from dental fillings vary from 3,000 to 17,000 ng Hg. Mercury (Hg) also known as quick silver is an essential constituent of dental amalgam. It is a toxic substance of global concern. A persistent pollutant, mercury is not limited to its source but it travels, on time thousands of kilometers away from the source. Scientific evidence, including, UNEP Global Mercury report, establishes mercury as an extremely toxic substance, which is a major threat to wildlife, ecosystem and human health, at a global scale. Children are more at risk from mercury poisoning which affects their neurological development and brain. Mercury poisoning diminishes memory, attention, thinking and sight. In the past, a number of studies at dental sites in many countries have been carried out and reported which have been reviewed and briefly described. This paper describes and discusses the recent investigations, regarding mercury vapours level in air, carried out at 18 dental sites in Pakistan and other countries. It is evident from the data of 42 dental sites in 17 countries, including, selected dental sites in five main cities of Pakistan, described and discussed in this paper that at most dental sites in many countries including Pakistan, the indoor mercury vapours levels exceed far above the permissible limit, recommended for safe physical and mental health. At these sites, public, in general, and the medical, paramedical staff and vulnerable population, in particular, are at most serious risk to health resulting from exposure to toxic and hazardous mercury. (author)

  3. Concentration of mercury in wheat samples stored with mercury tablets as preservative. [Neutrons

    Energy Technology Data Exchange (ETDEWEB)

    Lalit, B Y; Ramachandran, T V [Bhabha Atomic Research Centre, Bombay (India). Air Monitoring Section

    1977-01-01

    Tablets consisting of mercury in the form of a dull grey powder made by triturating mercury with chalk and sugar are used in Indian household for storing food-grains. The contamination of wheat samples by mercury, when stored with mercury tablets for period of upto four years has been assessed by using non-destructive neutron activation analysis. The details of the analytical procedure used have also been briefly described. The concentration of mercury in wheat increases with storage period. Loss of weight of mercury tablet is proportional to the storage period to a first approximation. In the present experiment, the average weight loss at the and end of first year was 0.009716 g corresponding to 6 ppm in wheat.

  4. Radioactive mercury distribution in biological fluids and excretion in human subjects after inhalation of mercury vapor

    International Nuclear Information System (INIS)

    Cherian, M.G.; Hursh, J.B.; Clarkson, T.W.; Allen, J.

    1978-01-01

    The distribution of mercury in red blood cells (RBCs) and plasma, and its excretion in urine and feces are described in five human subjects during the first 7 days following inhalation of radioactive mercury vapor. A major portion (98%) of radioactive mercury in whole blood is initially accumulated in the RBCs and is transferred partly to the plasma compartment until the ratio of mercury in RBCs to plasma is about 2 within 20 h. The cumulative urinary and fecal excretion of mercury for 7 days is about 11.6% of the retained dose, and is closely related to the percent decline in body burden of mercury. There is little correlation between either the urinary excretion and plasma radioactivity of mercury, or the specific activities of urine and plasma mercury, suggesting a mechanism other than a direct glomerular filtration involved in the urinary excretion of recently exposed mercury. These studies suggest that blood mercury levels can be used as an index of recent exposure, while urinary levels may be an index of renal concentration of mercury. However, there is no reliable index for mercury concentration in the brain

  5. Solubility of helium in mercury for bubbling technology of the spallation neutron mercury target

    International Nuclear Information System (INIS)

    Hasegawa, S.; Naoe, T.; Futakawa, M.

    2010-01-01

    The pitting damage of mercury target container that originates in the pressure wave excited by the proton beam incidence becomes a large problem to reach the high-power neutron source in JSNS and SNS. The lifetime of mercury container is decreased remarkably by the pitting damage. As one of solutions, the pressure wave is mitigated by injecting the helium micro bubbles in mercury. In order to inject the helium micro bubbles into mercury, it is important to understand the characteristic of micro bubbles in mercury. The solubility of mercury-helium system is a key factor to decide bubbling conditions, because the disappearance behavior, i.e. the lifetime of micro bubbles, depends on the solubility. In addition, the bubble generation method is affected by it. Moreover, the experimental data related to the solubility of helium in mercury hardly exist. In this work, the solubility was obtained experimentally by measuring precisely the pressure drop of the gas that is facing to mercury surface. The pressure drop was attributed to the helium dissolution into mercury. Based on the measured solubility, the lifetime of micro bubbles and the method of the bubble generation is estimated using the solubility data.

  6. 46 CFR 196.15-15 - Examination of boilers and machinery.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 7 2010-10-01 2010-10-01 false Examination of boilers and machinery. 196.15-15 Section... VESSELS OPERATIONS Test, Drills, and Inspections § 196.15-15 Examination of boilers and machinery. (a) It shall be the duty of the chief engineer when he assumes charge of the boilers and machinery of a vessel...

  7. 46 CFR 196.45-1 - Master and chief engineer responsible.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 7 2010-10-01 2010-10-01 false Master and chief engineer responsible. 196.45-1 Section... VESSELS OPERATIONS Carrying of Excess Steam § 196.45-1 Master and chief engineer responsible. (a) It shall be the duty of the master and the engineer in charge of the boilers of any vessel to require that a...

  8. Mercury CEM Calibration

    Energy Technology Data Exchange (ETDEWEB)

    John F. Schabron; Joseph F. Rovani; Susan S. Sorini

    2007-03-31

    The Clean Air Mercury Rule (CAMR) which was published in the Federal Register on May 18, 2005, requires that calibration of mercury continuous emissions monitors (CEMs) be performed with NIST-traceable standards. Western Research Institute (WRI) is working closely with the Electric Power Research Institute (EPRI), the National Institute of Standards and Technology (NIST), and the Environmental Protection Agency (EPA) to facilitate the development of the experimental criteria for a NIST traceability protocol for dynamic elemental mercury vapor generators. The traceability protocol will be written by EPA. Traceability will be based on the actual analysis of the output of each calibration unit at several concentration levels ranging from about 2-40 ug/m{sup 3}, and this analysis will be directly traceable to analyses by NIST using isotope dilution inductively coupled plasma/mass spectrometry (ID ICP/MS) through a chain of analyses linking the calibration unit in the power plant to the NIST ID ICP/MS. Prior to this project, NIST did not provide a recommended mercury vapor pressure equation or list mercury vapor pressure in its vapor pressure database. The NIST Physical and Chemical Properties Division in Boulder, Colorado was subcontracted under this project to study the issue in detail and to recommend a mercury vapor pressure equation that the vendors of mercury vapor pressure calibration units can use to calculate the elemental mercury vapor concentration in an equilibrium chamber at a particular temperature. As part of this study, a preliminary evaluation of calibration units from five vendors was made. The work was performed by NIST in Gaithersburg, MD and Joe Rovani from WRI who traveled to NIST as a Visiting Scientist.

  9. Mercury Exposure and Heart Diseases

    Science.gov (United States)

    Genchi, Giuseppe; Sinicropi, Maria Stefania; Carocci, Alessia; Lauria, Graziantonio; Catalano, Alessia

    2017-01-01

    Environmental contamination has exposed humans to various metal agents, including mercury. It has been determined that mercury is not only harmful to the health of vulnerable populations such as pregnant women and children, but is also toxic to ordinary adults in various ways. For many years, mercury was used in a wide variety of human activities. Nowadays, the exposure to this metal from both natural and artificial sources is significantly increasing. Recent studies suggest that chronic exposure, even to low concentration levels of mercury, can cause cardiovascular, reproductive, and developmental toxicity, neurotoxicity, nephrotoxicity, immunotoxicity, and carcinogenicity. Possible biological effects of mercury, including the relationship between mercury toxicity and diseases of the cardiovascular system, such as hypertension, coronary heart disease, and myocardial infarction, are being studied. As heart rhythm and function are under autonomic nervous system control, it has been hypothesized that the neurotoxic effects of mercury might also impact cardiac autonomic function. Mercury exposure could have a long-lasting effect on cardiac parasympathetic activity and some evidence has shown that mercury exposure might affect heart rate variability, particularly early exposures in children. The mechanism by which mercury produces toxic effects on the cardiovascular system is not fully elucidated, but this mechanism is believed to involve an increase in oxidative stress. The exposure to mercury increases the production of free radicals, potentially because of the role of mercury in the Fenton reaction and a reduction in the activity of antioxidant enzymes, such as glutathione peroxidase. In this review we report an overview on the toxicity of mercury and focus our attention on the toxic effects on the cardiovascular system. PMID:28085104

  10. Mercury Exposure and Heart Diseases.

    Science.gov (United States)

    Genchi, Giuseppe; Sinicropi, Maria Stefania; Carocci, Alessia; Lauria, Graziantonio; Catalano, Alessia

    2017-01-12

    Environmental contamination has exposed humans to various metal agents, including mercury. It has been determined that mercury is not only harmful to the health of vulnerable populations such as pregnant women and children, but is also toxic to ordinary adults in various ways. For many years, mercury was used in a wide variety of human activities. Nowadays, the exposure to this metal from both natural and artificial sources is significantly increasing. Recent studies suggest that chronic exposure, even to low concentration levels of mercury, can cause cardiovascular, reproductive, and developmental toxicity, neurotoxicity, nephrotoxicity, immunotoxicity, and carcinogenicity. Possible biological effects of mercury, including the relationship between mercury toxicity and diseases of the cardiovascular system, such as hypertension, coronary heart disease, and myocardial infarction, are being studied. As heart rhythm and function are under autonomic nervous system control, it has been hypothesized that the neurotoxic effects of mercury might also impact cardiac autonomic function. Mercury exposure could have a long-lasting effect on cardiac parasympathetic activity and some evidence has shown that mercury exposure might affect heart rate variability, particularly early exposures in children. The mechanism by which mercury produces toxic effects on the cardiovascular system is not fully elucidated, but this mechanism is believed to involve an increase in oxidative stress. The exposure to mercury increases the production of free radicals, potentially because of the role of mercury in the Fenton reaction and a reduction in the activity of antioxidant enzymes, such as glutathione peroxidase. In this review we report an overview on the toxicity of mercury and focus our attention on the toxic effects on the cardiovascular system.

  11. Mercury Exposure and Heart Diseases

    Directory of Open Access Journals (Sweden)

    Giuseppe Genchi

    2017-01-01

    Full Text Available Environmental contamination has exposed humans to various metal agents, including mercury. It has been determined that mercury is not only harmful to the health of vulnerable populations such as pregnant women and children, but is also toxic to ordinary adults in various ways. For many years, mercury was used in a wide variety of human activities. Nowadays, the exposure to this metal from both natural and artificial sources is significantly increasing. Recent studies suggest that chronic exposure, even to low concentration levels of mercury, can cause cardiovascular, reproductive, and developmental toxicity, neurotoxicity, nephrotoxicity, immunotoxicity, and carcinogenicity. Possible biological effects of mercury, including the relationship between mercury toxicity and diseases of the cardiovascular system, such as hypertension, coronary heart disease, and myocardial infarction, are being studied. As heart rhythm and function are under autonomic nervous system control, it has been hypothesized that the neurotoxic effects of mercury might also impact cardiac autonomic function. Mercury exposure could have a long-lasting effect on cardiac parasympathetic activity and some evidence has shown that mercury exposure might affect heart rate variability, particularly early exposures in children. The mechanism by which mercury produces toxic effects on the cardiovascular system is not fully elucidated, but this mechanism is believed to involve an increase in oxidative stress. The exposure to mercury increases the production of free radicals, potentially because of the role of mercury in the Fenton reaction and a reduction in the activity of antioxidant enzymes, such as glutathione peroxidase. In this review we report an overview on the toxicity of mercury and focus our attention on the toxic effects on the cardiovascular system.

  12. Sexual differences in the excretion of organic and inorganic mercury by methyl mercury-treated rats

    International Nuclear Information System (INIS)

    Thomas, D.J.; Fisher, H.L.; Sumler, M.R.; Mushak, P.; Hall, L.L.

    1987-01-01

    Adult male and female Long Evans rats received 1 mumole of methyl ( 203 Hg) mercuric chloride per kilogram sc. Whole-body retention of mercury and excretion of organic and inorganic mercury in urine and feces were monitored for 98 days after dosing. Females cleared mercury from the body more rapidly than did males. The major route of mercury excretion was feces. By 98 days after dosing, cumulative mercury excretion in feces accounted for about 51% of the dose in males and about 54% of the dose in females. For both sexes, about 33% of the dose was excreted in feces as inorganic mercury. Cumulative excretion of organic mercury in feces accounted for about 18 and 21% of the dose in males and females, respectively. Urinary excretion of mercury was quantitatively a smaller route for mercury clearance but important sexual differences in loss by this route were found. Over the 98-day experimental period, males excreted in urine about 3.2% of the dose and females excreted 7.5%. Cumulative organic Hg excretion in urine accounted for 1.8% of the dose in males and 5.3% of the dose in females. These sexual differences in urinary and fecal excretion of organic and inorganic mercury following methyl mercury treatment were consistent with previous reports of sexual differences in mercury distribution and retention in methyl mercury-treated rats, particularly sexual differences in organic mercury uptake and retention in the kidney. Relationships between body burdens of organic or inorganic Hg and output of these forms of Hg in urine and feces were also found to be influenced by the interval after MeHg treatment and by sex. Relationship between concentration of Hg in liver and feces and in kidney and urine differed for organic and inorganic Hg and depended upon sexual status and interval after MeHg treatment

  13. 76 FR 13851 - National Emission Standards for Hazardous Air Pollutants: Mercury Emissions From Mercury Cell...

    Science.gov (United States)

    2011-03-14

    ... National Emission Standards for Hazardous Air Pollutants: Mercury Emissions From Mercury Cell Chlor-Alkali...-5] RIN 2060-AN99 National Emission Standards for Hazardous Air Pollutants: Mercury Emissions From Mercury Cell Chlor-Alkali Plants AGENCY: Environmental Protection Agency (EPA). ACTION: Supplemental...

  14. Mercury in Nordic ecosystems

    Energy Technology Data Exchange (ETDEWEB)

    Munthe, John; Waengberg, Ingvar (IVL Swedish Environmental Research Inst., Stockholm (SE)); Rognerud, Sigurd; Fjeld, Eirik (Norwegian Inst. for Water Research (NIVA), Oslo (Norway)); Verta, Matti; Porvari, Petri (Finnish Environment Inst. (SYKE), Helsinki (Finland)); Meili, Markus (Inst. of Applied Environmental Research (ITM), Stockholm (Sweden))

    2007-12-15

    This report provides a first comprehensive compilation and assessment of available data on mercury in air, precipitation, sediments and fish in the Nordic countries. The main conclusion is that mercury levels in Nordic ecosystems continue to be affected by long-range atmospheric transport. The geographical patterns of mercury concentrations in both sediments and fish are also strongly affected by ecosystem characteristics and in some regions possibly by historical pollution. An evaluation of geographical variations in mercury concentrations in precipitation indicates that the influence from anthropogenic sources from Central European areas is still significant. The annual variability of deposition is large and dependant of precipitation amounts. An evaluation of data from stations around the North Sea has indicated a significant decrease in mercury concentrations in precipitation indicating a continuous decrease of emissions in Europe (Waengberg et al., 2007). For mercury in air (TGM), the geographical pattern is less pronounced indicating the influence of mercury emissions and distribution over a larger geographical area (i.e. hemispherical transport). Comparison of recent (surficial) and historical lake sediments show significantly elevated concentrations of mercury most likely caused by anthropogenic atmospheric deposition over the past century. The highest pollution impact was observed in the coastal areas of southern Norway, in south western Finland and in Sweden from the coastal areas in the southwest across the central parts to the north-east. The general increase in recent versus old sediments was 2-5 fold. Data on mercury in Nordic freshwater fish was assembled and evaluated with respect to geographical variations. The fish data were further compared with temporal and spatial trends in mercury deposition and mercury contamination of lake sediments in order to investigate the coupling between atmospheric transport and deposition of mercury and local mercury

  15. Understanding the mercury reduction issue: the impact of mercury on the environment and human health.

    Science.gov (United States)

    Kao, Richard T; Dault, Scott; Pichay, Teresa

    2004-07-01

    Mercury has been used in both medicine and dentistry for centuries. Recent media attention regarding the increased levels of mercury in dietary fish, high levels of mercury in air emissions, and conjecture that certain diseases may be caused by mercury exposure has increased public awareness of the potential adverse health effects of high doses of mercury. Dentistry has been criticized for its continued use of mercury in dental amalgam for both public health and environmental reasons. To address these concerns, dental professionals should understand the impact of the various levels and types of mercury on the environment and human health. Mercury is unique in its ability to form amalgams with other metals. Dental amalgam--consisting of silver, copper, tin, and mercury--has been used as a safe, stable, and cost-effective restorative material for more than 150 years. As a result of this use, the dental profession has been confronted by the public on two separate health issues concerning the mercury content in amalgam. The first issue is whether the mercury amalgamated with the various metals to create dental restorations poses a health issue for patients. The second is whether the scraps associated with amalgam placement and the removal of amalgam restorations poses environmental hazards which may eventually have an impact on human health. Despite the lack of scientific evidence for such hazards, there is growing pressure for the dental profession to address these health issues. In this article, the toxicology of mercury will be reviewed and the impact of amalgam on health and the environment will be examined.

  16. Chemical Form Matters: Differential Accumulation of Mercury Following Inorganic and Organic Mercury Exposures in Zebrafish Larvae

    Energy Technology Data Exchange (ETDEWEB)

    Korbas, Malgorzata; MacDonald, Tracy C.; Pickering, Ingrid J.; George, Graham N.; Krone, Patrick H. (Saskatchewan)

    2013-04-08

    Mercury, one of the most toxic elements, exists in various chemical forms each with different toxicities and health implications. Some methylated mercury forms, one of which exists in fish and other seafood products, pose a potential threat, especially during embryonic and early postnatal development. Despite global concerns, little is known about the mechanisms underlying transport and toxicity of different mercury species. To investigate the impact of different mercury chemical forms on vertebrate development, we have successfully combined the zebrafish, a well-established developmental biology model system, with synchrotron-based X-ray fluorescence imaging. Our work revealed substantial differences in tissue-specific accumulation patterns of mercury in zebrafish larvae exposed to four different mercury formulations in water. Methylmercury species not only resulted in overall higher mercury burdens but also targeted different cells and tissues than their inorganic counterparts, thus revealing a significant role of speciation in cellular and molecular targeting and mercury sequestration. For methylmercury species, the highest mercury concentrations were in the eye lens epithelial cells, independent of the formulation ligand (chloride versus L-cysteine). For inorganic mercury species, in absence of L-cysteine, the olfactory epithelium and kidney accumulated the greatest amounts of mercury. However, with L-cysteine present in the treatment solution, mercuric bis-L-cysteineate species dominated the treatment, significantly decreasing uptake. Our results clearly demonstrate that the common differentiation between organic and inorganic mercury is not sufficient to determine the toxicity of various mercury species.

  17. Getting Mercury out of Schools.

    Science.gov (United States)

    1999

    This guide was prepared while working with many Massachusetts schools to remove items that contain mercury and to find suitable alternatives. It contains fact sheets on: mercury in science laboratories and classrooms, mercury in school buildings and maintenance areas, mercury in the medical office and in medical technology classrooms in vocational…

  18. Environmental Mercury and Its Toxic Effects

    Directory of Open Access Journals (Sweden)

    Kevin M. Rice

    2014-03-01

    Full Text Available Mercury exists naturally and as a man-made contaminant. The release of processed mercury can lead to a progressive increase in the amount of atmospheric mercury, which enters the atmospheric-soil-water distribution cycles where it can remain in circulation for years. Mercury poisoning is the result of exposure to mercury or mercury compounds resulting in various toxic effects depend on its chemical form and route of exposure. The major route of human exposure to methylmercury (MeHg is largely through eating contaminated fish, seafood, and wildlife which have been exposed to mercury through ingestion of contaminated lower organisms. MeHg toxicity is associated with nervous system damage in adults and impaired neurological development in infants and children. Ingested mercury may undergo bioaccumulation leading to progressive increases in body burdens. This review addresses the systemic pathophysiology of individual organ systems associated with mercury poisoning. Mercury has profound cellular, cardiovascular, hematological, pulmonary, renal, immunological, neurological, endocrine, reproductive, and embryonic toxicological effects.

  19. Histochemical demonstration of two mercury pools in trout tissues: mercury in kidney and liver after mercuric chloride exposure

    International Nuclear Information System (INIS)

    Baatrup, E.; Nielsen, M.G.; Danscher, G.

    1986-01-01

    Juvenile rainbow trout (Salmo gairdneri) were exposed to 100 ppb mercury (as HgCl 2 ) in the water for 14 days. Concentrations of mercury in water and fish organs were monitored using radiolabeled mercury. Tissues from kidney and liver were fixed, and sections were developed by autometallography, a method whereby accumulations of mercury sulfides and/or mercury selenides are silver amplified. In the kidney, mercury was found within lysosomes and extracellularly in the basal lamina of proximal tubules. In the liver, mercury was found within lysosomes of the hepatocytes. Additional groups of mercury-exposed trout were subjected to selenium (as Na 2 SeO 3 ), administered intraperitoneally 2 hr before fixation. Following this treatment, additional mercury could be visualized in the kidney circulatory system, including glomeruli, and in the nucleus and endoplasmic reticulum of liver cells. It is suggested that the mercury visualized prior to selenium treatment represents inorganic mercury, while additional mercury visualized after selenium administration represents an organic form

  20. Mercury exposure and risk of cardiovascular disease: a nested case-control study in the PREDIMED (PREvention with MEDiterranean Diet) study.

    Science.gov (United States)

    Downer, Mary K; Martínez-González, Miguel A; Gea, Alfredo; Stampfer, Meir; Warnberg, Julia; Ruiz-Canela, Miguel; Salas-Salvadó, Jordi; Corella, Dolores; Ros, Emilio; Fitó, Montse; Estruch, Ramon; Arós, Fernando; Fiol, Miquel; Lapetra, José; Serra-Majem, Lluís; Bullo, Monica; Sorli, Jose V; Muñoz, Miguel A; García-Rodriguez, Antonio; Gutierrez-Bedmar, Mario; Gómez-Gracia, Enrique

    2017-01-05

    Substantial evidence suggests that consuming 1-2 servings of fish per week, particularly oily fish (e.g., salmon, herring, sardines) is beneficial for cardiovascular health due to its high n-3 polyunsaturated fatty acid content. However, there is some concern that the mercury content in fish may increase cardiovascular disease risk, but this relationship remains unclear. The PREDIMED trial included 7477 participants who were at high risk for cardiovascular disease at baseline. In this study, we evaluated associations between mercury exposure, fish consumption and cardiovascular disease. We randomly selected 147 of the 288 cases diagnosed with cardiovascular disease during follow-up and matched them on age and sex to 267 controls. Instrumental neutron activation analysis was used to assess toenail mercury concentration. In-person interviews, medical record reviews and validated questionnaires were used to assess fish consumption and other covariates. Information was collected at baseline and updated yearly during follow-up. We used conditional logistic regression to evaluate associations in the total nested case-control study, and unconditional logistic regression for population subsets. Mean (±SD) toenail mercury concentrations (μg per gram) did not significantly differ between cases (0.63 (±0.53)) and controls (0.67 (±0.49)). Mercury concentration was not associated with cardiovascular disease in any analysis, and neither was fish consumption or n-3 fatty acids. The fully-adjusted relative risks for the highest versus lowest quartile of mercury concentration were 0.71 (95% Confidence Interval [CI], 0.34, 1.14; p trend  = 0.37) for the nested case-control study, 0.74 (95% CI, 0.32, 1.76; p trend  = 0.43) within the Mediterranean diet intervention group, and 0.50 (95% CI, 0.13, 1.96; p trend  = 0.41) within the control arm of the trial. Associations remained null when mercury was jointly assessed with fish consumption at baseline and during follow

  1. Distribution of mercury in guinea pig offspring after in utero exposure to mercury vapor during late gestation

    Energy Technology Data Exchange (ETDEWEB)

    Yoshida, Minoru; Yamamura, Yukio; Sataoh, Hiroshi

    1986-04-01

    Organ distribution of mercury after in utero mercury vapor exposure was investigated in neonatal guinea pigs. Mother guinea pigs in late gestation were exposed to 0.2-0.3 mg/m/sup 3/ mercury vapor 2 h per day until giving birth. Mercury concentrations in neonatal brain, lungs, heart, kidneys, plasma and erythrocytes were much lower than those of maternal organs and tissues. Neonatal liver, however, showed a mercury concentration twice as high as maternal liver. Mercury concentration ratios of erythrocytes to plasma in offspring were quite different from those of mothers, being 0.2-0.4 for offspring, and 1.3-3.0 for mothers. These results suggested that mercury vapor metabolism in fetuses was quite different from that in their mothers. This may be due to the different blood circulation, as mercury vapor transferred through the placental barrier would be rapidly oxidized into ionic mercury in fetal liver and accumulated in the organ. The different mercury vapor metabolism may prevent fetal brain, which is rapidly developing, and thus vulnerable, from being exposed to excessive mercury vapor.

  2. Energy conservation through more efficient lighting.

    Science.gov (United States)

    Maya, J; Grossman, M W; Lagushenko, R; Waymouth, J F

    1984-10-26

    The efficiency of a mercury-rare gas electrical discharge, which forms the basis of a fluorescent lamp, can be increased about 5 percent simply by increasing the concentration of mercury-196 from 0.146 percent (natural) to about 3 percent. These findings can be implemented immediately without any significant change in the process of manufacturing of this widely used source of illumination, provided that mercury-196 can be obtained economically. The potential energy savings for the United States are estimated to be worth in excess of $200 million per year.

  3. Mercury in mercury(II)-spiked soils is highly susceptible to plant bioaccumulation.

    Science.gov (United States)

    Hlodák, Michal; Urík, Martin; Matúš, Peter; Kořenková, Lucia

    2016-01-01

    Heavy metal phytotoxicity assessments usually use soluble metal compounds in spiked soils to evaluate metal bioaccumulation, growth inhibition and adverse effects on physiological parameters. However, exampling mercury phytotoxicity for barley (Hordeum vulgare) this paper highlights unsuitability of this experimental approach. Mercury(II) in spiked soils is extremely bioavailable, and there experimentally determined bioaccumulation is significantly higher compared to reported mercury bioaccumulation efficiency from soils collected from mercury-polluted areas. Our results indicate this is not affected by soil sorption capacity, thus soil ageing and formation of more stable mercuric complexes with soil fractions is necessary for reasonable metal phytotoxicity assessments.

  4. 46 CFR 196.13-1 - Muster lists, emergency signals, and manning.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 7 2010-10-01 2010-10-01 false Muster lists, emergency signals, and manning. 196.13-1... VESSELS OPERATIONS Station Bills § 196.13-1 Muster lists, emergency signals, and manning. The requirements for muster lists, emergency signals, and manning must be in accordance with subchapter W (Lifesaving...

  5. Below a Historic Mercury Mine: Non-linear Patterns of Mercury Bioaccumulation in Aquatic Organisms

    Science.gov (United States)

    Haas, J.; Ichikawa, G.; Ode, P.; Salsbery, D.; Abel, J.

    2001-12-01

    Unlike most heavy metals, mercury is capable of bioaccumulating in aquatic food-chains, primarily because it is methylated by bacteria in sediment to the more toxic methylmercury form. Mercury concentrations in a number of riparian systems in California are highly elevated as a result of historic mining activities. These activities included both the mining of cinnabar in the coastal ranges to recover elemental mercury and the use of elemental mercury in the gold fields of the Sierra Nevada Mountains. The most productive mercury mining area was the New Almaden District, now a county park, located in the Guadalupe River drainage of Santa Clara County, where cinnabar was mined and retorted for over 100 years. As a consequence, riparian systems in several subwatersheds of the Guadalupe River drainage are contaminated with total mercury concentrations that exceed state hazardous waste criteria. Mercury concentrations in fish tissue frequently exceed human health guidelines. However, the potential ecological effects of these elevated mercury concentrations have not been thoroughly evaluated. One difficulty is in extrapolating sediment concentrations to fish tissue concentrations without accounting for physical and biological processes that determine bioaccumulation patterns. Many processes, such as methylation and demethylation of mercury by bacteria, assimilation efficiency in invertebrates, and metabolic rates in fish, are nonlinear, a factor that often confounds attempts to evaluate the effects of mercury contamination on aquatic food webs. Sediment, benthic macroinvertebrate, and fish tissue samples were collected in 1998 from the Guadalupe River drainage in Santa Clara County at 13 sites upstream and downstream from the historic mining district. Sediment and macroinvertebrate samples were analyzed for total mercury and methylmercury. Fish samples were analyzed for total mercury as whole bodies, composited by species and size. While linear correlations of sediment

  6. Mercury pollution in Wuchuan mercury mining area, Guizhou, Southwestern China: the impacts from large scale and artisanal mercury mining.

    Science.gov (United States)

    Li, Ping; Feng, Xinbin; Qiu, Guangle; Shang, Lihai; Wang, Shaofeng

    2012-07-01

    To evaluate the environmental impacts from large scale mercury mining (LSMM) and artisanal mercury mining (AMM), total mercury (THg) and methyl mercury (MeHg) were determined in mine waste, ambient air, stream water and soil samples collected from Wuchuan mercury (Hg) mining area, Guizhou, Southwestern China. Mine wastes from both LSMM and AMM contained high THg concentrations, which are important Hg contamination sources to the local environment. Total gaseous mercury (TGM) concentrations in the ambient air near AMM furnaces were highly elevated, which indicated that AMM retorting is a major source of Hg emission. THg concentrations in the stream water varied from 43 to 2100 ng/L, where the elevated values were mainly found in the vicinity of AMM and mine waste heaps of LSMM. Surface soils were seriously contaminated with Hg, and land using types and organic matter played an important role in accumulation and transportation of Hg in soil. The results indicated heavy Hg contaminations in the study area, which were resulted from both LSMM and AMM. The areas impacted by LSMM were concentrated in the historical mining and smelting facilities, while Hg pollution resulted from AMM can be distributed anywhere in the Hg mining area. Copyright © 2011 Elsevier Ltd. All rights reserved.

  7. Behaviour of mercury compounds in soil

    Energy Technology Data Exchange (ETDEWEB)

    Booer, J R

    1944-01-01

    The uses of inorganic compounds of mercury for the control of plant pests is reviewed, and a summary of the relevant chemical and physical properties of the compounds concerned is given. On chemical evidence a working hypothesis is propounded showing that all compounds may be expected to decompose into metallic mercury. A pot technique is described by means of which a correlation can be obtained between the effective mercury content of a given soil sample and the rate of growth of wheat seedlings. The mathematical treatment of the results is described, and the validity of the pot technique is verified by statistical analysis of results. Using the pot technqiue it is shown that volatilization losses are insignificant but that mercury is slowly rendered ineffective by the formation of mercuric sulphide. The effect of sulphur-reducing bacteria is considered and the influence of Vibrio desulphuricans on mercury is studied in detail. Experimental evidence obtained by the pot technique is produced to show that mercurous chloride slowly decomposes in the soil giving mercury and mercuric chloride, mercuric chloride rapidly decomposes into mercury and mercurous chloride, and other inorganic compounds decompose directly into mercury. The working hypothesis is substantiated in all major aspects. The uses and properties of the organo-mercury compounds are then discussed. Type compounds selected are ethyl mercury phosphate, phenyl mercury acetate and methoxyethyl mercury acetate. Using the pot technique it is shown that the formation of organo-mercury clays takes place and that these clays decompose giving metallic mercury. A mechanism is suggested.

  8. Mercury in the environment : a review

    International Nuclear Information System (INIS)

    Goodarzi, F.

    2000-01-01

    Both geogenic and anthropogenic sources are responsible for the input of mercury into the environment. However, mercury comes mostly from geogenic sources and is found naturally in air, water and soil. Crustal degassing results in emission of mercury into the atmosphere. Mercury in water and soil is due mostly to input from sedimentary rocks. Mercury in lake sediments is related mainly to input by country rock and anthropogenic activities such as agriculture. The mercury content of coal is similar to or less than the amount found in the earths crust. Natural charcoal is also able to capture mercury at low temperature combustion. The amount of mercury emitted from the stack of coal-fired power plants is related to the nature of the milled coal and its mineralogical and elemental content. Mercury emissions originating from the combustion of coal from electric utility power plants are considered to be among the greatest contributors to global mercury air emissions. In order to quantify the impact the electric power industry has on the environment, information regarding mercury concentrations in coal and their speciation is needed. For this reason the author examined the behaviour of mercury in three coal samples ashed at increasing temperatures. Mercury removal from coal-fired power plants ranges from 10 to 50 per cent by fabric filters and 20 to 95 per cent by FGD systems. This data will help in regulating emissions of hazardous air pollutants from electric utility steam generating units and will potentially provide insight into the industry's contribution to the global mercury burden. 50 refs

  9. Axial mercury segregation in direct current operated low-pressure argon-mercury gas discharge: Part II. Model

    International Nuclear Information System (INIS)

    Gielen, John W A M; Groot, Simon de; Dijk, Jan van; Mullen, Joost J A M van der

    2004-01-01

    In a previous paper we had presented experimental results on mercury segregation due to cataphoresis in direct current operated low-pressure argon-mercury gas discharges. In this paper, we present our model to describe cataphoretic segregation in argon (or another noble gas)-mercury discharges. The model is based on the balance equations for mass and momentum and includes electrophoresis effects of electrons on mercury. Good agreement is found between the experimental results and model calculations. The model confirms our experimental observation that the mercury vapour pressure gradient depends on the local mercury vapour pressure. Furthermore, the model predicts the reversal of the direction of the transport of mercury under certain conditions (the phenomenon known as retrograde cataphoresis)

  10. Mercury in Canadian crude oil

    International Nuclear Information System (INIS)

    Hollebone, B.P.

    2005-01-01

    Estimates for average mercury concentrations in crude oil range widely from 10 ng/g of oil to 3,500 ng/g of oil. With such a broad range of estimates, it is difficult to determine the contributions of the petroleum sector to the total budget of mercury emissions. In response to concerns that the combustion of petroleum products may be a major source of air-borne mercury pollution, Environment Canada and the Canadian Petroleum Products Institute has undertaken a survey of the average total mercury concentration in crude oil processed in Canadian refineries. In order to calculate the potential upper limit of total mercury in all refined products, samples of more than 30 different types of crude oil collected from refineries were measured for their concentration of mercury as it enters into a refinery before processing. High temperature combustion, cold vapour atomic absorption and cold vapour atomic fluorescence were the techniques used to quantify mercury in the samples. The results of the study provide information on the total mass of mercury present in crude oil processed in Canada each year. Results can be used to determine the impact of vehicle exhaust emissions to the overall Canadian mercury emission budget. 17 refs., 2 tabs., 2 figs

  11. MESSENGER: Exploring Mercury's Magnetosphere

    Science.gov (United States)

    Slavin, James A.

    2008-01-01

    The MESSENGER mission to Mercury offers our first opportunity to explore this planet's miniature magnetosphere since Mariner 10's brief fly-bys in 1974-5. Mercury's magnetosphere is unique in many respects. The magnetosphere of Mercury is the smallest in the solar system with its magnetic field typically standing off the solar wind only - 1000 to 2000 km above the surface. For this reason there are no closed dri-fi paths for energetic particles and, hence, no radiation belts; the characteristic time scales for wave propagation and convective transport are short possibly coupling kinetic and fluid modes; magnetic reconnection at the dayside magnetopause may erode the subsolar magnetosphere allowing solar wind ions to directly impact the dayside regolith; inductive currents in Mercury's interior should act to modify the solar In addition, Mercury's magnetosphere is the only one with its defining magnetic flux tubes rooted in a planetary regolith as opposed to an atmosphere with a conductive ionosphere. This lack of an ionosphere is thought to be the underlying reason for the brevity of the very intense, but short lived, approx. 1-2 min, substorm-like energetic particle events observed by Mariner 10 in Mercury's magnetic tail. In this seminar, we review what we think we know about Mercury's magnetosphere and describe the MESSENGER science team's strategy for obtaining answers to the outstanding science questions surrounding the interaction of the solar wind with Mercury and its small, but dynamic magnetosphere.

  12. 46 CFR 196.30-1 - Repairs to boilers and pressure vessels.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 7 2010-10-01 2010-10-01 false Repairs to boilers and pressure vessels. 196.30-1... VESSELS OPERATIONS Reports of Accidents, Repairs, and Unsafe Equipment § 196.30-1 Repairs to boilers and pressure vessels. (a) Before making any repairs to boilers or unfired pressure vessels, the Chief Engineer...

  13. Mercury's Dynamic Magnetic Tail

    Science.gov (United States)

    Slavin, James A.

    2010-01-01

    The Mariner 10 and MESSENGER flybys of Mercury have revealed a magnetosphere that is likely the most responsive to upstream interplanetary conditions of any in the solar system. The source of the great dynamic variability observed during these brief passages is due to Mercury's proximity to the Sun and the inverse proportionality between reconnection rate and solar wind Alfven Mach number. However, this planet's lack of an ionosphere and its small physical dimensions also contribute to Mercury's very brief Dungey cycle, approx. 2 min, which governs the time scale for internal plasma circulation. Current observations and understanding of the structure and dynamics of Mercury's magnetotail are summarized and discussed. Special emphasis will be placed upon such questions as: 1) How much access does the solar wind have to this small magnetosphere as a function of upstream conditions? 2) What roles do heavy planetary ions play? 3) Do Earth-like substorms take place at Mercury? 4) How does Mercury's tail respond to extreme solar wind events such coronal mass ejections? Prospects for progress due to advances in the global magnetohydrodynamic and hybrid simulation modeling and the measurements to be taken by MESSENGER after it enters Mercury orbit on March 18, 2011 will be discussed.

  14. Mercury in Your Environment

    Science.gov (United States)

    Basic information about mercury, how it gets in the air, how people are exposed to it and health effects associated with exposure; what EPA and other organizations are doing to limit exposures; what citizens should know to minimize exposures and to reduce mercury in the environment; and information about products that contain mercury.

  15. Rapid Monitoring of Mercury in Air from an Organic Chemical Factory in China Using a Portable Mercury Analyzer

    Directory of Open Access Journals (Sweden)

    Akira Yasutake

    2011-01-01

    Full Text Available A chemical factory, using a production technology of acetaldehyde with mercury catalysis, was located southeast of Qingzhen City in Guizhou Province, China. Previous research showed heavy mercury pollution through an extensive downstream area. A current investigation of the mercury distribution in ambient air, soils, and plants suggests that mobile mercury species in soils created elevated mercury concentrations in ambient air and vegetation. Mercury concentrations of up to 600 ng/m3 in air over the contaminated area provided evidence of the mercury transformation to volatile Hg(0. Mercury analysis of soil and plant samples demonstrated that the mercury concentrations in soil with vaporized and plant-absorbable forms were higher in the southern area, which was closer to the factory. Our results suggest that air monitoring using a portable mercury analyzer can be a convenient and useful method for the rapid detection and mapping of mercury pollution in advanced field surveys.

  16. Aerobic Mercury-resistant bacteria alter Mercury speciation and retention in the Tagus Estuary (Portugal).

    Science.gov (United States)

    Figueiredo, Neusa L; Canário, João; O'Driscoll, Nelson J; Duarte, Aida; Carvalho, Cristina

    2016-02-01

    Aerobic mercury-resistant bacteria were isolated from the sediments of two highly mercury-polluted areas of the Tagus Estuary (Barreiro and Cala do Norte) and one natural reserve area (Alcochete) in order to test their capacity to transform mercury. Bacterial species were identified using 16S rRNA amplification and sequencing techniques and the results indicate the prevalence of Bacillus sp. Resistance patterns to mercurial compounds were established by the determination of minimal inhibitory concentrations. Representative Hg-resistant bacteria were further tested for transformation pathways (reduction, volatilization and methylation) in cultures containing mercury chloride. Bacterial Hg-methylation was carried out by Vibrio fluvialis, Bacillus megaterium and Serratia marcescens that transformed 2-8% of total mercury into methylmercury in 48h. In addition, most of the HgR bacterial isolates showed Hg(2+)-reduction andHg(0)-volatilization resulting 6-50% mercury loss from the culture media. In summary, the results obtained under controlled laboratory conditions indicate that aerobic Hg-resistant bacteria from the Tagus Estuary significantly affect both the methylation and reduction of mercury and may have a dual face by providing a pathway for pollution dispersion while forming methylmercury, which is highly toxic for living organisms. Copyright © 2015 Elsevier Inc. All rights reserved.

  17. EDITORIAL: Mercury-free discharges for lighting

    Science.gov (United States)

    Haverlag, M.

    2007-07-01

    This special Cluster of articles in Journal of Physics D: Applied Physics covers the subject of mercury-free discharges that are being investigated by different light source researchers, as an alternative to existing mercury-containing lamps. The main driving force to move away from mercury-containing discharge light sources is connected to the environmentally unfriendly nature of mercury. After inhalation or direct contact, severe mercury exposure can lead to damage to human brain cells, the kidneys, the liver and the nervous system. For this reason, the use of mercury in products is becoming more and more restricted by different governmental bodies. In the lighting industry, however, many products still make use of mercury, for different reasons. The main reason is that mercury-containing products are, in most cases, more efficient than mercury-free products. For a realistic comparison of the environmental impact, the mercury-contamination due to electricity production must be taken into account, which depends on the type of fuel being used. For an average European fuel-mix, the amount of mercury that is released into the environment is around 29 μg kWh-1. This means that a typical 30 W TL lamp during a lifetime of 20,000 hours will release a total of about 20 mg mercury due to electricity production, which exceeds the total mercury dose in the lamp (more and more of which is being recycled) by a factor of 5-10 for a modern TL lamp. This illustrates that, quite apart from other environmental arguments like increased CO2 production, mercury-free alternatives that use more energy can in fact be detrimental for the total mercury pollution over the lifetime of the lamp. For this reason, the lighting industry has concentrated on lowering the mercury content in lamps as long as no efficient alternatives exist. Nevertheless, new initiatives for HID lamps and fluorescent lamps with more or less equal efficiency are underway, and a number of them are described in this

  18. Intoxication with metallic mercury

    International Nuclear Information System (INIS)

    Fichte, B.; Assmann, H.; Ritzau, F.

    1984-01-01

    Intoxications by metallic mercury are extremely rare. Report of a patient, who tried to commit suicide by subcutaneous injection of 500 g of metallic mercury. He died 16 months later in the course of the intoxication. A short review is given of effects and reactions of metallic mercury in the human organism. (orig.) [de

  19. Intoxication with metallic mercury

    Energy Technology Data Exchange (ETDEWEB)

    Fichte, B.; Ritzau, F.; Assmann, H.

    1984-02-01

    Intoxications by metallic mercury are extremely rare. Report is given of a patient who tried to commit suicide by subcutaneous injection of 500 g of metallic mercury. He died 16 months later in the course of the intoxication. A short review is given of effects and reactions of metallic mercury in the human organism.

  20. Intoxication with metallic mercury

    Energy Technology Data Exchange (ETDEWEB)

    Fichte, B.; Assmann, H.; Ritzau, F.

    1984-02-01

    Intoxications by metallic mercury are extremely rare. Report is given of a patient, who tried to commit suicide by subcutaneous injection of 500 g of metallic mercury. He died 16 months later in the course of the intoxication. A short review is given of effects and reactions of metallic mercury in the human organism.

  1. Mercury in dated Greenland marine sediments

    DEFF Research Database (Denmark)

    Asmund, G.; Nielsen, S.P.

    2000-01-01

    Twenty marine sediment cores from Greenland were analysed for mercury, and dated by the lead-210 method. In general the cores exhibit a mercury profile with higher mercury concentrations in the upper centimetres of the core. The cores were studied by linear regression of In Hg vs, age of the sedi......Twenty marine sediment cores from Greenland were analysed for mercury, and dated by the lead-210 method. In general the cores exhibit a mercury profile with higher mercury concentrations in the upper centimetres of the core. The cores were studied by linear regression of In Hg vs, age...... indicating that the mercury mainly originates from atmospheric washout. But the large variability indicates that other processes also influence the mercury flux to Arctic marine sediments. (C) 2000 Elsevier Science B.V. All rights reserved....

  2. Mercury kinetics in marine zooplankton

    International Nuclear Information System (INIS)

    Fowler, S.W.; Heyraud, M.; LaRosa, J.

    1976-01-01

    Mercury, like many other heavy metals, is potentially available to marine animals by uptake directly from water and/or through the organisms food. Furthermore, bioavailability, assimilation and subsequent retention in biota may be affected by the chemical species of the element in sea water. While mercury is known to exist in the inorganic form in sea water, recent work has indicated that, in certain coastal areas, a good portion of the total mercury appears to be organically bound; however, the exact chemical nature of the organic fraction has yet to be determined. Methyl mercury may be one constituent of the natural organically bound fraction since microbial mechanisms for in situ methylation of mercury have been demonstrated in the aquatic environment. Despite the fact that naturally produced methyl mercury probably comprises only a small fraction of an aquatic ecosystem, the well-documented toxic effects of this organo-mercurial, caused by man-made introductions into marine food chains, make it an important compound to study

  3. The secondary release of mercury in coal fly ash-based flue-gas mercury removal technology.

    Science.gov (United States)

    He, Jingfeng; Duan, Chenlong; Lei, Mingzhe; Zhu, Xuemei

    2016-01-01

    The secondary release of mercury from coal fly ash is a negative by-product from coal-fired power plants, and requires effective control to reduce environmental pollution. Analysing particle size distribution and composition of the coal fly ash produced by different mercury removing technologies indicates that the particles are generally less than 0.5 mm in size and are composed mainly of SiO2, Al2O3, and Fe2O3. The relationships between mercury concentration in the coal fly ash, its particle size, and loss of ignition were studied using different mercury removing approaches. The research indicates that the coal fly ash's mercury levels are significantly higher after injecting activated carbon or brominating activated carbon when compared to regular cooperating-pollution control technology. This is particularly true for particle size ranges of >0.125, 0.075-0.125, and 0.05-0.075 mm. Leaching experiments revealed the secondary release of mercury in discarded coal fly ash. The concentration of mercury in the coal fly ash increases as the quantity of injecting activated carbon or brominating activated carbon increases. The leached concentrations of mercury increase as the particle size of the coal fly ash increases. Therefore, the secondary release of mercury can be controlled by adding suitable activated carbon or brominating activated carbon when disposing of coal fly ash. Adding CaBr2 before coal combustion in the boiler also helps control the secondary release of mercury, by increasing the Hg(2+) concentration in the leachate. This work provides a theoretical foundation for controlling and removing mercury in coal fly ash disposal.

  4. 75 FR 15413 - Approval for Processing Authority, Foreign-Trade Zone 196, ATC Logistics & Electronics (Personal...

    Science.gov (United States)

    2010-03-29

    ... DEPARTMENT OF COMMERCE Foreign-Trade Zones Board [Order No. 1671] Approval for Processing Authority, Foreign-Trade Zone 196, ATC Logistics & Electronics (Personal Navigation Devices), Fort Worth... & Electronics, an operator of Foreign-Trade Zone 196, has requested processing authority within FTZ 196 in Fort...

  5. Biomarkers of mercury exposure at a mercury recycling facility in Ukraine.

    Science.gov (United States)

    Gibb, Herman Jones; Kozlov, Kostj; Buckley, Jessie Poulin; Centeno, Jose; Jurgenson, Vera; Kolker, Allan; Conko, Kathryn; Landa, Edward; Panov, Boris; Panov, Yuri; Xu, Hanna

    2008-08-01

    This study evaluates biomarkers of occupational mercury exposure among workers at a mercury recycling operation in Gorlovka, Ukraine. The 29 study participants were divided into three occupational categories for analysis: (1) those who worked in the mercury recycling operation (Group A, n = 8), (2) those who worked at the facility but not in the yard where the recycling was done (Group B, n = 14), and (3) those who did not work at the facility (Group C, n = 7). Urine, blood, hair, and nail samples were collected from the participants, and a questionnaire was administered to obtain data on age, gender, occupational history, smoking, alcohol consumption, fish consumption, tattoos, dental amalgams, home heating system, education, source of drinking water, and family employment in the former mercury mine/smelter located on the site of the recycling facility. Each factor was tested in a univariate regression with total mercury in urine, blood, hair, and nails. Median biomarker concentrations were 4.04 microg/g-Cr (urine), 2.58 microg/L (blood), 3.95 microg/g (hair), and 1.16 microg/g (nails). Occupational category was significantly correlated (p recycling operation had the highest blood and urinary mercury levels. Those who worked at the facility but were not directly involved with the recycling operation had higher levels than those who did not work at the facility.

  6. Groundwater Modeling Of Mercury Pollution At A Former Mercury Cell Chlor Alkali Facility In Pavoldar, Kazakhstan

    Science.gov (United States)

    In Kazakhstan, there is a serious case of mercury pollution near the city of Pavlodar from an old mercury cell chlor-alkali plant. The soil, sediment, and water is severly contaminated with mercury and mercury compounds as a result of the industrial activity of this chemical pla...

  7. Process for low mercury coal

    Science.gov (United States)

    Merriam, Norman W.; Grimes, R. William; Tweed, Robert E.

    1995-01-01

    A process for producing low mercury coal during precombustion procedures by releasing mercury through discriminating mild heating that minimizes other burdensome constituents. Said mercury is recovered from the overhead gases by selective removal.

  8. Mercury's magnetic field and interior

    International Nuclear Information System (INIS)

    Connerney, J.E.P.; Ness, N.F.

    1988-01-01

    The magnetic-field data collected on Mercury by the Mariner-10 spacecraft present substantial evidence for an intrinsic global magnetic field. However, studies of Mercury's thermal evolution show that it is most likely that the inner core region of Mercury solidified or froze early in the planet's history. Thus, the explanation of Mercury's magnetic field in the framework of the traditional planetary dynamo is less than certain

  9. Multi-model study of mercury dispersion in the atmosphere: vertical and interhemispheric distribution of mercury species

    Directory of Open Access Journals (Sweden)

    J. Bieser

    2017-06-01

    Full Text Available Atmospheric chemistry and transport of mercury play a key role in the global mercury cycle. However, there are still considerable knowledge gaps concerning the fate of mercury in the atmosphere. This is the second part of a model intercomparison study investigating the impact of atmospheric chemistry and emissions on mercury in the atmosphere. While the first study focused on ground-based observations of mercury concentration and deposition, here we investigate the vertical and interhemispheric distribution and speciation of mercury from the planetary boundary layer to the lower stratosphere. So far, there have been few model studies investigating the vertical distribution of mercury, mostly focusing on single aircraft campaigns. Here, we present a first comprehensive analysis based on various aircraft observations in Europe, North America, and on intercontinental flights. The investigated models proved to be able to reproduce the distribution of total and elemental mercury concentrations in the troposphere including interhemispheric trends. One key aspect of the study is the investigation of mercury oxidation in the troposphere. We found that different chemistry schemes were better at reproducing observed oxidized mercury patterns depending on altitude. High concentrations of oxidized mercury in the upper troposphere could be reproduced with oxidation by bromine while elevated concentrations in the lower troposphere were better reproduced by OH and ozone chemistry. However, the results were not always conclusive as the physical and chemical parameterizations in the chemistry transport models also proved to have a substantial impact on model results.

  10. Vertical Distribution of Total Mercury and Mercury Methylation in a Landfill Site in Japan

    Directory of Open Access Journals (Sweden)

    Jing Yang

    2018-06-01

    Full Text Available Mercury is a neurotoxin, with certain organic forms of the element being particularly harmful to humans. The Minamata Convention was adopted to reduce the intentional use and emission of mercury. Because mercury is an element, it cannot be decomposed. Mercury-containing products and mercury used for various processes will eventually enter the waste stream, and landfill sites will become a mercury sink. While landfill sites can be a source of mercury pollution, the behavior of mercury in solid waste within a landfill site is still not fully understood. The purpose of this study was to determine the depth profile of mercury, the levels of methyl mercury (MeHg, and the factors controlling methylation in an old landfill site that received waste for over 30 years. Three sampling cores were selected, and boring sampling was conducted to a maximum depth of 18 m, which reached the bottom layer of the landfill. Total mercury (THg and MeHg were measured in the samples to determine the characteristics of mercury at different depths. Bacterial species were identified by 16S rRNA amplification and sequencing, because the methylation process is promoted by a series of genes. It was found that the THg concentration was 19–975 ng/g, with a geometric mean of 298 ng/g, which was slightly less than the 400 ng/g concentration recorded 30 years previously. In some samples, MeHg accounted for up to 15–20% of THg, which is far greater than the general level in soils and sediments, although the source of MeHg was unclear. The genetic data indicated that hgcA was present mostly in the upper and lower layers of the three cores, merA was almost as much as hgcA, while the level of merB was hundreds of times less than those of the other two genes. A significant correlation was found between THg and MeHg, as well as between MeHg and MeHg/THg. In addition, a negative correlation was found between THg and merA. The coexistence of the three genes indicated that both

  11. miR-196a targets netrin 4 and regulates cell proliferation and migration of cervical cancer cells

    International Nuclear Information System (INIS)

    Zhang, Jie; Zheng, Fangxia; Yu, Gang; Yin, Yanhua; Lu, Qingyang

    2013-01-01

    Highlights: •miR-196a was overexpressed in cervical cancer tissue compared to normal tissue. •miR-196a expression elevated proliferation and migration of cervical cancer cells. •miR-196a inhibited NTN4 expression by binding 3′-UTR region of NTN4 mRNA. •NTN4 inversely correlated with miR-196a expression in cervical tissue and cell line. •NTN4 expression was low in cervical cancer tissue compared to normal tissue. -- Abstract: Recent research has uncovered tumor-suppressive and oncogenic potential of miR-196a in various tumors. However, the expression and mechanism of its function in cervical cancer remains unclear. In this study, we assess relative expression of miR-196a in cervical premalignant lesions, cervical cancer tissues, and four cancer cell lines using quantitative real-time PCR. CaSki and HeLa cells were treated with miR-196a inhibitors, mimics, or pCDNA/miR-196a to investigate the role of miR-196a in cancer cell proliferation and migration. We demonstrated that miR-196a was overexpressed in cervical intraepithelial neoplasia 2–3 and cervical cancer tissue. Moreover, its expression contributes to the proliferation and migration of cervical cancer cells, whereas inhibiting its expression led to a reduction in proliferation and migration. Five candidate targets of miR-196a chosen by computational prediction and Cervical Cancer Gene Database search were measured for their mRNA in both miR-196a-overexpressing and -depleted cancer cells. Only netrin 4 (NTN4) expression displayed an inverse association with miR-196a. Fluorescent reporter assays revealed that miR-196a inhibited NTN4 expression by targeting one binding site in the 3′-untranslated region (3′-UTR) of NTN4 mRNA. Furthermore, qPCR and Western blot assays verified NTN4 expression was downregulated in cervical cancer tissues compared to normal controls, and in vivo mRNA level of NTN4 inversely correlated with miR-196a expression. In summary, our findings provide new insights about the

  12. Mercury (Environmental Health Student Portal)

    Science.gov (United States)

    ... in contact with) to mercury is by eating fish or shellfish that have high levels of mercury. You can also get sick from: Touching it Breathing it in Drinking contaminated water How can mercury ...

  13. Dipole Bands in 196Hg

    International Nuclear Information System (INIS)

    Lawrie, J. J.; Lawrie, E. A.; Newman, R. T.; Sharpey-Schafer, J. F.; Smit, F. D.; Msezane, B.; Benatar, M.; Mabala, G. K.; Mutshena, K. P.; Federke, M.; Mullins, S. M.; Ncapayi, N. J.; Vymers, P.

    2011-01-01

    High spin states in 196 Hg have been populated in the 198 Pt(α,6n) reaction at 65 MeV and the level scheme has been extended. A new dipole band has been observed and a previously observed dipole has been confirmed. Excitation energies, spins and parities of these bands were determined from DCO ratio and linear polarization measurements. Possible quasiparticle excitations responsible for these structures are discussed.

  14. Elimination of mercury in health care facilities.

    Science.gov (United States)

    2000-03-01

    Mercury is a persistent, bioaccumulative toxin that has been linked to numerous health effects in humans and wildlife. It is a potent neurotoxin that may also harm the brain, kidneys, and lungs. Unborn children and young infants are at particular risk for brain damage from mercury exposure. Hospitals' use of mercury in chemical solutions, thermometers, blood pressure gauges, batteries, and fluorescent lamps makes these facilities large contributors to the overall emission of mercury into the environment. Most hospitals recognize the dangers of mercury. In a recent survey, four out of five hospitals stated that they have policies in place to eliminate the use of mercury-containing products. Sixty-two percent of them require vendors to disclose the presence of mercury in chemicals that the hospitals purchase. Only 12 percent distribute mercury-containing thermometers to new parents. Ninety-two percent teach their employees about the health and environmental effects of mercury, and 46 percent teach all employees how to clean up mercury spills. However, the same study showed that many hospitals have not implemented their policies. Forty-two percent were not aware whether they still purchased items containing mercury. In addition, 49 percent still purchase mercury thermometers, 44 percent purchase mercury gastrointestinal diagnostic equipment, and 64 percent still purchase mercury lab thermometers.

  15. Mercury

    CERN Document Server

    Balogh, André; Steiger, Rudolf

    2008-01-01

    Mercury, the planet closest to the Sun, is different in several respects from the other three terrestrial planets. In appearance, it resembles the heavily cratered surface of the Moon, but its density is high, it has a magnetic field and magnetosphere, but no atmosphere or ionosphere. This book reviews the progress made in Mercury studies since the flybys by Mariner 10 in 1974-75, based on the continued research using the Mariner 10 archive, on observations from Earth, and on increasingly realistic models of its interior evolution.

  16. Autometallographic tracing of mercury in frog liver

    International Nuclear Information System (INIS)

    Loumbourdis, N.S.; Danscher, G.

    2004-01-01

    The distribution of mercury in the liver of the frog Rana ridibunda with the autometallographic method was investigated. The mercury specific autometallographic (HgS/Se AMG ) technique is a sensitive histochemical approach for tracing mercury in tissues from mercury-exposed organisms. Mercury accumulates in vivo as mercury sulphur/mercury selenium nanocrystals that can be silver-enhanced. Thus, only a fraction of the Hg can be visualized. Six animals were exposed for one day and another group of six animals for 6 days in 1 ppm mercury (as HgCI 2 ) dissolved in fresh water. A third group of six animals, served as controls, were sacrificed the day of arrival at the laboratory. First, mercury appears in the blood plasma and erythrocytes. Next, mercury moves to hepatocytes and in the apical part of the cells, that facing bile canaliculi. In a next step, mercury appears in the endothelial and Kupffer cells. It seems likely that, the mercury of hepatocytes moves through bile canaliculi to the gut, most probably bound to glutathione and/or other similar ligands. Most probably, the endothelial and Kupffer cells comprise the first line of defense against metal toxicity. - Frogs can be good bioindicators of mercury

  17. Method and apparatus for sampling atmospheric mercury

    Science.gov (United States)

    Trujillo, Patricio E.; Campbell, Evan E.; Eutsler, Bernard C.

    1976-01-20

    A method of simultaneously sampling particulate mercury, organic mercurial vapors, and metallic mercury vapor in the working and occupational environment and determining the amount of mercury derived from each such source in the sampled air. A known volume of air is passed through a sampling tube containing a filter for particulate mercury collection, a first adsorber for the selective adsorption of organic mercurial vapors, and a second adsorber for the adsorption of metallic mercury vapor. Carbon black molecular sieves are particularly useful as the selective adsorber for organic mercurial vapors. The amount of mercury adsorbed or collected in each section of the sampling tube is readily quantitatively determined by flameless atomic absorption spectrophotometry.

  18. Methods for dispensing mercury into devices

    Science.gov (United States)

    Grossman, Mark W.; George, William A.

    1987-04-28

    A process for dispensing mercury into devices which requires mercury. Mercury is first electrolytically separated from either HgO or Hg.sub.2 Cl.sub.2 and plated onto a cathode wire. The cathode wire is then placed into a device requiring mercury.

  19. Mercury erosion experiments for spallation target system

    International Nuclear Information System (INIS)

    Kinoshita, Hidetaka; Kaminaga, Masanori; Haga, Katsuhiro; Hino, Ryutaro

    2003-01-01

    The Japan Atomic Energy Research Institute (JAERI) and the High Energy Accelerator Research Organization (KEK) are promoting a plan to construct the spallation neutron source at the Tokai Research Establishment, JAERI, under the High-Intensity Proton Accelerator Project (J-PARC). A mercury circulation system has been designed so as to supply mercury to the target stably under the rated flow rate of 41 m 3 /hr. Then, it was necessary to confirm a mercury pump performance from the viewpoint of making the mercury circulation system feasible, and more, to investigate erosion rate under the mercury flow as well as an amount of mercury remained on the surface after drain from the viewpoints of mechanical strength relating to the lifetime and remote handling of mercury components. The mercury pump performance was tested under the mercury flow conditions by using an experimental gear pump, which had almost the same structure as a practical mercury pump to be expected in the mercury circulation system, and the erosion rates in a mercury pipeline as well as the amount of mercury remained on the surface were also investigated. The discharged flow rates of the experimental gear pump increased linearly with the rotation speed, so that the gear pump would work as the flow meter. Erosion rates obtained under the mercury velocity less than 1.6 m/s was found to be so small that decrease of pipeline wall thickness would be 390 μm after 30-year operation under the rated mercury velocity of 0.7 m/s. For the amount of remaining mercury on the pipeline, remaining rates of weight and volume were estimated at 50.7 g/m 2 and 3.74 Hg-cm 3 /m 2 , respectively. Applying these remaining rates of weight and volume to the mercury target, the remaining mercury was estimated at about 106.5 g and 7.9 cm 3 . Radioactivity of this remaining mercury volume was found to be three-order lower than that of the target casing. (author)

  20. Histochemical demonstration of two mercury pools in trout tissues: mercury in kidney and liver after mercuric chloride exposure

    DEFF Research Database (Denmark)

    Baatrup, E; Nielsen, M G; Danscher, G

    1987-01-01

    Juvenile rainbow trout (Salmo gairdneri) were exposed to 100 ppb mercury (as HgCl2) in the water for 14 days. Concentrations of mercury in water and fish organs were monitored using radiolabeled mercury. Tissues from kidney and liver were fixed, and sections were developed by autometallography......, a method whereby accumulations of mercury sulfides and/or mercury selenides are silver amplified. In the kidney, mercury was found within lysosomes and extracellularly in the basal lamina of proximal tubules. In the liver, mercury was found within lysosomes of the hepatocytes. Additional groups of mercury......-exposed trout were subjected to selenium (as Na2SeO3), administered intraperitoneally 2 hr before fixation. Following this treatment, additional mercury could be visualized in the kidney circulatory system, including glomeruli, and in the nucleus and endoplasmic reticulum of liver cells. It is suggested...

  1. Mercury flow experiments. 4th report Measurements of erosion rate caused by mercury flow

    CERN Document Server

    Kinoshita, H; Hino, R; Kaminaga, M

    2002-01-01

    The Japan Atomic Energy Research Institute (JAERI) and the High Energy Accelerator Research Organization (KEK) are promoting a construction plan of the Material-Life Science Facility, which is consisted of a Muon Science Facility and a Neutron Scattering Facility, in order to open up the new science fields. The Neutron Scattering Facility will be utilized for advanced fields of Material and Life science using high intensity neutron generated by the spallation reaction of a 1 MW pulsed proton beam and mercury target. Design of the spallation mercury target system aims to obtain high neutron performance with high reliability and safety. Since the target system is using mercury as the target material and contains large amount of radioactive spallation products, it is necessary to estimate reliability for strength of instruments in a mercury flow system during lifetime of the facility. Piping and components in the mercury flow system would be damaged by erosion with mercury flow, since these components will be we...

  2. Mercury uptake in vivo by normal and acatalasemic mice exposed to metallic mercury vapor (203Hg degrees) and injected with metallic mercury or mercuric chloride (203HgCl2)

    International Nuclear Information System (INIS)

    Ogata, M.; Kenmotsu, K.; Hirota, N.; Meguro, T.; Aikoh, H.

    1985-01-01

    Levels of mercury in the brain and liver of acatalasemic mice immediately following exposure to metallic mercury vapor or injection of metallic mercury were higher than those found in normal mice. Acatalasemic mice had decreased levels of mercury in the blood and kidneys when the levels were compared with those of normal mice, which indicated that catalase plays a role in oxidizing and taking up mercury. Thus, the brain/blood or liver/blood ratio of mercury concentration in acatalasemic mice was significantly higher than that of normal mice. These results suggest that metallic mercury in the blood easily passed through the blood-brain or blood-liver barrier. The levels of mercury distribution to the kidneys of normal and acatalasemic mice, 1 hr after injection of mercuric chloride solution, were higher than that of normal and acatalasemic mice, respectively, 1 hr after injection of metallic mercury

  3. Mercury content in Hot Springs

    Energy Technology Data Exchange (ETDEWEB)

    Nakagawa, R

    1974-01-01

    A method of determination of mercury in hot spring waters by flameless atomic absorption spectrophotometry is described. Further, the mercury content and the chemical behavior of the elementary mercury in hot springs are described. Sulfide and iodide ions interfered with the determination of mercury by the reduction-vapor phase technique. These interferences could, however, be minimized by the addition of potassium permanganate. Waters collected from 55 hot springs were found to contain up to 26.0 ppb mercury. High concentrations of mercury have been found in waters from Shimoburo Springs, Aomori (10.0 ppb), Osorezan Springs, Aomori (1.3 approximately 18.8 ppb), Gosyogake Springs, Akita (26.0 ppb), Manza Springs, Gunma (0.30 approximately 19.5 ppb) and Kusatu Springs, Gunma (1.70 approximately 4.50 ppb). These hot springs were acid waters containing a relatively high quantity of chloride or sulfate.

  4. Method and apparatus for monitoring mercury emissions

    Science.gov (United States)

    Durham, Michael D.; Schlager, Richard J.; Sappey, Andrew D.; Sagan, Francis J.; Marmaro, Roger W.; Wilson, Kevin G.

    1997-01-01

    A mercury monitoring device that continuously monitors the total mercury concentration in a gas. The device uses the same chamber for converting speciated mercury into elemental mercury and for measurement of the mercury in the chamber by radiation absorption techniques. The interior of the chamber is resistant to the absorption of speciated and elemental mercury at the operating temperature of the chamber.

  5. Return to Mercury: a global perspective on MESSENGER's first Mercury flyby.

    Science.gov (United States)

    Solomon, Sean C; McNutt, Ralph L; Watters, Thomas R; Lawrence, David J; Feldman, William C; Head, James W; Krimigis, Stamatios M; Murchie, Scott L; Phillips, Roger J; Slavin, James A; Zuber, Maria T

    2008-07-04

    In January 2008, the MErcury Surface, Space ENvironment, GEochemistry, and Ranging (MESSENGER) spacecraft became the first probe to fly past the planet Mercury in 33 years. The encounter revealed that Mercury is a dynamic system; its liquid iron-rich outer core is coupled through a dominantly dipolar magnetic field to the surface, exosphere, and magnetosphere, all of which interact with the solar wind. MESSENGER images confirm that lobate scarps are the dominant tectonic landform and record global contraction associated with cooling of the planet. The history of contraction can be related to the history of volcanism and cratering, and the total contractional strain is at least one-third greater than inferred from Mariner 10 images. On the basis of measurements of thermal neutrons made during the flyby, the average abundance of iron in Mercury's surface material is less than 6% by weight.

  6. Acalabrutinib (ACP-196: a selective second-generation BTK inhibitor

    Directory of Open Access Journals (Sweden)

    Jingjing Wu

    2016-03-01

    Full Text Available Abstract More and more targeted agents become available for B cell malignancies with increasing precision and potency. The first-in-class Bruton’s tyrosine kinase (BTK inhibitor, ibrutinib, has been in clinical use for the treatment of chronic lymphocytic leukemia, mantle cell lymphoma, and Waldenstrom’s macroglobulinemia. More selective BTK inhibitors (ACP-196, ONO/GS-4059, BGB-3111, CC-292 are being explored. Acalabrutinib (ACP-196 is a novel irreversible second-generation BTK inhibitor that was shown to be more potent and selective than ibrutinib. This review summarized the preclinical research and clinical data of acalabrutinib.

  7. Mercury: Aspects of its ecology and environmental toxicity. [physiological effects of mercury compound contamination of environment

    Science.gov (United States)

    Siegel, S. M.

    1973-01-01

    A study was conducted to determine the effects of mercury pollution on the environment. The possible sources of mercury contamination in sea water are identified. The effects of mercury on food sources, as represented by swordfish, are analyzed. The physiological effects of varying concentrations of mercury are reported. Emphasis is placed on the situation existing in the Hawaiian Islands.

  8. Axial mercury segregation in direct current operated low-pressure argon-mercury gas discharges: Part I. Experimental

    International Nuclear Information System (INIS)

    Gielen, John W A M; Groot, Simon de; Mullen, Joost J A M van der

    2004-01-01

    Due to cataphoresis, axial segregation of mercury will occur when the gas discharge of a fluorescent lamp is operated by means of a direct current. A consequence of this is a non-uniform axial luminance distribution along the lamp. To determine the degree of axial mercury segregation experimentally, axial luminance distributions have been measured which are converted into axial mercury vapour pressure distributions by an appropriate calibration method. The mercury segregation has been investigated for variations in lamp tube radius (3.6-4.8 mm), argon buffer gas pressure (200-600 Pa) and lamp current (100-250 mA) at mercury vapour pressures set at the anode in the range from 0.2 to 9.0 Pa. From the experiments it has been concluded that the mercury vapour pressure gradient at any axial position for a certain lamp tube diameter, argon pressure and lamp current depends on the local mercury vapour pressure. This observation is in contrast to assumptions made in earlier modelling publications in which one mercury vapour pressure gradient is used for all axial positions. By applying a full factorial design, an empirical relation of the mercury segregation is found for any set of parameters inside the investigated parameter ranges

  9. Mercury Sorption onto Malt Spent Rootlets

    Science.gov (United States)

    Manariotis, I. D.; Anagnostopoulos, V.; Karapanagioti, H. K.; Chrysikopoulos, C.

    2011-12-01

    Mercury is a metal of particular concern due to its toxicity even at relatively low concentrations. The maximum permissible level for mercury in drinking water set by the European Union is 0.001 mg/L. Mercury is released into the environment via four principal pathways: (1) natural processes; i.e. a volcanic eruption, (2) incidental to some other activity; i.e. coal burning power plants, (3) accidentally during the manufacture, breakage or disposal of products that have mercury put into them deliberately, and (4) direct use in industrial settings. The present study focuses on the removal of mercury (II) from aqueous solutions via sorption onto Malt Spent Rootlets (MSR). Batch experiments were conducted employing MSR with size ranging from 0.18 to 1 mm. The effects of pH, mercury concentration, contact time, and solid to liquid ratio on mercury sorption onto MSR were investigated. The highest mercury removal from the aqueous phase, of 41%, was observed at pH of 5.

  10. Mercury Exposure: Protein Biomarkers of Mercury Exposure in Jaraqui Fish from the Amazon Region.

    Science.gov (United States)

    Vieira, José Cavalcante Souza; Braga, Camila Pereira; de Oliveira, Grasieli; Padilha, Cilene do Carmo Federici; de Moraes, Paula Martin; Zara, Luiz Fabricio; Leite, Aline de Lima; Buzalaf, Marília Afonso Rabelo; Padilha, Pedro de Magalhães

    2018-05-01

    This study presents data on the extraction and characterization of proteins associated with mercury in the muscle and liver tissues of jaraqui (Semaprochilodus spp.) from the Madeira River in the Brazilian Amazon. Protein fractionation was carried out by two-dimensional electrophoresis (2D-PAGE). Mercury determination in tissues, pellets, and protein spots was performed by graphite furnace atomic absorption spectrometry (GFAAS). Proteins in the spots that showed mercury were characterized by electrospray ionization tandem mass spectrometry (ESI-MS/MS). The highest mercury concentrations were found in liver tissues and pellets (426 ± 6 and 277 ± 4 μg kg -1 ), followed by muscle tissues and pellets (132 ± 4 and 86 ± 1 μg kg -1 , respectively). Mercury quantification in the protein spots allowed us to propose stoichiometric ratios in the range of 1-4 mercury atoms per molecule of protein in the protein spots. The proteins characterized in the analysis by ESI-MS/MS were keratin, type II cytoskeletal 8, parvalbumin beta, parvalbumin-2, ubiquitin-40S ribosomal S27a, 39S ribosomal protein L36 mitochondrial, hemoglobin subunit beta, and hemoglobin subunit beta-A/B. The results suggest that proteins such as ubiquitin-40S ribosomal protein S27a, which have specific domains, possibly zinc finger, can be used as biomarkers of mercury, whereas mercury and zinc present characteristics of soft acids.

  11. Method for the removal and recovery of mercury

    Science.gov (United States)

    Easterly, Clay E.; Vass, Arpad A.; Tyndall, Richard L.

    1997-01-01

    The present invention is an enhanced method for the removal and recovery of mercury from mercury-contaminated matrices. The method involves contacting a mercury-contaminated matrix with an aqueous dispersant solution derived from specific intra-amoebic isolates to release the mercury from the mercury-contaminated matrix and emulsify the mercury; then, contacting the matrix with an amalgamating metal from a metal source to amalgamate the mercury to the amalgamating metal; removing the metallic source from the mercury-contaminated matrix; and heating the metallic source to vaporize the mercury in a closed system to capture the mercury vapors.

  12. Isolation, screening and identification of mercury resistant bacteria from mercury contaminated soil

    OpenAIRE

    Kowalczyk Anna; Wilińska Magdalena; Chyc Marek; Bojko Monika; Latowski Dariusz

    2016-01-01

    New bacterial strains resistant to high concentration of mercury were obtained and character iz ed focusing on their potential application in bioremediation. The biological material was isolated from soil contaminated with mercury. The ability to removal of Hg from the liquid medium and the effect of the various pH and mercury concentrations in the environment on bacterial strains growth kinetics were tested. The selected strains were identified by analysis of the 16S ribosome subunit coding ...

  13. Groundwater Modeling of Mercury Pollution at a Former Mercury Cell Chlor Alkali Facility in Pavlodar City, Kazakhstan

    Science.gov (United States)

    In northern Kazakhstan, there is a serious case of mercury pollution near the city of Pavlodar from an old mercury cell chlor-alkali plant. The soil, sediment, and water is severely contaminated with mercury and mercury compounds as a result of the industrial activity of this ch...

  14. Phytoremediation of Ionic and Methyl Mercury Pollution

    Energy Technology Data Exchange (ETDEWEB)

    Meagher, Richard B.

    2004-12-01

    Phytoremediation is defined as the use of plants to extract, resist, detoxify, and/or sequester toxic environmental pollutants. The long-term goal of the proposed research is to develop and test highly productive, field-adapted plant species that have been engineered for the phytoremediation of mercury. A variety of different genes, which should enable plants to clean mercury polluted sites are being tested as tools for mercury phytoremediation, first in model laboratory plants and then in potential field species. Several of these genes have already been shown to enhance mercury phytoremediation. Mercury pollution is a serious, world-wide problem affecting the health of human and wildlife populations. Environmentally, the most serious mercury threat is the production of methylmercury (CH3Hg+) by native bacteria at mercury contaminated wetland sites. Methylmercury is inherently more toxic than metallic (Hg(0)) or ionic (Hg(II)) mercury, and because methylmercury is prolifically biomagnified up the food chain, it poses the most immediate danger to animal populations. We have successfully engineered two model plants, Arabidopsis and tobacco, to use the bacterial merB gene to convert methylmercury to less toxic ionic mercury and to use the bacterial merA gene to further detoxify ionic mercury to the least toxic form of mercury, metallic mercury. Plants expressing both MerA and MerB proteins detoxify methylmercury in two steps to the metallic form. These plants germinate, grow, and set seed at normal growth rates on levels of methylmercury or ionic mercury that are lethal to normal plants. Our newest efforts involve engineering plants with several additional bacterial and plant genes that allow for higher levels of mercury resistance and mercury hyperaccumulation. The potential for these plants to hyperaccumulate mercury was further advanced by developing constitutive, aboveground, and root-specific gene expression systems.

  15. Mercury emission from crematories in Japan

    Directory of Open Access Journals (Sweden)

    M. Takaoka

    2010-04-01

    Full Text Available Anthropogenic sources of mercury emissions have a significant impact on global pollution. Therefore, finding uncharacterised sources and assessing the emissions from these sources are important. However, limited data are available worldwide on mercury emissions from crematories. In Japan, 99.9% of dead bodies are cremated, which is the highest percentage in the world, and more than 1600 crematories are in operation. We thus focused on emissions from crematories in Japan. The number of targeted facilities was seven, and we used continuous emission monitoring to measure the mercury concentrations and investigate mercury behaviour. The total mercury concentrations in stack gases were a few μg/Nm3 (normal cubic meters. Considering the time profile of mercury and its species in cremations, the findings confirmed that the mercury in stack gas originated from dental amalgam. The amount of mercury emissions was calculated using the total concentration and gas flow rate. Furthermore, the annual amount of mercury emission from crematories in Japan was estimated by using the total number of corpses. The emission amount was considerably lower than that estimated in the United Kingdom. From statistical analyses on population demographics and measurements, future total emissions from crematories were also predicted. As a result, the amount of mercury emitted by crematories will likely increase by 2.6-fold from 2007 to 2037.

  16. Genetic effects of organic mercury compounds

    Energy Technology Data Exchange (ETDEWEB)

    Ramel, C

    1967-01-01

    Organic mercury compounds have a c-mitotic effect on plant cells that cause polyploidi. Studies were performed on Allium root cells. These investigations involved methyl mercury dicyandiamide, methyl mercury hydroxide, and phenyl mercury hydroxide. The lowest concentration necessary for a cytologically observable effect was about 0.05 ppM Hg for the methyl compounds. For the phenyl compound, the value was lower. Experiments were performed on Drosophila melanogaster. The question was whether the mercury would reach the gonads. Experimental data with mercury treated larvae indicated a chromosome disjunction. Data indicated a preferential segregation at the meiotic division might be involved. Experiments are being performed on mice inbred (CBA) in order to investigate teratogenic effects and dominant lethality caused by organic mercury compounds. The mutagenic effects of these compounds are studied on Neurospora Drosophila. No conclusive data is now available.

  17. Phytoremediation of Ionic and Methyl Mercury Pollution

    Energy Technology Data Exchange (ETDEWEB)

    Meagher, Richard B.

    2005-06-01

    Phytoremediation is defined as the use of plants to extract, resist, detoxify, and/or sequester toxic environmental pollutants. The long-term goal of the proposed research is to develop and test highly productive, field-adapted plant species that have been engineered for the phytoremediation of mercury. A variety of different genes, which should enable plants to clean mercury polluted sites are being tested as tools for mercury phytoremediation, first in model laboratory plants and then in potential field species. Several of these genes have already been shown to enhance mercury phytoremediation. Mercury pollution is a serious, world-wide problem affecting the health of human and wildlife populations. Environmentally, the most serious mercury threat is the production of methylmercury (CH3Hg+) by native bacteria at mercury contaminated wetland sites. Methylmercury is inherently more toxic than metallic (Hg(0)) or ionic (Hg(II)) mercury, and because methylmercury is prolifically biomagnified up the food chain, it poses the most immediate danger to animal populations. We have successfully engineered two model plants, Arabidopsis and tobacco, to use the bacterial merB gene to convert methylmercury to less toxic ionic mercury and to use the bacterial merA gene to further detoxify ionic mercury to the least toxic form of mercury, metallic mercury. Plants expressing both MerA and MerB proteins detoxify methylmercury in two steps to the metallic form. These plants germinate, grow, and set seed at normal growth rates on levels of methylmercury or ionic mercury that are lethal to normal plants. Our newest efforts involve engineering plants with several additional bacterial and plant genes that allow for higher levels of mercury resistance and mercury hyperaccumulation. The potential for these plants to hyperaccumulate mercury was further advanced by developing constitutive, aboveground, and root-specific gene expression systems. Our current strategy is to engineer plants to

  18. MERCURY IN MARINE LIFE DATABASE

    Science.gov (United States)

    The purpose of the Mercury in Marine Life Project is to organize information on estuarine and marine species so that EPA can better understand both the extent of monitoring for mercury and level of mercury contamination in the biota of coastal environments. This report follows a ...

  19. Possible interferences of mercury sulfur compounds with ethylated and methylated mercury species using HPLC-ICP-MS

    International Nuclear Information System (INIS)

    Wilken, R.D.; Nitschke, F.; Falter, R.

    2003-01-01

    The HPLC-ICP-MS coupling technique is able to separate and detect methyl, ethyl and inorganic mercury isotopes specifically. An identification of ethyl mercury(+) is not possible when the widely used sodium tetraethylborate derivatisation method in combination with GC-AFS/AAS or ICP-MS techniques is performed because it contains ethyl groups. An unidentified compound with the same retention time as ethyl mercury was found in the HPLC chromatograms of industrial sewage samples and humic-rich soils of microcosm experiments after applying water vapour distillation. We also observed such unidentified peaks in samples of heavily contaminated sites in Eastern Germany, separated by HPLC fractionation only. In the experiments described, different mercury sulfur adducts were synthesised and tested for their retention times in the HPLC-ICP-MS system. It was found that the compound CH 3 -S-Hg + showed the same retention time as the ethyl mercury standard. It is therefore possible that ethyl mercury detected in chromatography by comparison of the retention time could also be due to an adduct of a sulfur compound and a mercury species. CH 3 -S-Hg + should be tested in other chromatographic mercury speciation methods for this effect. This work can also be regarded as a contribution to the discussion of artificially occurring methyl mercury in sediments during sample preparation. (orig.)

  20. Mercury pollution in Malaysia.

    Science.gov (United States)

    Hajeb, Parvaneh; Jinap, S; Ismail, Ahmad; Mahyudin, Nor Ainy

    2012-01-01

    Although several studies have been published on levels of mercury contamination of the environment, and of food and human tissues in Peninsular Malaysia, there is a serious dearth of research that has been performed in East Malaysia (Sabah and Sarawak). Industry is rapidly developing in East Malaysia, and, hence, there is a need for establishing baseline levels of mercury contamination in environmental media in that part of the country by performing monitoring studies. Residues of total mercury and inorganic in food samples have been determined in nearly all previous studies that have been conducted; however, few researchers have analyzed samples for the presence of methlymercury residues. Because methylmercury is the most toxic form of mercury, and because there is a growing public awareness of the risk posed by methylmercury exposure that is associated with fish and seafood consumption, further monitoring studies on methylmercury in food are also essential. From the results of previous studies, it is obvious that the economic development in Malaysia, in recent years, has affected the aquatic environment of the country. Primary areas of environmental concern are centered on the rivers of the west Peninsular Malaysian coast, and the coastal waters of the Straits of Malacca, wherein industrial activities are rapidly expanding. The sources of existing mercury input to both of these areas of Malaysia should be studied and identified. Considering the high levels of mercury that now exists in human tissues, efforts should be continued, and accelerated in the future, if possible, to monitor mercury contamination levels in the coastal states, and particularly along the west Peninsular Malaysian coast. Most studies that have been carried out on mercury residues in environmental samples are dated, having been conducted 20-30 years ago; therefore, the need to collect much more and more current data is urgent. Furthermore, establishing baseline levels of mercury exposure to

  1. Mercury Information Clearinghouse

    Energy Technology Data Exchange (ETDEWEB)

    Chad A. Wocken; Michael J. Holmes; Dennis L. Laudal; Debra F. Pflughoeft-Hassett; Greg F. Weber; Nicholas V. C. Ralston; Stanley J. Miller; Grant E. Dunham; Edwin S. Olson; Laura J. Raymond; John H. Pavlish; Everett A. Sondreal; Steven A. Benson

    2006-03-31

    The Canadian Electricity Association (CEA) identified a need and contracted the Energy & Environmental Research Center (EERC) to create and maintain an information clearinghouse on global research and development activities related to mercury emissions from coal-fired electric utilities. With the support of CEA, the Center for Air Toxic Metals{reg_sign} (CATM{reg_sign}) Affiliates, and the U.S. Department of Energy (DOE), the EERC developed comprehensive quarterly information updates that provide a detailed assessment of developments in the various areas of mercury monitoring, control, policy, and research. A total of eight topical reports were completed and are summarized and updated in this final CEA quarterly report. The original quarterly reports can be viewed at the CEA Web site (www.ceamercuryprogram.ca). In addition to a comprehensive update of previous mercury-related topics, a review of results from the CEA Mercury Program is provided. Members of Canada's coal-fired electricity generation sector (ATCO Power, EPCOR, Manitoba Hydro, New Brunswick Power, Nova Scotia Power Inc., Ontario Power Generation, SaskPower, and TransAlta) and CEA, have compiled an extensive database of information from stack-, coal-, and ash-sampling activities. Data from this effort are also available at the CEA Web site and have provided critical information for establishing and reviewing a mercury standard for Canada that is protective of environment and public health and is cost-effective. Specific goals outlined for the CEA mercury program included the following: (1) Improve emission inventories and develop management options through an intensive 2-year coal-, ash-, and stack-sampling program; (2) Promote effective stack testing through the development of guidance material and the support of on-site training on the Ontario Hydro method for employees, government representatives, and contractors on an as-needed basis; (3) Strengthen laboratory analytical capabilities through

  2. INFRARED AND KINEMATIC PROPERTIES OF THE SUBSTELLAR OBJECT G 196-3 B

    International Nuclear Information System (INIS)

    Zapatero Osorio, M. R.; Caballero, J. A.; Rebolo, R.; Bihain, G.; Bejar, V. J. S.; Alvarez, C.

    2010-01-01

    We report unusual near- and mid-infrared photometric properties of G 196-3 B, the young substellar companion at 16'' from the active M2.5-type star G 196-3 A, using data taken with the IRAC and MIPS instruments onboard Spitzer. G 196-3 B shows markedly redder colors at all wavelengths from 1.6 up to 24 μm than expected for its spectral type, which is determined at L3 from optical and near-infrared spectra. We discuss various physical scenarios to account for its reddish nature and conclude that a low-gravity atmosphere with enshrouded upper atmospheric layers and/or a warm dusty disk/envelope provides the most likely explanations, the two of them consistent with an age in the interval 20-300 Myr. We also present new and accurate separate proper motion measurements for G 196-3 A and B confirming that both objects are gravitationally linked and share the same motion within a few mas yr -1 . After integration of the combined spectrophotometric spectral energy distributions, we obtain the result that the difference in the bolometric magnitudes of G 196-3 A and B is 6.15 ± 0.10 mag. Kinematic consideration of the Galactic space motions of the system for distances in the interval 15-30 pc suggests that the pair is a likely member of the Local Association and that it lies near the past positions of young star clusters like α Persei less than 85 Myr ago, where the binary might have originated. At these young ages, the mass of G 196-3 B would be in the range 12-25 M Jup , close to the frontier between planets and brown dwarfs.

  3. Mercury recycling in the United States in 2000

    Science.gov (United States)

    Brooks, William E.; Matos, Grecia R.

    2005-01-01

    Reclamation and recycling of mercury from used mercury- containing products and treatment of byproduct mercury from gold mining is vital to the continued, though declining, use of this metal. Mercury is reclaimed from mercury-containing waste by treatment in multistep high-temperature retorts-the mercury is volatized and then condensed for purification and sale. Some mercury-containing waste, however, may be landfilled, and landfilled material represents loss of a recyclable resource and a threat to the environment. Related issues include mercury disposal and waste management, toxicity and human health, and regulation of mercury releases in the environment. End-users of mercury-containing products may face fines and prosecution if these products are improperly recycled or not recycled. Local and State environmental regulations require adherence to the Resource Conservation and Recovery Act and the Comprehensive Environmental Response, Compensation, and Liability Act to regulate generation, treatment, and disposal of mercury-containing products. In the United States, several large companies and a number of smaller companies collect these products from a variety of sources and then reclaim and recycle the mercury. Because mercury has not been mined as a principal product in the United States since 1992, mercury reclamation from fabricated products has become the main source of mercury. Principal product mercury and byproduct mercury from mining operations are considered to be primary materials. Mercury may also be obtained as a byproduct from domestic or foreign gold-processing operations. In the early 1990s, U.S. manufacturers used an annual average that ranged from 500 to 600 metric tons of recycled and imported mercury for fabrication of automobile convenience switches, dental amalgam, fluorescent lamps, medical uses and thermometers, and thermostats. The amount now used for fabrication is estimated to be 200 metric tons per year or less. Much of the data on

  4. Quarter 9 Mercury information clearinghouse final report

    Energy Technology Data Exchange (ETDEWEB)

    Laudal, D.L.; Miller, S.; Pflughoeft-Hassett, D.; Ralston, N.; Dunham, G.; Weber, G.

    2005-12-15

    The Canadian Electricity Association (CEA) identified a need and contracted the Energy & Environmental Research Center (EERC) to create and maintain an information clearinghouse on global research and development activities related to mercury emissions from coal-fired electric utilities. A total of eight reports were completed and are summarized and updated in this final CEA quarterly report. Selected topics were discussed in detail in each quarterly report. Issues related to mercury from coal-fired utilities include the general areas of measurement, control, policy, and transformations. Specific topics that have been addressed in previous quarterly reports include the following: Quarterly 1 - Sorbent Control Technologies for Mercury Control; Quarterly 2 - Mercury Measurement; Quarterly 3 - Advanced and Developmental Mercury Control Technologies; Quarterly 4 - Prerelease of Mercury from Coal Combustion By-Products; Quarterly 5 - Mercury Fundamentals; Quarterly 6 - Mercury Control Field Demonstrations; Quarterly 7 - Mercury Regulations in the United States: Federal and State; and Quarterly 8 - Commercialization Aspects of Sorbent Injection Technologies in Canada. In this last of nine quarterly reports, an update of these mercury issues is presented that includes a summary of each topic, with recent information pertinent to advances made since the quarterly reports were originally presented. In addition to a comprehensive update of previous mercury-related topics, a review of results from the CEA Mercury Program is provided. 86 refs., 11 figs., 8 tabs.

  5. Down-regulation of microRNA-196a in the sera and involved skin of localized scleroderma patients.

    Science.gov (United States)

    Makino, Takamitsu; Jinnin, Masatoshi; Etoh, Mitsuhiko; Yamane, Keitaro; Kajihara, Ikko; Makino, Katsunari; Ichihara, Asako; Igata, Toshikatsu; Sakai, Keisuke; Fukushima, Satoshi; Ihn, Hironobu

    2014-01-01

    Localized scleroderma (LSc) exhibits fibrosis of the skin and subcutaneous tissue. LSc shows an excessive deposition of type 1 collagen. To elucidate the mechanism of type 1 collagen overexpression in LSc, we investigated the epigenetics, focusing on microRNA (miRNA). miRNA expression profile was determined by PCR array analysis. The expression of microRNA-196a (miR-196a) in the skin tissue was examined by in situ hybridization or real-time PCR. The serum levels of miR-196a were measured by real-time PCR. PCR array analysis demonstrated that the miR-196a level was markedly decreased in LSc skin tissue in vivo. The transfection of specific inhibitor for miR-196a into normal cultured human dermal fibroblasts led to the up-regulation of type 1 collagen protein in vitro. Furthermore, the serum levels of miR-196a were significantly decreased in LSc patients. Down-regulation of miR-196a and subsequent overexpression of type 1 collagen in dermal fibroblasts may play a key role in the pathogenesis of LSc. The serum levels of miR-196a may be useful as a diagnostic marker of LSc.

  6. Phytoremediation of Ionic and Methyl Mercury Pollution

    Energy Technology Data Exchange (ETDEWEB)

    Meagher, Richard B.

    2005-06-01

    Phytoremediation is defined as the use of plants to extract, resist, detoxify, and/or sequester toxic environmental pollutants. The long-term goal of the proposed research is to develop and test highly productive, field-adapted plant species that have been engineered for the phytoremediation of mercury. A variety of different genes, which should enable plants to clean mercury polluted sites are being tested as tools for mercury phytoremediation, first in model laboratory plants and then in potential field species. Several of these genes have already been shown to enhance mercury phytoremediation. Mercury pollution is a serious, world-wide problem affecting the health of human and wildlife populations. Environmentally, the most serious mercury threat is the production of methylmercury (CH3Hg+) by native bacteria at mercury contaminated wetland sites. Methylmercury is inherently more toxic than metallic (Hg(0)) or ionic (Hg(II)) mercury, and because methylmercury is prolifically biomagnified up the food chain, it poses the most immediate danger to animal populations. We have successfully engineered two model plants, Arabidopsis and tobacco, to use the bacterial merB gene to convert methylmercury to less toxic ionic mercury and to use the bacterial merA gene to further detoxify ionic mercury to the least toxic form of mercury, metallic mercury. Plants expressing both MerA and MerB proteins detoxify methylmercury in two steps to the metallic form. These plants germinate, grow, and set seed at normal growth rates on levels of methylmercury or ionic mercury that are lethal to normal plants. Our newest efforts involve engineering plants with several additional bacterial and plant genes that allow for higher levels of mercury resistance and mercury hyperaccumulation. The potential for these plants to hyperaccumulate mercury was further advanced by developing constitutive, aboveground, and root-specific gene expression systems. Our current strategy is to engineer plants to

  7. Minamata Convention on Mercury

    Science.gov (United States)

    On November 6, 2013 the United States signed the Minamata Convention on Mercury, a new multilateral environmental agreement that addresses specific human activities which are contributing to widespread mercury pollution

  8. Intake of mercury through fish consumption

    International Nuclear Information System (INIS)

    Sarmani, S.B.; Kiprawi, A.Z.; Ismail, R.B.; Hassan, R.B.; Wood, A.K.; Rahman, S.A.

    1995-01-01

    Fish has been known as a source of non-occupational mercury exposure to fish consuming population groups, and this is shown by the high hair mercury levels. In this study, hair samples collected from fishermen and their families, and commercial marine fishes were analyzed for mercury and methylmercury by neutron activation and gas chromatography. The results showed a correlation between hair mercury levels and fish consumption patterns. The levels of mercury found in this study were similar to those reported by other workers for fish consuming population groups worldwide. (author)

  9. Total Mercury content of skin toning creams

    African Journals Online (AJOL)

    Administrator

    2008-04-01

    Apr 1, 2008 ... used it for cosmetics (Silberberg, 1995). Mercury- ... Cosmetic preparations containing mercury com- pounds are .... mercury determination by a modified version of an open .... level mercury exposure, which could lead to a.

  10. Experimental dosing of wetlands with coagulants removes mercury from surface water and decreases mercury bioaccumulation in fish.

    Science.gov (United States)

    Ackerman, Joshua T; Kraus, Tamara E C; Fleck, Jacob A; Krabbenhoft, David P; Horwath, William R; Bachand, Sandra M; Herzog, Mark P; Hartman, C Alex; Bachand, Philip A M

    2015-05-19

    Mercury pollution is widespread globally, and strategies for managing mercury contamination in aquatic environments are necessary. We tested whether coagulation with metal-based salts could remove mercury from wetland surface waters and decrease mercury bioaccumulation in fish. In a complete randomized block design, we constructed nine experimental wetlands in California's Sacramento-San Joaquin Delta, stocked them with mosquitofish (Gambusia affinis), and then continuously applied agricultural drainage water that was either untreated (control), or treated with polyaluminum chloride or ferric sulfate coagulants. Total mercury and methylmercury concentrations in surface waters were decreased by 62% and 63% in polyaluminum chloride treated wetlands and 50% and 76% in ferric sulfate treated wetlands compared to control wetlands. Specifically, following coagulation, mercury was transferred from the filtered fraction of water into the particulate fraction of water which then settled within the wetland. Mosquitofish mercury concentrations were decreased by 35% in ferric sulfate treated wetlands compared to control wetlands. There was no reduction in mosquitofish mercury concentrations within the polyaluminum chloride treated wetlands, which may have been caused by production of bioavailable methylmercury within those wetlands. Coagulation may be an effective management strategy for reducing mercury contamination within wetlands, but further studies should explore potential effects on wetland ecosystems.

  11. Experimental dosing of wetlands with coagulants removes mercury from surface water and decreases mercury bioaccumulation in fish

    Science.gov (United States)

    Ackerman, Joshua T.; Kraus, Tamara E.C.; Fleck, Jacob A.; Krabbenhoft, David P.; Horwarth, William R.; Bachand, Sandra M.; Herzog, Mark; Hartman, Christopher; Bachand, Philip A.M.

    2015-01-01

    Mercury pollution is widespread globally, and strategies for managing mercury contamination in aquatic environments are necessary. We tested whether coagulation with metal-based salts could remove mercury from wetland surface waters and decrease mercury bioaccumulation in fish. In a complete randomized block design, we constructed nine experimental wetlands in California’s Sacramento–San Joaquin Delta, stocked them with mosquitofish (Gambusia affinis), and then continuously applied agricultural drainage water that was either untreated (control), or treated with polyaluminum chloride or ferric sulfate coagulants. Total mercury and methylmercury concentrations in surface waters were decreased by 62% and 63% in polyaluminum chloride treated wetlands and 50% and 76% in ferric sulfate treated wetlands compared to control wetlands. Specifically, following coagulation, mercury was transferred from the filtered fraction of water into the particulate fraction of water which then settled within the wetland. Mosquitofish mercury concentrations were decreased by 35% in ferric sulfate treated wetlands compared to control wetlands. There was no reduction in mosquitofish mercury concentrations within the polyaluminum chloride treated wetlands, which may have been caused by production of bioavailable methylmercury within those wetlands. Coagulation may be an effective management strategy for reducing mercury contamination within wetlands, but further studies should explore potential effects on wetland ecosystems.

  12. Determination of mercury in plant material

    Energy Technology Data Exchange (ETDEWEB)

    Pickard, J A; Martin, J T

    1960-07-01

    An analytical procedure used for the determination of traces of mercury in plant material is described. The conditions of combustion of organic matter are controlled to avoid loss of mercury and EDTA is used to reduce the values for apparent mercury on uncontaminated samples. Satisfactory recoveries of mercury added to apples, tomatoes and coffee are obtained. 10 references, 1 table.

  13. [Mercury Distribution Characteristics and Atmospheric Mercury Emission Factors of Typical Waste Incineration Plants in Chongqing].

    Science.gov (United States)

    Duan, Zhen-ya; Su, Hai-tao; Wang, Feng-yang; Zhang, Lei; Wang, Shu-xiao; Yu, Bin

    2016-02-15

    Waste incineration is one of the important atmospheric mercury emission sources. The aim of this article is to explore the atmospheric mercury pollution level of waste incineration industry from Chongqing. This study investigated the mercury emissions from a municipal solid waste incineration plant and a medical waste incineration plant in Chongqing. The exhaust gas samples in these two incineration plants were obtained using USA EPA 30B method. The mercury concentrations in the fly ash and bottom ash samples were analyzed. The results indicated that the mercury concentrations of the municipal solid waste and medical waste incineration plant in Chongqing were (26.4 +/- 22.7) microg x m(-3) and (3.1 +/- 0.8) microg x m(-3) in exhaust gas respectively, (5279.2 +/- 798.0) microg x kg(-1) and (11,709.5 +/- 460.5) microg x kg(-1) in fly ash respectively. Besides, the distribution proportions of the mercury content from municipal solid waste and medical waste in exhaust gas, fly ash, and bottom ash were 34.0%, 65.3%, 0.7% and 32.3%, 67.5%, 0.2% respectively; The mercury removal efficiencies of municipal solid waste and medical waste incineration plants were 66.0% and 67.7% respectively. The atmospheric mercury emission factors of municipal solid waste and medical waste incineration plants were (126.7 +/- 109.0) microg x kg(-1) and (46.5 +/- 12.0) microg x kg(-1) respectively. Compared with domestic municipal solid waste incineration plants in the Pearl River Delta region, the atmospheric mercury emission factor of municipal solid waste incineration plant in Chongqing was lower.

  14. The mixed waste focus area mercury working group: an integrated approach for mercury treatment and disposal

    International Nuclear Information System (INIS)

    Conley, T.B.; Morris, M.I.; Holmes-Burns, H.; Petersell, J.; Schwendiman, L.

    1997-01-01

    In May 1996, the U.S. Department of Energy (DOE) Mixed Waste Focus Area (MWFA) initiated the Mercury Work Group (HgWG), which was established to address and resolve the issues associated with mercury- contaminated mixed wastes. Three of the first four technology deficiencies identified during the MWFA technical baseline development process were related to mercury amalgamation, stabilization, and separation/removal. The HgWG will assist the MWFA in soliciting, identifying, initiating, and managing all the efforts required to address these deficiencies. The focus of the HgWG is to better establish the mercury-related treatment needs at the DOE sites, refine the MWFA technical baseline as it relates to mercury treatment, and make recommendations to the MWFA on how to most effectively address these needs. The team will initially focus on the sites with the most mercury-contaminated mixed wastes, whose representatives comprise the HgWG. However, the group will also work with the sites with less inventory to maximize the effectiveness of these efforts in addressing the mercury- related needs throughout the entire complex

  15. Atmospheric mercury footprints of nations.

    Science.gov (United States)

    Liang, Sai; Wang, Yafei; Cinnirella, Sergio; Pirrone, Nicola

    2015-03-17

    The Minamata Convention was established to protect humans and the natural environment from the adverse effects of mercury emissions. A cogent assessment of mercury emissions is required to help implement the Minamata Convention. Here, we use an environmentally extended multi-regional input-output model to calculate atmospheric mercury footprints of nations based on upstream production (meaning direct emissions from the production activities of a nation), downstream production (meaning both direct and indirect emissions caused by the production activities of a nation), and consumption (meaning both direct and indirect emissions caused by final consumption of goods and services in a nation). Results show that nations function differently within global supply chains. Developed nations usually have larger consumption-based emissions than up- and downstream production-based emissions. India, South Korea, and Taiwan have larger downstream production-based emissions than their upstream production- and consumption-based emissions. Developed nations (e.g., United States, Japan, and Germany) are in part responsible for mercury emissions of developing nations (e.g., China, India, and Indonesia). Our findings indicate that global mercury abatement should focus on multiple stages of global supply chains. We propose three initiatives for global mercury abatement, comprising the establishment of mercury control technologies of upstream producers, productivity improvement of downstream producers, and behavior optimization of final consumers.

  16. Does mercury vapor exposure increase urinary selenium excretion

    Energy Technology Data Exchange (ETDEWEB)

    Hongo, T; Suzuki, T; Himeno, S; Watanabe, C; Satoh, H; Shimada, Y

    1985-01-01

    It has been reported that an increase of urinary selenium excretion may occur as a result of mercury vapor exposure. However, experimental data regarding the interaction between mercury vapor and selenium have yielded ambiguous results about the retention and elimination of selenium due to mercury vapor exposure and the decrease of selenium excretion due to mercury in the form of mercuric mercury (Hg/sup 2 +/). In this study, the authors measured urinary mercury and selenium in workers with or without exposure to mercury vapor to determine whether or not urinary selenium excretion was increased as a result of mercury vapor exposure. Urine samples were collected from 141 workers, 71 men and 70 women, whose extent of exposure to mercury vapor varied according to their job sites. Workers were divided into five groups according to their urinary mercury levels. The mercury level in group I was less than 2.8 nmol/mmol creatinine which means that this group was mostly free from mercury exposure. The average age was almost identical among the groups. For both sexes, group V (with the highest urinary mercury level) had the lowest urinary selenium level, but one-way variance analysis (ANOVA) did not reveal any significant variations of urinary selenium with urinary mercury levels; however, a weak but significant negative correlation between mercury and selenium was found in men.

  17. Isolation, screening and identification of mercury resistant bacteria from mercury contaminated soil

    Directory of Open Access Journals (Sweden)

    Kowalczyk Anna

    2016-01-01

    Full Text Available New bacterial strains resistant to high concentration of mercury were obtained and character iz ed focusing on their potential application in bioremediation. The biological material was isolated from soil contaminated with mercury. The ability to removal of Hg from the liquid medium and the effect of the various pH and mercury concentrations in the environment on bacterial strains growth kinetics were tested. The selected strains were identified by analysis of the 16S ribosome subunit coding sequenc es as Pseudomonas syringae. The analysis of Hg concentration in liquid medium as effect of microbial metabolism demonstrated that P. syringae is able to remove almost entire metal from medium after 120 hours of incubation. Obtained results revealed new ability of the isolated strain P. syringae. Analyzed properties of this soil bacteria species able to reduce concentration of Hg ors immobi lize this metal are promising for industrial wastewater treatment and bioremediation of the soils polluted especially by mercury lamps scrapping, measuring instruments, dry batteries, detonators or burning fuels made from crude oil, which may also contain mercury. Selected bacteria strains provide efficient and relatively low-cost bioremediation of the areas and waters contaminated with Hg.

  18. Occupational Metallic Mercury Poisoning in Gilders

    Directory of Open Access Journals (Sweden)

    M Vahabzadeh

    2016-04-01

    Full Text Available Occupational exposure to elemental mercury vapor usually occurs through inhalation during its utilizations. This leads to a variety of adverse health effects. In some Islamic cities, this type of poisoning may occur during gilding of shrines using elemental mercury with gold. Herein, we report on three male patients aged 20–53 years, who were diagnosed with occupational metallic mercury poisoning due to gilding of a shrine. All patients presented with neuro-psychiatric disorders such as anxiety, loss of memory and concentration, and sleep disorders with high urinary mercury concentrations of 326–760 μg/L upon referring, 3–10 days after cessation of elemental mercury exposure. Following chelating therapy, the patients recovered clinically and their mercury concentrations declined to non-toxic level (<25 μg/L. Health, environmental and labor authorities, as well as the gilders should be aware of the toxicity risk of exposure to metalic mercury during gilding in closed environments and act accordingly.

  19. Sexual differences in the distribution and retention of organic and inorganic mercury in methyl mercury-treated rats

    International Nuclear Information System (INIS)

    Thomas, D.J.; Fisher, H.L.; Sumler, M.R.; Marcus, A.H.; Mushak, P.; Hall, L.L.

    1986-01-01

    At 56 days of age, male and female Long-Evans rats received 1 μmole of 203 Hg-labeled mercuric chloride per kilogram sc and total, organic, and inorganic mercury contents and concentrations in tissues were determined for up to 98 days postdosing. When expressed on a concentration basis, the only significant sexual difference was in the higher average concentration of organic mercury in the kidneys of females. When expressed on a tissue content basis, significant male-female differences in the kinetics (sex x time interactions) of organic mercury retention were found in kidney, brain, skeletal muscle, pelt, and whole body. Significant sex x time interactions in the concentrations of organic mercury were found in kidney, skeletal muscle, and whole body. Kinetics of retention and concentration of inorganic Hg in the pelt differed significantly for males and females. Discordance of degree of statistical significance of differences in mercury contents and concentrations reflected in part differences in relative body composition of males and females. Differences in integrated exposure were estimated by the female-to-male ratio of areas under retention curves. Reconstruction of whole body organic and inorganic mercury burdens from constituent tissues indicated that integrated exposures of males and females to inorganic mercury were equal but females had a lower integrated exposure to organic mercury. Integrated exposure of liver to either form of mercury was about equal in males and females. However, the integrated exposure of the brain of females to inorganic mercury was 2.19 times that of males suggest'ing a sexual difference in accumulation or retention of inorganic mercury in the nervous system

  20. Mercury cycling in a wastewater treatment plant treating waters with high mercury contents.

    Science.gov (United States)

    García-Noguero, Eva M.; García-Noguero, Carolina; Higueras, Pablo; Reyes-Bozo, Lorenzo; Esbrí, José M.

    2015-04-01

    The Almadén mercury mining district has been historically the most important producer of this element since Romans times to 2004, when both mining and metallurgic activities ceased as a consequence both of reserves exhaustion and persistent low prices for this metal. The reclamation of the main dump of the mine in 2007-2008 reduced drastically the atmospheric presence of the gaseous mercury pollutant in the local atmosphere. But still many areas, and in particular in the Almadén town area, can be considered as contaminated, and produce mercury releases that affect the urban residual waters. Two wastewater treatment plants (WWTP) where built in the area in year 2002, but in their design the projects did not considered the question of high mercury concentrations received as input from the town area. This communication presents data of mercury cycling in one of the WWTP, the Almadén-Chillón one, being the larger and receiving the higher Hg concentrations, due to the fact that it treats the waters coming from the West part of the town, in the immediate proximity to the mine area. Data were collected during a number of moments of activity of the plant, since April 2004 to nowadays. Analyses were carried out by means of cold vapor-atomic fluorescence spectroscopy (CV-AFS), using a PSA Millennium Merlin analytical device with gold trap. The detection limit is 0.1 ng/l. The calibration standards are prepared using the Panreac ICP Standard Mercury Solution (1,000±0,002 g/l Hg in HNO3 2-5%). Results of the surveys indicate that mercury concentrations in input and output waters in this plant has suffered an important descent since the cessation of mining and metallurgical activities, and minor reduction also after the reclamation of the main mine's dump. Since 2009, some minor seasonal variations are detected, in particular apparently related to accumulation during summer of mercury salts and particles, which are washed to the plant with the autumn's rains. Further

  1. Development of Nano-Sulfide Sorbent for Efficient Removal of Elemental Mercury from Coal Combustion Fuel Gas.

    Science.gov (United States)

    Li, Hailong; Zhu, Lei; Wang, Jun; Li, Liqing; Shih, Kaimin

    2016-09-06

    The surface area of zinc sulfide (ZnS) was successfully enlarged using nanostructure particles synthesized by a liquid-phase precipitation method. The ZnS with the highest surface area (named Nano-ZnS) of 196.1 m(2)·g(-1) was then used to remove gas-phase elemental mercury (Hg(0)) from simulated coal combustion fuel gas at relatively high temperatures (140 to 260 °C). The Nano-ZnS exhibited far greater Hg(0) adsorption capacity than the conventional bulk ZnS sorbent due to the abundance of surface sulfur sites, which have a high binding affinity for Hg(0). Hg(0) was first physically adsorbed on the sorbent surface and then reacted with the adjacent surface sulfur to form the most stable mercury compound, HgS, which was confirmed by X-ray photoelectron spectroscopy analysis and a temperature-programmed desorption test. At the optimal temperature of 180 °C, the equilibrium Hg(0) adsorption capacity of the Nano-ZnS (inlet Hg(0) concentration of 65.0 μg·m(-3)) was greater than 497.84 μg·g(-1). Compared with several commercial activated carbons used exclusively for gas-phase mercury removal, the Nano-ZnS was superior in both Hg(0) adsorption capacity and adsorption rate. With this excellent Hg(0) removal performance, noncarbon Nano-ZnS may prove to be an advantageous alternative to activated carbon for Hg(0) removal in power plants equipped with particulate matter control devices, while also offering a means of reusing fly ash as a valuable resource, for example as a concrete additive.

  2. Maternal transfer of mercury to songbird eggs.

    Science.gov (United States)

    Ackerman, Joshua T; Hartman, C Alex; Herzog, Mark P

    2017-11-01

    We evaluated the maternal transfer of mercury to eggs in songbirds, determined whether this relationship differed between songbird species, and developed equations for predicting mercury concentrations in eggs from maternal blood. We sampled blood and feathers from 44 house wren (Troglodytes aedon) and 34 tree swallow (Tachycineta bicolor) mothers and collected their full clutches (n = 476 eggs) within 3 days of clutch completion. Additionally, we sampled blood and feathers from 53 tree swallow mothers and randomly collected one egg from their clutches (n = 53 eggs) during mid to late incubation (6-10 days incubated) to evaluate whether the relationship varied with the timing of sampling the mother's blood. Mercury concentrations in eggs were positively correlated with mercury concentrations in maternal blood sampled at (1) the time of clutch completion for both house wrens (R 2  = 0.97) and tree swallows (R 2  = 0.97) and (2) during mid to late incubation for tree swallows (R 2  = 0.71). The relationship between mercury concentrations in eggs and maternal blood did not differ with the stage of incubation when maternal blood was sampled. Importantly, the proportion of mercury transferred from mothers to their eggs decreased substantially with increasing blood mercury concentrations in tree swallows, but increased slightly with increasing blood mercury concentrations in house wrens. Additionally, the proportion of mercury transferred to eggs at the same maternal blood mercury concentration differed between species. Specifically, tree swallow mothers transferred 17%-107% more mercury to their eggs than house wren mothers over the observed mercury concentrations in maternal blood (0.15-1.92 μg/g ww). In contrast, mercury concentrations in eggs were not correlated with those in maternal feathers and, likewise, mercury concentrations in maternal blood were not correlated with those in feathers (all R 2  mercury concentrations from maternal blood to eggs

  3. Mercury in the environment : a primer

    Energy Technology Data Exchange (ETDEWEB)

    Lourie, B; Glenn, W [ed.; Ogilvie, K; Everhardus, E; Friesen, K; Rae, S

    2003-06-01

    This report provides an overview of the occurrence and effects of mercury in the environment and its impacts on human health. Low levels of mercury occur naturally everywhere in the environment in plants, animals, rocks and air. Incidental emissions occur when natural mercury is released to the environment through human activity. In Canada, coal burning and metal processing are the two largest point sources of atmospheric mercury emissions. Energy facilities have the option to invest in expensive control technologies for coal plants, or they can generate electricity from alternative energy sources. Energy conservation, however, offers the greatest overall benefits for the environment and the public. Mercury can also be released when products containing mercury (such as electrical switches, thermostats, dental amalgam, and thermometers) are broken while in use, or when they are crushed in garbage trucks and dumped in landfills. Source separation is the best way to reduce waste-related emissions. Once mercury is released to the natural environment, it can be transported long distances through air or watercourses. It is volatile, therefore evaporates readily to the atmosphere where it may do one of three things: it may fall out near the point where it was emitted; it may be transported long distances to some point downwind; or, it may enter the global atmospheric mercury pool where it will circle the globe for a year or more within the Earth's major weather systems before being deposited. Data from Canada's National Pollutant Release Inventory indicates that mercury releases and transfers total 28,674 kg per year. The most critical component of the mercury cycle is the conversion of inorganic forms of mercury to the organic compound methylmercury which is more toxic to humans. Most concern about mercury focuses on lakes and other aquatic ecosystems. Fish in hydroelectric reservoirs have been found to contain elevated methylmercury levels because natural mercury in the

  4. Mercury Poisoning Linked to Skin Products

    Science.gov (United States)

    ... Products For Consumers Home For Consumers Consumer Updates Mercury Poisoning Linked to Skin Products Share Tweet Linkedin ... and, in some situations, criminal prosecution. Dangers of Mercury Exposure to mercury can have serious health consequences. ...

  5. Basic Information about Mercury

    Science.gov (United States)

    ... or metallic mercury is a shiny, silver-white metal and is liquid at room temperature. It is ... releases can happen naturally. Both volcanoes and forest fires send mercury into the atmosphere. Human activities, however, ...

  6. Origin of oxidized mercury in the summertime free troposphere over the southeastern US

    Directory of Open Access Journals (Sweden)

    V. Shah

    2016-02-01

    Full Text Available We collected mercury observations as part of the Nitrogen, Oxidants, Mercury, and Aerosol Distributions, Sources, and Sinks (NOMADSS aircraft campaign over the southeastern US between 1 June and 15 July 2013. We use the GEOS-Chem chemical transport model to interpret these observations and place new constraints on bromine radical initiated mercury oxidation chemistry in the free troposphere. We find that the model reproduces the observed mean concentration of total atmospheric mercury (THg (observations: 1.49 ± 0.16 ng m−3, model: 1.51 ± 0.08 ng m−3, as well as the vertical profile of THg. The majority (65 % of observations of oxidized mercury (Hg(II were below the instrument's detection limit (detection limit per flight: 58–228 pg m−3, consistent with model-calculated Hg(II concentrations of 0–196 pg m−3. However, for observations above the detection limit we find that modeled Hg(II concentrations are a factor of 3 too low (observations: 212 ± 112 pg m−3, model: 67 ± 44 pg m−3. The highest Hg(II concentrations, 300–680 pg m−3, were observed in dry (RH  <  35 % and clean air masses during two flights over Texas at 5–7 km altitude and off the North Carolina coast at 1–3 km. The GEOS-Chem model, back trajectories and observed chemical tracers for these air masses indicate subsidence and transport from the upper and middle troposphere of the subtropical anticyclones, where fast oxidation of elemental mercury (Hg(0 to Hg(II and lack of Hg(II removal lead to efficient accumulation of Hg(II. We hypothesize that the most likely explanation for the model bias is a systematic underestimate of the Hg(0 + Br reaction rate. We find that sensitivity simulations with tripled bromine radical concentrations or a faster oxidation rate constant for Hg(0 + Br, result in 1.5–2 times higher modeled Hg(II concentrations and improved agreement with the observations. The modeled

  7. The fate of Mercury in Arctic regions: New understanding of atmospheric chemical processes and mercury stability in snow.

    Science.gov (United States)

    Steffen, A.; Ferrari, C.; Dommergue, A.; Scherz, T.; Lawson, G.; Leiatch, R.

    2006-12-01

    Mercury is a known toxic pollutant in the Arctic environment. Atmospheric mercury depletion events (AMDEs) have been studied in the Arctic since 1995. While advances in understanding this newly discovered cycling of mercury in the atmosphere have been made, much of the chemistry and the impact of this annually reoccurring event to the Arctic ecosystem are not well understood. Four years of continuous measurements at Alert, Canada of so-called reactive gaseous mercury (RGM) and mercury associated to particles (PHg) coupled with ongoing snow sampling have produced new information on the atmospheric chemistry and deposition of these mercury species to the Arctic. A distinct pattern during the springtime period in the distribution of these atmospheric mercury species has emerged. This pattern is characterized by the predominance of PHg concentration at the onset of the AMDEs. During the latter part of the AMDE season, there is an obvious swicth in the speciation of mercury to RGM as the main component during AMDEs. This swicth from PHg to RGM is clearly linked to a significant increase of mercury in the snow. In addition, concentrations of PHg are clearly linked with particles in the air that are primarily associated with Arctic haze. Recently, similar results have also been observed in Ny-Alesund (Svalbard). Further observations indicate that once deposited, the deposited mercury appears to evolve chemically in the snow. This change in mercury may impact the transfer of mercury to the environment during snow melt. These first time observed links between atmospheric conditions and subsequent deposition of mercury may help to ascertain the conditions throughout the Arctic as to when significant deposition of mercury will occur. It is proposed that should the concentration of atmospheric particles increase in the Arctic due to long range transport from emission sources, an increase in the deposition of mercury to this environment will increase during the springtime

  8. Mercury

    CERN Document Server

    Mahoney, T J

    2014-01-01

    This gazetteer and atlas on Mercury lists, defines and illustrates every named (as opposed to merely catalogued) object and term as related to Mercury within a single reference work. It contains a glossary of terminology used, an index of all the headwords in the gazetteer, an atlas comprising maps and images with coordinate grids and labels identifying features listed in the gazetteer, and appendix material on the IAU nomenclature system and the transcription systems used for non-roman alphabets. This book is useful for the general reader, writers and editors dealing with astronomical themes, and those astronomers concerned with any aspect of astronomical nomenclature.

  9. Mercury analysis in hair

    DEFF Research Database (Denmark)

    Esteban, Marta; Schindler, Birgit K; Jiménez-Guerrero, José A

    2015-01-01

    Human biomonitoring (HBM) is an effective tool for assessing actual exposure to chemicals that takes into account all routes of intake. Although hair analysis is considered to be an optimal biomarker for assessing mercury exposure, the lack of harmonization as regards sampling and analytical...... assurance program (QAP) for assessing mercury levels in hair samples from more than 1800 mother-child pairs recruited in 17 European countries. To ensure the comparability of the results, standard operating procedures (SOPs) for sampling and for mercury analysis were drafted and distributed to participating...... laboratories. Training sessions were organized for field workers and four external quality-assessment exercises (ICI/EQUAS), followed by the corresponding web conferences, were organized between March 2011 and February 2012. ICI/EQUAS used native hair samples at two mercury concentration ranges (0...

  10. Coal fired flue gas mercury emission controls

    International Nuclear Information System (INIS)

    Wu, Jiang; Pan, Weiguo; Cao, Yan; Pan, Weiping

    2015-01-01

    Mercury (Hg) is one of the most toxic heavy metals, harmful to both the environment and human health. Hg is released into the atmosphere from natural and anthropogenic sources and its emission control has caused much concern. This book introduces readers to Hg pollution from natural and anthropogenic sources and systematically describes coal-fired flue gas mercury emission control in industry, especially from coal-fired power stations. Mercury emission control theory and experimental research are demonstrated, including how elemental mercury is oxidized into oxidized mercury and the effect of flue gas contents on the mercury speciation transformation process. Mercury emission control methods, such as existing APCDs (air pollution control devices) at power stations, sorbent injection, additives in coal combustion and photo-catalytic methods are introduced in detail. Lab-scale, pilot-scale and full-scale experimental studies of sorbent injection conducted by the authors are presented systematically, helping researchers and engineers to understand how this approach reduces the mercury emissions in flue gas and to apply the methods in mercury emission control at coal-fired power stations.

  11. Coal fired flue gas mercury emission controls

    Energy Technology Data Exchange (ETDEWEB)

    Wu, Jiang; Pan, Weiguo [Shanghai Univ. of Electric Power (China); Cao, Yan; Pan, Weiping [Western Kentucky Univ., Bowling Green, KY (United States)

    2015-05-01

    Mercury (Hg) is one of the most toxic heavy metals, harmful to both the environment and human health. Hg is released into the atmosphere from natural and anthropogenic sources and its emission control has caused much concern. This book introduces readers to Hg pollution from natural and anthropogenic sources and systematically describes coal-fired flue gas mercury emission control in industry, especially from coal-fired power stations. Mercury emission control theory and experimental research are demonstrated, including how elemental mercury is oxidized into oxidized mercury and the effect of flue gas contents on the mercury speciation transformation process. Mercury emission control methods, such as existing APCDs (air pollution control devices) at power stations, sorbent injection, additives in coal combustion and photo-catalytic methods are introduced in detail. Lab-scale, pilot-scale and full-scale experimental studies of sorbent injection conducted by the authors are presented systematically, helping researchers and engineers to understand how this approach reduces the mercury emissions in flue gas and to apply the methods in mercury emission control at coal-fired power stations.

  12. Mercury emission monitoring on municipal waste combustion

    International Nuclear Information System (INIS)

    Braun, H.; Gerig, A.

    1991-01-01

    In waste incineration, mercury is the only heavy metal to be released as a gas, mostly as mercury(II) chloride, because of its high volatility. Continuous emission monitoring is possible only when mercury occurs in its elemental form. This paper reports on various possibilities of converting Hg(II) into Hg(0) that has been studied and tested on a laboratory scale and in the TAMARA refuse incineration pilot facility. Continuous mercury emission measurement appears to be possible, provided mercury is converted in the flue gas condensate precipitated. The measuring results obtained on two municipal solid waste and on one sewage treatment sludge incineration plants show that the mercury monitor is a highly sensitive and selective continuously working instrument for mercury emission monitoring

  13. Mercury Spill Responses - Five States, 2012-2015.

    Science.gov (United States)

    Wozniak, Ryan J; Hirsch, Anne E; Bush, Christina R; Schmitz, Stuart; Wenzel, Jeff

    2017-03-17

    Despite measures to educate the public about the dangers of elemental mercury, spills continue to occur in homes, schools, health care facilities, and other settings, endangering the public's health and requiring costly cleanup. Mercury is most efficiently absorbed by the lungs, and exposure to high levels of mercury vapor after a release can cause cough, sore throat, shortness of breath, nausea, vomiting, diarrhea, headaches, and visual disturbances (1). Children and fetuses are most susceptible to the adverse effects of mercury vapor exposure. Because their organ systems are still developing, children have increased respiratory rates, and they are closer to the ground where mercury vapors are most highly concentrated (2). To summarize key features of recent mercury spills and lessons learned, five state health departments involved in the cleanup (Iowa, Michigan, Missouri, North Carolina, and Wisconsin) compiled data from various sources on nonthermometer mercury spills from 2012 to 2015. The most common sites of contamination were residences, schools and school buses, health care facilities, and commercial and industrial facilities. Children aged mercury exposure. To protect the public's health after a mercury spill, it is important that local, state, and federal agencies communicate and coordinate effectively to ensure a quick response, and to minimize the spread of contamination. To reduce the number of mercury spills that occur in the United States, public health officials should increase awareness about exchange programs for mercury-containing items and educate school and health care workers about sources of mercury and how to dispose of them properly.

  14. Volcanic mercury in Pinus canariensis

    Science.gov (United States)

    Rodríguez Martín, José Antonio; Nanos, Nikos; Miranda, José Carlos; Carbonell, Gregoria; Gil, Luis

    2013-08-01

    Mercury (Hg) is a toxic element that is emitted to the atmosphere by both human activities and natural processes. Volcanic emissions are considered a natural source of mercury in the environment. In some cases, tree ring records taken close to volcanoes and their relation to volcanic activity over time are contradictory. In 1949, the Hoyo Negro volcano (La Palma-Canary Islands) produced significant pyroclastic flows that damaged the nearby stand of Pinus canariensis. Recently, 60 years after the eruption, we assessed mercury concentrations in the stem of a pine which survived volcano formation, located at a distance of 50 m from the crater. We show that Hg content in a wound caused by pyroclastic impacts (22.3 μg kg-1) is an order of magnitude higher than the Hg concentrations measured in the xylem before and after the eruption (2.3 μg kg-1). Thus, mercury emissions originating from the eruption remained only as a mark—in pyroclastic wounds—and can be considered a sporadic and very high mercury input that did not affect the overall Hg input in the xylem. In addition, mercury contents recorded in the phloem (9.5 μg kg-1) and bark (6.0 μg kg-1) suggest that mercury shifts towards non-living tissues of the pine, an aspect that can be related to detoxification in volcanism-adapted species.

  15. Volcanic mercury in Pinus canariensis.

    Science.gov (United States)

    Rodríguez Martín, José Antonio; Nanos, Nikos; Miranda, José Carlos; Carbonell, Gregoria; Gil, Luis

    2013-08-01

    Mercury (Hg) is a toxic element that is emitted to the atmosphere by both human activities and natural processes. Volcanic emissions are considered a natural source of mercury in the environment. In some cases, tree ring records taken close to volcanoes and their relation to volcanic activity over time are contradictory. In 1949, the Hoyo Negro volcano (La Palma-Canary Islands) produced significant pyroclastic flows that damaged the nearby stand of Pinus canariensis. Recently, 60 years after the eruption, we assessed mercury concentrations in the stem of a pine which survived volcano formation, located at a distance of 50 m from the crater. We show that Hg content in a wound caused by pyroclastic impacts (22.3 μg kg(-1)) is an order of magnitude higher than the Hg concentrations measured in the xylem before and after the eruption (2.3 μg kg(-1)). Thus, mercury emissions originating from the eruption remained only as a mark-in pyroclastic wounds-and can be considered a sporadic and very high mercury input that did not affect the overall Hg input in the xylem. In addition, mercury contents recorded in the phloem (9.5 μg kg(-1)) and bark (6.0 μg kg(-1)) suggest that mercury shifts towards non-living tissues of the pine, an aspect that can be related to detoxification in volcanism-adapted species.

  16. Dissolved gaseous mercury formation and mercury volatilization in intertidal sediments.

    Science.gov (United States)

    Cesário, Rute; Poissant, Laurier; Pilote, Martin; O'Driscoll, Nelson J; Mota, Ana M; Canário, João

    2017-12-15

    Intertidal sediments of Tagus estuary regularly experiences complex redistribution due to tidal forcing, which affects the cycling of mercury (Hg) between sediments and the water column. This study quantifies total mercury (Hg) and methylmercury (MMHg) concentrations and fluxes in a flooded mudflat as well as the effects on water-level fluctuations on the air-surface exchange of mercury. A fast increase in dissolved Hg and MMHg concentrations was observed in overlying water in the first 10min of inundation and corresponded to a decrease in pore waters, suggesting a rapid export of Hg and MMHg from sediments to the water column. Estimations of daily advective transport exceeded the predicted diffusive fluxes by 5 orders of magnitude. A fast increase in dissolved gaseous mercury (DGM) concentration was also observed in the first 20-30min of inundation (maximum of 40pg L -1 ). Suspended particulate matter (SPM) concentrations were inversely correlated with DGM concentrations. Dissolved Hg variation suggested that biotic DGM production in pore waters is a significant factor in addition to the photochemical reduction of Hg. Mercury volatilization (ranged from 1.1 to 3.3ngm -2 h -1 ; average of 2.1ngm -2 h -1 ) and DGM production exhibited the same pattern with no significant time-lag suggesting a fast release of the produced DGM. These results indicate that Hg sediment/water exchanges in the physical dominated estuaries can be underestimated when the tidal effect is not considered. Copyright © 2017 Elsevier B.V. All rights reserved.

  17. Mercury emissions from municipal solid waste combustors

    Energy Technology Data Exchange (ETDEWEB)

    1993-05-01

    This report examines emissions of mercury (Hg) from municipal solid waste (MSW) combustion in the United States (US). It is projected that total annual nationwide MSW combustor emissions of mercury could decrease from about 97 tonnes (1989 baseline uncontrolled emissions) to less than about 4 tonnes in the year 2000. This represents approximately a 95 percent reduction in the amount of mercury emitted from combusted MSW compared to the 1989 mercury emissions baseline. The likelihood that routinely achievable mercury emissions removal efficiencies of about 80 percent or more can be assured; it is estimated that MSW combustors in the US could prove to be a comparatively minor source of mercury emissions after about 1995. This forecast assumes that diligent measures to control mercury emissions, such as via use of supplemental control technologies (e.g., carbon adsorption), are generally employed at that time. However, no present consensus was found that such emissions control measures can be implemented industry-wide in the US within this time frame. Although the availability of technology is apparently not a limiting factor, practical implementation of necessary control technology may be limited by administrative constraints and other considerations (e.g., planning, budgeting, regulatory compliance requirements, etc.). These projections assume that: (a) about 80 percent mercury emissions reduction control efficiency is achieved with air pollution control equipment likely to be employed by that time; (b) most cylinder-shaped mercury-zinc (CSMZ) batteries used in hospital applications can be prevented from being disposed into the MSW stream or are replaced with alternative batteries that do not contain mercury; and (c) either the amount of mercury used in fluorescent lamps is decreased to an industry-wide average of about 27 milligrams of mercury per lamp or extensive diversion from the MSW stream of fluorescent lamps that contain mercury is accomplished.

  18. Mercury accumulation in native mammals of the Southeast

    Energy Technology Data Exchange (ETDEWEB)

    Cumbie, P.M.; Jenkins, J.H.

    1974-01-01

    Mercury levels in tissues of mammals collected in Georgia, Florida, and South Carolina were compared using hair mercury concentration as an index of total mercury content. Bobcats (Lynx rufus), raccoons (Procyon lotor), opossum (Didelphis marsupialis) and gray fox (Urocyon cinereoargenteus) from the Lower Coastal Plain of Georgia had higher mercury levels than specimens from the Upper Coastal Plain or Piedmont. The highest individual mercury levels in raccoons and bobcats occurred in specimens from the Georgia Lower Coastal Plain flatwoods. Skeletal muscle and liver of individual raccoons and bobcats taken in the coastal flatwoods exceeded the 0.5 ppm limit for mercury in human foodstuffs. No pattern of mercury accumulation was detected in white-tailed deer (Odocoileus virginianus). Hair analysis revealed elevated mercury levels in mammals from a region exposed to mercury pollution. Mercury levels in wildlife exhibit a pattern similar to that of certain fallout radioisotopes such as /sub 137/Cs. These observations indicate that significant biomagnification of mercury may occur in native mammals in certain southeastern habitats. 28 references, 6 tables.

  19. Mercury in a coastal marine environment

    Energy Technology Data Exchange (ETDEWEB)

    Burton, J D; Leatherland, T M

    1971-06-18

    The problem of mercury pollution was investigated in Southampton Water and the English Channel. Mercury was determined in five specimens of the mollusk, Mercenaria mercenaria. The concentrations in whole organisms, without shell, ranged from 0.18 to 0.57 p.p.m. The amounts of mercury in the river and estuarine waters were found to be low. Yet, samples from the surface of the bottom mud in different parts of the estuary had mercury contents ranging from 0.19 to 0.64 p.p.m. The role of sediments in the transport of mercury in food chains could be significant, particularly for bottom living, suspension feeding animals. 14 references, 1 table.

  20. Mercury risk in poultry in the Wanshan Mercury Mine, China

    International Nuclear Information System (INIS)

    Yin, Runsheng; Zhang, Wei; Sun, Guangyi; Feng, Zhaohui; Hurley, James P.; Yang, Liyuan; Shang, Lihai; Feng, Xinbin

    2017-01-01

    In this study, total mercury (THg) and methylmercury (MeHg) concentrations in muscles (leg and breast), organs (intestine, heart, stomach, liver) and blood were investigated for backyard chickens, ducks and geese of the Wanshan Mercury Mine, China. THg in poultry meat products range from 7.9 to 3917.1 ng/g, most of which exceeded the Chinese national standard limit for THg in meat (50 ng/g). Elevated MeHg concentrations (0.4–62.8 ng/g) were also observed in meat products, suggesting that poultry meat can be an important human MeHg exposure source. Ducks and geese showed higher Hg levels than chickens. For all poultry species, the highest Hg concentrations were observed in liver (THg: 23.2–3917.1 ng/g; MeHg: 7.1–62.8 ng/g) and blood (THg: 12.3–338.0 ng/g; MeHg: 1.4–17.6 ng/g). We estimated the Hg burdens in chickens (THg: 15.3–238.1 μg; MeHg: 2.2–15.6 μg), ducks (THg: 15.3–238.1 μg; MeHg: 3.5–14.7 μg) and geese (THg: 83.8–93.4 μg; MeHg: 15.4–29.7 μg). To not exceed the daily intake limit for THg (34.2 μg/day) and MeHg (6 μg/day), we suggested that the maximum amount (g) for chicken leg, breast, heart, stomach, intestine, liver, and blood should be 1384, 1498, 2315, 1214, 1081, 257, and 717, respectively; the maximum amount (g) for duck leg, breast, heart, stomach, intestine, liver, and blood should be 750, 1041, 986, 858, 752, 134, and 573, respectively; and the maximum amount (g) for goose leg, breast, heart, stomach, intestine, liver, and blood should be 941, 1051, 1040, 1131, 964, 137, and 562, respectively. - Highlights: • Elevated mercury levels were observed in poultry from Wanshan Mercury Mine, China. • Ducks and geese showed higher mercury levels than chickens. • Liver and blood showed the highest mercury levels. • Poultry can be an important dietary Hg exposure source for local residents. - High levels of Hg associated with poultry surrounding the Wanshan Mercury Mine pose a great risk of Hg exposure to

  1. Sorption of mercury on chemically synthesized polyaniline

    International Nuclear Information System (INIS)

    Remya Devi, P.S.; Verma, R.; Sudersanan, M.

    2006-01-01

    Sorption of inorganic mercury (Hg 2+ ) and methyl mercury, on chemically synthesized polyaniline, in 0.1-10N HCl solutions has been studied. Hg 2+ is strongly sorbed at low acidities and the extent of sorption decreases with increase in acidity. The sorption of methyl mercury is very low in the HCl concentration range studied. Sorption of Hg 2+ on polyaniline in 0.1-10N LiCl and H 2 SO 4 solutions has also been studied. The analysis of the data indicates that the sorption of Hg 2+ depends on the degree of protonation of polyaniline and the nature of mercury(II) chloride complexes in solution. X-ray photoelectron spectroscopy analysis (XPS) of polyaniline sorbed with mercury show that mercury is bound as Hg 2+ . Sorbed mercury is quantitatively eluted from polyaniline with 0.5N HNO 3 . Polyaniline can be used for separation and pre-concentration of inorganic mercury from aqueous samples. (author)

  2. Global Mercury Pathways in the Arctic Ecosystem

    Science.gov (United States)

    Lahoutifard, N.; Lean, D.

    2003-12-01

    The sudden depletions of atmospheric mercury which occur during the Arctic spring are believed to involve oxidation of gaseous elemental mercury, Hg(0), rendering it less volatile and more soluble. The Hg(II) oxidation product(s) are more susceptible to deposition, consistent with the observation of dramatic increases in snow mercury levels during depletion events. Temporal correlations with ozone depletion events and the proliferation of BrO radicals support the hypothesis that oxidation of Hg(0) occurs in the gas phase and results in its conversion to RGM (Reactive Gaseous Mercury). The mechanisms of Hg(0) oxidation and particularly Hg(II) reduction are as yet unproven. In order to evaluate the feasibility of proposed chemical processes involving mercury in the Arctic atmosphere and its pathway after deposition on the snow from the air, we investigated mercury speciation in air and snow pack at Resolute, Nunavut, Canada (latitude 75° N) prior to and during snow melt during spring 2003. Quantitative, real-time information on emission, air transport and deposition were combined with experimental studies of the distribution and concentrations of different mercury species, methyl mercury, anions, total organic carbon and total inorganic carbon in snow samples. The effect of solar radiation and photoreductants on mercury in snow samples was also investigated. In this work, we quantify mercury removed from the air, and deposited on the snow and the transformation to inorganic and methyl mercury.

  3. Mercury pOIsonIng

    African Journals Online (AJOL)

    A case of mercury poisoning is reported and clinical observations of 6 .... fish ingested and occupational exposure. .... exposed to mercury as a result of inadequate industrial safety standards, and ... WHO Tech Rep Ser 1980; No. 674: 102-115.

  4. Phenotype-gene: 196 [Arabidopsis Phenome Database[Archive

    Lifescience Database Archive (English)

    Full Text Available 196 http://metadb.riken.jp/db/SciNetS_ria224i/cria224u3ria224u1194i decreased sensitivity under influence... http://metadb.riken.jp/db/SciNetS_ria224i/cria224u4ria224u17347412i decreased sensitivity under influence o

  5. Reference Atmosphere for Mercury

    Science.gov (United States)

    Killen, Rosemary M.

    2002-01-01

    We propose that Ar-40 measured in the lunar atmosphere and that in Mercury's atmosphere is due to current diffusion into connected pore space within the crust. Higher temperatures at Mercury, along with more rapid loss from the atmosphere will lead to a smaller column abundance of argon at Mercury than at the Moon, given the same crustal abundance of potassium. Because the noble gas abundance in the Hermean atmosphere represents current effusion, it is a direct measure of the crustal potassium abundance. Ar-40 in the atmospheres of the planets is a measure of potassium abundance in the interiors, since Ar-40 is a product of radiogenic decay of K-40 by electron capture with the subsequent emission of a 1.46 eV gamma-ray. Although the Ar-40 in the Earth's atmosphere is expected to have accumulated since the late bombardment, Ar-40 in the atmospheres of Mercury and the Moon is eroded quickly by photoionization and electron impact ionization. Thus, the argon content in the exospheres of the Moon and Mercury is representative of current effusion rather than accumulation over the lifetime of the planet.

  6. Health Effects of Exposures to Mercury

    Science.gov (United States)

    ... IRIS database Top of Page Elemental (Metallic) Mercury Effects Exposures to metallic mercury most often occur when metallic ... poor performance on tests of mental function Higher exposures may also cause kidney effects, respiratory failure and death. Note that metallic mercury ...

  7. Legislation, standards and methods for mercury emissions control

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    2012-04-15

    Mercury is an element of growing global concern. The United Nations Environment Programme plans to finalise and ratify a new global legally-binding convention on mercury by 2013. Canada already has legislation on mercury emissions from coal-fired utilities and the USA has recently released the new Mercury and Air Toxics Standard. Although other countries may not have mercury-specific legislation as such, many have legislation which results in significant co-benefit mercury reduction due to the installation of effective flue-gas cleaning technologies. This report reviews the current situation and trends in mercury emission legislation and, where possible, discusses the actions that will be taken under proposed or impending standards globally and regionally. The report also reviews the methods currently applied for mercury control and for mercury emission measurement with emphasis on the methodologies most appropriate for compliance. Examples of the methods of mercury control currently deployed in the USA, Canada and elsewhere are included.

  8. The tectonics of Mercury

    International Nuclear Information System (INIS)

    Melosh, H.J.; Mckinnon, W.B.

    1988-01-01

    The probable tectonic history of Mercury and the relative sequence of events are discussed on the basis of data collected by the Mariner-10 spacecraft. Results indicate that Mercury's tectonic activity was confined to its early history; its endogenic activity was principally due to a small change in the shape of its lithosphere, caused by tidal despinning, and a small change in area caused by shrinkage due to cooling. Exogenic processes, in particular the impact activity, have produced more abundant tectonic features. Many features associated with the Caloris basin are due to loading of Mercury's thick lithosphere by extrusive lavas or subsidence due to magma withdrawal. It is emphasized that tectonic features observed on Mercury yield insight into the earliest tectonic events on planets like Mars and, perhaps, the earth, where subsequent events obscured or erased the most ancient tectonic records

  9. Mercury Toolset for Spatiotemporal Metadata

    Science.gov (United States)

    Devarakonda, Ranjeet; Palanisamy, Giri; Green, James; Wilson, Bruce; Rhyne, B. Timothy; Lindsley, Chris

    2010-06-01

    Mercury (http://mercury.ornl.gov) is a set of tools for federated harvesting, searching, and retrieving metadata, particularly spatiotemporal metadata. Version 3.0 of the Mercury toolset provides orders of magnitude improvements in search speed, support for additional metadata formats, integration with Google Maps for spatial queries, facetted type search, support for RSS (Really Simple Syndication) delivery of search results, and enhanced customization to meet the needs of the multiple projects that use Mercury. It provides a single portal to very quickly search for data and information contained in disparate data management systems, each of which may use different metadata formats. Mercury harvests metadata and key data from contributing project servers distributed around the world and builds a centralized index. The search interfaces then allow the users to perform a variety of fielded, spatial, and temporal searches across these metadata sources. This centralized repository of metadata with distributed data sources provides extremely fast search results to the user, while allowing data providers to advertise the availability of their data and maintain complete control and ownership of that data. Mercury periodically (typically daily)harvests metadata sources through a collection of interfaces and re-indexes these metadata to provide extremely rapid search capabilities, even over collections with tens of millions of metadata records. A number of both graphical and application interfaces have been constructed within Mercury, to enable both human users and other computer programs to perform queries. Mercury was also designed to support multiple different projects, so that the particular fields that can be queried and used with search filters are easy to configure for each different project.

  10. Mercury Toolset for Spatiotemporal Metadata

    Science.gov (United States)

    Wilson, Bruce E.; Palanisamy, Giri; Devarakonda, Ranjeet; Rhyne, B. Timothy; Lindsley, Chris; Green, James

    2010-01-01

    Mercury (http://mercury.ornl.gov) is a set of tools for federated harvesting, searching, and retrieving metadata, particularly spatiotemporal metadata. Version 3.0 of the Mercury toolset provides orders of magnitude improvements in search speed, support for additional metadata formats, integration with Google Maps for spatial queries, facetted type search, support for RSS (Really Simple Syndication) delivery of search results, and enhanced customization to meet the needs of the multiple projects that use Mercury. It provides a single portal to very quickly search for data and information contained in disparate data management systems, each of which may use different metadata formats. Mercury harvests metadata and key data from contributing project servers distributed around the world and builds a centralized index. The search interfaces then allow the users to perform a variety of fielded, spatial, and temporal searches across these metadata sources. This centralized repository of metadata with distributed data sources provides extremely fast search results to the user, while allowing data providers to advertise the availability of their data and maintain complete control and ownership of that data. Mercury periodically (typically daily) harvests metadata sources through a collection of interfaces and re-indexes these metadata to provide extremely rapid search capabilities, even over collections with tens of millions of metadata records. A number of both graphical and application interfaces have been constructed within Mercury, to enable both human users and other computer programs to perform queries. Mercury was also designed to support multiple different projects, so that the particular fields that can be queried and used with search filters are easy to configure for each different project.

  11. 21 CFR 880.2920 - Clinical mercury thermometer.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 8 2010-04-01 2010-04-01 false Clinical mercury thermometer. 880.2920 Section 880... Devices § 880.2920 Clinical mercury thermometer. (a) Identification. A clinical mercury thermometer is a... mercury. (b) Classification. Class II (special controls). The device is exempt from the premarket...

  12. Bench-scale studies with mercury contaminated SRS soil

    International Nuclear Information System (INIS)

    Cicero, C.A.

    1995-01-01

    Bench-scale studies with mercury contaminated soil were performed at the SRTC to determine the optimum waste loading obtainable in the glass product without sacrificing durability, leach resistance, and processability. Vitrifying this waste stream also required offgas treatment for the capture of the vaporized mercury. Four soil glasses with slight variations in composition were produced, which were capable of passing the Product Consistency Test (PCT) and the Toxicity Characteristic Leaching Procedure (TCLP). The optimum glass feed composition contained 60 weight percent soil and produced a soda-lime-silica glass when melted at 1,350 C. The glass additives used to produce this glass were 24 weight percent Na 2 CO 3 and 16 weight percent CaCO 3 . Volatilized mercury released during the vitrification process was released to the proposed mercury collection system. The proposed mercury collection system consisted of quartz and silica tubing with a Na 2 S wash bottle followed by a NaOH wash bottle. Once in the system, the volatile mercury would pass through the wash bottle containing Na 2 S, where it would be converted to Hg 2 S, which is a stable form of mercury. However, attempts to capture the volatilized mercury in a Na 2 S solution wash bottle were not as successful as anticipated. Maximum mercury captured was only about 3.24% of the mercury contained in the feed. Mercury capture efforts then shifted to condensing and capturing the volatilized mercury. These attempts were much more successful at capturing the volatile mercury, with a capture efficiency of 34.24% when dry ice was used to pack the condenser. This captured mercury was treated on a mercury specific resin after digestion of the volatilized mercury

  13. Methyl mercury in terrestrial compartments

    International Nuclear Information System (INIS)

    Stoeppler, M.; Burow, M.; Padberg, S.; May, K.

    1993-09-01

    On the basis of the analytical methodology available at present the state of the art for the determination of total mercury and of various organometallic compounds of mercury in air, precipitation, limnic systems, soils, plants and biota is reviewed. This is followed by the presentation and discussion of examples for the data obtained hitherto for trace and ultratrace levels of total mercury and mainly methyl mercury in terrestrial and limnic environments as well as in biota. The data discussed stem predominantly from the past decade in which, due to significant methodological progress, many new aspects were elucidated. They include the most important results in this area achieved by the Research Centre (KFA) Juelich within the project 'Origin and Fate of Methyl Mercury' (contracts EV4V-0138-D and STEP-CT90-0057) supported by the Commission of the European Communities, Brussels. (orig.) [de

  14. Cytochemical demonstration of mercury deposits in trout liver and kidney following methyl mercury intoxication: differentiation of two mercury pools by selenium

    DEFF Research Database (Denmark)

    Baatrup, E; Danscher, G

    1988-01-01

    and the selected organs were determined by measuring the uptake of 203Hg-labeled MeHg. Spleen, liver, and kidney had the highest concentrations after both experimental periods, while the largest relative increases were found in brain, muscle, and kidney. The subcellular distribution of mercury accumulations...... was demonstrated cytochemically in liver and kidney using the silver enhancement method by which accumulations of mercury-sulfides and/or mercury-selenides are made visible for light and electron microscopy. When sections prepared from the liver and kidney from fish, injected with selenium 2 hr prior to being...... pronounced in the kidney. The HgSe pool, supposed to represent methyl mercury, was shown by the presence of silver deposits at new locations as well as by an increase in the amount of deposits within lysosomes. The new locations included (1) secretory-like vesicles and the bile canaliculi of the liver...

  15. PyMercury: Interactive Python for the Mercury Monte Carlo Particle Transport Code

    International Nuclear Information System (INIS)

    Iandola, F.N.; O'Brien, M.J.; Procassini, R.J.

    2010-01-01

    Monte Carlo particle transport applications are often written in low-level languages (C/C++) for optimal performance on clusters and supercomputers. However, this development approach often sacrifices straightforward usability and testing in the interest of fast application performance. To improve usability, some high-performance computing applications employ mixed-language programming with high-level and low-level languages. In this study, we consider the benefits of incorporating an interactive Python interface into a Monte Carlo application. With PyMercury, a new Python extension to the Mercury general-purpose Monte Carlo particle transport code, we improve application usability without diminishing performance. In two case studies, we illustrate how PyMercury improves usability and simplifies testing and validation in a Monte Carlo application. In short, PyMercury demonstrates the value of interactive Python for Monte Carlo particle transport applications. In the future, we expect interactive Python to play an increasingly significant role in Monte Carlo usage and testing.

  16. Intentional intravenous mercury injection

    African Journals Online (AJOL)

    In this case report, intravenous complications, treatment strategies and possible ... Mercury toxicity is commonly associated with vapour inhalation or oral ingestion, for which there exist definite treatment options. Intravenous mercury ... personality, anxiousness, irritability, insomnia, depression and drowsi- ness.[1] However ...

  17. Human accumulation of mercury in Greenland

    DEFF Research Database (Denmark)

    Johansen, Poul; Mulvad, Gert; Pedersen, Henning Sloth

    2007-01-01

    In the Arctic, the traditional diet exposes its people to a high intake of mercury especially from marine mammals. To determine whether the mercury is accumulated in humans, we analyzed autopsy samples of liver, kidney and spleen from adult ethnic Greenlanders who died between 1990 and 1994 from...... a wide range of causes, natural and violent. Liver, kidney and spleen samples from between 33 and 71 case subjects were analyzed for total mercury and methylmercury, and liver samples also for selenium. Metal levels in men and women did not differ and were not related to age except in one case, i.......e. for total mercury in liver, where a significant declining concentration with age was observed. The highest total mercury levels were found in kidney followed by liver and spleen. Methylmercury followed the same pattern, but levels were much lower, constituting only 19% of the total mercury concentration...

  18. Human accumulation of mercury in Greenland

    DEFF Research Database (Denmark)

    Johansen, P.; Mulvad, G.; Pedersen, H. S.

    2007-01-01

    a wide range of causes, natural and violent. Liver, kidney and spleen samples from between 33 and 71 case subjects were analyzed for total mercury and methylmercury, and liver samples also for selenium. Metal levels in men and women did not differ and were not related to age except in one case, i......In the Arctic, the traditional diet exposes its people to a high intake of mercury especially from marine mammals. To determine whether the mercury is accumulated in humans, we analyzed autopsy samples of liver, kidney and spleen from adult ethnic Greenlanders who died between 1990 and 1994 from.......e. for total mercury in liver, where a significant declining concentration with age was observed. The highest total mercury levels were found in kidney followed by liver and spleen. Methylmercury followed the same pattern, but levels were much lower, constituting only 19% of the total mercury concentration...

  19. New Mechanisms of Mercury Binding to Peat

    Science.gov (United States)

    Nagy, K. L.; Manceau, A.; Gasper, J. D.; Ryan, J. N.; Aiken, G. R.

    2007-12-01

    Mercury can be immobilized in the aquatic environment by binding to peat, a solid form of natural organic matter. Binding mechanisms can vary in strength and reversibility, and therefore will control concentrations of bioreactive mercury, may explain rates of mercury methylation, and are important for designing approaches to improve water quality using natural wetlands or engineered phytoremediation schemes. In addition, strong binding between mercury and peat is likely to result in the fixation of mercury that ultimately resides in coal. The mechanisms by which aqueous mercury at low concentrations reacts with both dissolved and solid natural organic matter remain incompletely understood, despite recent efforts. We have identified three distinct binding mechanisms of divalent cationic mercury to solid peats from the Florida Everglades using EXAFS spectroscopic data (FAME beamline, European Synchrotron Radiation Facility (ESRF)) obtained on experimental samples as compared to relevant references including mercury-bearing solids and mercury bound to various organic molecules. The proportions of the three molecular configurations vary with Hg concentration, and two new configurations that involve sulfur ligands occur at Hg concentrations up to about 4000 ppm. The binding mechanism at the lowest experimental Hg concentration (60-80 ppm) elucidates published reports on the inhibition of metacinnabar formation in the presence of Hg-bearing solutions and dissolved natural organic matter, and also, the differences in extent of mercury methylation in distinct areas of the Florida Everglades.

  20. Mercury in mussels of Bellingham Bay, Washington, (USA)

    Energy Technology Data Exchange (ETDEWEB)

    Roesijadi, G.; Drum, A.S.; Bridge, J.R.

    1978-11-01

    Laboratory experiments demonstrated the existence of metallothionein-like, low molecular weight, mercury-binding proteins in the marine mussel Mytilus edulis. Relatively large quantities of mercury were associated with such proteins in gills and digestive gland, the organs of interest in the present study. /sup 14/C-incorporation indicated induction of the protein in gills, but not in digestive gland. Mercury in digestive gland may have bound to existing metal-binding proteins. Short-term incorporation of mercury occurred primarily in gills. The induction of mercury-binding proteins in gills may have facilitated detoxification of mercury at the site of uptake. Mercury in mussels of Bellingham Bay were shown to have decreased from 1970 to 1978, the collection date for the present study. Mercury levels were low but approximately three times higher than those from uncontaminated areas. Mercury associated with the mercury-binding protein of gills and digestive glands of Bellingham Bay mussels were low and reflected the concentrations measured in the whole tissues. However, the highest concentration of mercury was associated with the low molecular pool components, the identity of which is not presently known.

  1. 21 CFR 862.3600 - Mercury test system.

    Science.gov (United States)

    2010-04-01

    ....3600 Mercury test system. (a) Identification. A mercury test system is a device intended to measure mercury, a heavy metal, in human specimens. Measurements obtained by this device are used in the diagnosis... 21 Food and Drugs 8 2010-04-01 2010-04-01 false Mercury test system. 862.3600 Section 862.3600...

  2. Worldwide trend of atmospheric mercury since 1995

    Directory of Open Access Journals (Sweden)

    F. Slemr

    2011-05-01

    Full Text Available Concern about the adverse effects of mercury on human health and ecosystems has led to tightening emission controls since the mid 1980s. But the resulting mercury emissions reductions in many parts of the world are believed to be offset or even surpassed by the increasing emissions in rapidly industrializing countries. Consequently, concentrations of atmospheric mercury are expected to remain roughly constant. Here we show that the worldwide atmospheric mercury concentrations have decreased by about 20 to 38 % since 1996 as indicated by long-term monitoring at stations in the Southern and Northern Hemispheres combined with intermittent measurements of latitudinal distribution over the Atlantic Ocean. The total reduction of the atmospheric mercury burden of this magnitude within 14 years is unusually large among most atmospheric trace gases and is at odds with the current mercury emission inventories with nearly constant anthropogenic emissions over this period. This suggests a major shift in the biogeochemical cycle of mercury including oceans and soil reservoirs. Decreasing reemissions from the legacy of historical mercury emissions are the most likely explanation for this decline since the hypothesis of an accelerated oxidation rate of elemental mercury in the atmosphere is not supported by the observed trends of other trace gases. Acidification of oceans, climate change, excess nutrient input and pollution may also contribute by their impact on the biogeochemistry of ocean and soils. Consequently, models of the atmospheric mercury cycle have to include soil and ocean mercury pools and their dynamics to be able to make projections of future trends.

  3. Mercury distribution in Douro estuary (Portugal)

    Energy Technology Data Exchange (ETDEWEB)

    Ramalhosa, E. [Department of Chemistry, University of Aveiro, 3810-193 Aveiro (Portugal); Pereira, E. [Department of Chemistry, University of Aveiro, 3810-193 Aveiro (Portugal)]. E-mail: eduper@dq.ua.pt; Vale, C. [National Institute for Agronomy and Fishery Research, IPIMAR, Avenida Brasilia, 1449-006 Lisboa (Portugal); Valega, M. [Department of Chemistry, University of Aveiro, 3810-193 Aveiro (Portugal); Monterroso, P. [Department of Chemistry, University of Aveiro, 3810-193 Aveiro (Portugal); Duarte, A.C. [Department of Chemistry, University of Aveiro, 3810-193 Aveiro (Portugal)

    2005-11-15

    Determinations of dissolved reactive and total dissolved mercury, particulate and sedimentary mercury, dissolved organic carbon (DOC), particulate organic carbon (POC) and suspended particulate matter (SPM) have been made in the estuary of river Douro, in northern Portugal. The estuary was stratified by salinity along most of its length, it had low concentrations of SPM, typically <20 mg dm{sup -3}, and concentrations of DOC in the range <1.0-1.8 mg dm{sup -3}. The surface waters had a maximum dissolved concentration of reactive mercury of about 10 ng dm{sup -3}, whereas for the more saline bottom waters it was about 65 ng dm{sup -3}. The surface waters had maximum concentrations of total suspended particulate mercury of {approx}7 {mu}g g{sup -1} and the bottom waters were always <1 {mu}g g{sup -1}. Concentrations of mercury in sediments was low and in the range from 0.06 to 0.18 {mu}g g{sup -1}. The transport of mercury in surface waters was mainly associated with organic-rich particulate matter, while in bottom waters the dissolved phase transport of mercury is more important. Lower particulate organic matter, formation of chlorocomplexes in more saline waters and eventually the presence of colloids appear to explain the difference of mercury partitioning in Douro estuarine waters.

  4. Mixed Waste Focus Area Mercury Working Group: An integrated approach to mercury waste treatment and disposal

    International Nuclear Information System (INIS)

    Conley, T.B.; Morris, M.I.; Osborne-Lee, I.W.

    1998-03-01

    In May 1996, the US Department of Energy (DOE) Mixed Waste Focus Area (MWFA) initiated the Mercury Working Group (HgWG). The HgWG was established to address and resolve the issues associated with mercury contaminated mixed wastes. During the MWFA's initial technical baseline development process, three of the top four technology deficiencies identified were related to the need for amalgamation, stabilization, and separation removal technologies for the treatment of mercury and mercury contaminated mixed waste. The HgWG is assisting the MWFA in soliciting, identifying, initiating, and managing efforts to address these areas. The focus of the HgWG is to better establish the mercury related treatment technologies at the DOE sites, refine the MWFA technical baseline as it relates to mercury treatment, and make recommendations to the MWFA on how to most effectively address these needs. Based on the scope and magnitude of the mercury mixed waste problem, as defined by HgWG, solicitations and contract awards have been made to the private sector to demonstrate both the amalgamation and stabilization processes using actual mixed wastes. Development efforts are currently being funded that will address DOE's needs for separation removal processes. This paper discusses the technology selection process, development activities, and the accomplishments of the HgWG to date through these various activities

  5. 40 CFR Appendix Xiii to Part 266 - Mercury Bearing Wastes That May Be Processed in Exempt Mercury Recovery Units

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 26 2010-07-01 2010-07-01 false Mercury Bearing Wastes That May Be Processed in Exempt Mercury Recovery Units XIII Appendix XIII to Part 266 Protection of Environment... XIII to Part 266—Mercury Bearing Wastes That May Be Processed in Exempt Mercury Recovery Units These...

  6. Mercury in terrestrial forested systems with highly elevated mercury deposition in southwestern China: The risk to insects and potential release from wildfires

    International Nuclear Information System (INIS)

    Zhou, Jun; Wang, Zhangwei; Sun, Ting; Zhang, Huan; Zhang, Xiaoshan

    2016-01-01

    Forests are considered a pool of mercury in the global mercury cycle. However, few studies have investigated the distribution of mercury in the forested systems in China. Tieshanping forest catchment in southwest China was impacted by mercury emissions from industrial activities and coal combustions. Our work studied mercury content in atmosphere, soil, vegetation and insect with a view to estimating the potential for mercury release during forest fires. Results of the present study showed that total gaseous mercury (TGM) was highly elevated and the annual mean concentration was 3.51 ± 1.39 ng m"−"2. Of the vegetation tissues, the mercury concentration follows the order of leaf/needle > root > bark > branch > bole wood for each species. Total ecosystem mercury pool was 103.5 mg m"−"2 and about 99.4% of the mercury resides in soil layers (0–40 cm). The remaining 0.6% (0.50 mg m"−"2) of mercury was stored in biomass. The large mercury stocks in the forest ecosystem pose a serious threat for large pluses to the atmospheric mercury during potential wildfires and additional ecological stress to forest insect: dung beetles, cicada and longicorn, with mercury concentration of 1983 ± 446, 49 ± 38 and 7 ± 5 ng g"−"1, respectively. Hence, the results obtained in the present study has implications for global estimates of mercury storage in forests, risks to forest insect and potential release to the atmosphere during wildfires. - Highlights: • Mercury in air, soil, biomass and insect were studied at a subtropical forest. • 99.4% of the total ecosystem mercury pools was resided in soil layers. • High mercury pools were large pulses to the atmosphere during potential wildfires. • High mercury deposition in forest pose an ecological stress to insect. - Large mercury pools in forest pose a serious threat for large pluses to the atmospheric mercury during potential wildfires and ecological stress to insect.

  7. Localized surface plasmon resonance mercury detection system and methods

    Science.gov (United States)

    James, Jay; Lucas, Donald; Crosby, Jeffrey Scott; Koshland, Catherine P.

    2016-03-22

    A mercury detection system that includes a flow cell having a mercury sensor, a light source and a light detector is provided. The mercury sensor includes a transparent substrate and a submonolayer of mercury absorbing nanoparticles, e.g., gold nanoparticles, on a surface of the substrate. Methods of determining whether mercury is present in a sample using the mercury sensors are also provided. The subject mercury detection systems and methods find use in a variety of different applications, including mercury detecting applications.

  8. Estimating threshold limits for mercury in biological material

    Energy Technology Data Exchange (ETDEWEB)

    Berlin, M H

    1963-01-01

    A brief historical review of the study of occupational exposure to mercury is presented. Important factors in the determination of the tolerable body burden of mercury are discussed, notably the body distribution of mercury after exposure, and the risk of accumulation in different organs. In acute exposure the kidney and liver accumulate much mercury and are hence liable to injury, while recent findings indicate that in chronic exposure to moderate levels of mercury the brain and possibly testes are the critical organs because of a pronounced tendency to accumulate. The possibility of obtaining an index of mercury retention is explored; it is concluded that urinary mercury excretion does not reflect the level of body retention although it may indicate very recent exposure. It is suggested that mercury concentration in biopsies of skin, liver, kidney and colonic mucosa may serve as an index of body retention of mercury. 37 references, 7 figures.

  9. Mercury concentration in coal - Unraveling the puzzle

    Science.gov (United States)

    Toole-O'Neil, B.; Tewalt, S.J.; Finkelman, R.B.; Akers, D.J.

    1999-01-01

    Based on data from the US Geological Survey's COALQUAL database, the mean concentration of mercury in coal is approximately 0.2 ??gg-1. Assuming the database reflects in-ground US coal resources, values for conterminous US coal areas range from 0.08 ??gg-1 for coal in the San Juan and Uinta regions to 0.22 ??gg-1 for the Gulf Coast lignites. Recalculating the COALQUAL data to an equal energy basis unadjusted for moisture differences, the Gulf Coast lignites have the highest values (36.4 lb of Hg/1012 Btu) and the Hams Fork region coal has the lowest value (4.8 lb of Hg/1012Btu). Strong indirect geochemical evidence indicates that a substantial proportion of the mercury in coal is associated with pyrite occurrence. This association of mercury and pyrite probably accounts for the removal of mercury with the pyrite by physical coal cleaning procedures. Data from the literature indicate that conventional coal cleaning removes approximately 37% of the mercury on an equal energy basis, with a range of 0% to 78%. When the average mercury reduction value is applied to in-ground mercury values from the COALQUAL database, the resulting 'cleaned' mercury values are very close to mercury in 'as-shipped' coal from the same coal bed in the same county. Applying the reduction fact or for coal cleaning to eastern US bituminous coal, reduces the mercury input load compared to lower-rank non-deaned western US coal. In the absence of analytical data on as-shipped coal, the mercury data in the COALQUAL database, adjusted for deanability where appropriate, may be used as an estimator of mercury contents of as-shipped coal. ?? 1998 Published by Elsevier Science Ltd. All rights reserved.

  10. 75 FR 30372 - Foreign-Trade Zone 196 Temporary/Interim Manufacturing Authority ATC Logistics & Electronics...

    Science.gov (United States)

    2010-06-01

    ... DEPARTMENT OF COMMERCE Foreign-Trade Zones Board [Docket T-2-2010] Foreign-Trade Zone 196 Temporary/Interim Manufacturing Authority ATC Logistics & Electronics (Cell Phone Kitting and Distribution... filed an application submitted by the ATC Logistics & Electronics, operator of Site 2, FTZ 196...

  11. Risk assessment of mercury contaminated sites

    International Nuclear Information System (INIS)

    Hempel, M.

    1993-01-01

    At two sites, highly contaminated with mercury, risk assessment was executed. Methods were developed to determine organomercury compounds in water, air and soil. Toxicity tests demonstrated the high toxicity of organomercury compounds compared to inorganic mercury. Besides highly toxic methylmercury, ethylmercury was found in soils close to a chemical plant in Marktredwitz. In ultrafiltration-experiments mercury showed great affinity to high molecular substances in water. Lysimeter-experiments proved, that organomercury compounds are adsorbed and transformed to inorganic and elemental mercury. (orig.) [de

  12. Control of mercury emissions: policies, technologies, and future trends

    OpenAIRE

    Rhee, Seung-Whee

    2015-01-01

    Seung-Whee Rhee Department of Environmental Engineering, Kyonggi University, Suwon, Republic of Korea Abstract: Owing to the Minamata Convention on Mercury and the Global Mercury Partnership, policies and regulations on mercury management in advanced countries were intensified by a mercury phaseout program in the mercury control strategy. In developing countries, the legislative or regulatory frameworks on mercury emissions are not established specifically, but mercury management is designed...

  13. Recent Advances in Atmospheric Chemistry of Mercury

    Directory of Open Access Journals (Sweden)

    Lin Si

    2018-02-01

    Full Text Available Mercury is one of the most toxic metals and has global importance due to the biomagnification and bioaccumulation of organomercury via the aquatic food web. The physical and chemical transformations of various mercury species in the atmosphere strongly influence their composition, phase, transport characteristics and deposition rate back to the ground. Modeling efforts to assess global cycling of mercury require an accurate understanding of atmospheric mercury chemistry. Yet, there are several key uncertainties precluding accurate modeling of physical and chemical transformations. We focus this article on recent studies (since 2015 on improving our understanding of the atmospheric chemistry of mercury. We discuss recent advances in determining the dominant atmospheric oxidant of elemental mercury (Hg0 and understanding the oxidation reactions of Hg0 by halogen atoms and by nitrate radical (NO3—in the aqueous reduction of oxidized mercury compounds (HgII as well as in the heterogeneous reactions of Hg on atmospheric-relevant surfaces. The need for future research to improve understanding of the fate and transformation of mercury in the atmosphere is also discussed.

  14. Urban artisanal gold shops and mercury emissions

    International Nuclear Information System (INIS)

    Cordy, P.; Veiga, M.; Carrasco, V.H.G.

    2008-01-01

    Artisanal miners in developing countries use mercury amalgamation processes to extract gold. The amalgams are then refined before being sold on to urban gold shops. The amalgams can often contain between 2 to 40 per cent mercury. Unburned amalgams are also often sold directly to gold shops. There are serious health risks for shop employees and nearby populations when the gold is melted and further purified. Studies have shown that mercury concentrations in the ambient air of gold shops often exceeds World Health Organization (WHO) limits by an order of magnitude or more. This study examined the practices and technologies used to refine gold in Latin America and Indonesia. The study compared and contrasted various refining methods and their resulting mercury emissions. Methods of reducing mercury emissions were also investigated, including a filtration system designed to capture 80 per cent of mercury emissions. Barriers to implementing mercury emissions reduction plans were also investigated. It was concluded that the design of urban gold shops must include condensers, fume hoods, and efficient mercury capture systems. 15 refs

  15. Anthropogenic mercury deposition to arctic lake sediments

    Energy Technology Data Exchange (ETDEWEB)

    Hermanson, M.H. [Westchester University, Westchester, PA (United States). Dept. of Health

    1998-01-01

    The history of atmospheric mercury inputs to remote arctic regions can be measured in lake sediment cores using lead-210 chronology. In the investigation, total mercury deposition is measured in sediments from Imitavik and Annak Lakes on the Belcher Islands in southeastern Hudson Bay, an area in the southern Canadian Arctic with no history of local industrial or agricultural sources of contamination. Both lakes received background and atmospheric inputs of mercury while Annak also received mercury from raw domestic sewage from the Hamlet of Sanikiluaq, a growing Inuit community of about 550 established in the late 1960s. Results from Imitavik show that anthropogenic mercury inputs, apparently transported through the atmosphere, began to appear in the mid-eighteenth century, and continued to the 1990s. Annak had a similar mercury history until the late 1960s when disposal of domestic sewage led to increased sediment and contaminant accumulation. The high input of mercury to Annak confirms that Sanikiluaq residents are exposed to mercury through native food sources. 39 refs., 7 figs., 3 tabs.

  16. 21 CFR 872.3700 - Dental mercury.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 8 2010-04-01 2010-04-01 false Dental mercury. 872.3700 Section 872.3700 Food and... DENTAL DEVICES Prosthetic Devices § 872.3700 Dental mercury. (a) Identification. Dental mercury is a... dental cavity or a broken tooth. (b) Classification. Class I. ...

  17. Origin and composition of Mercury

    International Nuclear Information System (INIS)

    Lewis, J.S.

    1988-01-01

    The predictions of the expected range of composition of Mercury at the time of its formation made on the basis of a suite of condensation-accretion models of Mercury spanning a range of condensation temperature and accretion sampling functions appropriate to Mercury are examined. It is concluded that these compositonal models can, if modified to take into account the nonselective loss of most of the silicate component of the planet during accretion, provide compositional predictions for the Weidenschilling (1978, 1980) mechanism for the accretion of a metal-rich Mercury. The silicate portion would, in this case, contain 3.6 to 4.5 percent alumina, roughly 1 percent of alkali oxides, and between 0.5 and 6 percent FeO

  18. Mercury migration into ground water, a literature study

    Energy Technology Data Exchange (ETDEWEB)

    Carlton, W.H.; Carden, J.L.; Kury, R.; Eichholz, G.G.

    1994-11-01

    This report presents a broad review of the technical literature dealing with mercury migration in the soil. The approach followed was to identify relevant articles by searching bibliographic data bases, obtaining the promising articles and searching these articles for any additional relevant citations. Eight catagories were used to organize the literature, with a review and summary of each paper. Catagories used were the following: chemical states of mercury under environmental conditions; diffusion of mercury vapor through soil; solubility and stability of mercury in environmental waters; transport of mercury on colloids; models for mercury migration through the environment; analytical techniques; retention of mercury by soil components; formation of organomecurials.

  19. Global Mercury Assessment 2013

    International Development Research Centre (IDRC) Digital Library (Canada)

    mercury pollution. This summary report and the accompanying. Technical Background Report for the Global. Mercury Assessment 2013 are developed in response to Decision 25/5, paragraph ... The use of different pollution control technologies in different ...... vegetation, snow, freshwater, and seawater. One of the largest ...

  20. Mercury removal from solid mixed waste

    International Nuclear Information System (INIS)

    Gates, D.D.; Morrissey, M.; Chava, K.K.; Chao, K.

    1994-01-01

    The removal of mercury from mixed wastes is an essential step in eliminating the temporary storage of large inventories of mixed waste throughout the Department of Energy (DOE) complex. Currently thermal treatment has been identified as a baseline technology and is being developed as part of the DOE Mixed Waste Integrated Program (MWIP). Since thermal treatment will not be applicable to all mercury containing mixed waste and the removal of mercury prior to thermal treatment may be desirable, laboratory studies have been initiated at Oak Ridge National Laboratory (ORNL) to develop alternative remediation technologies capable of removing mercury from certain mixed waste. This paper describes laboratory investigations of the KI/I 2 leaching processes to determine the applicability of this process to mercury containing solid mixed waste

  1. Coal fired flue gas mercury emission controls

    CERN Document Server

    Wu, Jiang; Pan, Weiguo; Pan, Weiping

    2015-01-01

    Mercury (Hg) is one of the most toxic heavy metals, harmful to both the environment and human health. Hg is released into the atmosphere from natural and anthropogenic sources and its emission control has caused much concern. This book introduces readers to Hg pollution from natural and anthropogenic sources and systematically describes coal-fired flue gas mercury emission control in industry, especially from coal-fired power stations. Mercury emission control theory and experimental research are demonstrated, including how elemental mercury is oxidized into oxidized mercury and the effect of

  2. Technical report: mercury in the environment: implications for pediatricians.

    Science.gov (United States)

    Goldman, L R; Shannon, M W

    2001-07-01

    Mercury is a ubiquitous environmental toxin that causes a wide range of adverse health effects in humans. Three forms of mercury (elemental, inorganic, and organic) exist, and each has its own profile of toxicity. Exposure to mercury typically occurs by inhalation or ingestion. Readily absorbed after its inhalation, mercury can be an indoor air pollutant, for example, after spills of elemental mercury in the home; however, industry emissions with resulting ambient air pollution remain the most important source of inhaled mercury. Because fresh-water and ocean fish may contain large amounts of mercury, children and pregnant women can have significant exposure if they consume excessive amounts of fish. The developing fetus and young children are thought to be disproportionately affected by mercury exposure, because many aspects of development, particularly brain maturation, can be disturbed by the presence of mercury. Minimizing mercury exposure is, therefore, essential to optimal child health. This review provides pediatricians with current information on mercury, including environmental sources, toxicity, and treatment and prevention of mercury exposure.

  3. Action of mercury as a soil fungicide

    Energy Technology Data Exchange (ETDEWEB)

    Booer, J R

    1951-01-01

    Metallic mercury and mercury compounds in the soil retard the growth of plants. The development of mosses and lichens is inhibited, and experimental evidence shows that the growth of toadstools on turf and the activity of ascomycetes is retarded by mercury. In vitro, mercury has no fungicidal action but the rate of growth of hyphae is reduced by mercury vapour. The lack of fungicial properties of mercury and its good performance in controlling certain soil-borne diseases are reconciled by assuming that a differential retardation disturbs the relationships necessary for infection. This assumption is supported by diagrams which treat the rates of growth of the parasite and the host as population characteristics normally distributed. 21 references, 10 figures, 5 tables.

  4. Assessment of Dietary Mercury Intake and Blood Mercury Levels in the Korean Population: Results from the Korean National Environmental Health Survey 2012–2014

    Directory of Open Access Journals (Sweden)

    Seong-Ah Kim

    2016-09-01

    Full Text Available From a public health perspective, there is growing concern about dietary mercury intake as the most important source of mercury exposure. This study was performed to estimate dietary mercury exposure and to analyze the association between mercury intake and blood mercury levels in Koreans. The study subjects were 553 adults, comprising a 10% representative subsample of the Korean National Environmental Health Survey (KoNEHS 2012–2014, who completed a health examination, a face-to-face interview, and a three-day food record. Dietary mercury and methylmercury intakes were assessed from the three-day food record, and blood mercury concentration was measured using a mercury analyzer. The association between dietary mercury intake and blood mercury levels was analyzed by comparing the odds ratios for the blood mercury levels above the Human BioMonitoring (HBM I value (5 μg/L among the three groups with different mercury intakes. The average total mercury intake was 4.74 and 3.07 μg/day in males and females, respectively. The food group that contributed most to mercury intake was fish and shellfish, accounting for 77.8% of total intake. The geometric mean of the blood mercury concentration significantly and linearly increased with the mercury and methylmercury intakes (p < 0.001. The odds ratios for blood mercury levels above the HBM I value in the highest mercury and methyl mercury intake group were 3.27 (95% Confidence Interval (CI 1.79–5.95 and 3.20 (95% CI 1.77–5.79 times higher than that of the lowest intake group, respectively. Our results provide compelling evidence that blood mercury level has a strong positive association with dietary intake, and that fish and shellfish contribute most to the dietary mercury exposure.

  5. Assessment of Dietary Mercury Intake and Blood Mercury Levels in the Korean Population: Results from the Korean National Environmental Health Survey 2012–2014

    Science.gov (United States)

    Kim, Seong-Ah; Kwon, YoungMin; Kim, Suejin; Joung, Hyojee

    2016-01-01

    From a public health perspective, there is growing concern about dietary mercury intake as the most important source of mercury exposure. This study was performed to estimate dietary mercury exposure and to analyze the association between mercury intake and blood mercury levels in Koreans. The study subjects were 553 adults, comprising a 10% representative subsample of the Korean National Environmental Health Survey (KoNEHS) 2012–2014, who completed a health examination, a face-to-face interview, and a three-day food record. Dietary mercury and methylmercury intakes were assessed from the three-day food record, and blood mercury concentration was measured using a mercury analyzer. The association between dietary mercury intake and blood mercury levels was analyzed by comparing the odds ratios for the blood mercury levels above the Human BioMonitoring (HBM) I value (5 μg/L) among the three groups with different mercury intakes. The average total mercury intake was 4.74 and 3.07 μg/day in males and females, respectively. The food group that contributed most to mercury intake was fish and shellfish, accounting for 77.8% of total intake. The geometric mean of the blood mercury concentration significantly and linearly increased with the mercury and methylmercury intakes (p mercury levels above the HBM I value in the highest mercury and methyl mercury intake group were 3.27 (95% Confidence Interval (CI) 1.79–5.95) and 3.20 (95% CI 1.77–5.79) times higher than that of the lowest intake group, respectively. Our results provide compelling evidence that blood mercury level has a strong positive association with dietary intake, and that fish and shellfish contribute most to the dietary mercury exposure. PMID:27598185

  6. Human Exposure and Health Effects of Inorganic and Elemental Mercury

    OpenAIRE

    Park, Jung-Duck; Zheng, Wei

    2012-01-01

    Mercury is a toxic and non-essential metal in the human body. Mercury is ubiquitously distributed in the environment, present in natural products, and exists extensively in items encountered in daily life. There are three forms of mercury, i.e., elemental (or metallic) mercury, inorganic mercury compounds, and organic mercury compounds. This review examines the toxicity of elemental mercury and inorganic mercury compounds. Inorganic mercury compounds are water soluble with a bioavailability o...

  7. Human Exposure and Health Effects of Inorganic and Elemental Mercury

    Science.gov (United States)

    Zheng, Wei

    2012-01-01

    Mercury is a toxic and non-essential metal in the human body. Mercury is ubiquitously distributed in the environment, present in natural products, and exists extensively in items encountered in daily life. There are three forms of mercury, i.e., elemental (or metallic) mercury, inorganic mercury compounds, and organic mercury compounds. This review examines the toxicity of elemental mercury and inorganic mercury compounds. Inorganic mercury compounds are water soluble with a bioavailability of 7% to 15% after ingestion; they are also irritants and cause gastrointestinal symptoms. Upon entering the body, inorganic mercury compounds are accumulated mainly in the kidneys and produce kidney damage. In contrast, human exposure to elemental mercury is mainly by inhalation, followed by rapid absorption and distribution in all major organs. Elemental mercury from ingestion is poorly absorbed with a bioavailability of less than 0.01%. The primary target organs of elemental mercury are the brain and kidney. Elemental mercury is lipid soluble and can cross the blood-brain barrier, while inorganic mercury compounds are not lipid soluble, rendering them unable to cross the blood-brain barrier. Elemental mercury may also enter the brain from the nasal cavity through the olfactory pathway. The blood mercury is a useful biomarker after short-term and high-level exposure, whereas the urine mercury is the ideal biomarker for long-term exposure to both elemental and inorganic mercury, and also as a good indicator of body burden. This review discusses the common sources of mercury exposure, skin lightening products containing mercury and mercury release from dental amalgam filling, two issues that happen in daily life, bear significant public health importance, and yet undergo extensive debate on their safety. PMID:23230464

  8. Mercury emission, control and measurement from coal combustion

    Energy Technology Data Exchange (ETDEWEB)

    Pan, Wei-Ping [North China Electric Power Univ., Beijing (China). School of Energy and Power Engineering; Western Kentucky Univ., Bowling Green, KY (United States). Inst. for Combustion Science and Environmental Technology; Cao, Yan [Western Kentucky Univ., Bowling Green, KY (United States). Inst. for Combustion Science and Environmental Technology; Zhang, Kai [North China Electric Power Univ., Beijing (China). School of Energy and Power Engineering

    2013-07-01

    Coal-fired electric power generation accounts for 65% of U.S. emissions of sulfur dioxide (SO2), 22% of nitrogen oxides (NOx), and 37% of mercury (Hg). The proposed Clear Air Interstate Rule (CAIR) and Clean Air Mercury Rule (CAMR) will attempt to regulate these emissions using a cap-and-trade program to replace a number of existing regulatory requirements that will impact this industry over the next decade. Mercury emissions remain the largest source that has not yet been efficiently controlled, in part because this is one of the most expensive to control. Mercury is a toxic, persistent pollutant that accumulates in the food chain. During the coal combustion process, when both sampling and accurate measurements are challenging, we know that mercury is present in three species: elemental, oxidized and particulate. There are three basic types of mercury measurement methods: Ontario Hydro Method, mercury continuous emission monitoring systems (CEMS) and sorbent-based monitoring. Particulate mercury is best captured by electrostatic precipitators (ESP). Oxidized mercury is best captured in wet scrubbers. Elemental mercury is the most difficult to capture, but selective catalytic reduction units (SCRs) are able to convert elemental mercury to oxidized mercury allowing it to be captured by wet flue gas desulfurization (FGD). This works well for eastern coals with high chlorine contents, but this does not work well on the Wyoming Powder River Basin (PRB) coals. However, no good explanation for its mechanism, correlations of chlorine content in coal with SCR performance, and impacts of higher chlorine content in coal on FGD re-emission are available. The combination of SCR and FGD affords more than an 80% reduction in mercury emissions in the case of high chlorine content coals. The mercury emission results from different coal ranks, boilers, and the air pollution control device (APCD) in power plant will be discussed. Based on this UAEPA new regulation, most power plants

  9. A thin, dense crust for Mercury

    Science.gov (United States)

    Sori, Michael M.

    2018-05-01

    Crustal thickness is a crucial geophysical parameter in understanding the geology and geochemistry of terrestrial planets. Recent development of mathematical techniques suggests that previous studies based on assumptions of isostasy overestimated crustal thickness on some of the solid bodies of the solar system, leading to a need to revisit those analyses. Here, I apply these techniques to Mercury. Using MESSENGER-derived elemental abundances, I calculate a map of grain density (average 2974 ± 89 kg/m3) which shows that Pratt isostasy is unlikely to be a major compensation mechanism of Mercury's topography. Assuming Airy isostasy, I find the best fit value for Mercury's mean crustal thickness is 26 ± 11 km, 25% lower than the most recently reported and previously thinnest number. Several geological implications follow from this relatively low value for crustal thickness, including showing that the largest impacts very likely excavated mantle material onto Mercury's surface. The new results also show that Mercury and the Moon have a similar proportion of their rocky silicates composing their crusts, and thus Mercury is not uniquely efficient at crustal production amongst terrestrial bodies. Higher resolution topography and gravity data, especially for the southern hemisphere, will be necessary to refine Mercury's crustal parameters further.

  10. 40 CFR 721.10068 - Elemental mercury.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 30 2010-07-01 2010-07-01 false Elemental mercury. 721.10068 Section... Substances § 721.10068 Elemental mercury. (a) Definitions. The definitions in § 721.3 apply to this section... elemental mercury (CAS. No. 7439-97-6) is subject to reporting under this section for the significant new...

  11. Monte Carlo treatment of resonance-radiation imprisonment in fluorescent lamps—revisited

    Science.gov (United States)

    Anderson, James B.

    2016-12-01

    We reported in 1985 a Monte Carlo treatment of the imprisonment of the 253.7 nm resonance radiation from mercury in the mercury-argon discharge of fluorescent lamps. The calculated spectra of the emitted radiation were found in good agreement with measured spectra. The addition of the isotope mercury-196 to natural mercury was found, also in agreement with experiments, to increase lamp efficiency. In this paper we report the extension of the earlier work with increased accuracy, analysis of photon exit-time distributions, recycling of energy released in quenching, analysis of dynamic similarity for different lamp sizes, variation of Mrozowski transfer rates, prediction and analysis of the hyperfine ultra-violet spectra, and optimization of tailored mercury isotope mixtures for increased lamp efficiency. The spectra were found insensitive to the extent of quenching and recycling. The optimized mixtures were found to increase efficiencies by as much as 5% for several lamp configurations. Optimization without increasing the mercury-196 fraction was found to increase efficiencies by nearly 1% for several configurations.

  12. Mockup experiments to investigate the leak rate correlation between mercury and helium for the mercury target system of J-PARC

    International Nuclear Information System (INIS)

    Haga, Katsuhiro; Naoe, Takashi; Kogawa, Hiroyuki; Wakui, Takashi; Futakawa, Masatoshi

    2009-01-01

    Checking the seal performance of the mercury piping network is very important for the mercury target system operation of J-PARC, and the test method for leaks using the pressure change measurement is preferable for this purpose because it can be carried out easily and precisely by measuring the pressure change, and it is free from the risk of mercury contamination. The piping network is pressurized by helium gas. Thus, the correlation between the helium leak rate and mercury leak flow rate was investigated experimentally by carrying out leak tests for helium and mercury with an identical mockup flange model. The results showed that the mercury leak flow rates of the experimental data were lower than those of the estimated value by 64% on average. It was also found that the threshold of the helium leak rate at which good seal performance for mercury can be obtained exists between 2.18 x 10 -4 and 1.01 x 10 -2 Pa.m 3 /s. This fact confirmed the sufficient safety margin of the mercury target system against the mercury leak, where 1 x 10 -6 Pa.m 3 /s was adopted as the seal performance criterion. (author)

  13. Recovery of Mercury From Contaminated Liquid Wastes

    International Nuclear Information System (INIS)

    1998-01-01

    The Base Contract program emphasized the manufacture and testing of superior sorbents for mercury removal, testing of the sorption process at a DOE site, and determination of the regeneration conditions in the laboratory. During this project, ADA Technologies, Inc. demonstrated the following key elements of a successful regenerable mercury sorption process: (1) sorbents that have a high capacity for dissolved, ionic mercury; (2) removal of ionic mercury at greater than 99% efficiency; and (3) thermal regeneration of the spent sorbent. ADA's process is based on the highly efficient and selective sorption of mercury by noble metals. Contaminated liquid flows through two packed columns that contain microporous sorbent particles on which a noble metal has been finely dispersed. A third column is held in reserve. When the sorbent is loaded with mercury to the point of breakthrough at the outlet of the second column, the first column is taken off-line and the flow of contaminated liquid is switched to the second and third columns. The spent column is regenerated by heating. A small flow of purge gas carries the desorbed mercury to a capture unit where the liquid mercury is recovered. Laboratory-scale tests with mercuric chloride solutions demonstrated the sorbents' ability to remove mercury from contaminated wastewater. Isotherms on surrogate wastes from DOE's Y-12 Plant in Oak Ridge, Tennessee showed greater than 99.9% mercury removal. Laboratory- and pilot-scale tests on actual Y-12 Plant wastes were also successful. Mercury concentrations were reduced to less than 1 ppt from a starting concentration of 1,000 ppt. The treatment objective was 50 ppt. The sorption unit showed 10 ppt discharge after six months. Laboratory-scale tests demonstrated the feasibility of sorbent regeneration. Results show that sorption behavior is not affected after four cycles

  14. Mercury and halogens in coal: Chapter 2

    Science.gov (United States)

    Kolker, Allan; Quick, Jeffrey C.; Granite, Evan J.; Pennline, Henry W.; Senior, Constance L.

    2014-01-01

    Apart from mercury itself, coal rank and halogen content are among the most important factors inherent in coal that determine the proportion of mercury captured by conventional controls during coal combustion. This chapter reviews how mercury in coal occurs, gives available concentration data for mercury in U.S. and international commercial coals, and provides an overview of the natural variation in halogens that influence mercury capture. Three databases, the U.S. Geological Survey coal quality (USGS COALQUAL) database for in-ground coals, and the 1999 and 2010 U.S. Environmental Protection Agency (EPA) Information Collection Request (ICR) databases for coals delivered to power stations, provide extensive results for mercury and other parameters that are compared in this chapter. In addition to the United States, detailed characterization of mercury is available on a nationwide basis for China, whose mean values in recent compilations are very similar to the United States in-ground mean of 0.17 ppm mercury. Available data for the next five largest producers (India, Australia, South Africa, the Russian Federation, and Indonesia) are more limited and with the possible exceptions of Australia and the Russian Federation, do not allow nationwide means for mercury in coal to be calculated. Chlorine in coal varies as a function of rank and correspondingly, depth of burial. As discussed elsewhere in this volume, on a proportional basis, bromine is more effective than chlorine in promoting mercury oxidation in flue gas and capture by conventional controls. The ratio of bromine to chlorine in coal is indicative of the proportion of halogens present in formation waters within a coal basin. This ratio is relatively constant except in coals that have interacted with deep-basin brines that have reached halite saturation, enriching residual fluids in bromine. Results presented here help optimize mercury capture by conventional controls and provide a starting point for

  15. The onset collectivity in {sup 196}Po

    Energy Technology Data Exchange (ETDEWEB)

    Bernstein, L A; Cizewski, J A; Jin, H Q; Henry, R G; Farris, L P [Rutgers--the State Univ., New Brunswick, NJ (United States); Khoo, T L; Carpenter, M P; Janssens, R V.F.; Lauritsen, T [Argonne National Lab., IL (United States); Bearden, I G [Purdue Univ., Lafayette, IN (United States); Ye, D [Notre Dame Univ., IN (United States)

    1992-08-01

    We have studied the in-beam {gamma}-ray spectroscopy of {sup 196}Po, which is the first Po isotope to exhibit collective vibrational structure. The onset of collective motion occurs in this isotope because of the large overlap between valence protons in h{sub 9/2} and valence neutrons in i{sub 13/2} orbitals. (author). 7 refs., 2 tabs., 3 figs.

  16. Acclimation of subsurface microbial communities to mercury

    DEFF Research Database (Denmark)

    de Lipthay, Julia R; Rasmussen, Lasse D; Øregaard, Gunnar

    2008-01-01

    of mercury tolerance and functional versatility of bacterial communities in contaminated soils initially were higher for surface soil, compared with the deeper soils. However, following new mercury exposure, no differences between bacterial communities were observed, which indicates a high adaptive potential......We studied the acclimation to mercury of bacterial communities of different depths from contaminated and noncontaminated floodplain soils. The level of mercury tolerance of the bacterial communities from the contaminated site was higher than those of the reference site. Furthermore, the level...... of the subsurface communities, possibly due to differences in the availability of mercury. IncP-1 trfA genes were detected in extracted community DNA from all soil depths of the contaminated site, and this finding was correlated to the isolation of four different mercury-resistance plasmids, all belonging...

  17. Biosensors for detection of mercury in contaminated soils

    International Nuclear Information System (INIS)

    Bontidean, Ibolya; Mortari, Alessia; Leth, Suzanne; Brown, Nigel L.; Karlson, Ulrich; Larsen, Martin M.; Vangronsveld, Jaco; Corbisier, Philippe; Csoeregi, Elisabeth

    2004-01-01

    Biosensors based on whole bacterial cells and on bacterial heavy metal binding protein were used to determine the mercury concentration in soil. The soil samples were collected in a vegetable garden accidentally contaminated with elemental mercury 25 years earlier. Bioavailable mercury was measured using different sensors: a protein-based biosensor, a whole bacterial cell based biosensor, and a plant sensor, i.e. morphological and biochemical responses in primary leaves and roots of bean seedlings grown in the mercury-contaminated soil. For comparison the total mercury concentration of the soil samples was determined by AAS. Whole bacterial cell and protein-based biosensors gave accurate responses proportional to the total amount of mercury in the soil samples. On the contrary, plant sensors were found to be less useful indicators of soil mercury contamination, as determined by plant biomass, mercury content of primary leaves and enzyme activities

  18. Mixed Waste Focus Area mercury contamination product line: An integrated approach to mercury waste treatment and disposal

    International Nuclear Information System (INIS)

    Hulet, G.A.; Conley, T.B.; Morris, M.I.

    1998-01-01

    The US Department of Energy (DOE) Mixed Waste Focus Area (MWFA) is tasked with ensuring that solutions are available for the mixed waste treatment problems of the DOE complex. During the MWFA's initial technical baseline development process, three of the top four technology deficiencies identified were related to the need for amalgamation, stabilization, and separation/removal technologies for the treatment of mercury and mercury-contaminated mixed waste. The focus area grouped mercury-waste-treatment activities into the mercury contamination product line under which development, demonstration, and deployment efforts are coordinated to provide tested technologies to meet the site needs. The Mercury Working Group (HgWG), a selected group of representatives from DOE sites with significant mercury waste inventories, is assisting the MWFA in soliciting, identifying, initiating, and managing efforts to address these areas. Based on the scope and magnitude of the mercury mixed waste problem, as defined by HgWG, solicitations and contract awards have been made to the private sector to demonstrate amalgamation and stabilization processes using actual mixed wastes. Development efforts are currently being funded under the product line that will address DOE's needs for separation/removal processes. This paper discusses the technology selection process, development activities, and the accomplishments of the MWFA to date through these various activities

  19. Magnesium-rich Basalts on Mercury

    Science.gov (United States)

    Martel, L. M. V.

    2013-05-01

    X-ray and gamma-ray spectrometers on NASA's MESSENGER spacecraft are making key measurements regarding the composition and properties of the surface of Mercury, allowing researchers to more clearly decipher the planet's formation and geologic history. The origin of the igneous rocks in the crust of Mercury is the focus of recent research by Karen Stockstill-Cahill and Tim McCoy (National Museum of Natural History, Smithsonian Institution), along with Larry Nittler and Shoshana Weider (Carnegie Institution of Washington) and Steven Hauck II (Case Western Reserve University). Using the well-known MELTS computer code Stockstill-Cahill and coauthors worked with MESSENGER-derived and rock-analog compositions to constrain petrologic models of the lavas that erupted on the surface of Mercury. Rock analogs included a partial melt of the Indarch meteorite and a range of Mg-rich terrestrial rocks. Their work shows the lavas on Mercury are most similar to terrestrial magnesian basalt (with lowered FeO content). The implications of the modeling are that Mg-rich lavas came from high-temperature sources in Mercury's mantle and erupted at high temperature with exceptionally low viscosity into thinly bedded and laterally extensive flows, concepts open to further evaluation by laboratory experiments and by geologic mapping of Mercury's surface using MESSENGER's imaging system and laser altimeter to document flow features and dimensions.

  20. Recovery of mercury from acid waste residues

    Science.gov (United States)

    Greenhalgh, Wilbur O.

    1989-12-05

    Mercury can be recovered from nitric acid-containing fluids by reacting the fluid with aluminum metal to produce mercury metal, and then quenching the reactivity of the nitric acid prior to nitration of the mercury metal.

  1. Mercury contamination from artisanal gold mining in Antioquia, Colombia: The world's highest per capita mercury pollution.

    Science.gov (United States)

    Cordy, Paul; Veiga, Marcello M; Salih, Ibrahim; Al-Saadi, Sari; Console, Stephanie; Garcia, Oseas; Mesa, Luis Alberto; Velásquez-López, Patricio C; Roeser, Monika

    2011-12-01

    The artisanal gold mining sector in Colombia has 200,000 miners officially producing 30tonnes Au/a. In the Northeast of the Department of Antioquia, there are 17 mining towns and between 15,000 and 30,000 artisanal gold miners. Guerrillas and paramilitary activities in the rural areas of Antioquia pushed miners to bring their gold ores to the towns to be processed in Processing Centers or entables. These Centers operate in the urban areas amalgamating the whole ore, i.e. without previous concentration, and later burn gold amalgam without any filtering/condensing system. Based on mercury mass balance in 15 entables, 50% of the mercury added to small ball mills (cocos) is lost: 46% with tailings and 4% when amalgam is burned. In just 5 cities of Antioquia, with a total of 150,000 inhabitants: Segovia, Remedios, Zaragoza, El Bagre, and Nechí, there are 323 entables producing 10-20tonnes Au/a. Considering the average levels of mercury consumption estimated by mass balance and interviews of entables owners, the mercury consumed (and lost) in these 5 municipalities must be around 93tonnes/a. Urban air mercury levels range from 300ng Hg/m(3) (background) to 1million ng Hg/m(3) (inside gold shops) with 10,000ng Hg/m(3) being common in residential areas. The WHO limit for public exposure is 1000ng/m(3). The total mercury release/emissions to the Colombian environment can be as high as 150tonnes/a giving this country the shameful first position as the world's largest mercury polluter per capita from artisanal gold mining. One necessary government intervention is to cut the supply of mercury to the entables. In 2009, eleven companies in Colombia legally imported 130tonnes of metallic mercury, much of it flowing to artisanal gold mines. Entables must be removed from urban centers and technical assistance is badly needed to improve their technology and reduce emissions. Copyright © 2011 Elsevier B.V. All rights reserved.

  2. Cutaneous mercury granuloma

    OpenAIRE

    Kalpana A Bothale; Sadhana D Mahore; Sushil Pande; Trupti Dongre

    2013-01-01

    Cutaneous mercury granuloma is rarely encountered. Clinically it may pose difficulty in diagnosis. Here, we report a 23-year-old male presented with erythematous, nodular lesions over the forearm and anterior aspect of chest wall. Metallic mercury in tissue sections appear as dark black, opaque, spherical globules of varying size and number. They are surrounded by granulomatous foreign-body reaction. It is composed of foreign body giant cells and mixed inflammatory infiltrate composed of hist...

  3. Natural and anthropogenic mercury sources and their impact on the air-surface exchange of mercury on regional and global scales

    Energy Technology Data Exchange (ETDEWEB)

    Ebinghaus, R.; Tripathi, R.M.; Wallschlaeger, D.; Lindberg, S.E.

    1998-12-31

    Mercury is outstanding among the global environmental pollutants of continuing concern. Especially in the last decade of the 20th century, environmental scientists, legislators, politicians and the public have become aware of mercury pollution in the global environment. It has often been suggested that anthropogenic emissions are leading to a general increase in mercury on local, regional, and global scales (Lindqvist et al. 1991; Expert Panel 1994). Mercury is emitted into the atmosphere from a number of natural as well as anthropogenic sources. In contrast with most of the other heavy metals, mercury and many of its compounds behave exceptionally in the environment due to their volatility and capability for methylation. Long-range atmospheric transport of mercury, its transformation to more toxic methylmercury compounds, and their bioaccumulation in the aquatic foodchain have motivated intensive research on mercury as a pollutant of global concern. Mercury takes part in a number of complex environmental cycles, and special interest is focused on the aquatic-biological and the atmospheric cycles. (orig./SR)

  4. Natural and anthropogenic mercury sources and their impact on the air-surface exchange of mercury on regional and global scales

    Energy Technology Data Exchange (ETDEWEB)

    Ebinghaus, R; Tripathi, R M; Wallschlaeger, D; Lindberg, S E

    1999-12-31

    Mercury is outstanding among the global environmental pollutants of continuing concern. Especially in the last decade of the 20th century, environmental scientists, legislators, politicians and the public have become aware of mercury pollution in the global environment. It has often been suggested that anthropogenic emissions are leading to a general increase in mercury on local, regional, and global scales (Lindqvist et al. 1991; Expert Panel 1994). Mercury is emitted into the atmosphere from a number of natural as well as anthropogenic sources. In contrast with most of the other heavy metals, mercury and many of its compounds behave exceptionally in the environment due to their volatility and capability for methylation. Long-range atmospheric transport of mercury, its transformation to more toxic methylmercury compounds, and their bioaccumulation in the aquatic foodchain have motivated intensive research on mercury as a pollutant of global concern. Mercury takes part in a number of complex environmental cycles, and special interest is focused on the aquatic-biological and the atmospheric cycles. (orig./SR)

  5. Mercury-cycling in surface waters and in the atmosphere - species analysis for the investigation of transformation and transport properties of mercury

    International Nuclear Information System (INIS)

    Ebinghaus, R.; Hintelmann, H.; Wilken, R.D.

    1994-01-01

    The river Elbe has been one of the most contaminated rivers with regard to mercury for many years. In 1991 a length-profile has been measured for mercury and methylmercury (CH 3 Hg + ) from Obristvi, Czech Republic, to the German bight. Total mercury has been measured by cold vapor atomic absorption spectrometry (CVAAS). The organo mercury compounds have been separated by high performance liquid chromatography (HPLC) connected on-line to an atomic fluorescence spectrometer (AFS) by a continuous flow-system. Total mercury up to 120 mg Hg + /kg and CH 3 Hg + concentrations up to 130 μg CH 3 Hg + /kg could be detected in special sites. The formation of CH 3 Hg + in sediments can be caused besides the methylation of mercury, by sulphate reducing or methanogenic bacteria and transmethylation reactions with organometals. Atmospheric mercury concentrations have been measured at three different European sites. Samples have been collected on gold-coated glass balls or on quartz wool, respectively. After thermal desorption mercury has been determined using the two step amalgamation technique with AFS detection. Compared to natural background concentrations of total gaseous mercury (TGM), slightly increased levels could be detected at a rural site in Germany. This increase can probably be explained by long-range transport processes. Within the vicinity of a inactivated mercury production plant high concentrations of up to 13.5 ng/m 3 particle associated mercury (Hg part ) have been detected. Consequently, dry deposition of mercury in the particulate form can intensify the total deposition flux close to Hg-emitting sources. (orig.)

  6. Mercury-Containing Devices and Demolition

    Science.gov (United States)

    Some items inside residential buildings contain mercury, which poses a persistent and toxic human health and environmental threat. These materials should be carefully salvaged for proper recycling to prevent mercury contamination prior to demolition.

  7. Behavior of mercury in high-temperature vitrification processes

    International Nuclear Information System (INIS)

    Goles, R.W.; Holton, K.K.; Sevigny, G.J.

    1992-01-01

    This paper reports that the Pacific Northwest Laboratory (PNL) has evaluated the waste processing behavior of mercury in simulated defense waste. A series of tests were performed under various operating conditions using an experimental-scale liquid-fed ceramic melter (LFCM). This solidification technology had no detectable capacity for incorporating mercury into its product, borosilicate glass. Chemically, the condensed mercury effluent was composed almost entirely of chlorides, and except in a low-temperature test, Hg 2 Cl 2 was the primary chloride formed. As a result, combined mercury accounted for most of the insoluble mass collected by the process quench scrubber. Although macroscopic quantities of elemental mercury were never observed in process secondary waste streams, finely divided and dispersed mercury that blackened all condensed Hg 2 Cl 2 residues was capable of saturating the quenched process exhaust with mercury vapor. The vapor pressure of mercury, however, in the quenched melter exhaust was easily and predictably controlled with the off-gas stream chiller

  8. Comparison of Indoor Mercury Vapor in Common Areas of Residential Buildings with Outdoor Levels in a Community Where Mercury Is Used for Cultural Purposes

    Science.gov (United States)

    Garetano, Gary; Gochfeld, Michael; Stern, Alan H.

    2006-01-01

    Elemental mercury has been imbued with magical properties for millennia, and various cultures use elemental mercury in a variety of superstitious and cultural practices, raising health concerns for users and residents in buildings where it is used. As a first step in assessing this phenomenon, we compared mercury vapor concentration in common areas of residential buildings versus outdoor air, in two New Jersey cities where mercury is available and is used in cultural practices. We measured mercury using a portable atomic absorption spectrometer capable of quantitative measurement from 2 ng/m3 mercury vapor. We evaluated the interior hallways in 34 multifamily buildings and the vestibule in an additional 33 buildings. Outdoor mercury vapor averaged 5 ng/m3; indoor mercury was significantly higher (mean 25 ng/m3; p < 0.001); 21% of buildings had mean mercury vapor concentration in hallways that exceeded the 95th percentile of outdoor mercury vapor concentration (17 ng/m3), whereas 35% of buildings had a maximum mercury vapor concentration that exceeded the 95th percentile of outdoor mercury concentration. The highest indoor average mercury vapor concentration was 299 ng/m3, and the maximum point concentration was 2,022 ng/m3. In some instances, we were able to locate the source, but we could not specifically attribute the elevated levels of mercury vapor to cultural use or other specific mercury releases. However, these findings provide sufficient evidence of indoor mercury source(s) to warrant further investigation. PMID:16393659

  9. Distribution and excretion of inhaled mercury vapour

    Energy Technology Data Exchange (ETDEWEB)

    Gage, J C

    1961-01-01

    Rats have been exposed for varying periods to an atmosphere containing 1 mg/cu.m. mercury vapor. The toxic effects produced showed resemblances to signs of mercurialism in man. An attempt has been made to study the kinetics of absorption and excretion of mercury from measurements of the amounts excreted and stored in the tissues. The efficiency of absorption of mercury by the rat lung is about 50%. A small proportion is excreted into the gut. After about 10 days of continuous exposure a steady state is reached in which excretion balances absorption. During short exposures the turnover of mercury in all tissues except brain is fairly rapid and most of the mercury is cleared from the body within a week after exposure. The urinary excretion of mercury, during the initial stage of storage in the tissues and the final stage of clearance, shows divergencies from the simple exponential pattern; there appears to be a delay mechanism in the kidney which, in intermittent exposures, may result in the occurrence of peak excretion during periods of non-exposure. After more prolonged exposures the mercury in the kidney appears to be converted to a form which is only very slowly excreted. The significance of the urinary excretion of mercury by man after industrial exposure to mercury vapour is discussed. The rat experiments suggest that single measurements will give only limited information concerning industrial conditions, but that an approximate assessment of the total absorbed during a working week would be obtained if it were possible to make a seven-day collection of urine. Repeated measurements after exposure would yield information on the duration of exposure and would have some diagnostic value.

  10. Mercury

    Science.gov (United States)

    ... that mercuric chloride and methylmercury are possible human carcinogens. top How does mercury affect children? Very young ... billion parts of drinking water (2 ppb). The Food and Drug Administration (FDA) has set a maximum ...

  11. A Challenging Case of Acute Mercury Toxicity

    Directory of Open Access Journals (Sweden)

    Ali Nayfeh

    2018-01-01

    Full Text Available Background. Mercury exists in multiple forms: elemental, organic, and inorganic. Its toxic manifestations depend on the type and magnitude of exposure. The role of colonoscopic decompression in acute mercury toxicity is still unclear. We present a case of acute elemental mercury toxicity secondary to mercury ingestion, which markedly improved with colonoscopic decompression. Clinical Case. A 54-year-old male presented to the ED five days after ingesting five ounces (148 cubic centimeters of elemental mercury. Examination was only significant for a distended abdomen. Labs showed elevated serum and urine mercury levels. An abdominal radiograph showed radiopaque material throughout the colon. Succimer and laxatives were initiated. The patient had recurrent bowel movements, and serial radiographs showed interval decrease of mercury in the descending colon with interval increase in the cecum and ascending colon. Colonoscopic decompression was done successfully. The colon was evacuated, and a repeat radiograph showed decreased hyperdense material in the colon. Three months later, a repeat radiograph showed no hyperdense material in the colon. Conclusion. Ingested elemental mercury can be retained in the colon. Although there are no established guidelines for colonoscopic decompression, our patient showed significant improvement. We believe further studies on this subject are needed to guide management practices.

  12. Mercury Study Report to Congress

    Science.gov (United States)

    EPA's Report to Congress on Mercury provides an assessment of the magnitude of U.S. mercury emissions by source, the health and environmental implications of those emissions, and the availability and cost of control technologies.

  13. Mercury in products - a source of transboundary pollutant transport

    Energy Technology Data Exchange (ETDEWEB)

    Munthe, J; Kindbom, K [Swedish Environmental Research Inst., Stockholm (Sweden)

    1997-12-01

    The purpose of this report is to summarize current knowledge on product-related emissions of mercury to air on a European scale, and to estimate the contribution from mercury contained in products, to the total anthropogenic emissions of mercury to air and transboundary transport of mercury in Europe. Products included in this study are batteries, measuring and control instruments, light sources and electrical equipment, all intentionally containing mercury. The main result of this study is that product-related emission of mercury can contribute significantly to total emissions and transboundary transport of mercury in the European region and that measures to limit the use of mercury in products can contribute to an overall decrease of the environmental input of mercury in Europe. It is concluded that: -Mercury contained in products may be emitted to air during consumption, after disposal when incinerated or when volatilized from landfill. Mercury may also be emitted to air during recycling of scrap metal or when accumulated (stored) in society. -The amount of mercury consumed in batteries and in measuring and control instruments had decreased since the late 1980`s. The total use of mercury in light sources and electrical equipment has not changed significantly during the same time period. The contribution to total anthropogenic emissions of mercury to air in Europe in the mid 1990`s is estimated to be: for batteries 4%; for measuring and control instruments 3%; for lighting and electrical equipment 11%. -Mercury in products leads to significant wet deposition input in Scandinavia. The relative amount of the total deposition flux attributable to products is estimated to be 10-14% 26 refs, 4 figs, 10 tabs

  14. Searching for the Source of Salt Marsh Buried Mercury.

    Science.gov (United States)

    Brooke, C. G.; Nelson, D. C.; Fleming, E. J.

    2016-12-01

    Salt marshes provide a barrier between upstream mercury contamination and coastal ecosystems. Mercury is sorbed, transported, and deposited in estuarine systems. Once the upstream mercury source has been remediated, the downstream mercury contaminated salt marsh sediments should become "capped" or buried by uncontaminated sediments preventing further ecosystem contamination. Downstream from a remediated mercury mine, an estuarine intertidal marsh in Tomales Bay, CA, USA, scavengers/predators (e.g. Pachygrapsus crassipes, Lined Shore Crab) have leg mercury concentrations as high as 5.5 ppm (dry wt./dry wt.), which increase significantly with crab size, a surrogate for trophic level. These elevated mercury concentrations suggests that "buried" mercury is rereleased into the environment. To locate possible sources of mercury release in Walker Marsh, we sampled a transect across the marsh that included diverse micro-environments (e.g. rhizoshere, stratified sediments, faunal burrows). From each location we determined the sediment structure, sediment color, total sediment mercury, total sediment iron, and microbial composition (n = 28). Where flora or fauna had perturbed the sediment, mercury concentrations were 10% less than undisturbed stratified sediments (1025 ppb vs. 1164 ppb, respectively). High-throughput SSU rRNA gene sequencing and subsequent co-occurrence network analysis genera indicated that in flora- or fauna- perturbed sediments there was an increased likelihood that microbial genera contained mercury mobilizing genes (94% vs 57%; in perturbed vs stratified sediments, respectively). Our observations are consistent with findings by others that in perturbed sites mercury mobility increased. We did however identify a microbial and geochemical profile with increased mercury mobility. For future work we plan to quantify the role these micro-environments have on mercury-efflux from salt marshes.

  15. Analysis of Halogen-Mercury Reactions in Flue Gas

    Energy Technology Data Exchange (ETDEWEB)

    Paula Buitrago; Geoffrey Silcox; Constance Senior; Brydger Van Otten

    2010-01-01

    Oxidized mercury species may be formed in combustion systems through gas-phase reactions between elemental mercury and halogens, such as chorine or bromine. This study examines how bromine species affect mercury oxidation in the gas phase and examines the effects of mixtures of bromine and chlorine on extents of oxidation. Experiments were conducted in a bench-scale, laminar flow, methane-fired (300 W), quartz-lined reactor in which gas composition (HCl, HBr, NO{sub x}, SO{sub 2}) and temperature profile were varied. In the experiments, the post-combustion gases were quenched from flame temperatures to about 350 C, and then speciated mercury was measured using a wet conditioning system and continuous emissions monitor (CEM). Supporting kinetic calculations were performed and compared with measured levels of oxidation. A significant portion of this report is devoted to sample conditioning as part of the mercury analysis system. In combustion systems with significant amounts of Br{sub 2} in the flue gas, the impinger solutions used to speciate mercury may be biased and care must be taken in interpreting mercury oxidation results. The stannous chloride solution used in the CEM conditioning system to convert all mercury to total mercury did not provide complete conversion of oxidized mercury to elemental, when bromine was added to the combustion system, resulting in a low bias for the total mercury measurement. The use of a hydroxylamine hydrochloride and sodium hydroxide solution instead of stannous chloride showed a significant improvement in the measurement of total mercury. Bromine was shown to be much more effective in the post-flame, homogeneous oxidation of mercury than chlorine, on an equivalent molar basis. Addition of NO to the flame (up to 400 ppmv) had no impact on mercury oxidation by chlorine or bromine. Addition of SO{sub 2} had no effect on mercury oxidation by chlorine at SO{sub 2} concentrations below about 400 ppmv; some increase in mercury oxidation

  16. OCCURRENCE OF MERCURY-RESISTANT MICROORGANISMS IN MERCURY-CONTAMINATED SOILS AND SEDIMENTS IN PAVLODAR, KAZAKHSTAN

    Science.gov (United States)

    There is extensive mercury contamination of soil surrounding a chloralkali plant in Pavlodar, Kazakhstan that operated from 1970 to 1990. High-level mercury contamination exists within the confines of the plant, at nearby off-site waste storage and evaporation ponds, and in Balky...

  17. Plain formation on Mercury: tectonic implications

    International Nuclear Information System (INIS)

    Thomas, P.

    1980-01-01

    Four major plain units, plus intermediates, are distinguished on Mercury. The chronologic relationships between these plains indicate that plains formation was a permanent process on Mercury. Their location and morphology seem to indicate a possible volcanic origin for these plains. The relationships between tectonism and volcanism seems to indicate the global contraction is not the only tectonic process on Mercury. (Auth.)

  18. True Polar Wander of Mercury

    Science.gov (United States)

    Keane, J. T.; Matsuyama, I.

    2018-05-01

    We use new MESSENGER gravity data to investigate how impact basins and volcanic provinces alter Mercury's moments of inertia. We find that Mercury has reoriented tens of degrees over its history, affecting tectonics, volatiles, and more.

  19. Aryl hydrocarbon receptor-dependent regulation of miR-196a expression controls lung fibroblast apoptosis but not proliferation

    International Nuclear Information System (INIS)

    Hecht, Emelia; Zago, Michela; Sarill, Miles; Rico de Souza, Angela; Gomez, Alvin; Matthews, Jason; Hamid, Qutayba; Eidelman, David H.; Baglole, Carolyn J.

    2014-01-01

    The aryl hydrocarbon receptor (AhR) is a ligand-activated transcription factor implicated in the regulation of apoptosis and proliferation. Although activation of the AhR by xenobiotics such as dioxin inhibits the cell cycle and control apoptosis, paradoxically, AhR expression also promotes cell proliferation and survival independent of exogenous ligands. The microRNA (miRNA) miR-196a has also emerged as a regulator of proliferation and apoptosis but a relationship between the AhR and miR-196a is not known. Therefore, we hypothesized that AhR-dependent regulation of endogenous miR-196a expression would promote cell survival and proliferation. Utilizing lung fibroblasts from AhR deficient (AhR −/− ) and wild-type (AhR +/+ ) mice, we show that there is ligand-independent regulation of miRNA, including low miR-196a in AhR −/− cells. Validation by qRT-PCR revealed a significant decrease in basal expression of miR-196a in AhR −/− compared to AhR +/+ cells. Exposure to AhR agonists benzo[a]pyrene (B[a]P) and FICZ as well as AhR antagonist CH-223191 decreased miR-196a expression in AhR +/+ fibroblasts concomitant with decreased AhR protein levels. There was increased proliferation only in AhR +/+ lung fibroblasts in response to serum, corresponding to a decrease in p27 KIP1 protein, a cyclin-dependent kinase inhibitor. Increasing the cellular levels of miR-196a had no effect on proliferation or expression of p27 KIP1 in AhR −/− fibroblasts but attenuated cigarette smoke-induced apoptosis. This study provides the first evidence that AhR expression is essential for the physiological regulation of cellular miRNA levels- including miR-196a. Future experiments designed to elucidate the functional relationship between the AhR and miR-196a may delineate additional novel ligand-independent roles for the AhR. - Highlights: • The AhR controls proliferation and apoptosis in lung cells. • The AhR regulates the expression of the microRNA miR-196a independent of

  20. Exploring Mercury: The Iron Planet

    OpenAIRE

    Stevenson, David J.

    2004-01-01

    Planet Mercury is both difficult to observe and difficult to reach by spacecraft. Just one spacecraft, Mariner 10, flew by the planet 30 years ago. An upcoming NASA mission, MESSENGER, will be launched this year and will go into orbit around Mercury at the end of this decade. A European mission is planned for the following decade. It's worth going there because Mercury is a strange body and the history of planetary exploration has taught us that strangeness gives us insight into planetary ori...

  1. Phosphorylation of the leukemic oncoprotein EVI1 on serine 196 modulates DNA binding, transcriptional repression and transforming ability.

    Directory of Open Access Journals (Sweden)

    Daniel J White

    Full Text Available The EVI1 (ecotropic viral integration site 1 gene at 3q26 codes for a transcriptional regulator with an essential role in haematopoiesis. Overexpression of EVI1 in acute myeloid leukaemia (AML is frequently associated with 3q26 rearrangements and confers extremely poor prognosis. EVI1 mediates transcriptional regulation, signalling, and epigenetic modifications by interacting with DNA, proteins and protein complexes. To explore to what extent protein phosphorylation impacts on EVI1 functions, we analysed endogenous EVI1 protein from a high EVI1 expressing Fanconi anaemia (FA derived AML cell line. Mass spectrometric analysis of immunoprecipitated EVI1 revealed phosphorylation at serine 196 (S196 in the sixth zinc finger of the N-terminal zinc finger domain. Mutated EVI1 with an aspartate substitution at serine 196 (S196D, which mimics serine phosphorylation of this site, exhibited reduced DNA-binding and transcriptional repression from a gene promotor selectively targeted by the N-terminal zinc finger domain. Forced expression of the S196D mutant significantly reduced EVI1 mediated transformation of Rat1 fibroblasts. While EVI1-mediated serial replating of murine haematopoietic progenitors was maintained by EVI1-S196D, this was associated with significantly higher Evi1-trancript levels compared with WT-EVI1 or EVI1-S196A, mimicking S196 non-phosphorylated EVI1. These data suggest that EVI1 function is modulated by phosphorylation of the first zinc finger domain.

  2. Mercury Emissions: The Global Context

    Science.gov (United States)

    Mercury emissions are a global problem that knows no national or continental boundaries. Mercury that is emitted to the air can travel thousands of miles in the atmosphere before it is eventually deposited back to the earth.

  3. Advanced Utility Mercury-Sorbent Field-Testing Program

    Energy Technology Data Exchange (ETDEWEB)

    Ronald Landreth

    2007-12-31

    This report summarizes the work conducted from September 1, 2003 through December 31, 2007 on the project entitled Advanced Utility Mercury-Sorbent Field-Testing Program. The project covers the testing at the Detroit Edison St. Clair Plant and the Duke Power Cliffside and Buck Stations. The St. Clair Plant used a blend of subbituminous and bituminous coal and controlled the particulate emissions by means of a cold-side ESP. The Duke Power Stations used bituminous coals and controlled their particulate emissions by means of hot-side ESPs. The testing at the Detroit Edison St. Clair Plant demonstrated that mercury sorbents could be used to achieve high mercury removal rates with low injection rates at facilities that burn subbituminous coal. A mercury removal rate of 94% was achieved at an injection rate of 3 lb/MMacf over the thirty day long-term test. Prior to this test, it was believed that the mercury in flue gas of this type would be the most difficult to capture. This is not the case. The testing at the two Duke Power Stations proved that carbon- based mercury sorbents can be used to control the mercury emissions from boilers with hot-side ESPs. It was known that plain PACs did not have any mercury capacity at elevated temperatures but that brominated B-PAC did. The mercury removal rate varies with the operation but it appears that mercury removal rates equal to or greater than 50% are achievable in facilities equipped with hot-side ESPs. As part of the program, both sorbent injection equipment and sorbent production equipment was acquired and operated. This equipment performed very well during this program. In addition, mercury instruments were acquired for this program. These instruments worked well in the flue gas at the St. Clair Plant but not as well in the flue gas at the Duke Power Stations. It is believed that the difference in the amount of oxidized mercury, more at Duke Power, was the difference in instrument performance. Much of the equipment was

  4. Feather growth influences blood mercury level of young songbirds.

    Science.gov (United States)

    Condon, Anne M; Cristol, Daniel A

    2009-02-01

    Dynamics of mercury in feathers and blood of free-living songbirds is poorly understood. Nestling eastern bluebirds (Sialia sialis) living along the mercury-contaminated South River (Virginia, USA) had blood mercury levels an order of magnitude lower than their parents (nestling: 0.09 +/- 0.06 mg/kg [mean +/- standard deviation], n = 156; adult: 1.21 +/- 0.57 mg/kg, n = 86). To test whether this low blood mercury was the result of mercury sequestration in rapidly growing feathers, we repeatedly sampled free-living juveniles throughout the period of feather growth and molt. Mean blood mercury concentrations increased to 0.52 +/- 0.36 mg/kg (n = 44) after the completion of feather growth. Some individuals had reached adult blood mercury levels within three months of leaving the nest, but levels dropped to 0.20 +/- 0.09 mg/kg (n = 11) once the autumn molt had begun. Most studies of mercury contamination in juvenile birds have focused on recently hatched young with thousands of rapidly growing feathers. However, the highest risk period for mercury intoxication in young birds may be during the vulnerable period after fledging, when feathers no longer serve as a buffer against dietary mercury. We found that nestling blood mercury levels were not indicative of the extent of contamination because a large portion of the ingested mercury ended up in feathers. The present study demonstrates unequivocally that in songbirds blood mercury level is influenced strongly by the growth and molt of feathers.

  5. Mercury Continuous Emmission Monitor Calibration

    Energy Technology Data Exchange (ETDEWEB)

    John Schabron; Eric Kalberer; Ryan Boysen; William Schuster; Joseph Rovani

    2009-03-12

    Mercury continuous emissions monitoring systems (CEMs) are being implemented in over 800 coal-fired power plant stacks throughput the U.S. Western Research Institute (WRI) is working closely with the Electric Power Research Institute (EPRI), the National Institute of Standards and Technology (NIST), and the Environmental Protection Agency (EPA) to facilitate the development of the experimental criteria for a NIST traceability protocol for dynamic elemental mercury vapor calibrators/generators. These devices are used to calibrate mercury CEMs at power plant sites. The Clean Air Mercury Rule (CAMR) which was published in the Federal Register on May 18, 2005 and vacated by a Federal appeals court in early 2008 required that calibration be performed with NIST-traceable standards. Despite the vacature, mercury emissions regulations in the future will require NIST traceable calibration standards, and EPA does not want to interrupt the effort towards developing NIST traceability protocols. The traceability procedures will be defined by EPA. An initial draft traceability protocol was issued by EPA in May 2007 for comment. In August 2007, EPA issued a conceptual interim traceability protocol for elemental mercury calibrators. The protocol is based on the actual analysis of the output of each calibration unit at several concentration levels ranging initially from about 2-40 {micro}g/m{sup 3} elemental mercury, and in the future down to 0.2 {micro}g/m{sup 3}, and this analysis will be directly traceable to analyses by NIST. The EPA traceability protocol document is divided into two separate sections. The first deals with the qualification of calibrator models by the vendors for use in mercury CEM calibration. The second describes the procedure that the vendors must use to certify the calibrators that meet the qualification specifications. The NIST traceable certification is performance based, traceable to analysis using isotope dilution inductively coupled plasma

  6. Mercury pollution in the ground of Saint-Petersburg

    Energy Technology Data Exchange (ETDEWEB)

    Malov, A.M. [FSSI Inst. of Toxicology FMBA of Russia, Saint-Petersburg (Russian Federation)

    2008-07-01

    The problem of mercury poisoning in St-Petersburg's industrial centre was investigated. First, mercury content was directly measured in ground samples taken at various depths. Mushrooms, which are abundant in every district of the city, were then collected from lawns, yards and parks. Mushrooms provide an accurate indication of mercury distribution in the upper layer of the ground because they get their nutrients from the environment. As such, the chemical composition of mushrooms depends on the composition of the substrate on which they grow, notably the composition of the ground soil and its mercury content. The purpose of the study was to determine the mercury content of the mushrooms growing in the centre of St-Petersburg and its suburbs. The mercury content of the samples was measured by using the cold vapor atomic absorption spectrometry method. The mercury content of the mushrooms collected ranged from 1.29 mg/kg to 0.010 mg/kg. There was some correlation of the 2 data sets for territorial mercury impurity. The mercury content in the blood of 2 comparable groups of women living in the central part of St-Petersburg and its suburbs was also compared. Although there was no one single patterns of mercury distribution in the ground of the city, the depth of 1.0 to 2.0 m was found to be the most polluted. It was concluded that both measuring methods could be used to determine mercury contamination, but each reflects the situation from a different perspective. 20 refs., 3 tabs.

  7. Alkaline sorbent injection for mercury control

    Science.gov (United States)

    Madden, Deborah A.; Holmes, Michael J.

    2002-01-01

    A mercury removal system for removing mercury from combustion flue gases is provided in which alkaline sorbents at generally extremely low stoichiometric molar ratios of alkaline earth or an alkali metal to sulfur of less than 1.0 are injected into a power plant system at one or more locations to remove at least between about 40% and 60% of the mercury content from combustion flue gases. Small amounts of alkaline sorbents are injected into the flue gas stream at a relatively low rate. A particulate filter is used to remove mercury-containing particles downstream of each injection point used in the power plant system.

  8. Hidden sources of mercury in clinical laboratories.

    Science.gov (United States)

    Alvarez-Chavez, C R; Federico-Perez, R A; Gomez-Alvarez, A; Velazquez-Contreras, L E; Perez-Rios, R

    2014-09-01

    The healthcare sector is an important contributor to mercury (Hg) pollution because of the potential presence of mercury in thermometers, blood pressure cuffs, amalgams, etc. There are also other potential sources of mercury in this sector which are used frequently and in high volumes where the presence of the metal is not obvious and which might be collectively contributing to pollution. For instance, some chemicals used for the clinical diagnosis of illness may contain mercury. The goal of this study was to investigate potential sources of mercury pollution, which originate from clinical laboratory discharges, using an exploratory approach. The focus was on the residue generated during automatic analysis of patients' bodily fluids at a medical center in Hermosillo, Sonora, Mexico. This study shows an overview of what might be happening in the region or the country related to non-obvious sources of mercury in the healthcare sector. The results showed measurable levels of mercury in the residues coming from urine sediment analysis. These amounts do not exceed the maximum allowed by Mexican environmental regulations; nevertheless, the frequency and cumulative volume of residues generated, combined with the potential for persistence and the bioaccumulation of mercury in the environment, warrant attention. The work carried out in this study is being taken as a model for future studies for pollution prevention in the healthcare sector with the goal of measuring mercury emissions to the environment from clinical laboratory wastewater, including identifying sources which--while not obvious--could be important given the frequency and volume of their use in the clinical diagnosis.

  9. Planet Mercury Conference, Tucson, AZ, Aug. 6-9, 1986, Proceedings

    International Nuclear Information System (INIS)

    Anon.

    1987-01-01

    The present conference discusses the mass, gravity field, and ephemeris of the planet Mercury, the vulcanoid hypothesis for the chronology of Mercury's geological and geophysical evolution, the Mercurian crater-filling classes that constrain the intercrater plains material emplacement process, and the wavelength and longitude dependence of Mercury polarization. Also discussed are an analysis of the Mariner 10 color radio map of Mercury, Mercury's magnetosphere, exosphere, and surface, the dynamics of electrons and heavy ions in the Mercury magnetosphere, electron measurements and substorm time scales in the Mercury and earth magnetospheres, Mercury's sodium variations with solar radiation pressure, and appulses and occultations of SAO stars by Mercury in the 1987-1995 period

  10. Mercury absorption in aqueous hypochlorite

    International Nuclear Information System (INIS)

    Zhao, L.L.; Rochelle, G.T.

    1999-01-01

    The absorption of elemental Hg vapor into aqueous hypochlorite was measured in a stirred tank reactor at 25 and 55C. NaOCl strongly absorbs Hg even at high pH. Low pH, high Cl - and high-temperature favor mercury absorption. Aqueous free Cl 2 was the active species that reacted with mercury. However, chlorine desorption was evident at high Cl - and pH 15 M -1 s -1 at 25C and 1.4x10 17 M -1 s -1 at 55C. Gas-phase reaction was observed between Hg and Cl 2 on apparatus surfaces. Strong mercury absorption in water was also detected with Cl 2 present. Results indicate that the chlorine concentration, moisture, and surface area contribute positively to mercury removal. (Copyright (c) 1999 Elsevier Science B.V., Amsterdam. All rights reserved.)

  11. Atmospheric mercury concentration and chemical speciation at a rural site in Beijing, China: implications of mercury emission sources

    Directory of Open Access Journals (Sweden)

    L. Zhang

    2013-10-01

    Full Text Available Continuous measurements of atmospheric mercury concentration and speciation play a key role in identifying mercury sources and its behavior in the atmosphere. In this study, speciated atmospheric mercury including gaseous elemental mercury (GEM, reactive gaseous mercury (RGM and particle-bound mercury (PBM were continuously measured at Miyun, a rural site in Beijing, China, from December 2008 to November 2009. The average GEM, RGM and PBM concentrations were found to be 3.22 ± 1.74, 10.1 ± 18.8 and 98.2 ± 112.7 pg m−3, respectively, about 2–20 times higher than the background concentration of the Northern Hemisphere. The results indicated that atmospheric mercury concentrations in northern China were highly affected by anthropogenic emissions. The atmospheric mercury showed obvious seasonal variations, with the highest seasonal average GEM concentration in summer (3.48 ng m−3 and the lowest value in winter (2.66 ng m−3. In autumn and winter a diurnal variation of GEM was observed, with peak levels in the late afternoon till midnight. Most of the high RGM concentration values occurred in the afternoon of all seasons due to the higher oxidation. The PBM concentration was higher in early morning of all seasons because of the the temperature inversion that increases in depth as the night proceeds. The ratio of GEM to CO indicates that residential boilers play an important role in the elevation of GEM in winter. The ratio of RGM to O3 could be an indicator of the contribution of local primary sources. The ratio of PBM to PM2.5 reveals that the air mass from the east and southwest of the site in spring and summer carries more atmospheric mercury. The HYSPLIT back-trajectory analysis indicated that the monitoring site is affected by local, regional and interregional sources simultaneously during heavy pollution episodes. The results from the potential source contribution function (PSCF model indicate that the atmospheric transport

  12. Release of volatile mercury from vascular plants

    Science.gov (United States)

    Siegel, S. M.; Puerner, N. J.; Speitel, T. W.

    1974-01-01

    Volatile, organic solvent soluble mercury has been found in leaves and seeds of several angiosperms. Leaves of garlic vine, avocado, and haole-koa release mercury in volatile form rapidly at room temperature. In garlic vine, the most active release is temperature dependent, but does not parallel the vapor-pressure temperature relationship for mercury. Mercury can be trapped in nitric-perchloric acid digestion fluid, or n-hexane, but is lost from the hexane unless the acid mixture is present. Seeds of haole-koa also contain extractable mercury but volatility declines in the series n-hexane (90%), methanol (50%), water (10%). This suggests that reduced volatility may accompany solvolysis in the more polar media.

  13. Method selection for mercury removal from hard coal

    Directory of Open Access Journals (Sweden)

    Dziok Tadeusz

    2017-01-01

    Full Text Available Mercury is commonly found in coal and the coal utilization processes constitute one of the main sources of mercury emission to the environment. This issue is particularly important for Poland, because the Polish energy production sector is based on brown and hard coal. The forecasts show that this trend in energy production will continue in the coming years. At the time of the emission limits introduction, methods of reducing the mercury emission will have to be implemented in Poland. Mercury emission can be reduced as a result of using coal with a relatively low mercury content. In the case of the absence of such coals, the methods of mercury removal from coal can be implemented. The currently used and developing methods include the coal cleaning process (both the coal washing and the dry deshaling as well as the thermal pretreatment of coal (mild pyrolysis. The effectiveness of these methods various for different coals, which is caused by the diversity of coal origin, various characteristics of coal and, especially, by the various modes of mercury occurrence in coal. It should be mentioned that the coal cleaning process allows for the removal of mercury occurring in mineral matter, mainly in pyrite. The thermal pretreatment of coal allows for the removal of mercury occurring in organic matter as well as in the inorganic constituents characterized by a low temperature of mercury release. In this paper, the guidelines for the selection of mercury removal method from hard coal were presented. The guidelines were developed taking into consideration: the effectiveness of mercury removal from coal in the process of coal cleaning and thermal pretreatment, the synergy effect resulting from the combination of these processes, the direction of coal utilization as well as the influence of these processes on coal properties.

  14. MODELING MERCURY CONTROL WITH POWDERED ACTIVATED CARBON

    Science.gov (United States)

    The paper presents a mathematical model of total mercury removed from the flue gas at coal-fired plants equipped with powdered activated carbon (PAC) injection for Mercury control. The developed algorithms account for mercury removal by both existing equipment and an added PAC in...

  15. Increased Mercury Bioaccumulation Follows Water Quality Improvement

    Energy Technology Data Exchange (ETDEWEB)

    Bogle, M.A.; Peterson, M.J.; Smith, J.G.; Southworth, G.R.

    1999-09-15

    Changes in physical and chemical characteristics of aquatic habitats made to reduce or eliminate ecological risks can sometimes have unforeseen consequences. Environmental management activities on the U.S. Dept. of Energy reservation in Oak Ridge, Tennessee,have succeeded in improving water quality in streams impacted by discharges fi-om industrial facilities and waste disposal sites. The diversity and abundance of pollution-sensitive components of the benthic macroinvertebrate communities of three streams improved after new waste treatment systems or remedial actions reduced inputs of various toxic chemicals. Two of the streams were known to be mercury-contaminated from historical spills and waste disposal practices. Waterborne mercury concentrations in the third were typical of uncontaminated systems. In each case, concentrations of mercury in fish, or the apparent biological availability of mercury increased over the period during which ecological metrics indicated improved water quality. In the system where waterborne mercury concentrations were at background levels, increased mercury bioaccumulation was probably a result of reduced aqueous selenium concentrations; however, the mechanisms for increased mercury accumulation in the other two streams remain under investigation. In each of the three systems, reduced inputs of metals and inorganic anions was followed by improvements in the health of aquatic invertebrate communities. However, this reduction in risk to aquatic invertebrates was accompanied by increased risk to humans and piscivorous wildlife related to increased mercury concentrations in fish.

  16. Mercury in tropical and subtropical coastal environments

    Science.gov (United States)

    Costa, Monica F.; Landing, William M.; Kehrig, Helena A.; Barletta, Mário; Holmes, Christopher D.; Barrocas, Paulo R. G.; Evers, David C.; Buck, David G.; Vasconcellos, Ana Claudia; Hacon, Sandra S.; Moreira, Josino C.; Malm, Olaf

    2012-01-01

    Anthropogenic activities influence the biogeochemical cycles of mercury, both qualitatively and quantitatively, on a global scale from sources to sinks. Anthropogenic processes that alter the temporal and spatial patterns of sources and cycling processes are changing the impacts of mercury contamination on aquatic biota and humans. Human exposure to mercury is dominated by the consumption of fish and products from aquaculture operations. The risk to society and to ecosystems from mercury contamination is growing, and it is important to monitor these expanding risks. However, the extent and manner to which anthropogenic activities will alter mercury sources and biogeochemical cycling in tropical and sub-tropical coastal environments is poorly understood. Factors as (1) lack of reliable local/regional data; (2) rapidly changing environmental conditions; (3) governmental priorities and; (4) technical actions from supra-national institutions, are some of the obstacles to overcome in mercury cycling research and policy formulation. In the tropics and sub-tropics, research on mercury in the environment is moving from an exploratory “inventory” phase towards more process-oriented studies. Addressing biodiversity conservation and human health issues related to mercury contamination of river basins and tropical coastal environments are an integral part of paragraph 221 paragraph of the United Nations document “The Future We Want” issued in Rio de Janeiro in June 2012. PMID:22901765

  17. Increased Mercury Bioaccumulation Follows Water Quality Improvement

    International Nuclear Information System (INIS)

    Bogle, M.A.; Peterson, M.J.; Smith, J.G.; Southworth, G.R.

    1999-01-01

    Changes in physical and chemical characteristics of aquatic habitats made to reduce or eliminate ecological risks can sometimes have unforeseen consequences. Environmental management activities on the U.S. Dept. of Energy reservation in Oak Ridge, Tennessee,have succeeded in improving water quality in streams impacted by discharges fi-om industrial facilities and waste disposal sites. The diversity and abundance of pollution-sensitive components of the benthic macroinvertebrate communities of three streams improved after new waste treatment systems or remedial actions reduced inputs of various toxic chemicals. Two of the streams were known to be mercury-contaminated from historical spills and waste disposal practices. Waterborne mercury concentrations in the third were typical of uncontaminated systems. In each case, concentrations of mercury in fish, or the apparent biological availability of mercury increased over the period during which ecological metrics indicated improved water quality. In the system where waterborne mercury concentrations were at background levels, increased mercury bioaccumulation was probably a result of reduced aqueous selenium concentrations; however, the mechanisms for increased mercury accumulation in the other two streams remain under investigation. In each of the three systems, reduced inputs of metals and inorganic anions was followed by improvements in the health of aquatic invertebrate communities. However, this reduction in risk to aquatic invertebrates was accompanied by increased risk to humans and piscivorous wildlife related to increased mercury concentrations in fish

  18. Mercury in Nelson's Sparrow subspecies at breeding sites.

    Directory of Open Access Journals (Sweden)

    Virginia L Winder

    Full Text Available BACKGROUND: Mercury is a persistent, biomagnifying contaminant that can cause negative effects on ecosystems. Marshes are often areas of relatively high mercury methylation and bioaccumulation. Nelson's Sparrows (Ammodramus nelsoni use marsh habitats year-round and have been documented to exhibit tissue mercury concentrations that exceed negative effects thresholds. We sought to further characterize the potential risk of Nelson's Sparrows to mercury exposure by sampling individuals from sites within the range of each of its subspecies. METHODOLOGY/PRINCIPAL FINDINGS: From 2009 to 2011, we captured adult Nelson's Sparrows at sites within the breeding range of each subspecies (A. n. nelsoni: Grand Forks and Upham, North Dakota; A. n. alterus: Moosonee, Ontario; and A. n. subvirgatus: Grand Manan Island, New Brunswick and sampled breast feathers, the first primary feather (P1, and blood for total mercury analysis. Mean blood mercury in nelsoni individuals captured near Grand Forks ranged from 0.84 ± 0.37 to 1.65 ± 1.02 SD ppm among years, between 2.0 and 4.9 times as high as concentrations at the other sites (P<0.01. Breast feather mercury did not vary among sites within a given sampling year (site means ranged from 0.98 ± 0.69 to 2.71 ± 2.93 ppm. Mean P1 mercury in alterus (2.96 ± 1.84 ppm fw was significantly lower than in any other sampled population (5.25 ± 2.24-6.77 ± 3.51 ppm; P ≤ 0.03. CONCLUSIONS/SIGNIFICANCE: Our study further characterized mercury in Nelson's Sparrows near Grand Forks; we documented localized and potentially harmful mercury concentrations, indicating that this area may represent a biological mercury hotspot. This finding warrants further research to determine if wildlife populations of conservation or recreational interest in this area may be experiencing negative effects due to mercury exposure. We present preliminary conclusions about the risk of each sampled population to mercury exposure.

  19. Bioavailability and stability of mercury sulfide in Armuchee (USA) soil

    International Nuclear Information System (INIS)

    Han, Fengxiang; Shiyab, Safwan; Su, Yi; Monts, David L.; Waggoner, Charles A.; Matta, Frank B.

    2007-01-01

    Because of the adverse effects of elemental mercury and mercury compounds upon human health, the U.S. Department of Energy (DOE) is engaged in an on-going effort to monitor and remediate mercury-contaminated DOE sites. In order to more cost effectively implement those extensive remediation efforts, it is necessary to obtain an improved understanding of the role that mercury and mercury compounds play in the ecosystem. We have conducted pilot scale experiments to study the bioavailability of mercury sulfide in an Armuchee (eastern US ) soil. The effects of plants and incubation time on chemical stability and bioavailability of HgS under simulated conditions of the ecosystem have been examined, as has the dynamics of the dissolution of mercury sulfide by various extractants. The results show that mercury sulfide in contaminated Armuchee soil was still to some extent bioavailable to plants. After planting, soil mercury sulfide is more easily dissolved by both 4 M and 12 M nitric acid than pure mercury sulfide reagent. Dissolution kinetics of soil mercury sulfide and pure chemical reagent by nitric acid are different. Mercury release by EDTA from HgS-contaminated soil increased with time of reaction and soil mercury level. Chelating chemicals increase the solubility and bioavailability of mercury in HgS-contaminated soil. (authors)

  20. Mercury content in electrum from artisanal mining site of Mongolia

    International Nuclear Information System (INIS)

    Murao, Satoshi; Naito, Kazuki; Dejidmaa, Gunchin; Sie, Soey H.

    2006-01-01

    In Mongolia, artisanal gold mining, modern gold rush, in which people use mercury to extract gold, is being proliferated rapidly and the mercury contamination of mining site is becoming a serious social issue. For the risk assessment of mercury, it is necessary to understand how much mercury is introduced to the environment from what kind of materials during mining activity. It is already known that major contribution of the contamination comes from mercury that was bought at shops and brought to mining sites by miners. However, no information is available on how much mercury is removed from electrum (natural gold grain) to the environment. Since gold deposit is always accompanied by mercury anomaly, it is anticipated that electrum grains contain some amount of mercury of natural origin, and this mercury (primary mercury) contributes to some extent to the contamination. In order to clarify how much mercury is incorporated in electrum grains, micro-PIXE at CSIRO was used for grain-by-grain analysis. The result showed that electrum from study area contains mercury up to 8260 ppm. It is concluded that for the risk management of mercury contamination, release of natural mercury from electrum grains during smelting must not be ignored

  1. Study of the environmental cycling of mercury

    Energy Technology Data Exchange (ETDEWEB)

    Garcia Frades, J P; Hildebrand, S G; Huckabee, J W; Murias, B; Diaz, F S; Wilson, R H

    1977-01-01

    A study of mercury in the environment is under way near the mercury mine at Almaden, Spain. The main aspects of the project are: ecology; atmospheric monitoring; and human studies. The mercury deposit at Almaden is described. The liquid effluent from the mine and smelter contains high concentrations of mercury that pollute nearby rivers. Sample collection and analytical methods used in the ecological survey are reviewed. Ecological experiments are considered. Air monitoring studies and human studies currently being performed are assessed. (1 map)

  2. Mercury speciation during in situ thermal desorption in soil

    Energy Technology Data Exchange (ETDEWEB)

    Park, Chang Min, E-mail: cmpark80@gmail.com; Katz, Lynn E.; Liljestrand, Howard M.

    2015-12-30

    Highlights: • Impact of soil conditions on distribution and phase transitions of Hg was identified. • Metallic Hg was slowly transformed to Hg{sup 0} gas until the temperature reached 358.15 K. • Phase change of HgCl{sub 2(s)} completely occurred without decomposition at 335.15 K. • HgS remained solid in dry soil sharply decreased in the narrow temperature range. • Hg gas can be easily captured with higher vapor pressures of soil compositions. - Abstract: Metallic mercury (Hg{sup 0}) and its compounds are highly mobile and toxic environmental pollutants at trace level. In situ thermal desorption (ISTD) is one of the soil remediation processes applying heat and vacuum simultaneously. Knowledge of thermodynamic mercury speciation is imperative to understand the fate and transport of mercury during thermal remediation and operate the treatment processes in a cost-effective manner. Hence, speciation model for inorganic mercury was developed over a range of environmental conditions to identify distribution of dissolved mercury species and potential transformations of mercury at near source environment. Simulation of phase transitions for metallic mercury, mercury(II) chloride and mercury sulfide with temperature increase showed that complete vaporization of metallic mercury and mercury(II) chloride were achieved below the boiling point of water. The effect of soil compositions on mercury removal was also evaluated to better understand thermal remediation process. Higher vapor pressures expected both from soil pore water and inorganic carbonate minerals in soil as well as creation of permeability were significant for complete vaporization and removal of mercury.

  3. Mercury speciation during in situ thermal desorption in soil

    International Nuclear Information System (INIS)

    Park, Chang Min; Katz, Lynn E.; Liljestrand, Howard M.

    2015-01-01

    Highlights: • Impact of soil conditions on distribution and phase transitions of Hg was identified. • Metallic Hg was slowly transformed to Hg"0 gas until the temperature reached 358.15 K. • Phase change of HgCl_2_(_s_) completely occurred without decomposition at 335.15 K. • HgS remained solid in dry soil sharply decreased in the narrow temperature range. • Hg gas can be easily captured with higher vapor pressures of soil compositions. - Abstract: Metallic mercury (Hg"0) and its compounds are highly mobile and toxic environmental pollutants at trace level. In situ thermal desorption (ISTD) is one of the soil remediation processes applying heat and vacuum simultaneously. Knowledge of thermodynamic mercury speciation is imperative to understand the fate and transport of mercury during thermal remediation and operate the treatment processes in a cost-effective manner. Hence, speciation model for inorganic mercury was developed over a range of environmental conditions to identify distribution of dissolved mercury species and potential transformations of mercury at near source environment. Simulation of phase transitions for metallic mercury, mercury(II) chloride and mercury sulfide with temperature increase showed that complete vaporization of metallic mercury and mercury(II) chloride were achieved below the boiling point of water. The effect of soil compositions on mercury removal was also evaluated to better understand thermal remediation process. Higher vapor pressures expected both from soil pore water and inorganic carbonate minerals in soil as well as creation of permeability were significant for complete vaporization and removal of mercury.

  4. RECOVERY OF MERCURY FROM CONTAMINATED PRIMARY AND SECONDARY WASTES

    International Nuclear Information System (INIS)

    A. Faucette; J. Bognar; T. Broderick; T. Battaglia

    2000-01-01

    Effective removal of mercury contamination from water is a complex and difficult problem. In particular, mercury treatment of natural waters is difficult because of the low regulatory standards. For example, the Environmental Protection Agency has established a national ambient water quality standard of 12 parts-per-trillion (ppt), whereas the standard is 1.8 ppt in the Great Lakes Region. In addition, mercury is typically present in several different forms, but sorption processes are rarely effective with more than one or two of these forms. To meet the low regulatory discharge limits, a sorption process must be able to address all forms of mercury present in the water. One approach is to apply different sorbents in series depending on the mercury speciation and the regulatory discharge limits. Four new sorbents have been developed to address the variety of mercury species present in industrial discharges and natural waters. Three of these sorbents have been field tested on contaminated creek water at the Y-12 Plant. Two of these sorbents have demonstrated very high removal efficiencies for soluble mercury species, with mercury concentrations at the outlet of a pilot-scale system less than 12 ppt for as long as six months. The other sorbent tested at the Y-12 Plant is targeted at colloidal mercury that is not removed by standard sorption or filtration processes. At the Y-12 Plant, colloidal mercury appears to be associated with iron, so a sorbent that removes mercury-iron complexes in the presence of a magnetic field was evaluated. Field results indicate good removal of this mercury fraction from the Y-12 waters. In addition, this sorbent is easily regenerated by simply removing the magnetic field and flushing the columns with water. The fourth sorbent is still undergoing laboratory development, but results to date indicate exceptionally high mercury sorption capacity. The sorbent is capable of removing all forms of mercury typically present in natural and

  5. Mercury's Weather-Beaten Surface: Understanding Mercury in the Context of Lunar and Asteroid Space Weathering Studies

    Science.gov (United States)

    Dominque, Deborah L.; Chapman, Clark R.; Killen, Rosemary M.; Zurbuchen, Thomas H.; Gilbert, Jason A.; Sarantos, Menelaos; Benna, Mehdi; Slavin, James A.; Orlando, Thomas M.; Schriver, David; hide

    2011-01-01

    Understanding the composition of Mercury's crust is key to comprehending the formation of the planet. The regolith, derived from the crustal bedrock, has been altered via a set of space weathering processes. These processes are the same set of mechanisms that work to form Mercury's exosphere, and are moderated by the local space environment and the presence of an intrinsic planetary magnetic field. The alterations need to be understood in order to determine the initial crustal compositions. The complex interrelationships between Mercury's exospheric processes, the space environment, and surface composition are examined and reviewed. The processes are examined in the context of our understanding of these same processes on the lunar and asteroid regoliths. Keywords: Mercury (planet) Space weathering Surface processes Exosphere Surface composition Space environment 3

  6. Occupational exposure to mercury. What is a safe level?

    OpenAIRE

    Moienafshari, R.; Bar-Oz, B.; Koren, G.

    1999-01-01

    QUESTION: One of my pregnant patients, a dental hygienist, uses mercury in her workplace, but appears to have no symptoms of mercury toxicity. She has heard that mercury might affect her fetus. What should I recommend to her? What is a safe level of mercury in the air for pregnant women? ANSWER: Testing for levels of mercury in whole blood and, preferably, urine is useful for confirming exposure. Currently, mercury vapour concentrations greater than 0.01 mg/m3 are considered unsafe. Also, wom...

  7. Fish consumption limit for mercury compounds

    Directory of Open Access Journals (Sweden)

    Abbas Esmaili-Sari

    2011-09-01

    Full Text Available Background and objectives: Methyl mercury can carry out harmful effects on the reproductive, respiratory, and nervous system of human. Moreover, mercury is known as the most toxic heavy metal in nature. Fish and seafood consumption is the major MeHg exposure route for human. The present study tries to cover researches which have been conducted on mercury levels in 21 species of fish from Persian Gulf, Caspian Sea and Anzali Wetland during the past 6 years, and in addition to stating mercury level, it provides recommendations about the restriction of monthly fish consumption for each species separately. Material and methods: Fish samples were transferred to the laboratory and stored in refrigerator under -20oC until they were dissected. Afterwards, the muscle tissues were separated and dried. The dried samples were ground and changed into a homogenous powder and then the mercury concentration rate has been determined by advanced mercury analyzer, model 254. Results: In general, mercury contamination in fishes caught from Anzali Wetland was much more than fishes from Caspian Sea. Also, from among all studied fishes, oriental sole (Euryglossa orientalis, caught from Persian Gulf, allocated the most mercury level to itself with the rate of 5.61ml per kg., therefore, it exercises a severe consumption restriction for pregnant women and vulnerable groups. Conclusion: Based on the calculations, about 50% of fishes, mostly with short food chain, can be easily consumed during the year. However, with regard to Oriental sole (Euryglossa orientalis and shark (Carcharhinus dussumieri, caught from Persian Gulf, special consideration should be taken in their consumption. On the other hand, careful planning should be made for the high rate of fish consumption among fishing community.

  8. Interspecific and intraspecific variation in selenium:mercury molar ratios in saltwater fish from the Aleutians: Potential protection on mercury toxicity by selenium

    Science.gov (United States)

    Burger, Joanna; Gochfeld, Michael; Jeitner, Christian; Donio, Mark; Pittfield, Taryn

    2014-01-01

    A number of factors affect the consumption risk from mercury in fish, including mercury levels, seasonal patterns of mercury concentrations, human consumption patterns, and sensitive populations (e.g. pregnant women, fetuses, young children, and yet unknown genetic factors). Recently the protective effects of selenium on methylmercury toxicity have been publicized, particularly for saltwater fish. We examine levels of mercury and selenium in several species of fish and seabirds from the Aleutians (Alaska), determine selenium:mercury molar ratios, and examine species-specific and individual variation in the ratios as a means of exploring the use of the ratio in risk assessment and risk management. Variation among species was similar for mercury and selenium. There was significant inter-specific and intraspecific variation in selenium:mercury molar ratios for fish, and for birds. The mean selenium:mercury molar ratios for all fish and bird species were above 1, meaning there was an excess of selenium relative to mercury. It has been suggested that an excess of selenium confers some protective advantage for salt water fish, although the degree of excess necessary is unclear. The selenium:mercury molar ratio was significantly correlated negatively with total length for most fish species, but not for dolly varden. Some individuals of Pacific cod, yellow irish lord, rock greenling, Pacific halibut, dolly varden, and to a lesser extent, flathead sole, had selenium:mercury ratios below 1. No bird muscle had an excess of mercury (ratio below 1), and only glaucous-winged gull and pigeon guillemot had ratios between 1 and 5. There was a great deal of variation in selenium:mercury molar ratios within fish species, and within bird species, making it difficult and impractical to use these ratios in risk assessment or management, for fish advisories, or for consumers, particularly given the difficulty of interpreting the ratios. PMID:22664537

  9. Mercury in the nation's streams - Levels, trends, and implications

    Science.gov (United States)

    Wentz, Dennis A.; Brigham, Mark E.; Chasar, Lia C.; Lutz, Michelle A.; Krabbenhoft, David P.

    2014-01-01

    Mercury is a potent neurotoxin that accumulates in fish to levels of concern for human health and the health of fish-eating wildlife. Mercury contamination of fish is the primary reason for issuing fish consumption advisories, which exist in every State in the Nation. Much of the mercury originates from combustion of coal and can travel long distances in the atmosphere before being deposited. This can result in mercury-contaminated fish in areas with no obvious source of mercury pollution.Three key factors determine the level of mercury contamination in fish - the amount of inorganic mercury available to an ecosystem, the conversion of inorganic mercury to methylmercury, and the bioaccumulation of methylmercury through the food web. Inorganic mercury originates from both natural sources (such as volcanoes, geologic deposits of mercury, geothermal springs, and volatilization from the ocean) and anthropogenic sources (such as coal combustion, mining, and use of mercury in products and industrial processes). Humans have doubled the amount of inorganic mercury in the global atmosphere since pre-industrial times, with substantially greater increases occurring at locations closer to major urban areas.In aquatic ecosystems, some inorganic mercury is converted to methylmercury, the form that ultimately accumulates in fish. The rate of mercury methylation, thus the amount of methylmercury produced, varies greatly in time and space, and depends on numerous environmental factors, including temperature and the amounts of oxygen, organic matter, and sulfate that are present.Methylmercury enters aquatic food webs when it is taken up from water by algae and other microorganisms. Methylmercury concentrations increase with successively higher trophic levels in the food web—a process known as bioaccumulation. In general, fish at the top of the food web consume other fish and tend to accumulate the highest methylmercury concentrations.This report summarizes selected stream studies

  10. MESSENGER at Mercury: Early Orbital Operations

    Science.gov (United States)

    McNutt, Ralph L., Jr; Solomon, Sean C.; Bedini, Peter D.; Anderson, Brian J.; Blewett, David T.; Evans, Larry G.; Gold, Robert E.; Krimigis, Stamatios M.; Murchie, Scott L.; Nittler, Larry R.; hide

    2013-01-01

    The MErcury Surface, Space ENvironment, GEochemistry, and Ranging (MESSENGER) spacecraft, launched in August 2004 under NASA's Discovery Program, was inserted into orbit about the planet Mercury in March 2011. MESSENGER's three flybys of Mercury in 2008-2009 marked the first spacecraft visits to the innermost planet since the Mariner 10 flybys in 1974-1975. The unprecedented orbital operations are yielding new insights into the nature and evolution of Mercury. The scientific questions that frame the MESSENGER mission led to the mission measurement objectives to be achieved by the seven payload instruments and the radio science experiment. Interweaving the full set of required orbital observations in a manner that maximizes the opportunity to satisfy all mission objectives and yet meet stringent spacecraft pointing and thermal constraints was a complex optimization problem that was solved with a software tool that simulates science observations and tracks progress toward meeting each objective. The final orbital observation plan, the outcome of that optimization process, meets all mission objectives. MESSENGER's Mercury Dual Imaging System is acquiring a global monochromatic image mosaic at better than 90% coverage and at least 250 m average resolution, a global color image mosaic at better than 90% coverage and at least 1 km average resolution, and global stereo imaging at better than 80% coverage and at least 250 m average resolution. Higher-resolution images are also being acquired of targeted areas. The elemental remote sensing instruments, including the Gamma-Ray and Neutron Spectrometer and the X-Ray Spectrometer, are being operated nearly continuously and will establish the average surface abundances of most major elements. The Visible and Infrared Spectrograph channel of MESSENGER's Mercury Atmospheric and Surface Composition Spectrometer is acquiring a global map of spectral reflectance from 300 to 1450 nm wavelength at a range of incidence and emission

  11. Zagadnienie uczuć religijnych w kontekście art. 196 Kodeksu karnego

    Directory of Open Access Journals (Sweden)

    Barbara Tryka

    2017-01-01

    Full Text Available The article analyzes religious feelings in the context of criminal offence against religious feelings in the face of philosophical, psychological and juridical interpretations. According to Article 196 of the Polish Criminal Code from 1997 religious feelings are regarded as protected goods. However, the mentioned term has not been clearly defined, which provokes controversies in legal circles. The paper indicates the exact nature of religious feelings and their relation to religious beliefs. The author argues that Article 196 unnecessarily focuses on the offence of feelings rather than the defence of religion in the public sphere. The application of the expression religious feelings to the Criminal Code grants vast possibilities of its understanding and causes numerous over interpretations of Article 196. To avoid that confusion the law ought to circumscribe the extent to which religion can be protected. The inquiry into specific cases of offence against religious feelings must not be based on the subjective experience of the offended victim because one will never find the ultimate criterion to assess whether someone has actually been hurt. After the prohibited activities/possible offences against religion are defined, the behavior of the offender should be the main point of reference. A propounded amendment might generate other problems such as, for example, the transgression/violation of the neutrality of the state; therefore, Article 196 in its current meaning is unacceptable. Consequently, the religious feelings term should be clarified or removed.

  12. Mercury extraction by the TRUEX process solvent. II. Selective partitioning of mercury from co-extracted actinides in a simulated acidic ICPP waste stream

    International Nuclear Information System (INIS)

    Brewer, K.N.; Herbst, R.S.; Tranter, T.J.; Todd, T.A.

    1995-01-01

    The TRUEX process is being evaluated at the Idaho Chemical Processing Plant (ICPP) as a means to partition the actinides from acidic sodium-bearing waste (SBW). The mercury content of this waste averages 1 g/l. Because the chemistry of mercury has not been extensively evaluated in the TRUEX process, mercury was singled out as an element of interest. Radioactive mercury, 203 Hg, was spiked into a simulated solution of SBW containing 1 g/l mercury. Successive extraction batch contacts with the mercury spiked waste and successive scrubbing and stripping batch contacts of the mercury loaded TRUEX solvent (0.2 M CMPO-1.4 M TBP in dodecane) show that mercury will extract into and strip from the solvent. The extraction distribution coefficient for mercury, as HgCl 2 , from SBW having a nitric acid concentration of 1.4 M and a chloride concentration of 0.035 M was found to be 3. The stripping distribution coefficient was found to be 0.5 with 5 M HNO 3 and 0.077 with 0.25 M Na 2 CO 3 . Because experiments described here show that mercury can be extracted from SBW and stripped from the solvent, a process has been developed to partition mercury from the actinides in SBW. 10 refs., 3 figs., 10 tabs

  13. Mercury's shifting, rolling past

    OpenAIRE

    Trulove, Susan

    2008-01-01

    Patterns of scalloped-edged cliffs or lobate scarps on Mercury's surface are thrust faults that are consistent with the planet shrinking and cooling with time. However, compression occurred in the planet's early history and Mariner 10 images revealed decades ago that lobate scarps are among the youngest features on Mercury. Why don't we find more evidence of older compressive features?

  14. Identification of elemental mercury in the subsurface

    Science.gov (United States)

    Jackson, Dennis G

    2015-01-06

    An apparatus and process is provided for detecting elemental mercury in soil. A sacrificial electrode of aluminum is inserted below ground to a desired location using direct-push/cone-penetrometer based equipment. The insertion process removes any oxides or previously found mercury from the electrode surface. Any mercury present adjacent the electrode can be detected using a voltmeter which indicates the presence or absence of mercury. Upon repositioning the electrode within the soil, a fresh surface of the aluminum electrode is created allowing additional new measurements.

  15. High activity carbon sorbents for mercury capture

    Directory of Open Access Journals (Sweden)

    Stavropoulos George G.

    2006-01-01

    Full Text Available High efficiency activated carbons have been prepared for removing mercury from gas streams. Starting materials used were petroleum coke, lignite, charcoal and olive seed waste, and were chemically activated with KOH. Produced adsorbents were primarily characterized for their porosity by N2 adsorption at 77 K. Their mercury retention capacity was characterized based on the breakthrough curves. Compared with typical commercial carbons, they have exhibited considerably enhanced mercury adsorption capacity. An attempt has been made to correlate mercury entrapment and pore structure. It has been shown that physical surface area is increased during activation in contrast to the mercury adsorption capacity that initially increases and tends to decrease at latter stages. Desorption of active sites may be responsible for this behavior.

  16. MERCURY USAGE AND ALTERNATIVES IN THE ELECTRICAL AND ELECTRONICS INDUSTRIES

    Science.gov (United States)

    Many industries have already found alternatives for mercury or have greatly decreased mercury use. However, the unique electromechanical and photoelectric properties of mercury and mercury compounds have made replacement of mercury difficult in some applications. This study was i...

  17. Substance Flow Analysis of Mercury in China

    Science.gov (United States)

    Hui, L. M.; Wang, S.; Zhang, L.; Wang, F. Y.; Wu, Q. R.

    2015-12-01

    In previous studies, the emission of anthropogenic atmospheric Hg in China as well as single sector have been examined a lot. However, there might have been more Hg released as solid wastes rather than air. Hg stored in solid wastes may be released to air again when the solid wastes experience high temperature process or cause local pollution if the solid wastes are stacked casually for a long time. To trace the fate of Hg in China, this study developed the substance flow of Hg in 2010 covering all the sectors summarized in table 1. Below showed in Figure 1, the total Hg input is 2825t. The unintentional input of Hg, mined Hg, and recycled Hg account for 57%, 32% and 11% respectively. Figure 2 provides the detail information of substance flow of Hg. Byproducts from one sector may be used as raw materials of another, causing cross Hg flow between sectors. The Hg input of cement production is 303 t, of which 34% comes from coal and limestone, 33% comes from non-ferrous smelting, 23% comes from coal combustion, 7% comes from iron and steel production and 3% comes from mercury mining. Hg flowing to recycledHg production is 639 t, mainly from Hg contained in waste active carbon and mercuric chloride catalyst from VCM production and acid sludge from non-ferrous smelting. There are 20 t mercury flowing from spent mercury adding products to incineration. Figure1 and Figure 2 also show that 46% of the output Hg belongs to "Lagged release", which means this part of mercury might be released later. The "Lagged release" Hg includes 809 t Hg contained in stacked byproducts form coal combustion, non-ferrous smelting, iron and steel production, Al production, cement production and mercury mining, 161t Hg stored in the pipeline of VCM producing, 10 t Hg in fluorescent lamps that are in use and 314 t mercury stored in materials waiting to be handled with in recycled mercury plants. There is 112 t Hg stored in landfill and 129 t Hg exported abroad with the export of mercury adding

  18. Aryl hydrocarbon receptor-dependent regulation of miR-196a expression controls lung fibroblast apoptosis but not proliferation

    Energy Technology Data Exchange (ETDEWEB)

    Hecht, Emelia [Department of Medicine, McGill University, Montreal, Quebec (Canada); Zago, Michela [Research Institute of the McGill University Health Centre, McGill University, Montreal, Quebec (Canada); Sarill, Miles [Department of Medicine, McGill University, Montreal, Quebec (Canada); Rico de Souza, Angela [Research Institute of the McGill University Health Centre, McGill University, Montreal, Quebec (Canada); Gomez, Alvin; Matthews, Jason [Department of Pharmacology and Toxicology, University of Toronto, Toronto, ON (Canada); Hamid, Qutayba; Eidelman, David H. [Department of Medicine, McGill University, Montreal, Quebec (Canada); Research Institute of the McGill University Health Centre, McGill University, Montreal, Quebec (Canada); Baglole, Carolyn J., E-mail: Carolyn.baglole@McGill.ca [Department of Medicine, McGill University, Montreal, Quebec (Canada); Research Institute of the McGill University Health Centre, McGill University, Montreal, Quebec (Canada)

    2014-11-01

    The aryl hydrocarbon receptor (AhR) is a ligand-activated transcription factor implicated in the regulation of apoptosis and proliferation. Although activation of the AhR by xenobiotics such as dioxin inhibits the cell cycle and control apoptosis, paradoxically, AhR expression also promotes cell proliferation and survival independent of exogenous ligands. The microRNA (miRNA) miR-196a has also emerged as a regulator of proliferation and apoptosis but a relationship between the AhR and miR-196a is not known. Therefore, we hypothesized that AhR-dependent regulation of endogenous miR-196a expression would promote cell survival and proliferation. Utilizing lung fibroblasts from AhR deficient (AhR{sup −/−}) and wild-type (AhR{sup +/+}) mice, we show that there is ligand-independent regulation of miRNA, including low miR-196a in AhR{sup −/−} cells. Validation by qRT-PCR revealed a significant decrease in basal expression of miR-196a in AhR{sup −/−} compared to AhR{sup +/+} cells. Exposure to AhR agonists benzo[a]pyrene (B[a]P) and FICZ as well as AhR antagonist CH-223191 decreased miR-196a expression in AhR{sup +/+} fibroblasts concomitant with decreased AhR protein levels. There was increased proliferation only in AhR{sup +/+} lung fibroblasts in response to serum, corresponding to a decrease in p27{sup KIP1} protein, a cyclin-dependent kinase inhibitor. Increasing the cellular levels of miR-196a had no effect on proliferation or expression of p27{sup KIP1} in AhR{sup −/−} fibroblasts but attenuated cigarette smoke-induced apoptosis. This study provides the first evidence that AhR expression is essential for the physiological regulation of cellular miRNA levels- including miR-196a. Future experiments designed to elucidate the functional relationship between the AhR and miR-196a may delineate additional novel ligand-independent roles for the AhR. - Highlights: • The AhR controls proliferation and apoptosis in lung cells. • The AhR regulates the

  19. Presence of mercury in natural gas

    International Nuclear Information System (INIS)

    Gijselman, P.B.

    1991-01-01

    This paper describes the occupational health programme used to ensure that NAM and contractor personnel of the Nederlandse Aardolie Mij (NAM) exposed to mercury, common in Dutch gas, are adequately protected through the correct use of Personal Protective Equipment (PPE), proper instruction and suitable work procedures. To avoid health damage due to mercury exposure during maintenance and shutdown activities the occupational health department of NAM set up a programme covering 3 activities: monitoring of atmospheric air; sampling of inspired air during work, and measurement of mercury excretion in urine of workers instruction of company and contractor personnel consultancy during preparation of work instructions. The monitoring program showed that, through correct use of PPE, staff do not exhibit mercury concentration levels exceeding the human toxicity limit (100 ug/g creatinine) even after exposure to mercury vapor concentrations above the TLV of 0.5 mg/m 3 . The correct use of PPE is a result of the instruction programme which also promotes increased awareness for personnel of the harmful effects of mercury. Finally, the provision of consultancy during the preparation of work instructions has contributed to various measures; for instance, staff wearing plastic (Viton) protective suits may not work longer than 2 hours continuously to avoid heat exhaustion

  20. HPV16 early gene E5 specifically reduces miRNA-196a in cervical cancer cells

    Science.gov (United States)

    Liu, Chanzhen; Lin, Jianfei; Li, Lianqin; Zhang, Yonggang; Chen, Weiling; Cao, Zeyi; Zuo, Huancong; Chen, Chunling; Kee, Kehkooi

    2015-01-01

    High-risk human papillomavirus (HPV) type 16, which is responsible for greater than 50% of cervical cancer cases, is the most prevalent and lethal HPV type. However, the molecular mechanisms of cervical carcinogenesis remain elusive, particularly the early steps of HPV infection that may transform normal cervical epithelium into a pre-neoplastic state. Here, we report that a group of microRNAs (microRNAs) were aberrantly decreased in HPV16-positive normal cervical tissues, and these groups of microRNAs are further reduced in cervical carcinoma. Among these miRNAs, miR196a expression is the most reduced in HPV16-infected tissues. Interestingly, miR196a expression is low in HPV16-positive cervical cancer cell lines but high in HPV16-negative cervical cancer cell lines. Furthermore, we found that only HPV16 early gene E5 specifically down-regulated miRNA196a in the cervical cancer cell lines. In addition, HoxB8, a known miR196a target gene, is up-regulated in the HPV16 cervical carcinoma cell line but not in HPV18 cervical cancer cell lines. Various doses of miR196a affected cervical cancer cell proliferation and apoptosis. Altogether, these results suggested that HPV16 E5 specifically down-regulates miR196a upon infection of the human cervix and initiates the transformation of normal cervix cells to cervical carcinoma. PMID:25563170

  1. Sodium Velocity Maps on Mercury

    Science.gov (United States)

    Potter, A. E.; Killen, R. M.

    2011-01-01

    The objective of the current work was to measure two-dimensional maps of sodium velocities on the Mercury surface and examine the maps for evidence of sources or sinks of sodium on the surface. The McMath-Pierce Solar Telescope and the Stellar Spectrograph were used to measure Mercury spectra that were sampled at 7 milliAngstrom intervals. Observations were made each day during the period October 5-9, 2010. The dawn terminator was in view during that time. The velocity shift of the centroid of the Mercury emission line was measured relative to the solar sodium Fraunhofer line corrected for radial velocity of the Earth. The difference between the observed and calculated velocity shift was taken to be the velocity vector of the sodium relative to Earth. For each position of the spectrograph slit, a line of velocities across the planet was measured. Then, the spectrograph slit was stepped over the surface of Mercury at 1 arc second intervals. The position of Mercury was stabilized by an adaptive optics system. The collection of lines were assembled into an images of surface reflection, sodium emission intensities, and Earthward velocities over the surface of Mercury. The velocity map shows patches of higher velocity in the southern hemisphere, suggesting the existence of sodium sources there. The peak earthward velocity occurs in the equatorial region, and extends to the terminator. Since this was a dawn terminator, this might be an indication of dawn evaporation of sodium. Leblanc et al. (2008) have published a velocity map that is similar.

  2. Simultaneous determination of mercury and organic carbon using a direct mercury analyzer: Mercury profiles in sediment cores from oxbow lakes in the Mississippi Delta

    Science.gov (United States)

    Sediment cores from seasonal wetland and open water areas from six oxbow lakes in the Mississippi River alluvial flood plain were analyzed for total-mercury (Hg) using a direct mercury analyzer (DMA). In the process we evaluated the feasibility of simultaneously determining organic matter content by...

  3. Determination of Mercury Daily Intake and Hair-to-Blood Mercury Concentration Ratio in People Resident of the Coast of the Persian Gulf, Iran.

    Science.gov (United States)

    Okati, Narjes; Esmaili-Sari, Abbas

    2018-01-01

    The objectives of this study were to understand the mercury daily intake and hair-to-blood mercury ratio in fishermen and non-fishermen families in the coast of the Persian Gulf in Iran. The mean mercury concentration in the hair of fishermen and non-fishermen families was 5.76 and 2.27 μg/g, respectively. The mean mercury concentrations of RBCs were obtained for fishermen families and non-fishermen families: 35.96 and 17.18 μg/L, respectively. Hair mercury concentrations in 17% of people were higher than 10 μg/g, the No Observed Adverse Effects Level set by the World Health Organization. 78% of people had a blood mercury value > 5.8 μg/L, the standard level set by the U.S. Environmental Protection Agency. A significant correlation (r = 0.94, p = 0.000) was seen between log hair and RBCs mercury concentrations. The mean mercury daily intake for fishermen and non-fishermen families was 0.42 and 0.20 µg/kg BW per day, respectively. The mean mercury daily intake of fishermen families was higher than the provisional tolerable daily intake (0.23 µg/kg BW per day) suggested by the Joint Expert Committee on Food Additives. Mercury daily intake significantly correlated with fish consumption (r = 0.50, p = 0.000) and log hair mercury (r = 0.88, p = 0.000). The total mean of hair-to-blood mercury concentration ratio was 306. We conclude that the use of mercury concentrations in the hair and RBCs could have been suitable biomarkers for predicting mercury exposure of people with a high rate of fish consumption.

  4. FINAL REPORT ON THE AQUATIC MERCURY ASSESSMENT STUDY

    Energy Technology Data Exchange (ETDEWEB)

    Halverson, N

    2008-09-30

    In February 2000, the United States Environmental Protection Agency (EPA) Region 4 issued a proposed Total Maximum Daily Load (TMDL) for total mercury in the middle and lower Savannah River. The initial TMDL, which would have imposed a 1 ng/l mercury limit for discharges to the middle/lower Savannah River, was revised to 2.8 ng/l in the final TMDL released in February 2001. The TMDL was intended to protect people from the consumption of contaminated fish, which is the major route of mercury exposure to humans. The most bioaccumulative form of mercury is methylmercury, which is produced in aquatic environments by the action of microorganisms on inorganic mercury. Because of the environmental and economic significance of the mercury discharge limits that would have been imposed by the TMDL, the Savannah River Site (SRS) initiated several studies concerning: (1) mercury in SRS discharges, SRS streams and the Savannah River, (2) mercury bioaccumulation factors for Savannah River fish, (3) the use of clams to monitor the influence of mercury from tributary streams on biota in the Savannah River, and (4) mercury in rainwater falling on the SRS. The results of these studies are presented in detail in this report. The first study documented the occurrence, distribution and variation of total and methylmercury at SRS industrial outfalls, principal SRS streams and the Savannah River where it forms the border with the SRS. All of the analyses were performed using the EPA Method 1630/31 ultra low-level and contaminant-free techniques for measuring total and methylmercury. Total mercury at National Pollutant Discharge Elimination System (NPDES) outfalls ranged from 0.31-604 ng/l with a mean of 8.71 ng/l. Mercury-contaminated groundwater was the source for outfalls with significantly elevated mercury concentrations. Total mercury in SRS streams ranged from 0.95-15.7 ng/l. Mean total mercury levels in the streams varied from 2.39 ng/l in Pen Branch to 5.26 ng/l in Tims Branch

  5. Tensile deformations in mono- and polycrystalline uranium between 20 deg. C and -196 deg. C; Deformation par traction de l'uranium mono- et polycristallin entre 20 deg. C et -196 deg. C

    Energy Technology Data Exchange (ETDEWEB)

    Lemogne, A [Commissariat a l' Energie Atomique, Saclay (France). Centre d' Etudes Nucleaires

    1965-06-01

    Tensile stress tests been carried out at low temperatures (between 20 C and -196 C) on monocrystalline and polycrystalline uranium of various purities. The mechanical properties of the monocrystals have been related, at all temperatures, to plastic flow mechanisms. Below -100 C brittle fracture occurs on the planes making up the twins. A detailed study of the plastic behaviour at -196 C has made it possible to show that all the twin planes except the [176] plane were liable to become privileged planes for brittle fracture. The mechanical properties of the polycrystals, the breaking stress and the elongation at breaking point, decrease as the temperature decreases from 20 to -196 C; they undergo a transition however - not to be confused with the ductile-brittle transition - whose position and strength depend on the grain size and on the purity. It has been verified also that Petch's law is approximately applicable to the plastic flow and rupture stresses; a study has also been made of the influence of temperature and purity on the constants occurring in this equation. Finally, experiments at -196 C on the deformation up to breaking point of polycrystalline samples cold-worked at 20 C have shown the importance of the role played by intergranular cracks in the plastic behaviour of uranium. (author) [French] Des essais de traction ont ete realises a basse temperature (entre 20 C et -196 C, sur des monocristaux et des polycristaux d'uranium de differentes puretes. Les proprietes mecaniques des monocristaux ont ete reliees, a toutes temperatures, aux mecanismes d'ecoulement plastique. Une rupture fragile intervient a partir de -100 C sur les plans de composition de macle. L'etude detaillee du comportement plastique a -196 C a permis de preciser que tous les plans de macle, sauf [176], etaient susceptibles de devenir des plans de rupture fragile privilegies. Les proprietes mecaniques des polycristaux, contrainte de rupture et allongement a la rupture, decroissent quand on

  6. OCCURRENCE OF MICROORGANISMS RESISTANT TO MERCURY IN MERCURY CONTAMINATED SOILS AND SEDIMENTS IN PAVLODAR, KAZAKHSTAN

    Science.gov (United States)

    There is extensive mercury contamination of soil surrounding a chloralkali plant in Pavlodar, Kazakhstan that operated from 1970 to 1990. High-level mercury contamination exists within the confines of the plant, at nearby off-site waste storage and evaporation ponds, and in Balky...

  7. Chelation Therapy for Mercury Poisoning

    Directory of Open Access Journals (Sweden)

    Rong Guan

    2009-01-01

    Full Text Available Chelation therapy has been the major treatment for heavy metal poisoning. Various chelating agents have been developed and tested for treatment of heavy metal intoxications, including mercury poisoning. It has been clearly shown that chelating agents could rescue the toxicity caused by heavy metal intoxication, but the potential preventive role of chelating agents against heavy metal poisoning has not been explored much. Recent paper by Siddiqi and colleagues has suggested a protective role of chelating agents against mercury poisoning, which provides a promising research direction for broader application of chelation therapy in prevention and treatment of mercury poisoning.

  8. REEMISSION OF MERCURY COMPOUNDS FROM SEWAGE SLUDGE DISPOSAL

    Directory of Open Access Journals (Sweden)

    Beata Janowska

    2016-12-01

    Full Text Available The sewage sludge disposal and cultivation methods consist in storage, agricultural use, compost production, biogas production or heat treatment. The sewage sludge production in municipal sewage sludge treatment plants in year 2013 in Poland amounted to 540.3 thousand Mg d.m. The sewage sludge for agricultural or natural use must satisfy chemical, sanitary and environmental safety requirements. The heavy metal content, including the mercury content, determines the sewage sludge disposal method. Mercury has a high chemical activity and biological form compounds with different properties. The properties of the mercury present in sewage sludge or composts, its potential bioavailability depend on its physicochemical forms. Different forms of mercury, which are found in soil and sediments and sewage sludge, may be determined using various techniques sequential extraction. In order to assess the bioavailability the analysis of fractional of mercury in samples of sewage sludge and composts was made. For this purpose the analytical procedure based on a four sequential extraction process was applied. Mercury fractions were classified as exchangeable (EX, base soluble (BS, acids soluble (AS and oxidizable (OX. This article presents the research results on the mercury compounds contents in sewage sludge subjected to drying process, combustion and in composted sewage sludge. During drying and combustion process of the sewage sludge, mercury transforms into volatile forms that could be emitted into the atmosphere. The mercury fractionation in composted sewage sludge proved that mercury in compost occurs mainly in an organic fraction and in a residual fraction that are scarce in the environment.

  9. Mercury bioaccumulation in the Mediterranean

    Directory of Open Access Journals (Sweden)

    Cinnirella S.

    2013-04-01

    Full Text Available This study details mercury pollution within the food chain of the Mediterranean by analysing the most comprehensive mercury dataset available for biota and water measurements. In this study we computed a bioaccumulation factor (BAF for datasets in the existing mercury-related scientific literature, in on-going programs, and in past measurement campaigns. Preliminary results indicate a major lack of information, making the outcome of any assessment very uncertain. Importantly, not all marine eco-regions are (or have ever been covered by measurement campaigns. Most lacking is information associated with the South-Eastern part of the Mediterranean, and in several eco-regions it is still impossible to reconstruct a trophic net, as the required species were not accounted for when mercury measurements were taken. The datasets also have additional temporal sampling problems, as species were often not sampled systematically (but only sporadically during any given sampling period. Moreover, datasets composed of mercury concentrations in water also suffer from similar geographic limitations, as they are concentrated in the North-Western Mediterranean. Despite these concerns, we found a very clear bioaccumulation trend in 1999, the only year where comprehensive information on both methylmercury concentrations in water and biota was available.

  10. Distribution of mercury in the brain and its subcellular units in experimental organic mercury poisonings

    Energy Technology Data Exchange (ETDEWEB)

    Yoshino, Y; Mozai, T; Nakao, K

    1966-01-01

    The relation between mercury content and histological changes in dog brain was studied. The compounds used were methylmercury thioacetamide (CH/sub 3/HgSCH/sub 2/CONH/sub 2/) with and without /sup 203/Hg. The most noticeable histological change was observed in the calcarine area where the mercury level was always higher than in other areas. In some dogs the mercury content in the cerebellum was noticeably high, but this was not a constant finding. Chemical fractionation of the brain of the rat poisoned with the radioactive methylmercury compound revealed that almost all radioactivity resided in the protein fraction, there being little radioactivity in the lipid and nucleic acid fractions. Hydrolysis of the protein released mercury. It is noteworthy that a latent period exists between the time when the concentration of the poison in the brain reaches its peak and the development of nervous symptoms.

  11. Mercury Binding Sites in Thiol-Functionalized Mesostructured Silica

    International Nuclear Information System (INIS)

    Billinge, Simon J.L.; McKimmey, Emily J.; Shatnawi, Mouath; Kim, HyunJeong; Petkov, Valeri; Wermeille, Didier; Pinnavaia, Thomas J.

    2005-01-01

    Thiol-functionalized mesostructured silica with anhydrous compositions of (SiO 2 ) 1-x (LSiO 1.5 ) x , where L is a mercaptopropyl group and x is the fraction of functionalized framework silicon centers, are effective trapping agents for the removal of mercuric(II) ions from water. In the present work, we investigate the mercury-binding mechanism for representative thiol-functionalized mesostructures by atomic pair distribution function (PDF) analysis of synchrotron X-ray powder diffraction data and by Raman spectroscopy. The mesostructures with wormhole framework structures and compositions corresponding to x = 0.30 and 0.50 were prepared by direct assembly methods in the presence of a structure-directing amine porogen. PDF analyses of five mercury-loaded compositions with Hg/S ratios of 0.50-1.30 provided evidence for the bridging of thiolate sulfur atoms to two metal ion centers and the formation of chain structures on the pore surfaces. We find no evidence for Hg-O bonds and can rule out oxygen coordination of the mercury at greater than the 10% level. The relative intensities of the PDF peaks corresponding to Hg-S and Hg-Hg atomic pairs indicate that the mercury centers cluster on the functionalized surfaces by virtue of thiolate bridging, regardless of the overall mercury loading. However, the Raman results indicate that the complexation of mercury centers by thiolate depends on the mercury loading. At low mercury loadings (Hg/S (le) 0.5), the dominant species is an electrically neutral complex in which mercury most likely is tetrahedrally coordinated to bridging thiolate ligands, as in Hg(SBu t ) 2 . At higher loadings (Hg/S 1.0-1.3), mercury complex cations predominate, as evidenced by the presence of charge-balancing anions (nitrate) on the surface. This cationic form of bound mercury is assigned a linear coordination to two bridging thiolate ligands.

  12. Mercury in Nelson's Sparrow Subspecies at Breeding Sites

    Science.gov (United States)

    Winder, Virginia L.; Emslie, Steven D.

    2012-01-01

    Background Mercury is a persistent, biomagnifying contaminant that can cause negative effects on ecosystems. Marshes are often areas of relatively high mercury methylation and bioaccumulation. Nelson's Sparrows (Ammodramus nelsoni) use marsh habitats year-round and have been documented to exhibit tissue mercury concentrations that exceed negative effects thresholds. We sought to further characterize the potential risk of Nelson's Sparrows to mercury exposure by sampling individuals from sites within the range of each of its subspecies. Methodology/Principal Findings From 2009 to 2011, we captured adult Nelson's Sparrows at sites within the breeding range of each subspecies (A. n. nelsoni: Grand Forks and Upham, North Dakota; A. n. alterus: Moosonee, Ontario; and A. n. subvirgatus: Grand Manan Island, New Brunswick) and sampled breast feathers, the first primary feather (P1), and blood for total mercury analysis. Mean blood mercury in nelsoni individuals captured near Grand Forks ranged from 0.84±0.37 to 1.65±1.02 SD ppm among years, between 2.0 and 4.9 times as high as concentrations at the other sites (Pmercury did not vary among sites within a given sampling year (site means ranged from 0.98±0.69 to 2.71±2.93 ppm). Mean P1 mercury in alterus (2.96±1.84 ppm fw) was significantly lower than in any other sampled population (5.25±2.24–6.77±3.51 ppm; P≤0.03). Conclusions/Significance Our study further characterized mercury in Nelson's Sparrows near Grand Forks; we documented localized and potentially harmful mercury concentrations, indicating that this area may represent a biological mercury hotspot. This finding warrants further research to determine if wildlife populations of conservation or recreational interest in this area may be experiencing negative effects due to mercury exposure. We present preliminary conclusions about the risk of each sampled population to mercury exposure. PMID:22384194

  13. Movement of mercury-203 in plants. Final report

    International Nuclear Information System (INIS)

    Gay, D.D.; Butler, G.P.

    1977-10-01

    Seeds of Pisum sativum, varieties Little Marvel and Alaska, were planted in soils contaminated with radioactive ionic mercury, methylmercury or phenylmercury compounds. After saturation, stems, leaves, and pods were harvested and analyzed by gamma spectroscopy. Utilizing a least squares three-way analysis of covariance coupled with a Studentized Range Test, significant differences were noted among the levels of the three mercury compounds in the plants, between mercury levels in the two pea varieties and among mercury levels in the different pea tissues examined. Phenylmercury levels differed consistently from levels of ionic mercury and methylmercury suggesting a separate pathway for it in peas

  14. Uptake of mercury vapor by wheat. An assimilation model

    International Nuclear Information System (INIS)

    Browne, C.L.; Fang, S.C.

    1978-01-01

    Using a whole-plant chamber and 203 Hg-labeled mercury, a quantitative study was made of the effect of environmental parameters on the uptake, by wheat (Triticum aestivum), of metallic mercury vapor, an atmospheric pollutant. Factors were examined in relation to their influence on components of the gas-assimilation model, U(Hg) = (C/sub A' -- C/sub L')/(r/sub L.Hg/ + r/sub M.Hg/) where U(Hg) is the rate of mercury uptake per unit leaf surface, C/sub A'/ is the ambient mercury vapor concentration, C/sub L'/ is the mercury concentration at immobilization sites within the plant (assumed to be zero), r/sub L.Hg/ is the total leaf resistance to mercury vapor exchange, and r/sub M.Hg/ is a residual term to account for unexplained physical and biochemical resistances to mercury vapor uptake. Essentially all mercury vapor uptake was confined to the leaves. r/sub L.Hg/ was particularly influenced by illumination (0 to 12.8 klux), but unaffected by ambient temperature (17 to 33 0 C) and mercury vapor concentration (0 to 40 μg m -3 ). The principal limitation to mercury vapor uptake was r/sub M.Hg/, which was linearly related to leaf temperature, but unaffected by mercury vapor concentration and illumination, except for apparent high values in darkness. Knowing C/sub A'/ and estimating r/sub L.Hg/ and r/sub M.Hg/ from experimental data, mercury vapor uptake by wheat in light was accurately predicted for several durations of exposure using the above model

  15. Mercury emission from a temperate lake during autumn turnover

    International Nuclear Information System (INIS)

    Wollenberg, Jennifer L.; Peters, Stephen C.

    2009-01-01

    Lakes in temperate regions stratify during summer and winter months, creating distinct layers of water differentiated by their physical and chemical characteristics. When lakes mix in autumn and spring, mercury cycling may be affected by the chemical changes that occur during mixing. Sampling was conducted in Lake Lacawac, Eastern Pennsylvania, USA, throughout the autumn of 2007 to characterize changes in emission of gaseous elemental mercury (Hg 0 ) from the lake surface and dissolved mercury profiles in the water column during mixing. Water chemistry and weather parameters were also measured, including dissolved organic carbon (DOC), iron, and solar radiation which have been shown to interact with mercury species. Results indicate that emission of Hg 0 from the lake to the atmosphere during turnover was controlled both by solar radiation and by surface water mercury concentration. As autumn turnover progressed through the months of October and November, higher mercury concentration water from the hypolimnion mixed with epilimnetic water, increasing mercury concentration in epilimnetic waters. Dissolved absorbance was significantly correlated with mercury concentrations and with iron, but DOC concentrations were essentially constant throughout the study period and did not exhibit a relationship with either dissolved mercury concentrations or emission rates. Positive correlations between dissolved mercury and iron and manganese also suggest a role for these elements in mercury transport within the lake, but iron and manganese did not demonstrate a relationship with emission rates. This research indicates that consideration of seasonal processes in lakes is important when evaluating mercury cycling in aquatic systems

  16. Mercury toxicity in the Amazon: contrast sensitivity and color discrimination of subjects exposed to mercury

    Directory of Open Access Journals (Sweden)

    A.R. Rodrigues

    2007-03-01

    Full Text Available We measured visual performance in achromatic and chromatic spatial tasks of mercury-exposed subjects and compared the results with norms obtained from healthy individuals of similar age. Data were obtained for a group of 28 mercury-exposed subjects, comprising 20 Amazonian gold miners, 2 inhabitants of Amazonian riverside communities, and 6 laboratory technicians, who asked for medical care. Statistical norms were generated by testing healthy control subjects divided into three age groups. The performance of a substantial proportion of the mercury-exposed subjects was below the norms in all of these tasks. Eleven of 20 subjects (55% performed below the norms in the achromatic contrast sensitivity task. The mercury-exposed subjects also had lower red-green contrast sensitivity deficits at all tested spatial frequencies (9/11 subjects; 81%. Three gold miners and 1 riverine (4/19 subjects, 21% performed worse than normal subjects making more mistakes in the color arrangement test. Five of 10 subjects tested (50%, comprising 2 gold miners, 2 technicians, and 1 riverine, performed worse than normal in the color discrimination test, having areas of one or more MacAdam ellipse larger than normal subjects and high color discrimination thresholds at least in one color locus. These data indicate that psychophysical assessment can be used to quantify the degree of visual impairment of mercury-exposed subjects. They also suggest that some spatial tests such as the measurement of red-green chromatic contrast are sufficiently sensitive to detect visual dysfunction caused by mercury toxicity.

  17. Biogeochemistry of mercury and methylmercury in sediment cores from Sundarban mangrove wetland, India--a UNESCO World Heritage Site.

    Science.gov (United States)

    Chatterjee, Mousumi; Canário, João; Sarkar, Santosh Kumar; Branco, Vasco; Godhantaraman, Nallamuthu; Bhattacharya, Bhaskar Deb; Bhattacharya, Asokkumar

    2012-09-01

    This study was performed to elucidate the distribution, concentration trend and possible sources of total mercury (Hg(T)) and methylmercury (MeHg) in sediment cores (<63 μm particle size; n = 75) of Sundarban mangrove wetland, northeastern part of the Bay of Bengal, India. Total mercury was determined by atomic absorption spectrometry (AAS) in a Leco AMA 254 instrument and MeHg by gas chromatography-atomic fluorescence spectrometry (GC-AFS). A wide range of variation in Hg(T) (0.032-0.196 μg g(-1) dry wt.) as well as MeHg (0.04-0.13 ng g(-1) dry wt.) concentrations revealed a slight local contamination. The prevalent low Hg(T) levels in sediments could be explained by sediment transport by the tidal Hugli (Ganges) River that would dilute the Hg(T) values via sediment mixing processes. A broader variation of MeHg proportions (%) were also observed in samples suggesting that other environmental variables such as organic carbon and microbial activity may play a major role in the methylation process. An overall elevated concentration of Hg(T) in surface layers (0-4 cm) of the core is due to remobilization of mercury from deeper sediments. Based on the index of geoaccumulation (I (geo)) and low effects-range (ER-L) values, it is considered that the sediment is less polluted by Hg(T) and there is less ecotoxicological risk. The paper provides the first information of MeHg in sediments from this wetland environment and the authors strongly recommend further examination of Hg(T) fluxes for the development of a detailed coastal MeHg model. This could provide more refine estimates of a total flux into the water column.

  18. 76 FR 75446 - Amendment of Class E Airspace; Mercury, NV

    Science.gov (United States)

    2011-12-02

    ...-0894; Airspace Docket No. 11-AWP-14] Amendment of Class E Airspace; Mercury, NV AGENCY: Federal... Mercury, Desert Rock Airport, Mercury, NV. Decommissioning of the Mercury Non-Directional Beacon (NDB) at Mercury, Desert Rock Airport has made this action necessary for the safety and management of Instrument...

  19. Influences on Mercury Bioaccumulation Factors for the Savannah River

    International Nuclear Information System (INIS)

    Paller, M.H.

    2003-01-01

    Mercury TMDLs (Total Maximum Daily Loads) are a regulatory instrument designed to reduce the amount of mercury entering a water body and ultimately to control the bioaccumulation of mercury in fish. TMDLs are based on a BAF (bioaccumulation factor), which is the ratio of methyl mercury in fish to dissolved methyl mercury in water. Analysis of fish tissue and aqueous methyl mercury samples collected at a number of locations and over several seasons in a 118 km reach of the Savannah River demonstrated that species specific BAFs varied by factors of three to eight. Factors contributing to BAF variability were location, habitat and season related differences in fish muscle tissue mercury levels and seasonal differences in dissolved methyl mercury levels. Overall (all locations, habitats, and seasons) average BAFs were 3.7 x 106 for largemouth bass, 1.4 x 106 for sunfishes, and 2.5 x 106 for white catfish. Inaccurate and imprecise BAFs can result in unnecessary economic impact or insufficient protection of human health. Determination of representative and precise BAFs for mercury in fish FR-om large rivers necessitates collecting large and approximately equal numbers of fish and aqueous methyl mercury samples over a seasonal cycle FR-om the entire area and all habitats to be represented by the TMDL

  20. Mercury: Exploration of a Planet

    Science.gov (United States)

    1976-01-01

    The flight of the Mariner 10 spacecraft to Venus and Mercury is detailed in animation and photography. Views of Mercury are featured. Also included is animation on the origin of the solar system. Dr. Bruce C. Murray, director of the Jet Propulsion Laboratory, comments on the mission.

  1. Prenatal and early postnatal intoxication by inorganic mercury resulting from the maternal use of mercury containing soap.

    Science.gov (United States)

    Lauwerys, R; Bonnier, C; Evrard, P; Gennart, J P; Bernard, A

    1987-05-01

    A case of slight renal tubular dysfunction associated with cataract and anaemia was diagnosed in a 3-month-old black boy in whom high levels of mercury were found in blood and urine. Several arguments suggest that the renal, ocular and haematological defects may have resulted from exposure to mercury during foetal life and the 1-month lactation period due to the extensive use of inorganic mercury containing cosmetics by the mother.

  2. Monte Carlo treatment of resonance-radiation imprisonment in fluorescent lamps—revisited

    International Nuclear Information System (INIS)

    Anderson, James B

    2016-01-01

    We reported in 1985 a Monte Carlo treatment of the imprisonment of the 253.7 nm resonance radiation from mercury in the mercury–argon discharge of fluorescent lamps. The calculated spectra of the emitted radiation were found in good agreement with measured spectra. The addition of the isotope mercury-196 to natural mercury was found, also in agreement with experiments, to increase lamp efficiency. In this paper we report the extension of the earlier work with increased accuracy, analysis of photon exit-time distributions, recycling of energy released in quenching, analysis of dynamic similarity for different lamp sizes, variation of Mrozowski transfer rates, prediction and analysis of the hyperfine ultra-violet spectra, and optimization of tailored mercury isotope mixtures for increased lamp efficiency. The spectra were found insensitive to the extent of quenching and recycling. The optimized mixtures were found to increase efficiencies by as much as 5% for several lamp configurations. Optimization without increasing the mercury-196 fraction was found to increase efficiencies by nearly 1% for several configurations. (paper)

  3. Improved estimates of filtered total mercury loadings and total mercury concentrations of solids from potential sources to Sinclair Inlet, Kitsap County, Washington

    Science.gov (United States)

    Paulson, Anthony J.; Conn, Kathleen E.; DeWild, John F.

    2013-01-01

    Previous investigations examined sources and sinks of mercury to Sinclair Inlet based on historic and new data. This included an evaluation of mercury concentrations from various sources and mercury loadings from industrial discharges and groundwater flowing from the Bremerton naval complex to Sinclair Inlet. This report provides new data from four potential sources of mercury to Sinclair Inlet: (1) filtered and particulate total mercury concentrations of creek water during the wet season, (2) filtered and particulate total mercury releases from the Navy steam plant following changes in the water softening process and discharge operations, (3) release of mercury from soils to groundwater in two landfill areas at the Bremerton naval complex, and (4) total mercury concentrations of solids in dry dock sumps that were not affected by bias from sequential sampling. The previous estimate of the loading of filtered total mercury from Sinclair Inlet creeks was based solely on dry season samples. Concentrations of filtered total mercury in creek samples collected during wet weather were significantly higher than dry weather concentrations, which increased the estimated loading of filtered total mercury from creek basins from 27.1 to 78.1 grams per year. Changes in the concentrations and loading of filtered and particulate total mercury in the effluent of the steam plant were investigated after the water softening process was changed from ion-exchange to reverse osmosis and the discharge of stack blow-down wash began to be diverted to the municipal water-treatment plant. These changes reduced the concentrations of filtered and particulate total mercury from the steam plant of the Bremerton naval complex, which resulted in reduced loadings of filtered total mercury from 5.9 to 0.15 grams per year. Previous investigations identified three fill areas on the Bremerton naval complex, of which the western fill area is thought to be the largest source of mercury on the base

  4. Micro pit formation by mercury-sphere collision

    International Nuclear Information System (INIS)

    Ishikura, Syuichi; Kogawa, Hiroyuki; Futakawa, Masatoshi; Kaminaga, Masanori; Hino, Ryutaro

    2004-01-01

    The development of a MW-class spallation neutron source facility is being carried out under the Japan Proton Accelerator Research Complex (J-PARC) Project promoted by JAERI and KEK. A mercury target working as the spallation neutron source will be subjected to pressure waves generated by rapid thermal expansion of mercury due to a pulsed proton beam injection. The pressure wave will impose dynamic stress on the vessel and deform the vessel, which would cause cavitation in mercury. To evaluate the effect of mercury micro jets, driven by cavitation bubble collapse, on the micro-pit formation, analyses on mercury sphere collision were carried out: single bubble dynamics and collision behavior on interface between liquid and solid, which take the nonlinearity due to shock wave in mercury and the strain rate dependency of yield stress in solid metal into account. Analytical results give a good explanation to understand relationship between the micro-pit formation and material properties: the pit size could decrease with increasing the yield strength of materials. (author)

  5. 37 CFR 2.196 - Times for taking action: Expiration on Saturday, Sunday or Federal holiday.

    Science.gov (United States)

    2010-07-01

    ...: Expiration on Saturday, Sunday or Federal holiday. 2.196 Section 2.196 Patents, Trademarks, and Copyrights... Saturday, Sunday or Federal holiday. Whenever periods of time are specified in this part in days, calendar... taking any action or paying any fee in the Office falls on a Saturday, Sunday, or Federal holiday within...

  6. Removal of mercury from coal via a microbial pretreatment process

    Science.gov (United States)

    Borole, Abhijeet P [Knoxville, TN; Hamilton, Choo Y [Knoxville, TN

    2011-08-16

    A process for the removal of mercury from coal prior to combustion is disclosed. The process is based on use of microorganisms to oxidize iron, sulfur and other species binding mercury within the coal, followed by volatilization of mercury by the microorganisms. The microorganisms are from a class of iron and/or sulfur oxidizing bacteria. The process involves contacting coal with the bacteria in a batch or continuous manner. The mercury is first solubilized from the coal, followed by microbial reduction to elemental mercury, which is stripped off by sparging gas and captured by a mercury recovery unit, giving mercury-free coal. The mercury can be recovered in pure form from the sorbents via additional processing.

  7. Mercury emissions control technologies for mixed waste thermal treatment

    International Nuclear Information System (INIS)

    Chambers, A.; Knecht, M.; Soelberg, N.; Eaton, D.

    1997-01-01

    EPA has identified wet scrubbing at low mercury feedrates, as well as carbon adsorption via carbon injection into the offgas or via flow through fixed carbon beds, as control technologies that can be used to meet the proposed Maximum Achievable Control Technology (MACT) rule limit for mercury emissions from hazardous waste incinerators. DOE is currently funding demonstrations of gold amalgamation that may also control mercury to the desired levels. Performance data from a variety of sources was reviewed to determine ranges of achievable mercury control. Preliminary costs were estimated for using these technologies to control mercury emissions from mixed waste incineration. Mercury emissions control for mixed waste incineration may need to be more efficient than for incineration of other hazardous wastes because of higher mercury concentrations in some mixed waste streams. However, mercury control performance data for wet scrubbing and carbon adsorption is highly variable. More information is needed to demonstrate control efficiencies that are achievable under various design and operating conditions for wet scrubbing, carbon adsorption, and gold amalgamation technologies. Given certain assumptions made in this study, capital costs, operating costs, and lifecycle costs for carbon injection, carbon beds, and gold amalgamation generally vary for different assumed mercury feedrates and for different offgas flowrates. Assuming that these technologies can in fact provide the necessary mercury control performance, each of these technologies may be less costly than the others for certain mercury feedrates and the offgas flowrates

  8. Evidence of mercury trapping in biofilm-EPS and mer operon-based volatilization of inorganic mercury in a marine bacterium Bacillus cereus BW-201B.

    Science.gov (United States)

    Dash, Hirak R; Basu, Subham; Das, Surajit

    2017-04-01

    Biofilm-forming mercury-resistant marine bacterium Bacillus cereus BW-201B has been explored to evident that the bacterial biofilm-EPS (exopolymers) trap inorganic mercury but subsequently release EPS-bound mercury for induction of mer operon-mediated volatilization of inorganic mercury. The isolate was able to tolerate 50 ppm of mercury and forms biofilm in presence of mercury. mer operon-mediated volatilization was confirmed, and -SH was found to be the key functional group of bacterial EPS responsible for mercury binding. Biofilm-EPS-bound mercury was found to be internalized to the bacterial system as confirmed by reversible conformational change of -SH group and increased expression level of merA gene in a timescale experiment. Biofilm-EPS trapped Hg after 24 h of incubation, and by 96 h, the volatilization process reaches to its optimum confirming the internalization of EPS-bound mercury to the bacterial cells. Biofilm disintegration at the same time corroborates the results.

  9. Mercury concentrations in cattle from NW Spain.

    Science.gov (United States)

    López Alonso, M; Benedito, J L; Miranda, M; Castillo, C; Hernández, J; Shore, R F

    2003-01-20

    Mercury is a toxic metal that is released into the environment as a result of various industrial and agricultural processes. It can be accumulated by domestic animals and so contaminate human foodstuffs. To date, there is no information on mercury residues in livestock in Spain and the aim of the present study was to quantify the concentrations of mercury in cattle in two of the major regions in north-west Spain, Galicia (a largely rural region) and Asturias, which is characterised by heavy industry and mining. Total mercury concentrations were determined in tissue (liver, kidney and muscle) and blood from 284 calves (6-10 months old) and 56 cows (2-16 years old) from across the whole of the two regions. Mercury was usually detected in the kidney (62.4-87.5% of samples) but most (79.5-96%) liver, muscle and blood samples did not contain detectable residues. Renal mercury concentrations did not differ between male and female calves but were significantly greater in female calves than in cows. Unexpectedly, kidney mercury concentrations were significantly higher in calves from the predominantly rural region of Galicia (geometric mean: 12.2 microg/kg w.wt.) than in animals from the industrialised-mining region of Asturias (3.40 microg/kg w.wt.). Overall, mercury residues in cattle from NW Spain were similar to those reported in cattle from non-polluted areas in other countries and do not constitute a risk to animal or human health. Copyright 2002 Elsevier Science B.V.

  10. Mercury exposure in young children living in New York City.

    Science.gov (United States)

    Rogers, Helen S; Jeffery, Nancy; Kieszak, Stephanie; Fritz, Pat; Spliethoff, Henry; Palmer, Christopher D; Parsons, Patrick J; Kass, Daniel E; Caldwell, Kathy; Eadon, George; Rubin, Carol

    2008-01-01

    Residential exposure to vapor from current or previous cultural use of mercury could harm children living in rental (apartment) homes. That concern prompted the following agencies to conduct a study to assess pediatric mercury exposure in New York City communities by measuring urine mercury levels: New York City Department of Health and Mental Hygiene's (NYCDOHMH) Bureau of Environmental Surveillance and Policy, New York State Department of Health/Center for Environmental Health (NYSDOHCEH), Wadsworth Center's Biomonitoring Program/Trace Elements Laboratory (WC-TEL), and Centers for Disease Control and Prevention (CDC). A previous study indicated that people could obtain mercury for ritualistic use from botanicas located in Brooklyn, Manhattan, and the Bronx. Working closely with local community partners, we concentrated our recruiting efforts through health clinics located in potentially affected neighborhoods. We developed posters to advertise the study, conducted active outreach through local partners, and, as compensation for participation in the study, we offered a food gift certificate redeemable at a local grocer. We collected 460 urine specimens and analyzed them for total mercury. Overall, geometric mean urine total mercury was 0.31 microg mercury/l urine. One sample was 24 microg mercury/l urine, which exceeded the (20 microg mercury/l urine) NYSDOH Heavy Metal Registry reporting threshold for urine mercury exposure. Geometric mean urine mercury levels were uniformly low and did not differ by neighborhood or with any clinical significance by children's ethnicity. Few parents reported the presence of mercury at home, in a charm, or other item (e.g., skin-lightening creams and soaps), and we found no association between these potential sources of exposure and a child's urinary mercury levels. All pediatric mercury levels measured in this study were well below a level considered to be of medical concern. This study found neither self-reported nor measured

  11. Mercury speciation analysis in marine samples by HPLC-ICPMS

    DEFF Research Database (Denmark)

    Rasmussen, Rie Romme; Svendsen, Maja Erecius; Herbst, M. Birgitte Koch

    Mercury (Hg) is a naturally occurring element, which is found in the earth’s crust and can be released into the environment through both natural and anthropogenic processes. Mercury exists as elemental mercury (metallic), inorganic mercury and organic mercury (primarily methylmercury......). Methylmercury is highly toxic, particularly to the nervous system, and the developing brain is thought to be the most sensitive target organ for methylmercury toxicity. Methylmercury bioaccumulates and biomagnifies along the food chain and it is the most common mercury species in fish and seafood. Human...... hydrochloric acid by sonication. Hereby the protein-bound mercury species are released. The extracts were then centrifuged (10 min at 3170 x g) and the supernatant decanted (extraction step was repeated twice). The combined extracts were added 10 M sodium hydroxide to increase pH, following further dilution...

  12. Permafrost stores a globally significant amount of mercury

    Science.gov (United States)

    Schaefer, K. M.; Schuster, P. F.; Antweiler, R.; Aiken, G.; DeWild, J.; Gryziec, J. D.; Gusmeroli, A.; Hugelius, G.; Jafarov, E.; Krabbenhoft, D. P.; Liu, L.; Herman-Mercer, N. M.; Mu, C.; Roth, D. A.; Schaefer, T.; Striegl, R. G.; Wickland, K.; Zhang, T.

    2017-12-01

    Changing climate in northern regions is causing permafrost to thaw with major implications for the cycling of mercury in arctic and subarctic ecosystems. Permafrost occurs in nearly one quarter of the Earth's Northern Hemisphere. We measured total soil mercury concentration in 588 samples from 13 soil permafrost cores from the interior and the North Slope of Alaska. The median concentration was 47.7±23.4 ng Hg g soil-1 and the median ratio of Hg to carbon was 1.56±0.86 µg Hg g C-1. We estimate Alaskan permafrost stores 56±32 kilotons of mercury and the entire northern hemisphere permafrost land mass stores 773±441 kilotons of mercury. This increases estimates of mercury stored in soils by 60%, making permafrost the second largest reservoir of mercury on the planet. Climate projections indicate extensive permafrost thawing, releasing mercury into the environment through a variety of mechanisms, for example, terrestrial transport via dissolved organic carbon (DOC), gaseous elemental mercury (GEM) evasion, forest fires, atmospheric mixing processes with ozone, and Springtime atmospheric Hg depletion after the polar sunrise. These findings have major implications for terrestrial and aquatic life, the world's fisheries, and ultimately human health.

  13. Mercury exposure may influence fluctuating asymmetry in waterbirds

    Science.gov (United States)

    Herring, Garth; Eagles-Smith, Collin A.; Ackerman, Joshua T.

    2017-01-01

    Variation in avian bilateral symmetry can be an indicator of developmental instability in response to a variety of stressors, including environmental contaminants. The authors used composite measures of fluctuating asymmetry to examine the influence of mercury concentrations in 2 tissues on fluctuating asymmetry within 4 waterbird species. Fluctuating asymmetry increased with mercury concentrations in whole blood and breast feathers of Forster's terns (Sterna forsteri), a species with elevated mercury concentrations. Specifically, fluctuating asymmetry in rectrix feather 1 was the most strongly correlated structural variable of those tested (wing chord, tarsus, primary feather 10, rectrix feather 6) with mercury concentrations in Forster's terns. However, for American avocets (Recurvirostra americana), black-necked stilts (Himantopus mexicanus), and Caspian terns (Hydroprogne caspia), the authors found no relationship between fluctuating asymmetry and either whole-blood or breast feather mercury concentrations, even though these species had moderate to elevated mercury exposure. The results indicate that mercury contamination may act as an environmental stressor during development and feather growth and contribute to fluctuating asymmetry of some species of highly contaminated waterbirds.

  14. Total mercury, methyl mercury, and carbon in fresh and burned plants and soil in Northwestern Ontario

    Energy Technology Data Exchange (ETDEWEB)

    Mailman, M. [Department of Zoology, University of Manitoba, Winnipeg, Man. R3T 2N2 (Canada); Freshwater Institute, 501 University Crescent, Winnipeg, Man. R3T 2N6 (Canada)]. E-mail: mailmanma@dfo-mpo.gc.ca; Bodaly, R.A. [Department of Zoology, University of Manitoba, Winnipeg, Man. R3T 2N2 (Canada); Freshwater Institute, 501 University Crescent, Winnipeg, Man. R3T 2N6 (Canada)

    2005-11-15

    Terrestrial plants and soil contain substantial amounts of organic carbon (C) and mercury. Flooding terrestrial areas stimulates microbial methyl mercury (MeHg) production and fish obtain elevated MeHg concentrations. Our purpose was to determine the loss of C, total mercury (THg), and MeHg from boreal plants and soil after burning to assess the potential of burning before flooding to lower MeHg. Fresh plants contained 4 to 52 ng g{sup -1} dry weight (dw) of THg and 0.1 to 1.3 ng g{sup -1} dw of MeHg. Upland soils contained 162{+-}132 ng g{sup -1} dw of THg and 0.6{+-}0.6 ng g{sup -1} dw of MeHg. Complete burning caused plants to lose 96, 98, 97, and 94% of the mass, C, THg, and MeHg, respectively. Upland soil lost 27, 95, 79, and 82% of the mass, C, THg, and MeHg, respectively. Our results demonstrated that a substantial loss of C, THg, and MeHg was caused by burning. - Burning terrestrial vegetation and soil causes substantial losses of organic carbon, total mercury, and methyl mercury.

  15. Total mercury, methyl mercury, and carbon in fresh and burned plants and soil in Northwestern Ontario

    International Nuclear Information System (INIS)

    Mailman, M.; Bodaly, R.A.

    2005-01-01

    Terrestrial plants and soil contain substantial amounts of organic carbon (C) and mercury. Flooding terrestrial areas stimulates microbial methyl mercury (MeHg) production and fish obtain elevated MeHg concentrations. Our purpose was to determine the loss of C, total mercury (THg), and MeHg from boreal plants and soil after burning to assess the potential of burning before flooding to lower MeHg. Fresh plants contained 4 to 52 ng g -1 dry weight (dw) of THg and 0.1 to 1.3 ng g -1 dw of MeHg. Upland soils contained 162±132 ng g -1 dw of THg and 0.6±0.6 ng g -1 dw of MeHg. Complete burning caused plants to lose 96, 98, 97, and 94% of the mass, C, THg, and MeHg, respectively. Upland soil lost 27, 95, 79, and 82% of the mass, C, THg, and MeHg, respectively. Our results demonstrated that a substantial loss of C, THg, and MeHg was caused by burning. - Burning terrestrial vegetation and soil causes substantial losses of organic carbon, total mercury, and methyl mercury

  16. MicroRNA-196a is a putative diagnostic biomarker and therapeutic target for laryngeal cancer.

    Directory of Open Access Journals (Sweden)

    Koichiro Saito

    Full Text Available BACKGROUND: MicroRNA (miRNA is an emerging subclass of small non-coding RNAs that regulates gene expression and has a pivotal role for many physiological processes including cancer development. Recent reports revealed the role of miRNAs as ideal biomarkers and therapeutic targets due to their tissue- or disease-specific nature. Head and neck cancer (HNC is a major cause of cancer-related mortality and morbidity, and laryngeal cancer has the highest incidence in it. However, the molecular mechanisms involved in laryngeal cancer development remain to be known and highly sensitive biomarkers and novel promising therapy is necessary. METHODOLOGY/PRINCIPAL FINDINGS: To explore laryngeal cancer-specific miRNAs, RNA from 5 laryngeal surgical specimens including cancer and non-cancer tissues were hybridized to microarray carrying 723 human miRNAs. The resultant differentially expressed miRNAs were further tested by using quantitative real time PCR (qRT-PCR on 43 laryngeal tissue samples including cancers, noncancerous counterparts, benign diseases and precancerous dysplasias. Significant expressional differences between matched pairs were reproduced in miR-133b, miR-455-5p, and miR-196a, among which miR-196a being the most promising cancer biomarker as validated by qRT-PCR analyses on additional 84 tissue samples. Deep sequencing analysis revealed both quantitative and qualitative deviation of miR-196a isomiR expression in laryngeal cancer. In situ hybridization confirmed laryngeal cancer-specific expression of miR-196a in both cancer and cancer stroma cells. Finally, inhibition of miR-196a counteracted cancer cell proliferation in both laryngeal cancer-derived cells and mouse xenograft model. CONCLUSIONS/SIGNIFICANCE: Our study provided the possibilities that miR-196a might be very useful in diagnosing and treating laryngeal cancer.

  17. Acute mercury poisoning: a case report

    Directory of Open Access Journals (Sweden)

    Aktas Can

    2010-03-01

    Full Text Available Abstract Background Mercury poisoning can occur as a result of occupational hazard or suicide attempt. This article presents a 36-year-old case admitted to emergency department (ED due to exposure to metallic mercury. Case Presentatıon A 36-year-old woman presented to the ED with a three-day history of abdominal pain, diarrhea and fever. One week ago her daughter had brought mercury in the liquid form from the school. She had put it on the heating stove. One day later, her 14-month old sister baby got fever and died before admission to the hospital. Her blood pressure was 134/87 mmHg; temperature, 40.2°C; heart rate 105 bpm and regular; respiration, 18 bpm; O2 saturation, 96%. Nothing was remarkable on examination and routine laboratory tests. As serine or urinary mercury levels could not be tested in the city, symptomatic chelation treatment with N-acetyl cysteine (NAC was instituted with regard to presumptive diagnosis and history. At the 7th day of admission she was discharged without any sequelae or complaint. At the discharge day blood was drawn and sent for mercury levels which turned out to be 30 μg/dL (normal range: 0 - 10 μg/dL. Conclusion Public education on poisoning and the potential hazards of mercury are of vital importance for community health.

  18. Fate of mercury in the Arctic (FOMA)

    DEFF Research Database (Denmark)

    Skov, H.; Christensen, J.; Asmund, G.

    This report is the final reporting of the project FONA, funded by the Danish Environmental Protection Agency with means from the MIKA/DANCEA funds for Environmental Support to the Arctic Region. The aim of the project is to study the intercompartment mercury transport chain in the arctic area. From...... in the Arctic. The report focus on the surface exchange of mercury, the uptake of abiotic mercury into the biological system, and the bioaccumulation in the first steps of the food web, and the resulting distribution and time trend of mercury in selected animals feeding on various trophic levels...

  19. Sorbents for mercury removal from flue gas

    Energy Technology Data Exchange (ETDEWEB)

    Granite, Evan J.; Hargis, Richard A.; Pennline, Henry W.

    1998-01-01

    A review of the various promoters and sorbents examined for the removal of mercury from flue gas is presented. Commercial sorbent processes are described along with the chemistry of the various sorbent-mercury interactions. Novel sorbents for removing mercury from flue gas are suggested. Since activated carbons are expensive, alternate sorbents and/or improved activated carbons are needed. Because of their lower cost, sorbent development work can focus on base metal oxides and halides. Additionally, the long-term sequestration of the mercury on the sorbent needs to be addressed. Contacting methods between the flue gas and the sorbent also merit investigation.

  20. Sorbents for the oxidation and removal of mercury

    Science.gov (United States)

    Olson, Edwin S [Grand Forks, ND; Holmes, Michael J [Thompson, ND; Pavlish, John H [East Grand Forks, MN

    2008-10-14

    A promoted activated carbon sorbent is described that is highly effective for the removal of mercury from flue gas streams. The sorbent comprises a new modified carbon form containing reactive forms of halogen and halides. Optional components may be added to increase reactivity and mercury capacity. These may be added directly with the sorbent, or to the flue gas to enhance sorbent performance and/or mercury capture. Mercury removal efficiencies obtained exceed conventional methods. The sorbent can be regenerated and reused. Sorbent treatment and preparation methods are also described. New methods for in-flight preparation, introduction, and control of the active sorbent into the mercury contaminated gas stream are described.

  1. Sorbents for the oxidation and removal of mercury

    Science.gov (United States)

    Olson, Edwin S [Grand Forks, ND; Holmes, Michael J [Thompson, ND; Pavlish, John H [East Grand Forks, MN

    2012-05-01

    A promoted activated carbon sorbent is described that is highly effective for the removal of mercury from flue gas streams. The sorbent comprises a new modified carbon form containing reactive forms of halogen and halides. Optional components may be added to increase reactivity and mercury capacity. These may be added directly with the sorbent, or to the flue gas to enhance sorbent performance and/or mercury capture. Mercury removal efficiencies obtained exceed conventional methods. The sorbent can be regenerated and reused. Sorbent treatment and preparation methods are also described. New methods for in-flight preparation, introduction, and control of the active sorbent into the mercury contaminated gas stream are described.

  2. NMR of mercury in porous coal and silica gel

    International Nuclear Information System (INIS)

    Kasperovich, V.S.; Charnaya, E.V.; Tien, C.; Wur, C.S.

    2003-01-01

    Temperature dependences of the integral intensity and NMR signals Knight shift in 199 Hg nuclei are measured for liquid and solid mercury introduced into the porous coal and silica gel. The decrease in the crystallization completion temperature and small temperature hysteresis (from 4 up to 9 K) between melting and crystallization are identified. Mercury melting temperature in pores coincided with melting temperature of the bulk mercury. NMR signal from crystalline mercury under conditions of limited geometry was observed for the first time. It is ascertained that Knight shift for mercury in the pores both in liquid and crystalline phases is lesser than for the bulk mercury [ru

  3. Industrial-Scale Processes For Stabilizing Radioactively Contaminated Mercury Wastes

    International Nuclear Information System (INIS)

    Broderick, T. E.; Grondin, R.

    2003-01-01

    This paper describes two industrial-scaled processes now being used to treat two problematic mercury waste categories: elemental mercury contaminated with radionuclides and radioactive solid wastes containing greater than 260-ppm mercury. The stabilization processes were developed by ADA Technologies, Inc., an environmental control and process development company in Littleton, Colorado. Perma-Fix Environmental Services has licensed the liquid elemental mercury stabilization process to treat radioactive mercury from Los Alamos National Laboratory and other DOE sites. ADA and Perma-Fix also cooperated to apply the >260-ppm mercury treatment technology to a storm sewer sediment waste collected from the Y-12 complex in Oak Ridge, TN

  4. Making Mercury's Core with Light Elements

    Science.gov (United States)

    Vander Kaaden, Kathleen E.; McCubbin, Francis M.; Ross, D. Kent

    2016-01-01

    Recent results obtained from the MErcury Surface, Space ENvironment, GEochemistry, and Ranging spacecraft showed the surface of Mercury has low FeO abundances (less than 2 wt%) and high S abundances (approximately 4 wt%), suggesting the oxygen fugacity of Mercury's surface materials is somewhere between 3 to 7 log10 units below the IW buffer. The highly reducing nature of Mercury has resulted in a relatively thin mantle and a large core that has the potential to exhibit an exotic composition in comparison to the other terrestrial planets. This exotic composition may extend to include light elements (e.g., Si, C, S). Furthermore, has argued for a possible primary floatation crust on Mercury composed of graphite, which may require a core that is C-saturated. In order to investigate mercurian core compositions, we conducted piston cylinder experiments at 1 GPa, from 1300 C to 1700 C, using a range of starting compositions consisting of various Si-Fe metal mixtures (Si5Fe95, Si10Fe90, Si22Fe78, and Si35Fe65). All metals were loaded into graphite capsules used to ensure C-saturation during the duration of each experimental run. Our experiments show that Fe-Si metallic alloys exclude carbon relative to more Fe-rich metal. This exclusion of carbon commences within the range of 5 to 10 wt% Si. These results indicate that if Mercury has a Si-rich core (having more than approximately 5 wt% silicon), it would have saturated in carbon at low C abundances allowing for the possible formation of a graphite floatation crust as suggested by. These results have important implications for the thermal and magmatic evolution of Mercury.

  5. The Mercury Problem in Artisanal and Small-Scale Gold Mining.

    Science.gov (United States)

    Esdaile, Louisa J; Chalker, Justin M

    2018-05-11

    Mercury-dependent artisanal and small-scale gold mining (ASGM) is the largest source of mercury pollution on Earth. In this practice, elemental mercury is used to extract gold from ore as an amalgam. The amalgam is typically isolated by hand and then heated-often with a torch or over a stove-to distill the mercury and isolate the gold. Mercury release from tailings and vaporized mercury exceed 1000 tonnes each year from ASGM. The health effects on the miners are dire, with inhaled mercury leading to neurological damage and other health issues. The communities near these mines are also affected due to mercury contamination of water and soil and subsequent accumulation in food staples, such as fish-a major source of dietary protein in many ASGM regions. The risks to children are also substantial, with mercury emissions from ASGM resulting in both physical and mental disabilities and compromised development. Between 10 and 19 million people use mercury to mine for gold in more than 70 countries, making mercury pollution from ASGM a global issue. With the Minamata Convention on Mercury entering force this year, there is political motivation to help overcome the problem of mercury in ASGM. In this effort, chemists can play a central role. Here, the problem of mercury in ASGM is reviewed with a discussion on how the chemistry community can contribute solutions. Introducing portable and low-cost mercury sensors, inexpensive and scalable remediation technologies, novel methods to prevent mercury uptake in fish and food crops, and efficient and easy-to-use mercury-free mining techniques are all ways in which the chemistry community can help. To meet these challenges, it is critical that new technologies or techniques are low-cost and adaptable to the remote and under-resourced areas in which ASGM is most common. The problem of mercury pollution in ASGM is inherently a chemistry problem. We therefore encourage the chemistry community to consider and address this issue that

  6. MESSENGER'S First Flyby of Mercury

    Science.gov (United States)

    Slavin, James A.

    2008-01-01

    The MESSENGER mission to Mercury offers our first opportunity to explore this planet's miniature magnetosphere since Mariner 10's brief fly-bys in 1974-5. The magnetosphere of Mercury is the smallest in the solar system with its magnetic field typically standing off the solar wind only - 1000 to 2000 km above the surface. An overview of the MESSENGER mission and its January 14th close flyby of Mercury will be provided. Primary science objectives and the science instrumentation will be described. Initial results from MESSENGER'S first flyby on January 14th, 2008 will be discussed with an emphasis on the magnetic field and charged particle measurements.

  7. Mercury Hair Concentration among Primary School Children in Malaysia

    Directory of Open Access Journals (Sweden)

    Nurul Izzah Abdul Samad

    2017-12-01

    Full Text Available The main concern regarding mercury exposure is the adverse health effect on the developing nervous system. The objective of this cross-sectional study was to determine hair mercury levels and their association with socio-demographic characteristics, complaints about mercury poisoning symptoms and the fish consumption pattern among children in Malaysia. A cross-sectional study was conducted among 215 school children aged 11 years old. Hair was collected from the children and the total mercury was analyzed using oxygen combustion–gold amalgamation atomic absorption spectrophotometry. Anthropometric data, a fish consumption questionnaire and mercury poisoning symptoms were collected during a personal interview. The mean hair mercury level among primary school children was 0.63 ± 0.59 µg/g with the geometric mean of 0.47 µg/g. A total of 14% of respondents had hair mercury levels above 1 µg/g. A multiple binary logistic regression analysis outlined that fish consumption of at least one meal per week increased the likelihood of having a high mercury level (odds ratio (OR 3.7, 95% confidence interval (CI 1.3–10.4. This study confirms the existence of a mercury burden among Malaysian children and the level is high compared to other regional studies. This study provides important baseline data regarding the mercury level among children in Malaysia.

  8. Failure probability analysis on mercury target vessel

    International Nuclear Information System (INIS)

    Ishikura, Syuichi; Futakawa, Masatoshi; Kogawa, Hiroyuki; Sato, Hiroshi; Haga, Katsuhiro; Ikeda, Yujiro

    2005-03-01

    Failure probability analysis was carried out to estimate the lifetime of the mercury target which will be installed into the JSNS (Japan spallation neutron source) in J-PARC (Japan Proton Accelerator Research Complex). The lifetime was estimated as taking loading condition and materials degradation into account. Considered loads imposed on the target vessel were the static stresses due to thermal expansion and static pre-pressure on He-gas and mercury and the dynamic stresses due to the thermally shocked pressure waves generated repeatedly at 25 Hz. Materials used in target vessel will be degraded by the fatigue, neutron and proton irradiation, mercury immersion and pitting damages, etc. The imposed stresses were evaluated through static and dynamic structural analyses. The material-degradations were deduced based on published experimental data. As a result, it was quantitatively confirmed that the failure probability for the lifetime expected in the design is very much lower, 10 -11 in the safety hull, meaning that it will be hardly failed during the design lifetime. On the other hand, the beam window of mercury vessel suffered with high-pressure waves exhibits the failure probability of 12%. It was concluded, therefore, that the leaked mercury from the failed area at the beam window is adequately kept in the space between the safety hull and the mercury vessel by using mercury-leakage sensors. (author)

  9. Mercury-induced oxidative stress in Indian mustard (Brassica juncea L.).

    Science.gov (United States)

    Shiyab, Safwan; Chen, Jian; Han, Fengxiang X; Monts, David L; Matta, Fank B; Gu, Mengmeng; Su, Yi; Masad, Motasim A

    2009-10-01

    Mercury, a potent neurotoxin, is released to the environment in significant amounts by both natural processes and anthropogenic activities. No natural hyperaccumulator plant has been reported for mercury phytoremediation. Few studies have been conducted on the physiological responses of Indian mustard, a higher biomass plant with faster growth rates, to mercury pollution. This study investigated the phytotoxicity of mercury to Indian mustard (Brassica juncea L.) and mercury-induced oxidative stress in order to examine the potential application of Indian mustard to mercury phytoremediation. Two common cultivars (Florida Broadleaf and Longstanding) of Indian mustard were grown hydroponically in a mercury-spiked solution. Plant uptake, antioxidative enzymes, peroxides, and lipid peroxidation under mercury stress were investigated. Antioxidant enzymes (catalase, CAT; peroxidase, POD; and superoxide dismutase, SOD) were the most sensitive indices of mercury-induced oxidative response of Indian mustard plants. Indian mustard effectively generated an enzymatic antioxidant defense system (especially CAT) to scavenge H(2)O(2), resulting in lower H(2)O(2) in shoots with higher mercury concentrations. These two cultivars of Indian mustard demonstrated an efficient metabolic defense and adaptation system to mercury-induced oxidative stress. A majority of Hg was accumulated in the roots and low translocations of Hg from roots to shoots were found in two cultivars of Indian mustard. Thus Indian mustard might be a potential candidate plant for phytofiltration/phytostabilization of mercury contaminated waters and wastewater.

  10. Isotopic Fractionation of Mercury in Great Lakes Precipitation

    Science.gov (United States)

    Gratz, L. E.; Keeler, G. J.; Blum, J. D.; Sherman, L. S.

    2009-12-01

    Mercury (Hg) is a hazardous bioaccumulative neurotoxin, and atmospheric deposition is a primary way in which mercury enters terrestrial and aquatic ecosystems. However, the chemical processes and transport regimes that mercury undergoes from emission to deposition are not well understood. Thus the use of mercury isotopes to characterize the biogeochemical cycling of mercury is a rapidly growing area of study. Precipitation samples were collected in Chicago, IL, Holland, MI, and Dexter, MI from April 2007 - October 2007 to begin examining the isotopic fractionation of atmospheric mercury in the Great Lakes region. Results show that mass-dependent fractionation relative to NIST-3133 (MDF - δ202Hg) ranged from -0.8‰ to 0.2‰ (±0.2‰) in precipitation samples, while mass-independent fractionation (MIF - Δ199Hg) varied from 0.1‰ to 0.6‰ (±0.1‰). Although clear urban-rural differences were not observed, this may be due to the weekly collection of precipitation samples rather than collection of individual events, making it difficult to truly characterize the meteorology and source influences associated with each sample and suggesting that event-based collection is necessary during future sampling campaigns. Additionally, total vapor phase mercury samples were collected in Dexter, MI in 2009 to examine isotopic fractionation of mercury in ambient air. In ambient samples δ202Hg ranged from 0.3‰ to 0.5‰ (±0.1‰), however Δ199Hg was not significant. Because mercury in precipitation is predominantly Hg2+, while ambient vapor phase mercury is primarily Hg0, these results may suggest the occurrence of MIF during the oxidation of Hg0 to Hg2+ prior to deposition. Furthermore, although it has not been previously reported or predicted, MIF of 200Hg was also detected. Δ200Hg ranged from 0.0‰ to 0.2‰ in precipitation and from -0.1‰ to 0.0‰ in ambient samples. This work resulted in methodological developments in the collection and processing of

  11. The MESSENGER mission to Mercury: scientific objectives and implementation

    Science.gov (United States)

    Solomon, Sean C.; McNutt, Ralph L.; Gold, Robert E.; Acuña, Mario H.; Baker, Daniel N.; Boynton, William V.; Chapman, Clark R.; Cheng, Andrew F.; Gloeckler, George; Head, James W., III; Krimigis, Stamatios M.; McClintock, William E.; Murchie, Scott L.; Peale, Stanton J.; Phillips, Roger J.; Robinson, Mark S.; Slavin, James A.; Smith, David E.; Strom, Robert G.; Trombka, Jacob I.; Zuber, Maria T.

    2001-12-01

    Mercury holds answers to several critical questions regarding the formation and evolution of the terrestrial planets. These questions include the origin of Mercury's anomalously high ratio of metal to silicate and its implications for planetary accretion processes, the nature of Mercury's geological evolution and interior cooling history, the mechanism of global magnetic field generation, the state of Mercury's core, and the processes controlling volatile species in Mercury's polar deposits, exosphere, and magnetosphere. The MErcury Surface, Space ENvironment, GEochemistry, and Ranging (MESSENGER) mission has been designed to fly by and orbit Mercury to address all of these key questions. After launch by a Delta 2925H-9.5, two flybys of Venus, and two flybys of Mercury, orbit insertion is accomplished at the third Mercury encounter. The instrument payload includes a dual imaging system for wide and narrow fields-of-view, monochrome and color imaging, and stereo; X-ray and combined gamma-ray and neutron spectrometers for surface chemical mapping; a magnetometer; a laser altimeter; a combined ultraviolet-visible and visible-near-infrared spectrometer to survey both exospheric species and surface mineralogy; and an energetic particle and plasma spectrometer to sample charged species in the magnetosphere. During the flybys of Mercury, regions unexplored by Mariner 10 will be seen for the first time, and new data will be gathered on Mercury's exosphere, magnetosphere, and surface composition. During the orbital phase of the mission, one Earth year in duration, MESSENGER will complete global mapping and the detailed characterization of the exosphere, magnetosphere, surface, and interior.

  12. Mercury accumulation and its distribution to metallothionein in mouse brain after sub-chronic pulse exposure to mercury vapor

    Energy Technology Data Exchange (ETDEWEB)

    Yasutake, A. [Biochemistry Section, National Institute for Minamata Disease, Minamata, Kumamoto 867-0008 (Japan); Sawada, M.; Shimada, A. [Department of Veterinary Pathology, Tottori University, 4-101 Koyamacho, Minami, Tottori 680-0945 (Japan); Satoh, M. [Department of Hygienics, Gifu Pharmaceutical University, 5-6-1 Mitahora-higashi, Gifu 502-8585 (Japan); Tohyama, C. [Environmental Health Sciences Division, National Institute for Environmental Studies, 16-2 Onogawa, Tsukuba, Ibaraki 305-8506 (Japan)

    2004-09-01

    Previously we found that exposure to mercury vapor effectively induced metallothionein (MT) biosynthesis in rat brain. Although the induction of not only MT-I/II but also MT-III was evident, the induction rate of the latter was much lower than that of the former. The brain of an MT-null mouse lacks MT-I/II, but has MT-III. Here we examined the effects of sub-chronic pulse exposure to mercury vapor on the brain MT in MT-null mice and their wild type controls. MT-null and wild type mice were preliminarily exposed to mercury vapor for 2 weeks at 0.1 mg Hg/m{sup 3} for 1 h/day for 3 days a week, and then exposed for 11 weeks at 4.1 mg Hg/m{sup 3} for 30 min/day for 3 days a week. This exposure caused no toxic signs such as abnormal behavior or loss of body weight gain in the mice of either strain throughout the experimental period. Twenty-four hours after the termination of the exposure, mice were sacrificed and brain samples were subjected to mercury analysis, MT assay, and pathological examination. The MT-null mice showed lower accumulation of mercury in the brain than the wild type mice. Mercury exposure resulted in a 70% increase of brain MT in the wild type mice, which was mostly accounted for by the increase in MT-I/II. On the other hand, the brain MT in the MT-null mice increased by 19%, suggesting less reactivity of the MT-III gene to mercury vapor. Although histochemical examination revealed silver-mercury grains in the cytoplasm of nerve cells and glial cells throughout the brains of both strains, no significant difference was observed between the two strains. (orig.)

  13. Physics of mercury-free high-pressure discharge lamps

    International Nuclear Information System (INIS)

    Born, M

    2002-01-01

    This paper gives a summary of recent results about the replacement of mercury in high-pressure discharge lamps by metallic zinc. Actually, this topic is of high relevance for the lighting industry due to the need of more environmentally friendly products. The work presented here is supported by the German government under contract no 13N8072 and 13N8264. Due to upcoming European legislations which are expected for the year 2003, the replacement of mercury in lighting products is a high priority task. For example, mercury-free headlight discharge lamps are requested by the automotive industry. Pure zinc/argon discharges as well as lamps including zinc or mercury and metal halide additives are investigated. Experimental data are compared with model calculations of the energy balance involving the transport of heat and radiation. Since the excitation energies of relevant zinc transitions are lower than for mercury, axis temperatures of pure zinc lamps are about 300 K below the value of mercury arcs. In addition, the thermal conductivity of zinc including the contribution of radiation diffusion is larger than compared to mercury. From lamp voltage measurements it is found that the cross section for elastical electron scattering by zinc atoms is about the same than for mercury. When adding metal halides to a pure zinc discharge with argon as a starting gas, i.e. NaI, TlI, DyI 3 , axis temperatures decrease to about 5100 K due to strong radiation cooling. In order to obtain sufficiently large lamp voltages, wall temperatures of more than 1300 K are adjusted by means of polycrystalline aluminaoxide (Al 2 O 3 ) as a wall material. Electric field strengths of 6.0 and 8.6 V mm -1 are measured for metal halide lamps containing zinc or mercury, respectively. The light technical data of the discharges are very close, since mercury and zinc do not contribute significantly to the radiation in the visible range. Efficacies of up to 93 and 100 lm W -1 are found in metal halide

  14. Genetic effects of organic mercury compounds

    Energy Technology Data Exchange (ETDEWEB)

    Ramel, C

    1967-01-01

    Studies on the genetic and developmental effects of organic mercury compounds on lilies, drosophila, and ice were carried out. It was found that chromosomal and developmental abnormalities were correlated with the administration of mercury compounds.

  15. Mercury Lander Mission Concept Study Summary

    Science.gov (United States)

    Eng, D. A.

    2018-05-01

    Provides a summary of the Mercury Lander Mission Concept Study performed as part of the last Planetary Decadal Survey. The presentation will focus on engineering trades and the challenges of developing a Mercury lander mission.

  16. Solid-phase partitioning of mercury in artisanal gold mine tailings from selected key areas in Mindanao, Philippines, and its implications for mercury detoxification.

    Science.gov (United States)

    Opiso, Einstine M; Aseneiro, John Paul J; Banda, Marybeth Hope T; Tabelin, Carlito B

    2018-03-01

    The solid-phase partitioning of mercury could provide necessary data in the identification of remediation techniques in contaminated artisanal gold mine tailings. This study was conducted to determine the total mercury content of mine wastes and identify its solid-phase partitioning through selective sequential extraction coupled with cold vapour atomic absorption spectroscopy. Samples from mine tailings and the carbon-in-pulp (CIP) process were obtained from selected key areas in Mindanao, Philippines. The results showed that mercury use is still prevalent among small-scale gold miners in the Philippines. Tailings after ball mill-gravity concentration (W-BM and Li-BM samples) from Mt Diwata and Libona contained high levels of mercury amounting to 25.024 and 6.5 mg kg -1 , respectively. The most prevalent form of mercury in the mine tailings was elemental/amalgamated mercury, followed by water soluble, exchangeable, organic and strongly bound phases, respectively. In contrast, mercury content of carbon-in-pulp residues were significantly lower at only 0.3 and 0.06 mg kg -1 for P-CIP (Del Pilar) and W-CIP (Mt Diwata), respectively. The bulk of mercury in P-CIP samples was partitioned in residual fraction while in W-CIP samples, water soluble mercury predominated. Overall, this study has several important implications with regards to mercury detoxification of contaminated mine tailings from Mindanao, Philippines.

  17. Biomarkers of mercury exposure in two eastern Ukraine cities

    Science.gov (United States)

    Gibb, H.; Haver, C.; Kozlov, K.; Centeno, J.A.; Jurgenson, V.; Kolker, A.; Conko, K.M.; Landa, E.R.; Xu, H.

    2011-01-01

    This study evaluates biomarkers of mercury exposure among residents of Horlivka, a city in eastern Ukraine located in an area with geologic and industrial sources of environmental mercury, and residents of Artemivsk, a nearby comparison city outside the mercury-enriched area. Samples of urine, blood, hair, and nails were collected from study participants, and a questionnaire was administered to obtain data on age, gender, occupational history, smoking, alcohol consumption, fish consumption, tattoos, dental amalgams, home heating system, education, source of drinking water, and family employment in mines. Median biomarker mercury concentrations in Artemivsk were 0.26 ??g/g-Cr (urine), 0.92 ??g/L (blood), 0.42 ??g/g (hair), 0.11 ??g/g (toenails), and 0.09 ??g/g (fingernails); median concentrations in Horlivka were 0.15 ??g/g-Cr (urine), 1.01 ??g/L (blood), 0.14 ??g/g (hair), 0.31 ??g/g (toenails), and 0.31 ??g/g (fingernails). Biomarkers of mercury exposure for study participants from Horlivka and Artemivsk are low in comparison with occupationally exposed workers at a mercury recycling facility in Horlivka and in comparison with exposures known to be associated with clinical effects. Blood and urinary mercury did not suggest a higher mercury exposure among Horlivka residents as compared with Artemivsk; however, three individuals living in the immediate vicinity of the mercury mines had elevated blood and urinary mercury, relative to overall results for either city. For a limited number of residents from Horlivka (N = 7) and Artemivsk (N = 4), environmental samples (vacuum cleaner dust, dust wipes, soil) were collected from their residences. Mercury concentrations in vacuum cleaner dust and soil were good predictors of blood and urinary mercury. Copyright ?? 2011 JOEH, LLC.

  18. Litterfall mercury dry deposition in the eastern USA

    International Nuclear Information System (INIS)

    Risch, Martin R.; DeWild, John F.; Krabbenhoft, David P.; Kolka, Randall K.; Zhang, Leiming

    2012-01-01

    Mercury (Hg) in autumn litterfall from predominately deciduous forests was measured in 3 years of samples from 23 Mercury Deposition Network sites in 15 states across the eastern USA. Annual litterfall Hg dry deposition was significantly higher (median 12.3 micrograms per square meter (μg/m 2 ), range 3.5–23.4 μg/m 2 ) than annual Hg wet deposition (median 9.6 μg/m 2 , range 4.4–19.7 μg/m 2 ). The mean ratio of dry to wet Hg deposition was 1.3–1. The sum of dry and wet Hg deposition averaged 21 μg/m 2 per year and 55% was litterfall dry deposition. Methylmercury was a median 0.8% of Hg in litterfall and ranged from 0.6 to 1.5%. Annual litterfall Hg and wet Hg deposition rates differed significantly and were weakly correlated. Litterfall Hg dry deposition differed among forest-cover types. This study demonstrated how annual litterfall Hg dry deposition rates approximate the lower bound of annual Hg dry fluxes. - Highlights: ► Annual litterfall mercury dry deposition was significantly higher than wet deposition. ► The mean ratio of dry to wet mercury deposition was 1.3–1. ► The sum of dry and wet mercury deposition averaged 55% litterfall dry deposition. ► Litterfall mercury deposition was highest in the oak-hickory forest-cover type. ► Methylmercury was a median 0.8% of mercury in litterfall and ranged to 1.5%. - A multi-year study of Mercury Deposition Network sites found that annual mercury dry deposition from litterfall in predominately deciduous forests exceeded annual mercury wet deposition in the eastern USA.

  19. Detecting Airborne Mercury by Use of Palladium Chloride

    Science.gov (United States)

    Ryan, Margaret; Shevade, Abhijit; Kisor, Adam; Homer, Margie; Jewell, April; Manatt, Kenneth; Torres, Julia; Soler, Jessica; Taylor, Charles

    2009-01-01

    Palladium chloride films have been found to be useful as alternatives to the gold films heretofore used to detect airborne elemental mercury at concentrations of the order of parts per billion (ppb). Somewhat more specifically, when suitably prepared palladium chloride films are exposed to parts-per-billion or larger concentrations of airborne mercury, their electrical resistances change by amounts large enough to be easily measurable. Because airborne mercury adversely affects health, it is desirable to be able to detect it with high sensitivity, especially in enclosed environments in which there is a risk of leakage of mercury from lamps or other equipment. The detection of mercury by use of gold films involves the formation of gold/mercury amalgam. Gold films offer adequate sensitivity for detection of airborne mercury and could easily be integrated into an electronic-nose system designed to operate in the temperature range of 23 to 28 C. Unfortunately, in order to regenerate a gold-film mercury sensor, one must heat it to a temperature of 200 C for several minutes in clean flowing air. In preparation for an experiment to demonstrate the present sensor concept, palladium chloride was deposited from an aqueous solution onto sets of gold electrodes and sintered in air to form a film. Then while using the gold electrodes to measure the electrical resistance of the films, the films were exposed, at a temperature of 25 C, to humidified air containing mercury at various concentrations from 0 to 35 ppb (see figure). The results of this and other experiments have been interpreted as signifying that sensors of this type can detect mercury in room-temperature air at concentrations of at least 2.5 ppb and can readily be regenerated at temperatures <40 C.

  20. Atmospheric wet deposition of mercury in North America

    Energy Technology Data Exchange (ETDEWEB)

    Sweet, C.W.; Prestbo, E.; Brunette, B.

    1999-07-01

    Currently, 39 states in the US and 5 Canadian provinces have issued advisories about the dangers of eating mercury-contaminated fish taken from waters within their boundaries. The problem is most severe in the Great Lakes region, the Northeast US states, the Canadian maritime provinces, and in south Florida where many lakes and streams contain fish with concentrations of 1 ppm or higher. For many rural and remote locations, atmospheric deposition is the primary source of mercury. In 1995, the National Atmospheric Deposition Program (NADP) initiated a program to monitor total mercury and methylmercury (MMHg) in wet deposition (rain and snow) in North America. In this program, the Mercury Deposition Network (MDN), individual monitoring sites are funded and operated by a variety of local, state, and federal agencies. However, sampling and analysis are coordinated through a central laboratory so that all of the samples are collected and analyzed using the same protocols. Weekly wet-only precipitation samples are collected using an all-glass sampling train and special handling techniques. Analysis is by cold vapor atomic fluorescence spectrometry using USEPA Method 1631 for total mercury. Nearly 40 MDN sites are in operation in 1999. Most of the sites are in the eastern US and Canada. During 1996 and 1997, the volume-weighted mean concentration of total mercury in precipitation collected at 22 sites ranged from 6.0 to 18.9 ng/L. Annual deposition varied between 2.1 and 25.3 {micro} g/m{sup 2}. The average weekly wet deposition of total mercury is more than three times higher in the summer (June-August) than in the winter (December-February). This increase is due to both higher amounts of precipitation and higher concentrations of mercury in precipitation during the summer. The highest values for mercury concentration in precipitation and wet deposition of mercury were measured in the southeastern US.

  1. Active methods of mercury removal from flue gases.

    Science.gov (United States)

    Marczak, Marta; Budzyń, Stanisław; Szczurowski, Jakub; Kogut, Krzysztof; Burmistrz, Piotr

    2018-03-23

    Due to its adverse impact on health, as well as its global distribution, long atmospheric lifetime and propensity for deposition in the aquatic environment and in living tissue, the US Environmental Protection Agency (US EPA) has classified mercury and its compounds as a severe air quality threat. Such widespread presence of mercury in the environment originates from both natural and anthropogenic sources. Global anthropogenic emission of mercury is evaluated at 2000 Mg year -1 . According to the National Centre for Emissions Management (Pol. KOBiZE) report for 2014, Polish annual mercury emissions amount to approximately 10 Mg. Over 90% of mercury emissions in Poland originate from combustion of coal.The purpose of this paper was to understand mercury behaviour during sub-bituminous coal and lignite combustion for flue gas purification in terms of reduction of emissions by active methods. The average mercury content in Polish sub-bituminous coal and lignite was 103.7 and 443.5 μg kg -1 . The concentration of mercury in flue gases emitted into the atmosphere was 5.3 μg m -3 for sub-bituminous coal and 17.5 μg m -3 for lignite. The study analysed six low-cost sorbents with the average achieved efficiency of mercury removal from 30.6 to 92.9% for sub-bituminous coal and 22.8 to 80.3% for lignite combustion. Also, the effect of coke dust grain size was examined for mercury sorptive properties. The fine fraction of coke dust (CD) adsorbed within 243-277 μg Hg kg -1 , while the largest fraction at only 95 μg Hg kg -1 . The CD fraction physical oxidation of Hg in the flue gas, its effectiveness has increased twofold.

  2. MERCURY CONTROL WITH CALCIUM-BASED SORBENTS AND OXIDIZING AGENTS

    Energy Technology Data Exchange (ETDEWEB)

    Thomas K. Gale

    2002-06-01

    The initial tasks of this DOE funded project to investigate mercury removal by calcium-based sorbents have been completed, and initial testing results have been obtained. Mercury monitoring capabilities have been obtained and validated. An approximately 1MW (3.4 Mbtu/hr) Combustion Research Facility at Southern Research Institute was used to perform pilot-scale investigations of mercury sorbents, under conditions representative of full-scale boilers. The initial results of ARCADIS G&M proprietary sorbents, showed ineffective removal of either elemental or oxidized mercury. Benchscale tests are currently underway to ascertain the importance of differences between benchscale and pilot-scale experiments. An investigation of mercury-capture temperature dependence using common sorbents has also begun. Ordinary hydrated lime removed 80 to 90% of the mercury from the flue gas, regardless of the temperature of injection. High temperature injection of hydrated lime simultaneously captured SO{sub 2} at high temperatures and Hg at low temperatures, without any deleterious effects on mercury speciation. Future work will explore alternative methods of oxidizing elemental mercury.

  3. Carbon bed mercury emissions control for mixed waste treatment.

    Science.gov (United States)

    Soelberg, Nick; Enneking, Joe

    2010-11-01

    Mercury has various uses in nuclear fuel reprocessing and other nuclear processes, and so it is often present in radioactive and mixed (radioactive and hazardous) wastes. Compliance with air emission regulations such as the Hazardous Waste Combustor (HWC) Maximum Achievable Control Technology (MACT) standards can require off-gas mercury removal efficiencies up to 99.999% for thermally treating some mixed waste streams. Test programs have demonstrated this level of off-gas mercury control using fixed beds of granular sulfur-impregnated activated carbon. Other results of these tests include (1) the depth of the mercury control mass transfer zone was less than 15-30 cm for the operating conditions of these tests; (2) MERSORB carbon can sorb mercury up to 19 wt % of the carbon mass; and (3) the spent carbon retained almost all (98.3-99.99%) of the mercury during Toxicity Characteristic Leachability Procedure (TCLP) tests, but when even a small fraction of the total mercury dissolves, the spent carbon can fail the TCLP test when the spent carbon contains high mercury concentrations.

  4. Mercury in Thana creek, Bombay harbour

    Digital Repository Service at National Institute of Oceanography (India)

    Zingde, M.D.; Desai, B.N.

    weight) with marked increased from harbour to the creek region suggests substantial mercury input in the head region. Chemical extraction by hydrogen peroxide indicated that more than 70% of mercury was leachable and probably organically bound...

  5. Assessing elemental mercury vapor exposure from cultural and religious practices.

    Science.gov (United States)

    Riley, D M; Newby, C A; Leal-Almeraz, T O; Thomas, V M

    2001-08-01

    Use of elemental mercury in certain cultural and religious practices can cause high exposures to mercury vapor. Uses include sprinkling mercury on the floor of a home or car, burning it in a candle, and mixing it with perfume. Some uses can produce indoor air mercury concentrations one or two orders of magnitude above occupational exposure limits. Exposures resulting from other uses, such as infrequent use of a small bead of mercury, could be well below currently recognized risk levels. Metallic mercury is available at almost all of the 15 botanicas visited in New York, New Jersey, and Pennsylvania, but botanica personnel often deny having mercury for sale when approached by outsiders to these religious and cultural traditions. Actions by public health authorities have driven the mercury trade underground in some locations. Interviews indicate that mercury users are aware that mercury is hazardous, but are not aware of the inhalation exposure risk. We argue against a crackdown by health authorities because it could drive the practices further underground, because high-risk practices may be rare, and because uninformed government intervention could have unfortunate political and civic side effects for some Caribbean and Latin American immigrant groups. We recommend an outreach and education program involving religious and community leaders, botanica personnel, and other mercury users.

  6. Cold cathode arc model in mercury discharges

    International Nuclear Information System (INIS)

    Li, Y.M.; Byszewski, W.W.; Budinger, A.B.

    1990-01-01

    Voltage/current characteristics measured during the starting of metal halide lamps indicate a low voltage discharge when condensates (mainly mercury) are localized on the electrodes. In this case, even with a cold cathode which does not emit electrons, the current is very high and voltage across the lamp drops to about 15 to 20 V. This type of discharge is similar to the cold cathode mercury vapor arc found in mercury pool rectifiers. The cathode sheath in the mercury vapor arc is characterized by very small cathode spot size, on the order of 10 -c cm 2 , very high current density of about 10 6 A/cm 2 and very low cathode fall of approximately 10 volts. The discharge is modified and generalized to describe the cathode phenomena in the cold cathode mercury vapor arc. The sensitivity of calculated discharge parameters with respect to such modifications were examined. Results show that the cathode fall voltage remains fairly constant (7-8 volts) with large fractional variations of metastable mercury atoms bombarding the cathode. This result compares very well with experimental waveforms when anode fall and plasma voltage approximations are incorporated

  7. Kazakhstan In situ BioTransformation of Mercury ...

    Science.gov (United States)

    Our final international work on the biological decontamination of the mercury contamination of soils in the Northern outskirts of Pavlodar as a result of activity at the former PO “Khimprom” chemical plant is reported here. The plant produced chlorine and alkali from the 1970s into the 1990s using the electrolytic amalgam method entailing the use of massive amounts of mercury. Ground water became contaminated with Hg resulting in a plume 470 m wide, 1.9 km long, estimated to contain 2 million cubic meters of water. This plume could reach the River Irtysh, a source of drinking water for large cities in Kazakhstan and Russia. Significant amounts of mercuric compounds are deposited in the sediments of Lake Balkyldak, 1.5 km north of the factory. This lake occasionally received wastewater from the factory. Phase I of the PO “Kimprom” clean-up that isolated the major sources of mercury at the site was completed in 2004. However, significant amounts of mercury remain underground including groundwater contaminated with Hg in the form of HgCl2 with little to no elemental or methyl mercury (MeHg). Develop biotechnology strategies to mitigate mercury contamination in groundwater

  8. Removal of mercury by adsorption: a review.

    Science.gov (United States)

    Yu, Jin-Gang; Yue, Bao-Yu; Wu, Xiong-Wei; Liu, Qi; Jiao, Fei-Peng; Jiang, Xin-Yu; Chen, Xiao-Qing

    2016-03-01

    Due to natural and production activities, mercury contamination has become one of the major environmental problems over the world. Mercury contamination is a serious threat to human health. Among the existing technologies available for mercury pollution control, the adsorption process can get excellent separation effects and has been further studied. This review is attempted to cover a wide range of adsorbents that were developed for the removal of mercury from the year 2011. Various adsorbents, including the latest adsorbents, are presented along with highlighting and discussing the key advancements on their preparation, modification technologies, and strategies. By comparing their adsorption capacities, it is evident from the literature survey that some adsorbents have shown excellent potential for the removal of mercury. However, there is still a need to develop novel, efficient adsorbents with low cost, high stability, and easy production and manufacture for practical utility.

  9. The Use of Bacteria for Remediation of Mercury Contaminated Groundwater

    Science.gov (United States)

    Many processes of mercury transformation in the environment are bacteria mediated. Mercury properties cause some difficulties of remediation of mercury contaminated environment. Despite the significance of the problem of mercury pollution, methods of large scale bioremediation ...

  10. Experimental Investigation of Chromium Behavior During Mercury's Differentiation

    Science.gov (United States)

    Boujibar, A.; Nittler, L. R.; Chabot, N.; McCubbin, F. M.; Righter, K.; Vander Kaaden, K. E.; McCoy, T. J.

    2018-05-01

    We use experimental data on Cr partitioning and its concentration on Mercury's surface to constrain on Mercury's oxidation state. We found that Mercury's bulk Cr composition can be chondritic and its core segregated at an fO2 of IW- 4.5 to IW-3.

  11. Observations of Mercury in 1988 and 1989

    International Nuclear Information System (INIS)

    Schmude, R.W. Jr.

    1990-01-01

    A visual study of the planet Mercury was carried out in May 1988 and in April and May 1989. Most of the observations were made with the 35.5-cm telescope at the Texas A ampersand M University Observatory. This report presents drawings and a map of Mercury that covers the longitude range of 195-285 deg. One important finding was that a polarizing filter combined with color filters gives a sharper view of the planet. It is also concluded that high-resolution images of Mercury's terminator, either as seen from the earth or with the Hubble Space Telescope, can provide information about Mercury's topography. 10 refs

  12. Mercury telluride as a zero-gap semiconductor

    International Nuclear Information System (INIS)

    Berchenko, N.N.; Pashkovskij, M.V.

    1976-01-01

    The paper presents a review of main properties of mercury telluride which is a representative of a new class of substances - gapless semiconductors. The causes leading to the appearance of a gapless state in mercury chalcogenides are considered; it is demonstrated that the main role in the formation of the inverse band structure belongs to relativistic corrections. The specific properties of mercury telluride are associated with the zero forbidden band, p-like nature of electron states of the conduction band and its nonparabolicity, resonance states of impurities and anomalies of dielectric permittivity. Conditions of forbidden band appearing in mercury telluride under the effect external factors are analyzed

  13. Apparatus for isotopic alteration of mercury vapor

    Science.gov (United States)

    Grossman, Mark W.; George, William A.; Marcucci, Rudolph V.

    1988-01-01

    An apparatus for enriching the isotopic Hg content of mercury is provided. The apparatus includes a reactor, a low pressure electric discharge lamp containing a fill including mercury and an inert gas. A filter is arranged concentrically around the lamp. In a preferred embodiment, constant mercury pressure is maintained in the filter by means of a water-cooled tube that depends from it, the tube having a drop of mercury disposed in it. The reactor is arranged around the filter, whereby radiation from said lamp passes through the filter and into said reactor. The lamp, the filter and the reactor are formed of a material which is transparent to ultraviolet light.

  14. The octanol/water distribution of mercury compounds

    International Nuclear Information System (INIS)

    Halbach, S.

    1985-01-01

    Lipophilicity plays an important role in the biological action of mercurials. The distribution of one inorganic and five organic mercury compounds was determined in an n-octanol/water system. Lipophilicity decreased in the order CH 3 HgCl, bromomercurihydroxypropane HgCl 2 chlormerodrin, p-chloromercuribenzoic acid (PCMB), p-chloromercuriphenylsulfonic acid (PCMBS). The toxicity of mercurials, as reported in the literature, appears to parallel their lipophilicity. (orig.)

  15. Interaction of ethanol and mercury body burden in the mouse

    Energy Technology Data Exchange (ETDEWEB)

    Dunn, J.D.

    1978-01-01

    The interaction of ethanol with mercury in the body resulting in increased exhalation of the metal was studied in the mouse. A persistent elimination of the metal in the breath was demonstrated after single, sublethal (<1 mgHg/Kg body weight) exposures to mercury vapor (Hg/sup 0/) or mercury II chloride (HgCl/sub 2/). The amount of mercury exhaled per unit time was enhanced by oral or parenteral administration of ethanol solutions. These modifications were investigated in dose-response studies in which the drug was administered in doses ranging from 0.2g to 5.5g/Kg to mice pretreated with mercury. The EC/sub 50/ for blood ethanol with respect to mercury exhalation was determined to be approximately 200 mg/dl corresponding to an output rate of approximately 0.1% of the simultaneous body burden in 30 min several days after mercury. A hypothesis that mercury expired by these animals was proportional to the body burden after mercury administration was addressed in experiments whereby mice given one of several doses of mercuric chloride (0.16 to 500 ..mu..g/Kg) were monitored for pulmonary mercury elimination for a fifteen day period. The high correlation obtained between the amount of mercury exhaled in a standard time period and the body burden by group indicated that breath sampling could be applied as an indicator of the mercury body burden which may not be limited to the mouse.

  16. A downstream voyage with mercury

    Science.gov (United States)

    Heinz, Gary

    2016-01-01

    Retrospective essay for the Bulletin of Environmental Contamination and Toxicology.As I look back on my paper, “Effects of Low Dietary Levels of Methyl Mercury on Mallard Reproduction,” published in 1974 in the Bulletin of Environmental Contamination and Toxicology, a thought sticks in my mind. I realize just how much my mercury research was not unlike a leaf in a stream, carried this way and that, sometimes stalled in an eddy, restarted, and carried downstream at a pace and path that was not completely under my control. I was hired in 1969 by the Patuxent Wildlife Research Center to study the effects of environmental pollutants on the behavior of wildlife. A colleague was conducting a study on the reproductive effects of methylmercury on mallards (Anas platyrhynchos), and he offered to give me some of the ducklings. I conducted a pilot study, testing how readily ducklings approached a tape-recorded maternal call. Sample sizes were small, but the results suggested that ducklings from mercury-treated parents behaved differently than controls. That’s how I got into mercury research—pretty much by chance.

  17. Characteristics and distributions of atmospheric mercury ...

    Science.gov (United States)

    Continuous measurements of speciated atmospheric mercury (Hg), including gaseous elemental mercury (GEM), particulate mercury (PHg), and reactive gaseous mercury (RGM) were conducted in Guizhou Province, southwestern China. Guiyang Power Plant (GPP), Guiyang Wujiang Cement Plant, Guizhou Aluminum Plant (GAP), and Guiyang Forest Park (GFP) in Guiyang were selected as study sites. Automatic Atmospheric Mercury Speciation Analyzers (Tekran 2537A) were used for GEM analysis. PHg and RGM were simultaneously collected by a manual sampling system, including elutriator, coupler/impactor, KCl-coated annular denuder, and a filter holder. Results show that different emission sources dominate different species of Hg. The highest average GEM value was 22.2 ± 28.3 ng·m−3 and the lowest 6.1 ± 3.9 ng·m−3, from samples collected at GPP and GAP, respectively. The maximum average PHg was 1984.9 pg·m−3 and the minimum average 55.9 pg·m−3, also from GPP and GAP, respectively. Similarly, the highest average RGM of 68.8 pg·m−3 was measured at GPP, and the lowest level of 20.5 pg·m−3 was found at GAP. We conclude that coal combustion sources are still playing a key role in GEM; traffic contributes significantly to PHg; and domestic pollution dominates RGM. Mercury (Hg) is a persistent hazardous pollutant with adverse effects on human health and wildlife due mainly to bioaccumulation and biomagnification in aquatic food webs (Lindqvist et al. 1991; Schroeder and Munt

  18. AAS determination of total mercury content in environmental samples

    International Nuclear Information System (INIS)

    Moskalova, M.; Zemberyova, M.

    1997-01-01

    Two methods for determination of total mercury content in environmental samples soils, and sediments, were compared. Dissolution procedure of soils, sediments, and biological material under elevated pressure followed by determination of mercury by cold vapour atomic absorption spectrometry using a MHS-1 system and direct total mercury determination without any chemical pretreatment from soil samples using a Trace Mercury Analyzer TMA-254 were compared. TMA-254 was also applied for the determination of mercury in various further standard reference materials. Good agreement with certified values of environmental reference materials was obtained. (authors)

  19. Five Hundred Years of Mercury Exposure and Adaptation

    Science.gov (United States)

    Lombardi, Guido; Lanzirotti, Antonio; Qualls, Clifford; Socola, Francisco; Ali, Abdul-Mehdi; Appenzeller, Otto

    2012-01-01

    Mercury is added to the biosphere by anthropogenic activities raising the question of whether changes in the human chromatin, induced by mercury, in a parental generation could allow adaptation of their descendants to mercury. We review the history of Andean mining since pre-Hispanic times in Huancavelica, Peru. Despite the persistent degradation of the biosphere today, no overt signs of mercury toxicity could be discerned in present day inhabitants. However, mercury is especially toxic to the autonomic nervous system (ANS). We, therefore, tested ANS function and biologic rhythms, under the control of the ANS, in 5 Huancavelicans and examined the metal content in their hair. Mercury levels varied from none to 1.014 ppm, significantly less than accepted standards. This was confirmed by microfocused synchrotron X-ray fluorescence analysis. Biologic rhythms were abnormal and hair growth rate per year, also under ANS control, was reduced (P Peru. This would generally benefit survival in the Anthropocene, the man-made world, we now live in. PMID:22910643

  20. Conditioning of spent mercury by amalgamation

    International Nuclear Information System (INIS)

    Yim, S. P.; Shon, J. S.; An, B. G.; Lee, H. J.; Lee, J. W.; Ji, C. G.; Kim, S. H.; Yoon, J. H.; Yang, M. S.

    2002-01-01

    Solidification by amalgamation was performed to immobilize and stabilize the liquid spent mercury. First, the appropriate metal and alloy which can convert liquid mercury into a solid form of amalgam were selected through initial tests. The amalgam form, formulated in optimum composition, was characterized and subjected to performance tests including compressive strength, water immersion, leachability and initial vaporization rate to evaluate mechanical integrity, durability and leaching properties. Finally, bench scale amalgamation trial was conducted with about 1 kg of spent mercury to verify the feasibility of amalgamation method

  1. Biosorption of mercury from aqueous solutions using highly characterised peats

    Directory of Open Access Journals (Sweden)

    A.M. Rizzuti

    2015-02-01

    Full Text Available This research investigated the biosorption of mercury from aqueous solutions by six highly characterised peats. Samples of the peats were tested both in unaltered condition and after being treated with hydrochloric acid (HCl to free up any occupied exchange sites. Other variables tested were sample dose, contact time, mixing temperature, and the concentration and pH of the mercury solution. Desorption studies were also performed, and tests were done to determine whether the peats could be re-used for mercury biosorption. The results indicate that all six peat types biosorb mercury from aqueous solutions extremely well (92−100 % removal and that their mercury removal capacities are not significantly affected by manipulation of the various factors tested. The factor that had the greatest impact on the mercury removal capacities of the peats was the pH of the mercury solution. The optimal mercury solution pH for mercury removal was in the range 5−7 for four of the peats and in the range 2−3 for the other two. The desorption results indicate that it may be possible to recover up to 41 % of the removed mercury. All of the peat types tested can be repeatedly re-used for additional mercury biosorption cycles. Hence, their disposal should not become a hazardous waste problem.

  2. Mercury in human hair

    International Nuclear Information System (INIS)

    Kapauan, P.A.; Cruz, C.C.; Verceluz, F.P.

    1980-10-01

    The analysis of mercury (Hg) in scalp hair obtained from individuals residing in five different localities in the Philippines - Metro Manila, Naga City in Bicol, Bataan, Oriental Mindoro, and Palawan is presented. An overall mean of 1.46 ug/g of hair was obtained for all samples excluding those from Palawan and represents a baseline value.'' In terms of the mercury levels found in hair, the Honda Bay area in Palawan is, relatively, a ''contaminated area.'' (author)

  3. Emissions of mercury from the power sector in Poland

    Energy Technology Data Exchange (ETDEWEB)

    Zysk, J.; Wyrwa, A.; Pluta, M. [AGH University of Science & Technology, Krakow (Poland). Faculty of Energy & Fuels

    2011-01-15

    Poland belongs to the European Union countries with the highest mercury emissions. This is mainly related to coal combustion. This paper presents estimates of mercury emissions from power sector in Poland. In this work, the bottom-up approach was applied and over 160 emission point sources were analysed. For each, the characteristics of the whole technological chain starting from fuel quality, boiler type as well as emission controls were taken into account. Our results show that emissions of mercury from brown coal power plants in 2005 were nearly four times greater than those of hard coal power plants. These estimates differ significantly from national statistics and some possible reasons are discussed. For the first time total mercury emissions from the Polish power sector were differentiated into its main atmospheric forms: gaseous elemental (GEM), reactive gaseous (RGM) and particulate-bound mercury. Information on emission source location and the likely vertical distribution of mercury emissions, which can be used in modelling of atmospheric dispersion of mercury is also provided.

  4. Emissions of mercury from the power sector in Poland

    Science.gov (United States)

    Zyśk, J.; Wyrwa, A.; Pluta, M.

    2011-01-01

    Poland belongs to the European Union countries with the highest mercury emissions. This is mainly related to coal combustion. This paper presents estimates of mercury emissions from power sector in Poland. In this work, the bottom-up approach was applied and over 160 emission point sources were analysed. For each, the characteristics of the whole technological chain starting from fuel quality, boiler type as well as emission controls were taken into account. Our results show that emissions of mercury from brown coal power plants in 2005 were nearly four times greater than those of hard coal power plants. These estimates differ significantly from national statistics and some possible reasons are discussed. For the first time total mercury emissions from the Polish power sector were differentiated into its main atmospheric forms: gaseous elemental (GEM), reactive gaseous (RGM) and particulate-bound mercury. Information on emission source location and the likely vertical distribution of mercury emissions, which can be used in modelling of atmospheric dispersion of mercury is also provided.

  5. Global Mercury Observatory System (GMOS): measurements of atmospheric mercury in Celestun, Yucatan, Mexico during 2012.

    Science.gov (United States)

    Velasco, Antonio; Arcega-Cabrera, Flor; Oceguera-Vargas, Ismael; Ramírez, Martha; Ortinez, Abraham; Umlauf, Gunther; Sena, Fabrizio

    2016-09-01

    Within the Global Mercury Observation System (GMOS) project, long-term continuous measurements of total gaseous mercury (TGM) were carried out by a monitoring station located at Celestun, Yucatan, Mexico, a coastal site along the Gulf of Mexico. The measurements covered the period from January 28th to October 17th, 2012. TGM data, at the Celestun site, were obtained using a high-resolution mercury vapor analyzer. TGM data show values from 0.50 to 2.82 ng/m(3) with an annual average concentration of 1.047 ± 0.271 ng/m(3). Multivariate analyses of TGM and meteorological variables suggest that TGM is correlated with the vertical air mass distribution in the atmosphere, which is influenced by diurnal variations in temperature and relative humidity. Diurnal variation is characterized by higher nighttime mercury concentrations, which might be influenced by convection currents between sea and land. The back trajectory analysis confirmed that local sources do not significantly influence TGM variations. This study shows that TGM monitoring at the Celestun site fulfills GMOS goals for a background site.

  6. ANALYSIS OF MERCURY IN VERMONT AND NEW HAMPSHIRE LAKES: EVALUATION OF THE REGIONAL MERCURY CYCLING MODEL

    Science.gov (United States)

    An evaluation of the Regional Mercury Cycling Model (R-MCM, a steady-state fate and transport model used to simulate mercury concentrations in lakes) is presented based on its application to a series of 91 lakes in Vermont and New Hampshire. Visual and statistical analyses are pr...

  7. Determination of inorganic mercury and total mercury in biological and environmental samples by flow injection-cold vapor-atomic absorption spectrometry using sodium borohydride as the sole reducing agent

    International Nuclear Information System (INIS)

    Rio Segade, Susana; Tyson, Julian F.

    2003-01-01

    A simple, fast, precise and accurate method to determine inorganic mercury and total mercury in biological and environmental samples was developed. The optimized flow-injection mercury system permitted the separate determination of inorganic mercury and total mercury using sodium borohydride as reducing agent. Inorganic mercury was selectively determined after reduction with 10 -4 % w/v sodium borohydride, while total mercury was determined after reduction with 0.75% w/v sodium borohydride. The calibration graphs were linear up to 30 ng ml -1 . The detection limits of the method based on three times the standard deviation of the blank were 24 and 3.9 ng l -1 for total mercury and inorganic mercury determination, respectively. The relative standard deviation was less than 1.5% for a 10 ng ml -1 mercury standard. As a means of checking method performance, deionized water and pond water samples were spiked with methylmercury and inorganic mercury; quantitative recovery for total mercury and inorganic mercury was obtained. The accuracy of the method was verified by analyzing alkaline and acid extracts of five biological and sediment reference materials. Microwave-assisted extraction procedures resulted in higher concentrations of recovered mercury species, lower matrix interference with mercury determination and less time involved in sample treatment than conventional extraction procedures. The standard addition method was only needed for calibration when biological samples were analyzed. The detection limits were in the range of 1.2-19 and 6.6-18 ng g -1 in biological and sediment samples for inorganic mercury and total mercury determination, respectively

  8. BEHAVIOR OF MERCURY DURING DWPF CHEMICAL PROCESS CELL PROCESSING

    Energy Technology Data Exchange (ETDEWEB)

    Zamecnik, J.; Koopman, D.

    2012-04-09

    The Defense Waste Processing Facility has experienced significant issues with the stripping and recovery of mercury in the Chemical Processing Cell (CPC). The stripping rate has been inconsistent, often resulting in extended processing times to remove mercury to the required endpoint concentration. The recovery of mercury in the Mercury Water Wash Tank has never been high, and has decreased significantly since the Mercury Water Wash Tank was replaced after the seventh batch of Sludge Batch 5. Since this time, essentially no recovery of mercury has been seen. Pertinent literature was reviewed, previous lab-scale data on mercury stripping and recovery was examined, and new lab-scale CPC Sludge Receipt and Adjustment Tank (SRAT) runs were conducted. For previous lab-scale data, many of the runs with sufficient mercury recovery data were examined to determine what factors affect the stripping and recovery of mercury and to improve closure of the mercury material balance. Ten new lab-scale SRAT runs (HG runs) were performed to examine the effects of acid stoichiometry, sludge solids concentration, antifoam concentration, form of mercury added to simulant, presence of a SRAT heel, operation of the SRAT condenser at higher than prototypic temperature, varying noble metals from none to very high concentrations, and higher agitation rate. Data from simulant runs from SB6, SB7a, glycolic/formic, and the HG tests showed that a significant amount of Hg metal was found on the vessel bottom at the end of tests. Material balance closure improved from 12-71% to 48-93% when this segregated Hg was considered. The amount of Hg segregated as elemental Hg on the vessel bottom was 4-77% of the amount added. The highest recovery of mercury in the offgas system generally correlated with the highest retention of Hg in the slurry. Low retention in the slurry (high segregation on the vessel bottom) resulted in low recovery in the offgas system. High agitation rates appear to result in lower

  9. 76 FR 56127 - Proposed Amendment of Class E Airspace; Mercury, NV

    Science.gov (United States)

    2011-09-12

    ...-0894; Airspace Docket No. 11-AWP-14] Proposed Amendment of Class E Airspace; Mercury, NV AGENCY... action proposes to amend Class E airspace at Mercury, Desert Rock Airport, Mercury, NV. Decommissioning of the Mercury Non- Directional Beacon (NDB) at Mercury, Desert Rock Airport has made this action...

  10. Mercury's Weather-Beaten Surface: Understanding Mercury in the Context of Lunar and Asteroidal Space Weathering Studies

    Science.gov (United States)

    Domingue, Deborah L.; Chapman, Clark. R.; Killen, Rosemary M.; Zurbuchen, Thomas H.; Gilbert, Jason A.; Sarantos, Menelaos; Benna, Mehdi; Slavin, James A.; Schriver, David; Travnicek, Pavel M.; hide

    2014-01-01

    Mercury's regolith, derived from the crustal bedrock, has been altered by a set of space weathering processes. Before we can interpret crustal composition, it is necessary to understand the nature of these surface alterations. The processes that space weather the surface are the same as those that form Mercury's exosphere (micrometeoroid flux and solar wind interactions) and are moderated by the local space environment and the presence of a global magnetic field. To comprehend how space weathering acts on Mercury's regolith, an understanding is needed of how contributing processes act as an interactive system. As no direct information (e.g., from returned samples) is available about how the system of space weathering affects Mercury's regolith, we use as a basis for comparison the current understanding of these same processes on lunar and asteroidal regoliths as well as laboratory simulations. These comparisons suggest that Mercury's regolith is overturned more frequently (though the characteristic surface time for a grain is unknown even relative to the lunar case), more than an order of magnitude more melt and vapor per unit time and unit area is produced by impact processes than on the Moon (creating a higher glass content via grain coatings and agglutinates), the degree of surface irradiation is comparable to or greater than that on the Moon, and photon irradiation is up to an order of magnitude greater (creating amorphous grain rims, chemically reducing the upper layers of grains to produce nanometer scale particles of metallic iron, and depleting surface grains in volatile elements and alkali metals). The processes that chemically reduce the surface and produce nanometer-scale particles on Mercury are suggested to be more effective than similar processes on the Moon. Estimated abundances of nanometer-scale particles can account for Mercury's dark surface relative to that of the Moon without requiring macroscopic grains of opaque minerals. The presence of

  11. Seasonal variation of mercury vapor concentrations in industrial ...

    African Journals Online (AJOL)

    Mercury has been known as a toxic substance that could raise potential risks to human health. The main anthropogenic sources of mercury pollution in air include combustion of fossil fuel, metal smelting and processing, and vehicle transportation all of which exist in Ahvaz city in Southwestern Iran. Ambient air mercury ...

  12. Distribution and excretion of methyl and phenyl mercury salts

    Energy Technology Data Exchange (ETDEWEB)

    Gage, J C

    1964-01-01

    The distribution, metabolism, and excretion of phenyl mercury acetate (P.M.A.) and of methyl mercury dicyanidiamide (M.M.D.) has been studied in the rat during the repeated subcutaneous administration of small doses over a period of six weeks, and for several weeks after a single dose. The results indicate that P.M.A. is absorbed unchanged into the circulation from which it is mainly removed by the liver and kidneys where it is metabolized and excreted in the feces and urine mostly as inorganic mercury. During repeated dosage the rats reached a steady state by the end of the second week when excretion approximately balanced intake. No measurable amount of mercury was found in the central nervous system. After repeated dosage with M.M.D. there is no clear indication of a steady state being reached after six weeks. There is an accumulation of organic mercury in all tissues, particularly in the red cells, and a progressive increase in the brain concentration. M.M.D. is more slowly released from the tissues than P.M.A. and the breakdown to inorganic mercury is low. The control of human exposure to alkyl and aryl mercury salts is considered in the light of these experimental observations. The recommendation that the concentration of alkyl mercury salts in the atmosphere should not exceed 0-01 mg/m/sup 3/ seems justifiable, but there appears to be no reason to establish the figure for aryl mercury salts below the 0-1 mg/m/sup 3/ recommended for inorganic mercury vapor. 13 references, 4 tables.

  13. Mercury content of shark from south-western Australian waters

    Energy Technology Data Exchange (ETDEWEB)

    Caputi, N.; Edmonds, J.S.; Heald, D.I.

    1979-11-01

    Muscle samples from four species of commercially sought sharks off the Western Australia coast were analyzed for total mercury. While substantial amounts of mercury were accumulated by sharks, as by other marine fish, the lack of polluting industry on the coast indicates that such mercury levels probably are natural. Mercury concentrations generally increased with fish size. (4 graphs, 1 map, 8 references, 2 tables)

  14. Mercury Toxicity and Treatment: A Review of the Literature

    Science.gov (United States)

    Bernhoft, Robin A.

    2012-01-01

    Mercury is a toxic heavy metal which is widely dispersed in nature. Most human exposure results from fish consumption or dental amalgam. Mercury occurs in several chemical forms, with complex pharmacokinetics. Mercury is capable of inducing a wide range of clinical presentations. Diagnosis of mercury toxicity can be challenging but can be obtained with reasonable reliability. Effective therapies for clinical toxicity have been described. PMID:22235210

  15. Mercury Toxicity and Treatment: A Review of the Literature

    Directory of Open Access Journals (Sweden)

    Robin A. Bernhoft

    2012-01-01

    Full Text Available Mercury is a toxic heavy metal which is widely dispersed in nature. Most human exposure results from fish consumption or dental amalgam. Mercury occurs in several chemical forms, with complex pharmacokinetics. Mercury is capable of inducing a wide range of clinical presentations. Diagnosis of mercury toxicity can be challenging but can be obtained with reasonable reliability. Effective therapies for clinical toxicity have been described.

  16. Mapping the Topography of Mercury with MESSENGER Laser Altimetry

    Science.gov (United States)

    Sun, Xiaoli; Cavanaugh, John F.; Neumann, Gregory A.; Smith, David E..; Zubor, Maria T.

    2012-01-01

    The Mercury Laser Altimeter onboard MESSENGER involves unique design elements that deal with the challenges of being in orbit around Mercury. The Mercury Laser Altimeter (MLA) is one of seven instruments on NASA's MErcury Surface, Space ENvironment, GEochemistry, and Ranging (MESSENGER) spacecraft. MESSENGER was launched on 3 August 2004, and entered into orbit about Mercury on 18 March 2011 after a journey through the inner solar system. This involved six planetary flybys, including three of Mercury. MLA is designed to map the topography and landforms of Mercury's surface. It also measures the planet's forced libration (motion about the spin axis), which helps constrain the state of the core. The first science measurements from orbit taken with MLA were made on 29 March 2011 and continue to date. MLA had accumulated about 8.3 million laser ranging measurements to Mercury's surface, as of 31 July 2012, i.e., over six Mercury years (528 Earth days). Although MLA is the third planetary lidar built at the NASA Goddard Space Flight Center (GSFC), MLA must endure a much harsher thermal environment near Mercury than the previous instruments on Mars and Earth satellites. The design of MLA was derived in part from that of the Mars Orbiter Laser Altimeter on Mars Global Surveyor. However, MLA must range over greater distances and often in off-nadir directions from a highly eccentric orbit. In MLA we use a single-mode diode-pumped Nd:YAG (neodymium-doped yttrium aluminum garnet) laser that is highly collimated to maintain a small footprint on the planet. The receiver has both a narrow field of view and a narrow spectral bandwidth to minimize the amount of background light detected from the sunlit hemisphere of Mercury. We achieve the highest possible receiver sensitivity by employing the minimum receiver detection threshold.

  17. Assessment of mercury in the Savannah River Site environment

    Energy Technology Data Exchange (ETDEWEB)

    Kvartek, E.J.; Carlton, W.H.; Denham, M.; Eldridge, L.; Newman, M.C.

    1994-09-01

    Mercury has been valued by humans for several millennia. Its principal ore, cinnabar, was mined for its distinctive reddish-gold color and high density. Mercury and its salts were used as medicines and aphrodisiacs. At SRS, mercury originated from one of the following: as a processing aid in aluminum dissolution and chloride precipitation; as part of the tritium facilities` gas handling system; from experimental, laboratory, or process support facilities; and as a waste from site operations. Mercury is also found in Par Pond and some SRS streams as the result of discharges from a mercury-cell-type chlor-alkali plant near the city of Augusta, GA. Reactor cooling water, drawn from the Savannah River, transported mercury onto the SRS. Approximately 80,000 kg of mercury is contained in the high level waste tanks and 10,000 kg is located in the SWDF. Additional quantities are located in the various seepage basins. In 1992, 617 wells were monitored for mercury contamination, with 47 indicating contamination in excess of the 0.002-ppm EPA Primary Drinking Water Standard. More than 20 Savannah River Ecology Laboratory (SREL) reports and publications pertinent to mercury (Hg) have been generated during the last two decades. They are divided into three groupings: SRS-specific studies, basic studies of bioaccumulation, and basic studies of effect. Many studies have taken place at Par Pond and Upper Three Runs Creek. Mercury has been detected in wells monitoring the groundwater beneath SRS, but not in water supply wells in excess of the Primary Drinking Water Limit of 0.002 ppm. There has been no significant release of mercury from SRS to the Savannah River. While releases to air are likely, based on process knowledge, modeling of the releases indicates concentrations that are well below the SCDHEC ambient standard.

  18. Assessment of mercury in the Savannah River Site environment

    International Nuclear Information System (INIS)

    Kvartek, E.J.; Carlton, W.H.; Denham, M.; Eldridge, L.; Newman, M.C.

    1994-09-01

    Mercury has been valued by humans for several millennia. Its principal ore, cinnabar, was mined for its distinctive reddish-gold color and high density. Mercury and its salts were used as medicines and aphrodisiacs. At SRS, mercury originated from one of the following: as a processing aid in aluminum dissolution and chloride precipitation; as part of the tritium facilities' gas handling system; from experimental, laboratory, or process support facilities; and as a waste from site operations. Mercury is also found in Par Pond and some SRS streams as the result of discharges from a mercury-cell-type chlor-alkali plant near the city of Augusta, GA. Reactor cooling water, drawn from the Savannah River, transported mercury onto the SRS. Approximately 80,000 kg of mercury is contained in the high level waste tanks and 10,000 kg is located in the SWDF. Additional quantities are located in the various seepage basins. In 1992, 617 wells were monitored for mercury contamination, with 47 indicating contamination in excess of the 0.002-ppm EPA Primary Drinking Water Standard. More than 20 Savannah River Ecology Laboratory (SREL) reports and publications pertinent to mercury (Hg) have been generated during the last two decades. They are divided into three groupings: SRS-specific studies, basic studies of bioaccumulation, and basic studies of effect. Many studies have taken place at Par Pond and Upper Three Runs Creek. Mercury has been detected in wells monitoring the groundwater beneath SRS, but not in water supply wells in excess of the Primary Drinking Water Limit of 0.002 ppm. There has been no significant release of mercury from SRS to the Savannah River. While releases to air are likely, based on process knowledge, modeling of the releases indicates concentrations that are well below the SCDHEC ambient standard

  19. Integrity Monitoring of Mercury Discharge Lamps

    Science.gov (United States)

    Tjoelker, Robert L.

    2010-01-01

    Mercury discharge lamps are critical in many trapped ion frequency standard applications. An integrity monitoring system can be implemented using end-of-life signatures observed in operational mercury discharge lamps, making it possible to forecast imminent failure and to take action to mitigate the consequences (such as switching to a redundant system). Mercury lamps are used as a source of 194-nm ultraviolet radiation for optical pumping and state selection of mercury trapped ion frequency standards. Lamps are typically fabricated using 202Hg distilled into high-purity quartz, or other 194-nm transmitting material (e.g., sapphire). A buffer gas is also placed into the bulb, typically a noble gas such as argon, neon, or krypton. The bulbs are driven by strong RF fields oscillating at .200 MHz. The lamp output may age over time by two internal mechanisms: (1) the darkening of the bulb that attenuates light transmission and (2) the loss of mercury due to migration or chemical interactions with the bulb surface. During fabrication, excess mercury is placed into a bulb, so that the loss rate is compensated with new mercury emanating from a cool tip or adjacent reservoir. The light output is nearly constant or varies slightly at a constant rate for many months/years until the mercury source is depleted. At this point, the vapor pressure abruptly falls and the total light output and atomic clock SNR (signal-to-noise ratio) decrease. After several days to weeks, the light levels decrease to a point where the atomic clock SNR is no longer sufficient to stay in lock, or the lamp self-extinguishes. This signature has been observed in four separate end-of-life lamp failures while operating in the Deep Space Network (DSN). A simple integrator circuit can observe and document steady-state lamp behavior. When the light levels drop over a predetermined time interval by a specified amount (e.g., 20 percent), an alarm is set. For critical operational applications, such as the DSN

  20. Formation of nanocolloidal metacinnabar in mercury-DOM-sulfide systems

    Science.gov (United States)

    Gerbig, Chase A.; Kim, Christopher S.; Stegemeier, John P.; Ryan, Joseph N.; Aiken, George R.

    2011-01-01

    Direct determination of mercury (Hg) speciation in sulfide-containing environments is confounded by low mercury concentrations and poor analytical sensitivity. Here we report the results of experiments designed to assess mercury speciation at environmentally relevant ratios of mercury to dissolved organic matter (DOM) (i.e., structure (EXAFS) spectroscopy. Aqueous Hg(II) and a DOM isolate were equilibrated in the presence and absence of 100 μM total sulfide. In the absence of sulfide, mercury adsorption to the resin increased as the Hg:DOM ratio decreased and as the strength of Hg-DOM binding increased. EXAFS analysis indicated that in the absence of sulfide, mercury bonds with an average of 2.4 ± 0.2 sulfur atoms with a bond length typical of mercury-organic thiol ligands (2.35 Å). In the presence of sulfide, mercury showed greater affinity for the C18 resin, and its chromatographic behavior was independent of Hg:DOM ratio. EXAFS analysis showed mercury–sulfur bonds with a longer interatomic distance (2.51–2.53 Å) similar to the mercury–sulfur bond distance in metacinnabar (2.53 Å) regardless of the Hg:DOM ratio. For all samples containing sulfide, the sulfur coordination number was below the ideal four-coordinate structure of metacinnabar. At a low Hg:DOM ratio where strong binding DOM sites may control mercury speciation (1.9 nmol mg–1) mercury was coordinated by 2.3 ± 0.2 sulfur atoms, and the coordination number rose with increasing Hg:DOM ratio. The less-than-ideal coordination numbers indicate metacinnabar-like species on the nanometer scale, and the positive correlation between Hg:DOM ratio and sulfur coordination number suggests progressively increasing particle size or crystalline order with increasing abundance of mercury with respect to DOM. In DOM-containing sulfidic systems nanocolloidal metacinnabar-like species may form, and these species need to be considered when addressing mercury biogeochemistry.

  1. Detection of concealed mercury with thermal neutrons

    International Nuclear Information System (INIS)

    Bell, Z.W.

    1994-01-01

    In the United States today, governments at all levels and the citizenry are paying increasing attention to the effects, both real and hypothetical, of industrial activity on the environment. Responsible modem industries, reflecting this heightened public and regulatory awareness, are either substituting benign materials for hazardous ones, or using hazardous materials only under carefully controlled conditions. In addition, present-day environmental consciousness dictates that we deal responsibly with legacy wastes. The decontamination and decommissioning (D ampersand D) of facilities at which mercury was used or processed presents a variety of challenges. Elemental mercury is a liquid at room temperature and readily evaporates in air. In large mercury-laden buildings, droplets may evaporate from one area only to recondense in other cooler areas. The rate of evaporation is a function of humidity and temperature; consequently, different parts of a building may be sources or sinks of mercury at different times of the day or even the year. Additionally, although mercury oxidizes in air, the oxides decompose upon heating. Hence, oxides contained within pipes or equipment, may be decomposed when those pipes and equipment are cut with saws or torches. Furthermore, mercury seeps through the pores and cracks in concrete blocks and pads, and collects as puddles and blobs in void spaces within and under them

  2. Mercury emissions from polish pulverized coalfired boiler

    Directory of Open Access Journals (Sweden)

    Wichliński Michał

    2017-01-01

    Full Text Available The current paper presents the research results carried out at one of Polish power plants at a pulverized hard coal-fired 225 MW unit. The research was carried out at full load of the boiler (100% MCR and focused on analysis of mercury content in the input fuel and limestone sorbent for wet flue gas desulfurization (FGD system, as well as investigation of mercury content in the combustion products, i.e. fly ash, slag, FGD product (gypsum and FGD effluents (waste. Within the framework of the present study the concentration of mercury vapor in the exhaust gas was also investigated. The analysis was performed using Lumex RA-915+ spectrometer with an attachment (RP-91C. The measurements were carried out at three locations, i.e. before the electrostatic precipitator (ESP, downstream the ESP, and downstream the wet FGD plant. Design of the measurement system allowed to determine both forms of mercury in the flue gas (Hg0 and Hg2+ at all measurement locations.Based on the measurement results the balance of mercury for a pulverized coal (PC boiler was calculated and the amount of mercury was assessed both in the input solids (fuel and sorbent, as well as the gaseous and solids products (flue gas, slag, ash, gypsum and FGD waste.

  3. Mercury's Seasonal Sodium Exosphere: MESSENGER Orbital Observations

    Science.gov (United States)

    Cassidy, Timothy A.; Merkel, Aimee W.; Burger, Matthew H.; Killen, Rosemary M.; McClintock, William E.; Vervack, Ronald J., Jr.; Sarantos, Menelaos

    2014-01-01

    The Mercury Atmospheric and Surface Composition Spectrometer (MASCS) Ultraviolet and Visible Spectrometer (UVVS) on the MErcury Surface, Space ENvironment, GEochemistry, and Ranging (MESSENGER) spacecraft now orbiting Mercury provides the first close-up look at the planet's sodium exosphere. UVVS has observed the exosphere from orbit almost daily for over 10 Mercury years. In this paper we describe and analyze a subset of these data: altitude profiles taken above the low-latitude dayside and south pole. The observations show spatial and temporal variations, but there are no obvious year-to-year variations in most of the observations. We do not see the episodic variability reported by some ground-based observers. We used these altitude profiles to make estimates of sodium density and temperature. The bulk of the exosphere, at about 1200 K, is much warmer than Mercury's surface. This value is consistent with some ground-based measurements and suggests that photon-stimulated desorption is the primary ejection process. We also observe a tenuous energetic component but do not see evidence of the predicted thermalized (or partially thermalized) sodium near Mercury's surface temperature. Overall we do not see the variable mixture of temperatures predicted by most Monte Carlo models of the exosphere.

  4. Axial mercury segregation in direct current operated low-pressure argon-mercury gas discharge: Part I. Experimental

    NARCIS (Netherlands)

    Gielen, J.W.A.M.; de Groot, S.; Dijk, van J.; Mullen, van der J.J.A.M.

    2004-01-01

    Due to cataphoresis, axial segregation of mercury will occur when the gas discharge of a fluorescent lamp is operated by means of a direct current. A consequence of this is a non-uniform axial luminance distribution along the lamp. To determine the degree of axial mercury segregation experimentally,

  5. Mercury's complex exosphere: results from MESSENGER's third flyby.

    Science.gov (United States)

    Vervack, Ronald J; McClintock, William E; Killen, Rosemary M; Sprague, Ann L; Anderson, Brian J; Burger, Matthew H; Bradley, E Todd; Mouawad, Nelly; Solomon, Sean C; Izenberg, Noam R

    2010-08-06

    During MESSENGER's third flyby of Mercury, the Mercury Atmospheric and Surface Composition Spectrometer detected emission from ionized calcium concentrated 1 to 2 Mercury radii tailward of the planet. This measurement provides evidence for tailward magnetospheric convection of photoions produced inside the magnetosphere. Observations of neutral sodium, calcium, and magnesium above the planet's north and south poles reveal altitude distributions that are distinct for each species. A two-component sodium distribution and markedly different magnesium distributions above the two poles are direct indications that multiple processes control the distribution of even single species in Mercury's exosphere.

  6. Diagnostic and therapeutic methods for occupational mercury poisoning

    International Nuclear Information System (INIS)

    Liu Zhanqi; Wang Xiuqin; Luo Futang

    2003-01-01

    A method of diagnosing and treating occupational mercury poisoning is reviewed in this paper. The treating measures for the chelating syndrome are also described. Based on his exposure history, urinary mercury, and clinical symptom, the employee who exposed occupationally to mercury can be diagnosed to a certain degree according to the related diagnostic standards. The chelating agent, such as meso-2, 3-dimercapto-succinicacid (DMSA), is used for mercury-lustrating treatment. By reducing the chelating agent dose and supplying necessary trace element, the side effect of chelating treatment is decreased. (authors)

  7. Mercury's Complex Exosphere: Results from MESSENGER's Third Flyby

    Science.gov (United States)

    Vervack, Ronald J., Jr.; McClintock, William E.; Killen, Rosemary M.; Sprague, Ann L.; Anderson, Brian J.; Burger, Matthew H.; Bradley, E. Todd; Mouawad, Nelly; Solomon, Sean C.; Izenberg, Noam R.

    2010-01-01

    During MESSENGER's third flyby of Mercury, the Mercury Atmospheric and Surface Composition Spectrometer detected emission from ionized calcium concentrated 1 to 2 Mercury radii tailward of the planet. This measurement provides evidence for tailward magnetospheric convection of photoions produced inside the magnetosphere. Observations of neutral sodium, calcium, and magnesium above the planet's north and south poles reveal attitude distributions that are distinct for each species. A two-component sodium distribution and markedly different magnesium distributions above the two poles are direct indications that multiple processes control the distribution of even single species in Mercury's exosphere,

  8. Transient analysis of mercury experimental loop using the RELAP5 code. 3rd report. Transient analysis using mercury properties

    International Nuclear Information System (INIS)

    Kinoshita, Hidetaka; Kaminaga, Masanori; Hino, Ryutaro

    2000-02-01

    In order to promote the Neutron Science Project of JAERI, the design of a 5MW-spallation target system is in progress with the purpose of producing a practical neutron application while at the same time adhering to the highest levels of safety. To establish the safety of the target system, it is important to understand the transient behaviors during anticipated operational events of the system, and to design the safety protection systems for the safe termination of the transients. This report presents the analytical results of transient behaviors in the mercury experimental loop using mercury properties. At first, the analytical pressure distributions were compared with experimental data measured with the mercury experimental loop. The modeling data were modified to reproduce the actual pressure distributions of the mercury experimental loop. Then a loss of forced convection and a loss of coolant accident were analyzed. In the case of the pump trip, the transient analysis was conducted using two types of mercury pumps, the mechanical type pump with moment of inertia, and the electrical-magnetic type pump without moment of inertia. The results show there was no clear difference in the two analyses, since the mercury had a large inertia, which was 13.5 times that of the water. Moreover, in the case of a pipe rupture at the pump exit, a moderate pressure decrease was confirmed when a small breakage area existed in which the coolant flowed out gradually. Based on these results, it was appeared that the transient fluctuation of pressure in the mercury loop would not become large and accidents would have to be detected by small fluctuations in pressure. Based on these analyses, we plan to conduct a simulation test to verify the RELAP5 code, and then the analysis of a full-scale mercury system will be performed. (author)

  9. MiR-196a exerts its oncogenic effect in glioblastoma multiforme by inhibition of IκBα both in vitro and in vivo

    KAUST Repository

    Yang, Guang

    2014-01-23

    BackgroundRecent studies have revealed that miR-196a is upregulated in glioblastoma multiforme (GBM) and that it correlates with the clinical outcome of patients with GBM. However, its potential regulatory mechanisms in GBM have never been reported.MethodsWe used quantitative real-time PCR to assess miR-196a expression levels in 132 GBM specimens in a single institution. Oncogenic capability of miR-196a was detected by apoptosis and proliferation assays in U87MG and T98G cells. Immunohistochemistry was used to determine the expression of IκBα in GBM tissues, and a luciferase reporter assay was carried out to confirm whether IκBα is a direct target of miR-196a. In vivo, xenograft tumors were examined for an antiglioma effect of miR-196a inhibitors.ResultsWe present for the first time evidence that miR-196a could directly interact with IκBα 3′-UTR to suppress IκBα expression and subsequently promote activation of NF-κB, consequently promoting proliferation of and suppressing apoptosis in GBM cells both in vitro and in vivo. Our study confirmed that miR-196a was upregulated in GBM specimens and that high levels of miR-196a were significantly correlated with poor outcome in a large cohort of GBM patients. Our data from human tumor xenografts in nude mice treated with miR-196 inhibitors demonstrated that inhibition of miR-196a could ameliorate tumor growth in vivo.ConclusionsMiR-196a exerts its oncogenic effect in GBM by inhibiting IκBα both in vitro and in vivo. Our findings provide new insights into the pathogenesis of GBM and indicate that miR-196a may predict clinical outcome of GBM patients and serve as a new therapeutic target for GBM. © 2014 © The Author(s) 2014. Published by Oxford University Press on behalf of the Society for Neuro-Oncology. All rights reserved. For permissions, please e-mail: journals.permissions@oup.com.

  10. Mercury emission and speciation of coal-fired power plants in China

    Science.gov (United States)

    Wang, S. X.; Zhang, L.; Li, G. H.; Wu, Y.; Hao, J. M.; Pirrone, N.; Sprovieri, F.; Ancora, M. P.

    2010-02-01

    Comprehensive field measurements are needed to understand the mercury emissions from Chinese power plants and to improve the accuracy of emission inventories. Characterization of mercury emissions and their behavior were measured in six typical coal-fired power plants in China. During the tests, the flue gas was sampled simultaneously at inlet and outlet of Selective Catalytic Reduction (SCR), electrostatic precipitators (ESP), and flue gas desulfurization (FGD) using the Ontario Hydro Method (OHM). The pulverized coal, bottom ash, fly ash and gypsum were also sampled in the field. Mercury concentrations in coal burned in the measured power plants ranged from 17 to 385 μg/kg. The mercury mass balances for the six power plants varied from 87 to 116% of the input coal mercury for the whole system. The total mercury concentrations in the flue gas from boilers were at the range of 1.92-27.15 μg/m3, which were significantly related to the mercury contents in burned coal. The mercury speciation in flue gas right after the boiler is influenced by the contents of halogen, mercury, and ash in the burned coal. The average mercury removal efficiencies of ESP, ESP plus wet FGD, and ESP plus dry FGD-FF systems were 24%, 73% and 66%, respectively, which were similar to the average removal efficiencies of pollution control device systems in other countries such as US, Japan and South Korea. The SCR system oxidized 16% elemental mercury and reduced about 32% of total mercury. Elemental mercury, accounting for 66-94% of total mercury, was the dominant species emitted to the atmosphere. The mercury emission factor was also calculated for each power plant.

  11. Does mercury contamination reduce body condition of endangered California clapper rails?

    International Nuclear Information System (INIS)

    Ackerman, Joshua T.; Overton, Cory T.; Casazza, Michael L.; Takekawa, John Y.; Eagles-Smith, Collin A.; Keister, Robin A.; Herzog, Mark P.

    2012-01-01

    We examined mercury exposure in 133 endangered California clapper rails (Rallus longirostris obsoletus) within tidal marsh habitats of San Francisco Bay, California from 2006 to 2010. Mean total mercury concentrations were 0.56 μg/g ww in blood (range: 0.15–1.43), 9.87 μg/g fw in head feathers (3.37–22.0), 9.04 μg/g fw in breast feathers (3.68–20.2), and 0.57 μg/g fww in abandoned eggs (0.15–2.70). We recaptured 21 clapper rails and most had low within-individual variation in mercury. Differences in mercury concentrations were largely attributed to tidal marsh site, with some evidence for year and quadratic date effects. Mercury concentrations in feathers were correlated with blood, and slopes differed between sexes (R 2 = 0.58–0.76). Body condition was negatively related to mercury concentrations. Model averaged estimates indicated a potential decrease in body mass of 20–22 g (5–7%) over the observed range of mercury concentrations. Our results indicate the potential for detrimental effects of mercury contamination on endangered California clapper rails in tidal marsh habitats. - Highlights: ► We examined mercury in endangered California clapper rails within tidal marshes. ► Differences in mercury concentrations were largely attributed to tidal marsh site. ► Mercury concentrations in blood, feathers, and eggs were considered elevated. ► Body condition was negatively related to mercury concentrations. ► Results indicate detrimental effects of mercury on endangered clapper rails. - Mercury contamination in endangered California clapper rails was influenced by tidal marsh site and increased mercury resulted in reduced bird body condition.

  12. Mercury speciation comparison. BrooksApplied Laboratories and Eurofins Frontier Global Sciences

    Energy Technology Data Exchange (ETDEWEB)

    Bannochie, C. J. [Savannah River Site (SRS), Aiken, SC (United States). Savannah River National Lab. (SRNL); Wilmarth, W. R. [Savannah River Site (SRS), Aiken, SC (United States). Savannah River National Lab. (SRNL)

    2016-12-16

    The Savannah River National Laboratory (SRNL) was tasked with preparing and shipping samples for Hg speciation by Eurofins Frontier Global Sciences (FGS), Inc. in Bothell, WA on behalf of the Savannah River Remediation (SRR) Mercury Program Team. These samples were analyzed for seven species including: total mercury, dissolved mercury, inorganic mercury ((Hg(I) and Hg(II)), elemental mercury, methylmercury, ethylmercury, and dimethylmercury, with an eighth species, particulate mercury, calculated from the difference between total and dissolved mercury after subtracting the elemental mercury. The species fraction of total mercury measured has ranged broadly from a low of 32% to a high of 146%, though the vast majority of samples have been <100%. This can be expected since one is summing multiple values that each have at least a ± 20% measurement uncertainty. Two liquid waste tanks particularly important to understanding the distribution of mercury species in the Savannah River Site (SRS) Tank Farm were selected for a round robin analysis by Eurofins FGS and BrooksApplied Laboratories (BAL). The analyses conducted by BAL on the Tank 22 and 38 samples and their agreement with those obtained from Eurofins FGS for total mercury, dissolved mercury, methylmercury, ethylmercury, and dimethylmercury provide a strong degree of confidence in these species measurements

  13. Mercury speciation comparison. BrooksApplied Laboratories and Eurofins Frontier Global Sciences

    International Nuclear Information System (INIS)

    Bannochie, C. J.; Wilmarth, W. R.

    2016-01-01

    The Savannah River National Laboratory (SRNL) was tasked with preparing and shipping samples for Hg speciation by Eurofins Frontier Global Sciences (FGS), Inc. in Bothell, WA on behalf of the Savannah River Remediation (SRR) Mercury Program Team. These samples were analyzed for seven species including: total mercury, dissolved mercury, inorganic mercury ((Hg(I) and Hg(II)), elemental mercury, methylmercury, ethylmercury, and dimethylmercury, with an eighth species, particulate mercury, calculated from the difference between total and dissolved mercury after subtracting the elemental mercury. The species fraction of total mercury measured has ranged broadly from a low of 32% to a high of 146%, though the vast majority of samples have been <100%. This can be expected since one is summing multiple values that each have at least a ± 20% measurement uncertainty. Two liquid waste tanks particularly important to understanding the distribution of mercury species in the Savannah River Site (SRS) Tank Farm were selected for a round robin analysis by Eurofins FGS and BrooksApplied Laboratories (BAL). The analyses conducted by BAL on the Tank 22 and 38 samples and their agreement with those obtained from Eurofins FGS for total mercury, dissolved mercury, methylmercury, ethylmercury, and dimethylmercury provide a strong degree of confidence in these species measurements

  14. 21 CFR 872.3080 - Mercury and alloy dispenser.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 8 2010-04-01 2010-04-01 false Mercury and alloy dispenser. 872.3080 Section 872...) MEDICAL DEVICES DENTAL DEVICES Prosthetic Devices § 872.3080 Mercury and alloy dispenser. (a) Identification. A mercury and alloy dispenser is a device with a spring-activated valve intended to measure and...

  15. ALTERNATIVE FIELD METHODS TO TREAT MERCURY IN SOIL

    Energy Technology Data Exchange (ETDEWEB)

    Ernest F. Stine Jr; Steven T. Downey

    2002-08-14

    U.S. Department of Energy (DOE) used large quantities of mercury in the uranium separating process from the 1950s until the late 1980s in support of national defense. Some of this mercury, as well as other hazardous metals and radionuclides, found its way into, and under, several buildings, soil and subsurface soils and into some of the surface waters. Several of these areas may pose potential health or environmental risks and must be dealt with under current environmental regulations. DOE's National Energy Technology Laboratory (NETL) awarded a contract ''Alternative Field Methods to Treat Mercury in Soil'' to IT Group, Knoxville TN (IT) and its subcontractor NFS, Erwin, TN to identify remedial methods to clean up mercury-contaminated high-clay content soils using proven treatment chemistries. The sites of interest were the Y-12 National Security Complex located in Oak Ridge, Tennessee, the David Witherspoon properties located in Knoxville, Tennessee, and at other similarly contaminated sites. The primary laboratory-scale contract objectives were (1) to safely retrieve and test samples of contaminated soil in an approved laboratory and (2) to determine an acceptable treatment method to ensure that the mercury does not leach from the soil above regulatory levels. The leaching requirements were to meet the TC (0.2 mg/l) and UTS (0.025 mg/l) TCLP criteria. In-situ treatments were preferred to control potential mercury vapors emissions and liquid mercury spills associated with ex-situ treatments. All laboratory work was conducted in IT's and NFS laboratories. Mercury contaminated nonradioactive soil from under the Alpha 2 building in the Y-12 complex was used. This soils contained insufficient levels of leachable mercury and resulted in TCLP mercury concentrations that were similar to the applicable LDR limits. The soil was spiked at multiple levels with metallic (up to 6000 mg/l) and soluble mercury compounds (up to 500 mg/kg) to

  16. Rotation of the planet mercury.

    Science.gov (United States)

    Jefferys, W H

    1966-04-08

    The equations of motion for the rotation of Mercury are solved for the general case by an asymptotic expansion. The findings of Liu and O'Keefe, obtained by numerical integration of a special case, that it is possible for Mercury's rotation to be locked into a 2:3 resonance with its revolution, are confirmed in detail. The general solution has further applications.

  17. Mercury removal sorbents

    Science.gov (United States)

    Alptekin, Gokhan

    2016-03-29

    Sorbents and methods of using them for removing mercury from flue gases over a wide range of temperatures are disclosed. Sorbent materials of this invention comprise oxy- or hydroxyl-halogen (chlorides and bromides) of manganese, copper and calcium as the active phase for Hg.sup.0 oxidation, and are dispersed on a high surface porous supports. In addition to the powder activated carbons (PACs), this support material can be comprised of commercial ceramic supports such as silica (SiO.sub.2), alumina (Al.sub.2O.sub.3), zeolites and clays. The support material may also comprise of oxides of various metals such as iron, manganese, and calcium. The non-carbon sorbents of the invention can be easily injected into the flue gas and recovered in the Particulate Control Device (PCD) along with the fly ash without altering the properties of the by-product fly ash enabling its use as a cement additive. Sorbent materials of this invention effectively remove both elemental and oxidized forms of mercury from flue gases and can be used at elevated temperatures. The sorbent combines an oxidation catalyst and a sorbent in the same particle to both oxidize the mercury and then immobilize it.

  18. Two new sources of reactive gaseous mercury in the free troposphere

    OpenAIRE

    H. Timonen; J. L. Ambrose; D. A. Jaffe

    2012-01-01

    Mercury (Hg) is a neurotoxin that bioaccumulates in the food chain. Mercury is emitted to the atmosphere primarily in its elemental form, which has a long lifetime allowing global transport. It is known that atmospheric oxidation of gaseous elemental mercury (GEM) generates reactive gaseous mercury (RGM) which plays an important role in the atmospheric mercury cycle by enhancing the rate of mercury deposition to ecosystems. However, the primary GEM oxidants, and the sources and chemical ...

  19. Mercury and selenium levels, and selenium:mercury molar ratios of brain, muscle and other tissues in bluefish (Pomatomus saltatrix) from New Jersey, USA

    Science.gov (United States)

    Burger, Joanna; Jeitner, Christian; Donio, Mark; Pittfield, Taryn; Gochfeld, Michael

    2015-01-01

    A number of contaminants affect fish health, including mercury and selenium, and the selenium: mercury molar ratio. Recently the protective effects of selenium on methylmercury toxicity have been publicized, particularly for consumption of saltwater fish. Yet the relative ameliorating effects of selenium on toxicity within fish have not been examined, nor has the molar ratio in different tissues, (i.e. brain). We examined mercury and selenium levels in brain, kidney, liver, red and white muscle, and skin and scales in bluefish (Pomatomus saltatrix) from New Jersey to determine whether there were toxic levels of either metal, and we computed the selenium: mercury molar ratios by tissues. Total mercury averaged 0.32 ± 0.02 ppm wet weight in edible muscle and 0.09 ± 0.01 ppm in brain. Selenium concentration averaged 0.37 ± 0.03 in muscle and 0.36 ± 0.03 ppm in brain. There were significant differences in levels of mercury, selenium, and selenium: mercury molar ratios, among tissues. Mercury and selenium levels were correlated in kidney and skin/scales. Mercury levels were highest in kidney, intermediate in muscle and liver, and lowest in brain and skin/scales; selenium levels were also highest in kidney, intermediate in liver, and were an order of magnitude lower in the white muscle and brain. Mercury levels in muscle, kidney and skin/scales were positively correlated with fish size (length). Selenium levels in muscle, kidney and liver were positively correlated with fish length, but in brain; selenium levels were negatively correlated with fish length. The selenium: mercury molar ratio was negatively correlated with fish length for white muscle, liver, kidney, and brain, particularly for fish over 50 cm in length, suggesting that older fish experience less protective advantages of selenium against mercury toxicity than smaller fish, and that consumers of bluefish similarly receive less advantage from eating larger fish. PMID:23202378

  20. Impact of marine mercury cycling on coastal atmospheric mercury concentrations in the North- and Baltic Sea region

    Directory of Open Access Journals (Sweden)

    Johannes Bieser

    2016-06-01

    Full Text Available Abstract The cycling of mercury between ocean and atmosphere is an important part of the global Hg cycle. Here we study the regional contribution of the air-sea exchange in the North- and Baltic Sea region. We use a newly developed coupled regional chemistry transport modeling (CTM system to determine the flux between atmosphere and ocean based on the meteorological model COSMO-CLM, the ocean-ecosystem model ECOSMO, the atmospheric CTM CMAQ and a newly developed module for mercury partitioning and speciation in the ocean (MECOSMO. The model was evaluated using atmospheric observations of gaseous elemental mercury (GEM, surface concentrations of dissolved gaseous mercury (DGM, and air-sea flux (ASF calculations based on observations made on seven cruises in the western and central Baltic Sea and three cruises in the North Sea performed between 1991 and 2006. It was shown that the model is in good agreement with observations: DGM (Normalized Mean Bias NMB=-0.27 N=413, ASF (NMB=-0.32, N=413, GEM (NMB=0.07, N=2359. Generally, the model was able to reproduce the seasonal DGM cycle with the best agreement during winter and autumn (NMBWinter=-0.26, NMBSpring=-0.41, NMBSummer=-0.29, NMBAutumn=-0.03. The modelled mercury evasion from the Baltic Sea ranged from 3400 to 4000 kg/a for the simulation period 1994–2007 which is on the lower end of previous estimates. Modelled atmospheric deposition, river inflow and air-sea exchange lead to an annual net Hg accumulation in the Baltic Sea of 500 to 1000 kg/a. For the North Sea the model calculates an annual mercury flux into the atmosphere between 5700 and 6000 kg/a. The mercury flux from the ocean influenced coastal atmospheric mercury concentrations. Running CMAQ coupled with the ocean model lead to better agreement with GEM observations. Directly at the coast GEM concentrations could be increased by up to 10% on annual average and observed peaks could be reproduced much better. At stations 100km downwind

  1. Crater Morphometry and Crater Degradation on Mercury: Mercury Laser Altimeter (MLA) Measurements and Comparison to Stereo-DTM Derived Results

    Science.gov (United States)

    Leight, C.; Fassett, C. I.; Crowley, M. C.; Dyar, M. D.

    2017-01-01

    Two types of measurements of Mercury's surface topography were obtained by the MESSENGER (MErcury Surface Space ENvironment, GEochemisty and Ranging) spacecraft: laser ranging data from Mercury Laser Altimeter (MLA) [1], and stereo imagery from the Mercury Dual Imaging System (MDIS) camera [e.g., 2, 3]. MLA data provide precise and accurate elevation meaurements, but with sparse spatial sampling except at the highest northern latitudes. Digital terrain models (DTMs) from MDIS have superior resolution but with less vertical accuracy, limited approximately to the pixel resolution of the original images (in the case of [3], 15-75 m). Last year [4], we reported topographic measurements of craters in the D=2.5 to 5 km diameter range from stereo images and suggested that craters on Mercury degrade more quickly than on the Moon (by a factor of up to approximately 10×). However, we listed several alternative explanations for this finding, including the hypothesis that the lower depth/diameter ratios we observe might be a result of the resolution and accuracy of the stereo DTMs. Thus, additional measurements were undertaken using MLA data to examine the morphometry of craters in this diameter range and assess whether the faster crater degradation rates proposed to occur on Mercury is robust.

  2. Mercury-free discharges for lighting - editorial

    NARCIS (Netherlands)

    Haverlag, M.

    2007-01-01

    This special Cluster of articles in Journal of Physics D: Applied Physics covers the subject of mercury-free discharges that are being investigated by different light source researchers, as an alternative to existing mercury-containing lamps. The main driving force to move away from

  3. Mercury Pollution Near A Chlor-Alkali Plant In Northern Kazakhstan

    Science.gov (United States)

    In northern Kazakhstan, there is a serious case of mercury pollution near Pavlodar City from an old mercury cell chlor-alkali plant. The soil, sediment, and water is contaminated with more than a thousand tons of mercury and mercury compounds as a result of the operation of the ...

  4. Magnetosphere, exosphere, and surface of Mercury

    International Nuclear Information System (INIS)

    Cheng, A.F.; Krimigis, S.M.; Johnson, R.E.; Lanzerotti, L.J.

    1987-01-01

    It is presently suggested in light of the atomic Na exosphere discovered for Mercury that this planet, like the Jupiter moon Io, is capable of maintaining a heavy ion magnetosphere. Na(+) ions from the exosphere are in this scenario accelerated to keV energies en route to making substantial contributions to the mass and energy budgets of the magnetosphere. Since Mercury's Na supply to the exosphere is primarily internal, it would appear that Mercury is losing its semivolatiles and that this process will proceed by way of photosputtering, which maintains an adequate Na-ejection rate from the planet's surface. 39 references

  5. A self-focusing mercury jet target

    CERN Document Server

    Johnson, C

    2002-01-01

    Mercury jet production targets have been studied in relation to antiproton production and, more recently, pion production for a neutrino factory. There has always been a temptation to include some self-focusing of the secondaries by passing a current through the mercury jet analogous to the already proven lithium lens. However, skin heating of the mercury causes fast vaporization leading to the development of a gliding discharge along the surface of the jet. This external discharge can, nevertheless, provide some useful focusing of the secondaries in the case of the neutrino factory. The technical complications must not be underestimated.

  6. Overview of Mercury Magnetospheric Orbiter (MMO) for BepiColombo

    Science.gov (United States)

    Murakami, G.; Hayakawa, H.; Fujimoto, M.; BepiColombo Project Team

    2018-05-01

    The next Mercury exploration mission BepiColombo will be launched in October 2018 and will arrive at Mercury in December 2025. We present the current status, science goals, and observation plans of JAXA's Mercury Magnetospheric Orbiter (MMO).

  7. Monitoring of mercury concentration in atmosphere in Usti nad Labem

    International Nuclear Information System (INIS)

    Synek, V.; Baloch, T.; Otcenasek, J.; Kremlova, S.; Subrt, P.

    2007-01-01

    This study elaborates the observation of mercury pollution of the atmosphere in the city of Usti nad Labem. The biggest source of the polluting mercury in Usti nad Labem is the chlor-alkali production in the factory of Spolchemie Inc. The method of mercury determination applied is based on capturing the mercury contented in a volume of the air on an amalgamator and measuring the mercury by an atomic absorption spectrometer (Perkin -Elmer 4100ZL) equipped with a special adapter after a thermal release of the mercury from the amalgamator. The basic characteristics of this method were evaluated; e.g. the limit of detection and limit of determination are, respectively, 0.43 and 1.4 ng/m 3 , the relative expanded uncertainty is 28 %. The work gives results of long-term (1998-2006) observations in a few localities in Usti nad Labem situated in various distances from the mercury source (e.g. means of 28.6 and 14.1 ng/m3 were obtained, respectively, in places 350 and 700 m far from the electrolysis plant) and also in a different city (Duchcov). The cases with a higher mercury concentration are very frequent so the sets of the obtained results have lognormal distributions. This study statistically compares the total level and variability of the mercury concentrations in the time series. It also investigates their trends, correlations between them and meteorological influences upon the levels of mercury concentration in the air. The effect of the mercury emission from the chlor-alkali plant is dominant. It as the only factor determines when the cases with a high mercury concentration in the atmosphere occur. (author)

  8. Mercury distribution characteristics in primary manganese smelting plants.

    Science.gov (United States)

    Back, Seung-Ki; Sung, Jin-Ho; Moon, Young-Hoon; Kim, Young-Hee; Seok, Kwang-Seol; Song, Geum-Ju; Seo, Yong-Chil

    2017-08-01

    The mercury (Hg) distribution characteristics were investigated in three primary manganese smelting plants in Korea for the assessment of anthropogenic Hg released. Input and output materials were sampled from each process, and Hg concentrations in the samples were analyzed. Among the input materials, the most mercury was found in the manganese ore (83.1-99.7%) and mercury was mainly released through fly ash or off gas, depending on the condition of off gas cleaning system. As off gas temperature decreases, proportion and concentration of emitted gaseous elemental mercury (Hg 0 ) in off gas decreases. Based on mass balance study from these three plants and national manganese production data, the total amount of mercury released from those Korean plants was estimated to 644 kg/yr. About half of it was emitted into the air while the rest was released to waste as fly ash. With the results of this investigation, national inventory for Hg emission and release could be updated for the response to Minamata Convention on Mercury. Copyright © 2017. Published by Elsevier Ltd.

  9. Influence of mercury ore roasting sites from 16th and 17th century on the mercury dispersion in surroundings of Idrija

    Directory of Open Access Journals (Sweden)

    Mateja Gosar

    2006-06-01

    Full Text Available In the first decade of mercury mining in Idrija the ore was roasted in piles. After that the ore was roasted for 150 years, until 1652, in earthen vessels at various sites in the woods around Idrija. Up to present 21 localities of ancient roasting sites were established.From the roasting areas Frbej‘ene trate, lying on a wide dolomitic terrace on the left side of the road from Idrija to ^ekovnik, 3 soil profiles are discussed. In all three profiles in the upper, organic matter rich soil horizon very high mercury contents (from 3 to 4,000mg/kg were found. In two profiles the contents rapidly decrease with depth, to about 10- times lower values already at 0.5 m. Below that, the mercury contents decrease slowly, to reach at the 1.3 m depth a few mg/kg metal. In the third profile the upper humic layer is followed downward by an additional humic layer containing very abundant pottery fragments. In this layer the maximum mercury contents were determined, 7.474 mg/kg Hg. The underlying loamy soil contains between 1000 and 2000 mg/kg mercury. Pšenk is one of the larger localities of roasting vessels fragments. It is located at Lačna voda brook below Hlev{e, above its confluence with the Padar ravine. The most abundant pottery remains are found in the upper western margin of the area, just below the way to Hleviše. The considered geochemical profile P{enk contains at the top a 45 cm thick humic layer with 4,000 to 5,000 mg/kg mercury. Deeper the contents fall to around 100 mg/kg mercury. The alculations result in an estimated amount of 1.4 t mercury still present at the P{enk locality, and in about 40 t of mercury on all roasting sites described up to present.The determined mercury contents in soils at old roasting sites are very high, and they surpass all hitherto described localities at Idrija and in the surroundings.

  10. Real-time analysis of total, elemental, and total speciated mercury

    International Nuclear Information System (INIS)

    Schlager, R.J.; Wilson, K.G.; Sappey, A.D.

    1995-01-01

    ADA Technologies, Inc., is developing a continuous emissions monitoring system that measures the concentrations of mercury in flue gas. Mercury is emitted as an air pollutant from a number of industrial processes. The largest contributors of these emissions are coal and oil combustion, municipal waste combustion, medical waste combustion, and the thermal treatment of hazardous materials. It is difficult, time consuming, and expensive to measure mercury emissions using current testing methods. Part of the difficulty lies in the fact that mercury is emitted from sources in several different forms, such as elemental mercury and mercuric chloride. The ADA analyzer measures these emissions in real time, thus providing a number of advantages over existing test methods: (1) it will provide a real-time measure of emission rates, (2) it will assure facility operators, regulators, and the public that emissions control systems are working at peak efficiency, and (3) it will provide information as to the nature of the emitted mercury (elemental mercury or speciated compounds). This update presents an overview of the CEM and describes features of key components of the monitoring system--the mercury detector, a mercury species converter, and the analyzer calibration system

  11. [Evaluation of the mercury accumulating capacity of pepper (Capsicum annuum)].

    Science.gov (United States)

    Pérez-Vargas, Híver M; Vidal-Durango, Jhon V; Marrugo-Negrete, José L

    2014-01-01

    To assess the mercury accumulating capacity in contaminated soils from the community of Mina Santa Cruz, in the south of the department of Bolívar, Colombia, of the pepper plant (Capsicum annuum), in order to establish the risk to the health of the consuming population. Samples were taken from tissues (roots, stems, and leaves) of pepper plants grown in two soils contaminated with mercury and a control soil during the first five months of growth to determine total mercury through cold vapor atomic absorption spectrometry. Total mercury was determined in the samples of pepper plant fruits consumed in Mina Santa Cruz. The mean concentrations of total mercury in the roots were higher than in stems and leaves. Accumulation in tissues was influenced by mercury levels in soil and the growth time of the plants. Mercury concentrations in fruits of pepper plant were lower than tolerable weekly intake provided by WHO. Percent of translocation of mercury to aerial parts of the plant were low in both control and contaminated soils. Despite low levels of mercury in this food, it is necessary to minimize the consumption of food contaminated with this metal.

  12. Real-time analysis of total, elemental, and total speciated mercury

    Energy Technology Data Exchange (ETDEWEB)

    Schlager, R.J.; Wilson, K.G.; Sappey, A.D. [ADA Technologies, Inc., Englewood, CO (United States)

    1995-11-01

    ADA Technologies, Inc., is developing a continuous emissions monitoring system that measures the concentrations of mercury in flue gas. Mercury is emitted as an air pollutant from a number of industrial processes. The largest contributors of these emissions are coal and oil combustion, municipal waste combustion, medical waste combustion, and the thermal treatment of hazardous materials. It is difficult, time consuming, and expensive to measure mercury emissions using current testing methods. Part of the difficulty lies in the fact that mercury is emitted from sources in several different forms, such as elemental mercury and mercuric chloride. The ADA analyzer measures these emissions in real time, thus providing a number of advantages over existing test methods: (1) it will provide a real-time measure of emission rates, (2) it will assure facility operators, regulators, and the public that emissions control systems are working at peak efficiency, and (3) it will provide information as to the nature of the emitted mercury (elemental mercury or speciated compounds). This update presents an overview of the CEM and describes features of key components of the monitoring system--the mercury detector, a mercury species converter, and the analyzer calibration system.

  13. Mercury Contamination of Skin-whitening Creams in Phnom Penh, Cambodia

    Directory of Open Access Journals (Sweden)

    Thomas Murphy

    2015-01-01

    Conclusion. Some producers of skin-whitening creams in Thailand, China and Taiwan appear to be aware of the risks of mercury contamination and have modified their products. However, other producers of skin-whitening creams continue to use mercury. XRF analysis allows for rapid screening of mercury in cosmetics and should be used to gather additional information on mercury content in cosmetics in support of public health efforts to stem the import, export and sales of skin creams containing mercury.

  14. Water displacement mercury pump

    Science.gov (United States)

    Nielsen, M.G.

    1984-04-20

    A water displacement mercury pump has a fluid inlet conduit and diffuser, a valve, a pressure cannister, and a fluid outlet conduit. The valve has a valve head which seats in an opening in the cannister. The entire assembly is readily insertable into a process vessel which produces mercury as a product. As the mercury settles, it flows into the opening in the cannister displacing lighter material. When the valve is in a closed position, the pressure cannister is sealed except for the fluid inlet conduit and the fluid outlet conduit. Introduction of a lighter fluid into the cannister will act to displace a heavier fluid from the cannister via the fluid outlet conduit. The entire pump assembly penetrates only a top wall of the process vessel, and not the sides or the bottom wall of the process vessel. This insures a leak-proof environment and is especially suitable for processing of hazardous materials.

  15. Mercury's Densely Cratered Surface

    Science.gov (United States)

    1974-01-01

    Mariner 10 took this picture (FDS 27465) of the densely cratered surface of Mercury when the spacecraft was 18,200 kilometers (8085 miles) from the planet on March 29. The dark line across top of picture is a 'dropout' of a few TV lines of data. At lower left, a portion of a 61 kilometer (38 mile) crater shows a flow front extending across the crater floor and filling more than half of the crater. The smaller, fresh crater at center is about 25 kilometers (15 miles) in diameter. Craters as small as one kilometer (about one-half mile) across are visible in the picture.The Mariner 10 mission, managed by the Jet Propulsion Laboratory for NASA's Office of Space Science, explored Venus in February 1974 on the way to three encounters with Mercury-in March and September 1974 and in March 1975. The spacecraft took more than 7,000 photos of Mercury, Venus, the Earth and the Moon.Image Credit: NASA/JPL/Northwestern University

  16. Selenium's importance in regulatory issues regarding mercury

    Energy Technology Data Exchange (ETDEWEB)

    Raymond, Laura J.; Ralston, Nicholas V.C. [University of North Dakota Energy and Environmental Research Center, 15 North 23rd Street, Stop 9018, Grand Forks, ND 58202-9018 (United States)

    2009-11-15

    Current seafood safety and health risk assessment criteria use mercury concentrations as their sole basis. This unfortunate limitation omits consideration of selenium, an essential trace element that appears to be the primary molecular target of mercury toxicity. Although selenium has been recognized for decades as a means of counteracting mercury toxicity, its effects have often been overlooked or misunderstood. Experimental animal studies have demonstrated that increasing concentrations of selenium throughout the normal dietary range increasingly counteracts methylmercury toxicity. Dietary concentrations of selenium that are slightly less than the average amount present in ocean fish have been shown to completely prevent the onset of toxic symptoms of mercury toxicity, while animals fed lesser amounts of selenium rapidly sickened and died. Dietary selenium from a variety of sources including ocean fish such as tuna, swordfish, menhaden, and rockfish has been shown to counteract mercury toxicity. Since ocean fish are among the richest sources of dietary selenium, it is important to include selenium concentration measurements in future mercury risk assessments and seafood safety criteria. Mercury:selenium molar ratios in blood provide far more consistent and physiologically meaningful risk assessments. Comprehensive seafood safety criteria such as the Selenium Health Benefit Value enable clear differentiation between seafoods that are safe and those that are hazardous for human consumption. Use of parameters that integrate mercury-selenium relationships also make it easy to understand the differences between the findings of maternal mercury exposure studies that have been performed in New Zealand, the Faroes, the Seychelles, and the United Kingdom. Development of criteria for evaluating mercury-selenium interactions will enhance environmental protection and improve public safety. (author)

  17. ECHMERIT: A new on-line global mercury-chemistry model

    Science.gov (United States)

    Jung, G.; Hedgecock, I. M.; Pirrone, N.

    2009-04-01

    Mercury is a volatile metal, that is of concern because when deposited and transformed to methylmercury accumulates within the food-web. Due to the long lifetime of elemental mercury, which is the dominant fraction of mercury species in the atmosphere, mercury is prone to long-range transport and therefore distributed over the globe, transported and hence deposited even in regions far from anthropogenic emission sources. Mercury is released to the atmosphere from a variety of natural and anthropogenic sources, in elementary and oxidised forms, and as particulate mercury. It is then transported, but also transformed chemically in the gaseous phase, as well as in aqueous phase within cloud and rain droplets. Mercury (particularly its oxidised forms) is removed from the atmosphere though wet and dry deposition processes, a large fraction of deposited mercury is, after chemical or biological reduction, re-emitted to the atmosphere as elementary mercury. To investigate mercury chemistry and transport processes on the global scale, the new, global model ECHMERIT has been developed. ECHMERIT simulates meteorology, transport, deposition, photolysis and chemistry on-line. The general circulation model on which ECHMERIT is based is ECHAM5. Sophisticated chemical modules have been implemented, including gas phase chemistry based on the CBM-Z chemistry mechanism, as well as aqueous phase chemistry, both of which have been adapted to include Hg chemistry and Hg species gas-droplet mass transfer. ECHMERIT uses the fast-J photolysis routine. State-of-the-art procedures simulating wet and dry deposition and emissions were adapted and included in the model as well. An overview of the model structure, development, validation and sensitivity studies is presented.

  18. Mercury emissions from South Africa’s coal-fired power stations

    Directory of Open Access Journals (Sweden)

    Belinda L. Garnham

    2016-12-01

    Full Text Available Mercury is a persistent and toxic substance that can be bio-accumulated in the food chain. Natural and anthropogenic sources contribute to the mercury emitted in the atmosphere. Eskom’s coal-fired power stations in South Africa contributed just under 93% of the total electricity produced in 2015 (Eskom 2016. Trace amounts of mercury can be found in coal, mostly combined with sulphur, and can be released into the atmosphere upon combustion. Coal-fired electricity generation plants are the highest contributors to mercury emissions in South Africa. A major factor affecting the amount of mercury emitted into the atmosphere is the type and efficiency of emission abatement equipment at a power station. Eskom employs particulate emission control technology at all its coal-fired power stations, and new power stations will also have sulphur dioxide abatement technology. A co-beneficial reduction of mercury emissions exists as a result of emission control technology. The amount of mercury emitted from each of Eskom’s coal-fired power stations is calculated, based on the amount of coal burnt and the mercury content in the coal. Emission Reduction Factors (ERF’s from two sources are taken into consideration to reflect the co-benefit received from the emission control technologies at the stations. Between 17 and 23 tons of mercury is calculated to have been emitted from Eskom’s coal-fired power stations in 2015. On completion of Eskom’s emission reduction plan, which includes fabric filter plant retrofits at two and a half stations and a flue gas desulphurisation retrofit at one power station, total mercury emissions from the fleet will potentially be reduced by 6-13% by 2026 relative to the baseline. Mercury emission reduction is perhaps currently not the most pressing air quality problem in South Africa. While the focus should then be on reducing emissions of other pollutants which have a greater impact on human health, mercury emission reduction

  19. Modeling dynamic exchange of gaseous elemental mercury at polar sunrise.

    Science.gov (United States)

    Dastoor, Ashu P; Davignon, Didier; Theys, Nicolas; Van Roozendael, Michel; Steffen, Alexandra; Ariya, Parisa A

    2008-07-15

    At polar sunrise, gaseous elemental mercury (GEM) undergoes an exceptional dynamic exchange in the air and at the snow surface during which GEM can be rapidly removed from the atmosphere (the so-called atmospheric mercury depletion events (AMDEs)) as well as re-emitted from the snow within a few hours to days in the Polar Regions. Although high concentrations of total mercury in snow following AMDEs is well documented, there is very little data available on the redox transformation processes of mercury in the snow and the fluxes of mercury at the air/snow interface. Therefore, the net gain of mercury in the Polar Regions as a result of AMDEs is still an open question. We developed a new version of the global mercury model, GRAHM, which includes for the first time bidirectional surface exchange of GEM in Polar Regions in spring and summer by developing schemes for mercury halogen oxidation, deposition, and re-emission. Also for the first time, GOME satellite data-derived boundary layer concentrations of BrO have been used in a global mercury model for representation of halogen mercury chemistry. Comparison of model simulated and measured atmospheric concentrations of GEM at Alert, Canada, for 3 years (2002-2004) shows the model's capability in simulating the rapid cycling of mercury during and after AMDEs. Brooks et al. (1) measured mercury deposition, reemission, and net surface gain fluxes of mercury at Barrow, AK, during an intensive measurement campaign for a 2 week period in spring (March 25 to April 7, 2003). They reported 1.7, 1.0 +/- 0.2, and 0.7 +/- 0.2 microg m(-2) deposition, re-emission, and net surface gain, respectively. Using the optimal configuration of the model, we estimated 1.8 microg m(-2) deposition, 1.0 microg m(-2) re-emission, and 0.8 microg m(-2) net surface gain of mercury for the same time period at Barrow. The estimated net annual accumulation of mercury within the Arctic Circle north of 66.5 degrees is approximately 174 t with +/-7 t of

  20. Mercury emission and speciation of coal-fired power plants in China

    Directory of Open Access Journals (Sweden)

    S. X. Wang

    2010-02-01

    Full Text Available Comprehensive field measurements are needed to understand the mercury emissions from Chinese power plants and to improve the accuracy of emission inventories. Characterization of mercury emissions and their behavior were measured in six typical coal-fired power plants in China. During the tests, the flue gas was sampled simultaneously at inlet and outlet of Selective Catalytic Reduction (SCR, electrostatic precipitators (ESP, and flue gas desulfurization (FGD using the Ontario Hydro Method (OHM. The pulverized coal, bottom ash, fly ash and gypsum were also sampled in the field. Mercury concentrations in coal burned in the measured power plants ranged from 17 to 385 μg/kg. The mercury mass balances for the six power plants varied from 87 to 116% of the input coal mercury for the whole system. The total mercury concentrations in the flue gas from boilers were at the range of 1.92–27.15 μg/m3, which were significantly related to the mercury contents in burned coal. The mercury speciation in flue gas right after the boiler is influenced by the contents of halogen, mercury, and ash in the burned coal. The average mercury removal efficiencies of ESP, ESP plus wet FGD, and ESP plus dry FGD-FF systems were 24%, 73% and 66%, respectively, which were similar to the average removal efficiencies of pollution control device systems in other countries such as US, Japan and South Korea. The SCR system oxidized 16% elemental mercury and reduced about 32% of total mercury. Elemental mercury, accounting for 66–94% of total mercury, was the dominant species emitted to the atmosphere. The mercury emission factor was also calculated for each power plant.

  1. Accumulation of mercury in Typha domingensis under field conditions.

    Science.gov (United States)

    Lominchar, M A; Sierra, M J; Millán, R

    2015-01-01

    Typha species is a common wetland plant used in the treatment of urban and industrial effluents. But, despite their widespread implementation, there are not many studies based on the behaviour of this plant growing in an areas affected by mercury. The present work investigates the ability of Typha domingensis to accumulate mercury under field conditions. The study area was along the Valdeazogues river which flows through the Almadén mining district (Ciudad Real, Spain) that is considered the largest mercury reservoir in the world. The mercury concentration in different plant fractions was measured as well as the available and total concentration in the bottom sediments. The results showed that the highest mercury concentrations were found in the belowground organs. T. domingensis had a high efficiency to accumulate mercury in their organs although available metal concentrations in the environment did not exceed 0.16 mg kg(-1). Bioaccumulation factors (BAF) ranged between 121 and 3168 in roots. Furthermore, significant correlations were found between mercury concentration in all plant organs and Hg in sediments (both total and available). These results demonstrated that T. domingensis could be used as a biomonitor as well as in phytoextraction technology in areas affected by mercury. Copyright © 2014 Elsevier Ltd. All rights reserved.

  2. DMPS (DIMAVAL) as a challenge test to assess the mercury and arsenic body/kidney load in humans and as a treatment of mercury toxicity

    Energy Technology Data Exchange (ETDEWEB)

    Aposhian, H.V.; Maiorino, R.M.; Aposhian, M.M. [Univ. of Arizona, Tucson, AZ (United States); Hurlbut, K.M. [Rocky Mountain Poison Control Center, Denver, CO (United States)] [and others

    1996-12-31

    Mercury is an element which, with its compounds, is hazardous and is found in hazardous wastes. In Order to develop suitable diagnostic and therapeutic agents for mercury exposure, we have sought alternative test systems. We have used the chelating agent 2,3-dimercaptopropane-1-sulfonate (DMPS, DIMAVAL{reg_sign}) for estimating the body burden of mercury in normal humans and in dental personnel in a developing country, and for detoxifying humans with mercurous chloride exposure. Use of the DMPS-mercury challenge test has shown that two-thirds of the mercury excreted in the urine of volunteers with dental amalgams appears to be derived from the mercury vapor released from their amalgams. The DMPS challenge test (300 mg, by mouth, after an 11 hr fast) was useful for monitoring dental personnel for mercury vapor exposure. The DMPS challenge test was given to 11 factory workers who make a skin lotion that contains mercurous chloride, 8 users of the skin lotion, and 9 controls. The increases in urinary Hg resulting from the DMPS challenge were 45, 87, and 38-fold, respectively. The results demonstrate that in humans exposed to mercurous chloride, the DMPS-mercury challenge test is of value for a more realistic estimation of mobilizable Hg. DMPS should be considered for use to determine mercury body burdens and to treat humans exposed to mercury and its compounds via exposure to hazardous wastes. 42 refs., 2 figs., 5 tabs.

  3. Heterogeneous oxidation of mercury in simulated post combustion conditions

    Energy Technology Data Exchange (ETDEWEB)

    Glenn A. Norton; Hongqun Yang; Robert C. Brown; Dennis L. Laudal; Grant E. Dunham; John Erjavec [Iowa State University, Ames, IA (United States). Center for Sustainable Environmental Technologies

    2003-01-01

    Heterogeneous mercury oxidation was studied by exposing whole fly ash samples and magnetic, nonmagnetic, and size-classified fly ash fractions to elemental mercury vapor in simulated flue gas streams. Fly ash from sub-bituminous Wyodak-Anderson PRB coal and bituminous Blacksville coal were used. Scanning electron microscopy, X-ray diffraction, thermogravimetric analyses, and BET N{sub 2} isothermal sorption analyses were performed to characterize the fly ash samples. Mercury speciation downstream from the ash was determined using the Ontario Hydro method. Results showed that the presence of fly ash was critical for mercury oxidation, and the surface area of the ash appears to be an important parameter. However, for a given fly ash, there were generally no major differences in catalytic oxidation potential between different fly ash fractions. This includes fractions enriched in unburned carbon and iron oxides. The presence of NO{sub 2}, HCl, and SO{sub 2} resulted in greater levels of mercury oxidation, while NO inhibited mercury oxidation. The gas matrix affected mercury oxidation more than the fly ash composition. 21 refs., 10 figs., 2 tabs.

  4. Sulfur polymer cement stabilization of elemental mercury mixed waste

    International Nuclear Information System (INIS)

    Melamed, D.; Fuhrmann, M.; Kalb, P.; Patel, B.

    1998-04-01

    Elemental mercury, contaminated with radionuclides, is a problem throughout the Department of Energy (DOE) complex. This report describes the development and testing of a process to immobilize elemental mercury, contaminated with radionuclides, in a form that is non-dispersible, will meet EPA leaching criteria, and has low mercury vapor pressure. In this stabilization and solidification process (patent pending) elemental mercury is mixed with an excess of powdered sulfur polymer cement (SPC) and additives in a vessel and heated to ∼35 C, for several hours, until all of the mercury is converted into mercuric sulfide (HgS). Additional SPC is then added and the mixture raised to 135 C, resulting in a homogeneous molten liquid which is poured into a suitable mold where is cools and solidifies. The final stabilized and solidified waste forms were characterized by powder X-ray diffraction, as well as tested for leaching behavior and mercury vapor pressure. During this study the authors have processed the entire inventory of mixed mercury waste stored at Brookhaven National Laboratory (BNL)

  5. Method for high temperature mercury capture from gas streams

    Science.gov (United States)

    Granite, Evan J [Wexford, PA; Pennline, Henry W [Bethel Park, PA

    2006-04-25

    A process to facilitate mercury extraction from high temperature flue/fuel gas via the use of metal sorbents which capture mercury at ambient and high temperatures. The spent sorbents can be regenerated after exposure to mercury. The metal sorbents can be used as pure metals (or combinations of metals) or dispersed on an inert support to increase surface area per gram of metal sorbent. Iridium and ruthenium are effective for mercury removal from flue and smelter gases. Palladium and platinum are effective for mercury removal from fuel gas (syngas). An iridium-platinum alloy is suitable for metal capture in many industrial effluent gas streams including highly corrosive gas streams.

  6. Surface composition of Mercury from reflectance spectrophotometry

    Science.gov (United States)

    Vilas, Faith

    1988-01-01

    The controversies surrounding the existing spectra of Mercury are discussed together with the various implications for interpretations of Mercury's surface composition. Special attention is given to the basic procedure used for reducing reflectance spectrophotometry data, the factors that must be accounted for in the reduction of these data, and the methodology for defining the portion of the surface contributing the greatest amount of light to an individual spectrum. The application of these methodologies to Mercury's spectra is presented.

  7. Process for removing mercury from aqueous solutions

    Science.gov (United States)

    Googin, John M.; Napier, John M.; Makarewicz, Mark A.; Meredith, Paul F.

    1986-01-01

    A process for removing mercury from water to a level not greater than two parts per billion wherein an anion exchange material that is insoluble in water is contacted first with a sulfide containing compound and second with a compound containing a bivalent metal ion forming an insoluble metal sulfide. To this treated exchange material is contacted water containing mercury. The water containing not more than two parts per billion of mercury is separated from the exchange material.

  8. Mercury risk from fluorescent lamps in China: current status and future perspective.

    Science.gov (United States)

    Hu, Yuanan; Cheng, Hefa

    2012-09-01

    Energy-efficient lighting is one of the key measures for addressing electric power shortages and climate change mitigation, and fluorescent lamps are expected to dominate the lighting market in China over the next several years. This review presents an overview on the emissions and risk of mercury from fluorescent lamps during production and disposal, and discusses measures for reducing the mercury risk through solid waste management and source reduction. Fluorescent lamps produced in China used to contain relatively large amounts of mercury (up to 40 mg per lamp) due to the prevalence of liquid mercury dosing, which also released significant amounts of mercury to the environment. Upgrade of the mercury dosing technologies and manufacturing facilities had significantly reduced the mercury contents in fluorescent lamps, with most of them containing less than 10 or 5mg per lamp now. Occupational hygiene studies showed that mercury emissions occurred during fluorescent lamp production, particularly in the facilities using liquid mercury dosing, which polluted the environmental media at and surrounding the production sites and posed chronic health risk to the workers by causing neuropsychological and motor impairments. It is estimated that spent fluorescent lamps account for approximately 20% of mercury input in the MSW in China. Even though recycling of fluorescent lamps presents an important opportunity to capture the mercury they contain, it is difficult and not cost-effective at reducing the mercury risk under the broader context of mercury pollution control in China. In light of the significant mercury emissions associated with electricity generation in China, we propose that reduction of mercury emissions and risk associated with fluorescent lamps should be achieved primarily through lowering their mercury contents by the manufacturers while recycling programs should focus on elemental mercury-containing waste products instead of fluorescent lamps to recapture

  9. Messenger Observations of Mercury's Bow Shock and Magnetopause

    Science.gov (United States)

    Slavin J. A.; Acuna, M. H.; Anderson, B. J.; Benna, M.; Gloeckler, G.; Krimigis, S. M.; Raines, M.; Schriver, D.; Travnicek, P.; Zurbuchen, T. H.

    2008-01-01

    The MESSENGER spacecraft made the first of three flybys of Mercury on January 14.2008 (1). New observations of solar wind interaction with Mercury were made with MESSENGER'S Magnetometer (MAG) (2.3) and Energetic Particle and Plasma Spectrometer (EPPS) - composed of the Energetic Particle Spectrometer (EPS) and Fast Imaging Plasma Spectrometer (FIPS) (3,4). These MESSENGER observations show that Mercury's magnetosphere has a large-scale structure that is distinctly Earth-like, but it is immersed in a comet-like cloud of planetary ions [5]. Fig. 1 provides a schematic view of the coupled solar wind - magnetosphere - neutral atmosphere - solid planet system at Mercury.

  10. PSYCHROPHILIC PSEUDOMONAS SP. RESISTANT TO MERCURY FROM PAVLODAR, KAZAKHSTAN

    Science.gov (United States)

    As mercury circulates and deposits globally, the remediation of extensive mercury contamination surrounding a chloralkali plant in Pavlodar, Kazakhstan is critical. High-levels of mercury contamination exist within the confines of the plant, at nearby off-site waste storage and e...

  11. Mercury Hazard Assessment for Piscivorous Wildlife in Glacier National Park

    KAUST Repository

    Stafford, Craig P.

    2016-12-14

    We examined the mercury hazard posed to selected piscivorous wildlife in Glacier National Park (GNP), Montana. Logging Lake was our focal site where we estimated the dietary mercury concentrations of wildlife (common loon [Gavia immer], American mink [Neovison vison], river otter [Lontra canadensis], and belted kingfisher [Megaceryle alcyon]) by assuming that fishes were consumed in proportion to their relative abundances. To evaluate if Logging Lake provided a suitable baseline for our study, we made geographic comparisons of fish mercury levels and investigated the distribution and abundance of high mercury fishes within GNP. We complimented our assessment by examining selenium:mercury molar ratios in fishes from Logging Lake and Saint Mary Lake. Our results suggest fish consumption does not imperil wildlife from Logging Lake based on published thresholds for adverse mercury effects, but some hazard may exist particularly if there is strong feeding selectivity for the most contaminated species, northern pikeminnow (Ptychocheilus oregonensis). The geographic comparisons of fish mercury levels, together with the distribution and abundance of high mercury fishes within GNP, suggest that Logging Lake provided a relatively protective baseline among our study lakes. Risk may be further reduced by the molar excess of selenium relative to mercury, particularly in the smaller fishes typically consumed by GNP wildlife. Our findings contrast with studies from northeastern US and southeastern Canada where greater mercury hazard to wildlife exists. An emergent finding from our research is that waterborne concentrations of methylmercury may provide limited insight into regional differences in fish mercury levels.

  12. Radiotracer Dilution Method for Mercury Inventory Study in Electrolytic Cells

    Science.gov (United States)

    Sugiharto, Su'ud, Zaki; Kurniadi, Rizal; Waris, Abdul; Santoso, Sigit Budi; Abidin, Zainal; Santoso, Gatot Budi

    2010-06-01

    Purpose of the experiment is to demonstrate feasibility the use of radiotracer to measure weight of mercury in electrolytic cells of soda industry. The weight of mercury in each cell of the plant is designed approximately 1700 kg. Radiotracer is prepared by mixing 203 Hg radioactive mercury with 2400 g of inactive mercury in a bath. The respective precisely weighted mercury aliquots to be injected into the cells are prepared by pouring approximately 130 g of radioactive mercury taken from the bath into 13 standard vials, in accordance with the number of the cells tested. Four standard references prepared by further dilution of ±2 g active mercury taken from the bath to obtain the dilution factors range of 12,000 to 20,000 from which the calibration graph is constructed. The injection process is conducting by pouring the radioactive mercury from aliquots into the flowing mercury at the inlet side of the cell and allows them to mix thoroughly. It is assumed that the mass of the radiotracer injected into a closed system remains constant, at least during the period of the test. From this experiment it was observed that the mixing time is two days after injection of radioactive mercury. The inactive mercury in each electrolytic cell calculated by the radiotracer method is of the range 1351.529 kg to 1966.354 kg with maximum error (95% confidence) is 1.52 %. The accuracy of measurement of the present method is better than gravimetric one which accounts 4 % of error on average.

  13. Mercury Hazard Assessment for Piscivorous Wildlife in Glacier National Park

    KAUST Repository

    Stafford, Craig P.; Downs, Christopher C.; Langner, Heiko W.

    2016-01-01

    We examined the mercury hazard posed to selected piscivorous wildlife in Glacier National Park (GNP), Montana. Logging Lake was our focal site where we estimated the dietary mercury concentrations of wildlife (common loon [Gavia immer], American mink [Neovison vison], river otter [Lontra canadensis], and belted kingfisher [Megaceryle alcyon]) by assuming that fishes were consumed in proportion to their relative abundances. To evaluate if Logging Lake provided a suitable baseline for our study, we made geographic comparisons of fish mercury levels and investigated the distribution and abundance of high mercury fishes within GNP. We complimented our assessment by examining selenium:mercury molar ratios in fishes from Logging Lake and Saint Mary Lake. Our results suggest fish consumption does not imperil wildlife from Logging Lake based on published thresholds for adverse mercury effects, but some hazard may exist particularly if there is strong feeding selectivity for the most contaminated species, northern pikeminnow (Ptychocheilus oregonensis). The geographic comparisons of fish mercury levels, together with the distribution and abundance of high mercury fishes within GNP, suggest that Logging Lake provided a relatively protective baseline among our study lakes. Risk may be further reduced by the molar excess of selenium relative to mercury, particularly in the smaller fishes typically consumed by GNP wildlife. Our findings contrast with studies from northeastern US and southeastern Canada where greater mercury hazard to wildlife exists. An emergent finding from our research is that waterborne concentrations of methylmercury may provide limited insight into regional differences in fish mercury levels.

  14. Radiotracer Dilution Method for Mercury Inventory Study in Electrolytic Cells

    International Nuclear Information System (INIS)

    Sugiharto; Su'ud, Zaki; Kurniadi, Rizal; Waris, Abdul; Santoso, Sigit Budi; Abidin, Zainal; Santoso, Gatot Budi

    2010-01-01

    Purpose of the experiment is to demonstrate feasibility the use of radiotracer to measure weight of mercury in electrolytic cells of soda industry. The weight of mercury in each cell of the plant is designed approximately 1700 kg. Radiotracer is prepared by mixing 203 Hg radioactive mercury with 2400 g of inactive mercury in a bath. The respective precisely weighted mercury aliquots to be injected into the cells are prepared by pouring approximately 130 g of radioactive mercury taken from the bath into 13 standard vials, in accordance with the number of the cells tested. Four standard references prepared by further dilution of ±2 g active mercury taken from the bath to obtain the dilution factors range of 12,000 to 20,000 from which the calibration graph is constructed. The injection process is conducting by pouring the radioactive mercury from aliquots into the flowing mercury at the inlet side of the cell and allows them to mix thoroughly. It is assumed that the mass of the radiotracer injected into a closed system remains constant, at least during the period of the test. From this experiment it was observed that the mixing time is two days after injection of radioactive mercury. The inactive mercury in each electrolytic cell calculated by the radiotracer method is of the range 1351.529 kg to 1966.354 kg with maximum error (95% confidence) is 1.52 %. The accuracy of measurement of the present method is better than gravimetric one which accounts 4 % of error on average.

  15. In vitro oxidation of mercury by the blood

    International Nuclear Information System (INIS)

    Hursh, J.B.; Sichak, S.P.; Clarkson, T.W.

    1988-01-01

    A method is described for studying the in vitro oxidation of mercury vapour by red blood cells at short times and with diminishing mercury vapour concentrations. It is found that for 40% red blood cell suspensions and 37 deg. C at concentrations greater than about 6 ng mercury vapour/ml, the oxidation rate is zero order, and that at lower concentrations the rate changes to first order. The effect of temperature and of added hydrogen peroxide de are studied. Results a considered in terms of the generally accepted belief that the catalase-compound I system is the main path of oxidation. If the results obtained in vitro in these experiments apply in vivo to man, it follows that inhaled mercury is carried in the blood to the brain and organs primarily as dissolved vapour rather than as inorganic mercury ions. (author)

  16. Amended Silicated for Mercury Control

    Energy Technology Data Exchange (ETDEWEB)

    James Butz; Thomas Broderick; Craig Turchi

    2006-12-31

    Amended Silicates{trademark}, a powdered, noncarbon mercury-control sorbent, was tested at Duke Energy's Miami Fort Station, Unit 6 during the first quarter of 2006. Unit 6 is a 175-MW boiler with a cold-side electrostatic precipitator (ESP). The plant burns run-of-the-river eastern bituminous coal with typical ash contents ranging from 8-15% and sulfur contents from 1.6-2.6% on an as-received basis. The performance of the Amended Silicates sorbent was compared with that for powdered activated carbon (PAC). The trial began with a period of baseline monitoring during which no sorbent was injected. Sampling during this and subsequent periods indicated mercury capture by the native fly ash was less than 10%. After the baseline period, Amended Silicates sorbent was injected at several different ratios, followed by a 30-day trial at a fixed injection ratio of 5-6 lb/MMACF. After this period, PAC was injected to provide a comparison. Approximately 40% mercury control was achieved for both the Amended Silicates sorbent and PAC at injection ratios of 5-6 lbs/MMACF. Higher injection ratios did not achieve significantly increased removal. Similar removal efficiencies have been reported for PAC injection trials at other plants with cold-side ESPs, most notably for plants using medium to high sulfur coal. Sorbent injection did not detrimentally impact plant operations and testing confirmed that the use of Amended Silicates sorbent does not degrade fly ash quality (unlike PAC). The cost for mercury control using either PAC or Amended Silicates sorbent was estimated to be equivalent if fly ash sales are not a consideration. However, if the plant did sell fly ash, the effective cost for mercury control could more than double if those sales were no longer possible, due to lost by-product sales and additional cost for waste disposal. Accordingly, the use of Amended Silicates sorbent could reduce the overall cost of mercury control by 50% or more versus PAC for locations where

  17. Assessment of atmospheric mercury emissions in Finland

    Science.gov (United States)

    Mukherjee; Melanen; Ekqvist; Verta

    2000-10-02

    This paper is part of the study of atmospheric emissions of heavy metals conducted by the Finnish Environment Institute in collaboration with the Technical Research Centre of Finland (VTT) under the umbrella of the Finnish Ministry of the Environment. The scope of our study is limited solely to anthropogenic mercury that is emitted directly to the atmosphere. This article addresses emission factors and trends of atmospheric mercury emissions during the 1990s and is based mainly on the database of the Finnish Environmental Administration. In addition, data based on the measurements taken by the VTT regarding emission factors have been used to estimate emissions of mercury from the incineration of waste. The study indicates that the total emission of mercury has decreased from 1140 kg in 1990 to 620 kg in 1997, while industrial and energy production have been on the increase simultaneously. The 45% emission reduction is due to improved gas cleaning equipment, process changes, automation, the installation of flue gas desulfurization process in coal-fired power plants and strict pollution control laws. In the past, some authors have estimated a higher mercury emission in Finland. In this study, it is also observed that there are no big changes in the quality of raw materials. Estimated emission factors can be of great help to management for estimating mercury emissions and also its risk assessment.

  18. Metallic mercury uptake by catalase Part 1 In Vitro metallic mercury uptake by various kind of animals' erythrocytes and purified human erythrocyte catalase

    OpenAIRE

    劒持,堅志

    1980-01-01

    The uptake of metallic mercury was studied using erythrocytes with different catalase activities taken from various kind of animals. The results were: 1) The uptake of metallic mercury by erythrocytes paralleled the activity of catalase in the erythrocytes with and without hydrogen peroxide, suggesting that the erythrocyte catalase activity is related to the uptake of metallic mercury. 2) The uptake of metallic mercury occurred not only with purified human erythrocyte catalase but also with h...

  19. Mercury Test on macroalgae from Burung and Tikus Island, Jakarta

    Science.gov (United States)

    Novianty, H.; Herandarudewi, S. M. C.; Suratno

    2018-04-01

    Environmental pollution, caused by the introduction of hazardous substances such as heavy metals into coastal waters, affects not only the condition of the waters but also the source of food that will be contaminated by hazardous metals, one of them is mercury (Hg). Mercury is toxic metal which could cause damage to the human body in certain threshold amounts. The aim of this study was to determin the content of mercury in several species of algae from Burung and Tikus Island, Jakarta. This study was using a descriptive method. The samples were collected from Burung and Tikus Island by simple rundown sampling. Mercury level was measured by NIC3000 mercury analyzer tool. The results showed that none of the mercury levels have passed 0.5 mg/kg (the safety standart level of mercury by SNI (Indonesian National Standard)7387 in 2019) mangrove. From tikus Island had lower total mercury than the ones from Burung Island. Burung Island is located near Pari Island which is a residential area, where pollution is more likely to occur.

  20. Avian mercury exposure and toxicological risk across western North America: A synthesis

    Science.gov (United States)

    Ackerman, Joshua T.; Eagles-Smith, Collin A.; Herzog, Mark; Hartman, Christopher; Peterson, Sarah; Evers, David C.; Jackson, Allyson K.; Elliott, John E.; Vander Pol, Stacy S.; Bryan, Colleen E.

    2016-01-01

    Methylmercury contamination of the environment is an important issue globally, and birds are useful bioindicators for mercury monitoring programs. The available data on mercury contamination of birds in western North America were synthesized. Original data from multiple databases were obtained and a literature review was conducted to obtain additional mercury concentrations. In total, 29219 original bird mercury concentrations from 225 species were compiled, and an additional 1712 mean mercury concentrations, representing 19998 individuals and 176 species, from 200 publications were obtained. To make mercury data comparable across bird tissues, published equations of tissue mercury correlations were used to convert all mercury concentrations into blood-equivalent mercury concentrations. Blood-equivalent mercury concentrations differed among species, foraging guilds, habitat types, locations, and ecoregions. Piscivores and carnivores exhibited the greatest mercury concentrations, whereas herbivores and granivores exhibited the lowest mercury concentrations. Bird mercury concentrations were greatest in ocean and salt marsh habitats and lowest in terrestrial habitats. Bird mercury concentrations were above toxicity benchmarks in many areas throughout western North America, and multiple hotspots were identified. Additionally, published toxicity benchmarks established in multiple tissues were summarized and translated into a common blood-equivalent mercury concentration. Overall, 66% of birds sampled in western North American exceeded a blood-equivalent mercury concentration of 0.2 μg/g wet weight (ww; above background levels), which is the lowest-observed effect level, 28% exceeded 1.0 μg/g ww (moderate risk), 8% exceeded 3.0 μg/g ww (high risk), and 4% exceeded 4.0 μg/g ww (severe risk). Mercury monitoring programs should sample bird tissues, such as adult blood and eggs, that are most-easily translated into tissues with well-developed toxicity benchmarks and that