WorldWideScience

Sample records for mendelevium 260

  1. Symposium commemorating the 25th anniversary of the discovery of mendelevium

    Energy Technology Data Exchange (ETDEWEB)

    Seaborg, G.T. (ed.)

    1980-01-01

    The Symposium honoring the 25th Anniversary of the discovery of mendelevium was held at the Lawrence Berkeley Laboratory on March 28, 1980. The following three papers were presented: Chemical Properties of Mendelevium; Nuclear Properties of Mendelevium; and Radioactive Decay of Md Isotopes. Besides these papers there were introductory remarks, reminiscences, and concluding remarks.

  2. Studies on some physico-chemical properties of the monovalent mendelevium

    International Nuclear Information System (INIS)

    Kamenskaya, A.N.; Mikheev, N.B.; Novichenko, V.L.

    1979-01-01

    It was established that Md 3+ reduced by Yb 2+ or Eu 2+ co-crystallizes with NaCl in water-ethanol solutions. The co-crystallization coefficient is independent of the relative quantities of the solid and liquid phase, of the concentration of the reducing agent in the concentration range from 1 to 8 mg/ml, and of the concentration of the chloride ion in the solution. Basing on the knowledge of anomalous mixed crystals and on the thermodynamical analysis of the formation of truly isomorphical solid solutions and anomalous mixed crystals, it was shown that mendelevium co-crystallizing with NaCl is in its monovalent state. Besides, it was concluded that up to 1.5 M chloride concentration the monovalent mendelevium does not form stable chloride complexes in water-ethanol solutions. (author)

  3. The discovery of 260Md and the decay properties of 258Fm, 258m,gMd and 259Md

    International Nuclear Information System (INIS)

    Lougheed, R.W.; Hulet, E.K.; Dougan, R.J.; Wild, J.F.; Dupzyk, R.J.; Henderson, C.M.; Moody, K.J.; Hahn, R.L.; Suemmerer, K.; Bethune, G.

    1986-01-01

    We have discovered a new neutron-rich isotope, 260 Md, from 18 O and 22 Ne bombardments of 254 Es. We observed a spontaneous-fission (SF) activity with a half-life of 32 days in electromagnetically separated fractions with mass number 260 from these bombardments and we measured the mass and kinetic energy distributions of this SF activity. The mass distribution was symmetric with the principal energy peak at a total kinetic energy (TKE) of 234 MeV, similar to previous observations for heavy fermium isotopes. Surprisingly, we also observed a smaller symmetric component with a TKE of 195 MeV. We interpret these two peaks in the TKE distribution as arising from two types of fission in the same nucleus, or bimodal fission. The observed fission activity may be either from the SF decay of 260 Md or from 260 Fm which would arise from electron-capture (EC) decay of 260 Md. We have eliminated the possible β - decay of 260 Md by measuring β - -SF time correlations for the decay of 260 Md and we plan to determine whether 260 Md decays by EC by measuring time correlations between fermium X-rays and SF events. We also measured various properties of the heavy fermium and mendelevium isotopes and obtained 1. more accurate cross-sections for the neutron-rich mendelevium isotopes which we use to predict the production rates of yet undiscovered nuclides, 2. improved half-life measurements for 258m,g Md and 259 Md, 3. confirmation of the EC decay of 258m Md by measurement of the fermium X-rays preceding the SF decay of 258 Fm and 4. very substantially improved mass and TKE distributions for the SF decay of 258 Fm and 259 Md. (orig.)

  4. Chemical properties of mendelevium

    Energy Technology Data Exchange (ETDEWEB)

    Hulet, E.K.

    1980-11-01

    Even with the most intense ion beams and the largest available quantities of target isotope, about 10/sup 6/ atoms at a time is all the Md that can be produced for chemical studies. This lack of sufficient sample size coupled with the very short lifetimes of the few atoms produced has severely restricted the gathering and the broadness of our knowledge concerning the properties of Md and the heavier elements. To illustrate, the literature contains a mere eleven references to the chemical studies of Md, and none of these deal with bulk properties associated with the element bound in solid phases. Some of these findings are: Md was found to be more volatile than other actinide metals which lead to the belief that it is divalent in the metallic state; separation of Md from the other actinides can be accomplished either by reduction of Md/sup 3 +/ to the divalent state or by chromatographic separations with Md remaining in the tripositive state; extraction of Md/sup 2 +/ with bis(2-ethylhexyl)phosphoric acid is much poorer than the extraction of the neighboring tripositive actinides; attempts to oxidize Md/sup 3 +/ with sodium bismuthate failed to show any evidence for Md/sup 4 +/; reduction potential of Md/sup 3 +/ was found to be close to -0.1 volt; Md/sup 3 +/ can be reduced to Md(Hg) by sodium amalgams and by electrolysis; the electrochemical behavior of Md is very similar to that of Fm and can be summarized in the equation, Md/sup 2 +/ + 2e/sup -/ = Md(Hg) and E/sup 0/ = -1.50 V.; and Md cannot be reduced to a monovalent ion with Sm/sup 2 +/.

  5. Chemical properties of mendelevium

    International Nuclear Information System (INIS)

    Hulet, E.K.

    1980-01-01

    The isotope 256 Md is nearly always employed for chemical studies of this element. This nuclide can be made by bombardment of fractions of a microgram of 254 Es with intense alpha-particle beams which will produce about 10 6 atoms of 256 Md with a half-life of 77 minutes. Even with the most intense ion beams and the largest available quantities of target isotope, about 10 6 atoms at a time is all the Md that can be produced for chemical studies. This lack of sufficient sample size coupled with the very short lifetimes of the few atoms produced has severly restricted the gathering and broadening of our knowledge concerning the properties of Md and the heavier elements. To illustrate, the literature contains a mere eleven references to the chemical studies of Md, and none of these deal with bulk properties associated with element found in solid phases. Some of these findings are: Md was found to be more volatile than other actinide metals which lead to the belief that it is divalent in the metallic state; separation of Md from the other actinides can be accomplished either by reduction of Md to the divalent state or by chromatographic separations with Md remaining in the tripositive state; extraction of Md with bis(2-ethylhexyl)phosphoric acid is much poorer than the extraction of the neighboring tripositive actinides; attempts to oxidize Md wih sodium bismuthate failed to show any evidence of Md 4+ ; standard reduction potential of Md 3+ was found to be close to -0.1 volt; Md 3+ can be reduced to Md(Hg) by sodium amalgams and by electrolysis; the electrochemical behavior of Md is very similar to that of Fm and can be summarized in the equation, Md 2+ + 2e - = Md(Hg), and E 0 = 1.5 V

  6. Chemical properties of mendelevium

    International Nuclear Information System (INIS)

    Hulet, E.K.

    1980-11-01

    Even with the most intense ion beams and the largest available quantities of target isotope, about 10 6 atoms at a time is all the Md that can be produced for chemical studies. This lack of sufficient sample size coupled with the very short lifetimes of the few atoms produced has severely restricted the gathering and the broadness of our knowledge concerning the properties of Md and the heavier elements. To illustrate, the literature contains a mere eleven references to the chemical studies of Md, and none of these deal with bulk properties associated with the element bound in solid phases. Some of these findings are: Md was found to be more volatile than other actinide metals which lead to the belief that it is divalent in the metallic state; separation of Md from the other actinides can be accomplished either by reduction of Md 3+ to the divalent state or by chromatographic separations with Md remaining in the tripositive state; extraction of Md 2+ with bis(2-ethylhexyl)phosphoric acid is much poorer than the extraction of the neighboring tripositive actinides; attempts to oxidize Md 3+ with sodium bismuthate failed to show any evidence for Md 4+ ; reduction potential of Md 3+ was found to be close to -0.1 volt; Md 3+ can be reduced to Md(Hg) by sodium amalgams and by electrolysis; the electrochemical behavior of Md is very similar to that of Fm and can be summarized in the equation, Md 2+ + 2e - = Md(Hg) and E 0 = -1.50 V.; and Md cannot be reduced to a monovalent ion with Sm 2+

  7. 16 CFR 260.6 - General principles.

    Science.gov (United States)

    2010-01-01

    ... ENVIRONMENTAL MARKETING CLAIMS § 260.6 General principles. The following general principles apply to all environmental marketing claims, including, but not limited to, those described in § 260.7. In addition, § 260.7... 16 Commercial Practices 1 2010-01-01 2010-01-01 false General principles. 260.6 Section 260.6...

  8. 40 CFR 260.11 - References.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 25 2010-07-01 2010-07-01 false References. 260.11 Section 260.11... WASTE MANAGEMENT SYSTEM: GENERAL Definitions § 260.11 References. (a) When used in parts 260 through 268 and 278 of this chapter, the following publications are incorporated by reference. These...

  9. 49 CFR 260.49 - Avoiding defaults.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 4 2010-10-01 2010-10-01 false Avoiding defaults. 260.49 Section 260.49 Transportation Other Regulations Relating to Transportation (Continued) FEDERAL RAILROAD ADMINISTRATION... REHABILITATION AND IMPROVEMENT FINANCING PROGRAM Procedures To Be Followed in the Event of Default § 260.49...

  10. 50 CFR 260.88 - Political activity.

    Science.gov (United States)

    2010-10-01

    ... part in political management or in political campaigns. Political activities in city, county, State, or... 50 Wildlife and Fisheries 7 2010-10-01 2010-10-01 false Political activity. 260.88 Section 260.88... Products for Human Consumption Miscellaneous § 260.88 Political activity. All inspectors and licensed...

  11. 40 CFR 82.260 - Definitions.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 17 2010-07-01 2010-07-01 false Definitions. 82.260 Section 82.260... STRATOSPHERIC OZONE Halon Emissions Reduction § 82.260 Definitions. Halon-containing equipment means equipment.... This group consists of the three halogenated hydrocarbons known as Halon 1211, Halon 1301, and Halon...

  12. 7 CFR 868.260 - Information.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 7 2010-01-01 2010-01-01 false Information. 868.260 Section 868.260 Agriculture... Governing Application of Standards § 868.260 Information. Requests for the Rice Inspection Handbook, Equipment Handbook, or for information concerning approved devices and procedures, criteria for approved...

  13. 49 CFR 260.7 - Priority consideration.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 4 2010-10-01 2010-10-01 false Priority consideration. 260.7 Section 260.7... REHABILITATION AND IMPROVEMENT FINANCING PROGRAM Overview § 260.7 Priority consideration. When evaluating applications, the Administrator will give priority consideration (but not necessarily in the following order...

  14. 7 CFR 1209.260 - Reports.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 10 2010-01-01 2010-01-01 false Reports. 1209.260 Section 1209.260 Agriculture... CONSUMER INFORMATION ORDER Rules and Regulations Reports § 1209.260 Reports. Each first handler shall be required to report monthly to the Council such information as may be required under § 1209.60(a) of this...

  15. 49 CFR 260.13 - Credit reform.

    Science.gov (United States)

    2010-10-01

    ... appropriations, direct payment of a Credit Risk Premium by the Applicant or a non-Federal infrastructure partner... 49 Transportation 4 2010-10-01 2010-10-01 false Credit reform. 260.13 Section 260.13... REHABILITATION AND IMPROVEMENT FINANCING PROGRAM Overview § 260.13 Credit reform. The Federal Credit Reform Act...

  16. 46 CFR 401.260 - Reports.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 8 2010-10-01 2010-10-01 false Reports. 401.260 Section 401.260 Shipping COAST GUARD... Pilots § 401.260 Reports. (a) A marine accident which occurs while a U.S. Registered Pilot is in the service of a vessel in U.S. or Canadian waters of the Great Lakes shall be reported by the Registered...

  17. 9 CFR 319.260 - Luncheon meat.

    Science.gov (United States)

    2010-01-01

    ... 9 Animals and Animal Products 2 2010-01-01 2010-01-01 false Luncheon meat. 319.260 Section 319.260... ORGANIZATION AND TERMINOLOGY; MANDATORY MEAT AND POULTRY PRODUCTS INSPECTION AND VOLUNTARY INSPECTION AND CERTIFICATION DEFINITIONS AND STANDARDS OF IDENTITY OR COMPOSITION Luncheon Meat, Loaves and Jellied Products...

  18. 49 CFR 195.260 - Valves: Location.

    Science.gov (United States)

    2010-10-01

    ... PIPELINE Construction § 195.260 Valves: Location. A valve must be installed at each of the following... that is more than 100 feet (30 meters) wide from high-water mark to high-water mark unless the...

  19. 21 CFR 172.260 - Oxidized polyethylene.

    Science.gov (United States)

    2010-04-01

    ... HUMAN CONSUMPTION (CONTINUED) FOOD ADDITIVES PERMITTED FOR DIRECT ADDITION TO FOOD FOR HUMAN CONSUMPTION Coatings, Films and Related Substances § 172.260 Oxidized polyethylene. Oxidized polyethylene may be safely...

  20. 16 CFR 260.8 - Environmental assessment.

    Science.gov (United States)

    2010-01-01

    ....8 Commercial Practices FEDERAL TRADE COMMISSION GUIDES AND TRADE PRACTICE RULES GUIDES FOR THE USE OF ENVIRONMENTAL MARKETING CLAIMS § 260.8 Environmental assessment. (a) National Environmental Policy... and analysis to determine whether issuing the Guides for the Use of Environmental Marketing Claims...

  1. Reference: 260 [Arabidopsis Phenome Database[Archive

    Lifescience Database Archive (English)

    Full Text Available 260 http://metadb.riken.jp/db/SciNetS_ria224i/cria224u4ria224u16116418i Mentewab A...in resistance to transgenic plants. 9 1177-80 16116418 2005 Sep Nature biotechnology Mentewab Ayalew|Stewart C Neal Jr

  2. Cern faces 260m euro budget cuts

    CERN Multimedia

    Banks, Michael

    2010-01-01

    "The Cern particle-physics lab near Geneva is to slash about 260m euro ($340m) from its budget for 2011-2015. The cut, which was approved by Cern's council last month, will require the lab to scale back research into future particles accelerators" (0.5 page)

  3. 50 CFR 260.6 - Terms defined.

    Science.gov (United States)

    2010-10-01

    ... Products for Human Consumption Definitions § 260.6 Terms defined. Words in the regulations in this part in... Commerce. Deviant. “Deviant” means a sample unit affected by one or more deviations or a sample unit that varies in a specifically defined manner from the requirements of a standard, specification, or other...

  4. 29 CFR 779.260 - Trade-in allowances.

    Science.gov (United States)

    2010-07-01

    ... 29 Labor 3 2010-07-01 2010-07-01 false Trade-in allowances. 779.260 Section 779.260 Labor... Volume of Sales Made Or Business Done § 779.260 Trade-in allowances. Where merchandise is taken in trade... sale before deduction of the allowance on such trade-in merchandise. This is so even though an...

  5. 40 CFR 260.3 - Use of number and gender.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 25 2010-07-01 2010-07-01 false Use of number and gender. 260.3... (CONTINUED) HAZARDOUS WASTE MANAGEMENT SYSTEM: GENERAL General § 260.3 Use of number and gender. As used in parts 260 through 265 and 268 of this chapter: (a) Words in the masculine gender also include the...

  6. 45 CFR 2541.260 - Non-Federal audit.

    Science.gov (United States)

    2010-10-01

    ... awards in a fiscal year, shall: (1) Determine whether State or local subgrantees have met the audit... 45 Public Welfare 4 2010-10-01 2010-10-01 false Non-Federal audit. 2541.260 Section 2541.260... GOVERNMENTS Post-Award Requirements § 2541.260 Non-Federal audit. (a) Basic rule. Grantees and subgrantees are...

  7. 46 CFR 107.260 - Rated load test for cranes.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 4 2010-10-01 2010-10-01 false Rated load test for cranes. 107.260 Section 107.260... INSPECTION AND CERTIFICATION Inspection and Certification § 107.260 Rated load test for cranes. (a) To meet the requirements in § 107.231(l), each crane must meet the following rated load test at both the...

  8. 49 CFR 260.15 - Credit risk premium.

    Science.gov (United States)

    2010-10-01

    ... the recovery of collateral. (c) The Credit Risk Premium must be paid before the disbursement of a... 49 Transportation 4 2010-10-01 2010-10-01 false Credit risk premium. 260.15 Section 260.15... REHABILITATION AND IMPROVEMENT FINANCING PROGRAM Overview § 260.15 Credit risk premium. (a) Where available...

  9. 36 CFR 2.60 - Livestock use and agriculture.

    Science.gov (United States)

    2010-07-01

    ... 36 Parks, Forests, and Public Property 1 2010-07-01 2010-07-01 false Livestock use and agriculture. 2.60 Section 2.60 Parks, Forests, and Public Property NATIONAL PARK SERVICE, DEPARTMENT OF THE INTERIOR RESOURCE PROTECTION, PUBLIC USE AND RECREATION § 2.60 Livestock use and agriculture. (a) The...

  10. 49 CFR 260.17 - Credit risk premium analysis.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 4 2010-10-01 2010-10-01 false Credit risk premium analysis. 260.17 Section 260... Financial Assistance § 260.17 Credit risk premium analysis. (a) When Federal appropriations are not available to cover the total subsidy cost, the Administrator will determine the Credit Risk Premium...

  11. 21 CFR 137.260 - Enriched corn meals.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 2 2010-04-01 2010-04-01 false Enriched corn meals. 137.260 Section 137.260 Food... Flours and Related Products § 137.260 Enriched corn meals. (a) Enriched corn meals are the foods, each of which conforms to the definition and standard of identity prescribed for a kind of corn meal by §§ 137...

  12. 50 CFR 260.84 - Policies and procedures.

    Science.gov (United States)

    2010-10-01

    ... 50 Wildlife and Fisheries 7 2010-10-01 2010-10-01 false Policies and procedures. 260.84 Section... Fishery Products for Human Consumption Miscellaneous § 260.84 Policies and procedures. The policies and... Inspection Manual. The policies and procedures are available from the Secretary to any interested party by...

  13. 21 CFR 176.260 - Pulp from reclaimed fiber.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 3 2010-04-01 2009-04-01 true Pulp from reclaimed fiber. 176.260 Section 176.260 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES (CONTINUED) FOOD FOR HUMAN CONSUMPTION (CONTINUED) INDIRECT FOOD ADDITIVES: PAPER AND PAPERBOARD COMPONENTS Substances...

  14. 23 CFR 260.111 - Responsibilities of educational institutions.

    Science.gov (United States)

    2010-04-01

    ... 23 Highways 1 2010-04-01 2010-04-01 false Responsibilities of educational institutions. 260.111 Section 260.111 Highways FEDERAL HIGHWAY ADMINISTRATION, DEPARTMENT OF TRANSPORTATION NATIONAL HIGHWAY... educational institutions. (a) The college or university chosen by the grant recipient shall enter into an...

  15. 17 CFR 260.7a-19 - Margin for binding.

    Science.gov (United States)

    2010-04-01

    ... 17 Commodity and Securities Exchanges 3 2010-04-01 2010-04-01 false Margin for binding. 260.7a-19...) GENERAL RULES AND REGULATIONS, TRUST INDENTURE ACT OF 1939 Formal Requirements § 260.7a-19 Margin for... and documents filed as a part thereof, shall have a back or stitching margin of at least 11/2 inches...

  16. 50 CFR 260.58 - Accessibility for sampling.

    Science.gov (United States)

    2010-10-01

    ... 50 Wildlife and Fisheries 7 2010-10-01 2010-10-01 false Accessibility for sampling. 260.58 Section... Fishery Products for Human Consumption Sampling § 260.58 Accessibility for sampling. Each applicant shall cause the processed products for which inspection is requested to be made accessible for proper sampling...

  17. 7 CFR 1901.260 - Coordination with other agencies.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 12 2010-01-01 2010-01-01 false Coordination with other agencies. 1901.260 Section... AGRICULTURE PROGRAM REGULATIONS PROGRAM-RELATED INSTRUCTIONS Procedures for the Protection of Historical and Archeological Properties § 1901.260 Coordination with other agencies. (a) When other Agencies are directly...

  18. 30 CFR 206.260 - Allocation of washed coal.

    Science.gov (United States)

    2010-07-01

    ... 30 Mineral Resources 2 2010-07-01 2010-07-01 false Allocation of washed coal. 206.260 Section 206... MANAGEMENT PRODUCT VALUATION Federal Coal § 206.260 Allocation of washed coal. (a) When coal is subjected to washing, the washed coal must be allocated to the leases from which it was extracted. (b) When the net...

  19. Release Note -- Vbfnlo-2.6.0

    CERN Document Server

    Arnold, K; Bozzi, G; Campanario, F; Englert, C; Feigl, B; Frank, J; Figy, T; Jager, B; Kerner, M; Kubocz, M; Oleari, C; Palmer, S; Rauch, M; Rzehak, H; Schissler, F; Schlimpert, O; Spannowsky, M; Zeppenfeld, D

    2012-01-01

    Vbfnlo is a flexible parton level Monte Carlo program for the simulation of vector boson fusion (VBF), double and triple vector boson (plus jet) production in hadronic collisions at next-to-leading order (NLO) in the strong coupling constant, as well as Higgs boson plus two jet production via gluon fusion at the one-loop level. This note briefly describes the main additional features and processes that have been added in the new release -- Vbfnlo Version 2.6.0. At NLO QCD diboson production (W\\gamma, WZ, ZZ, Z\\gamma and \\gamma\\gamma), same-sign W pair production via vector boson fusion and the process W\\gamma\\gamma j have been implemented (for which one-loop tensor integrals up to six-point functions are included). In addition, gluon induced diboson production can be studied separately at the leading order (one-loop) level. The diboson processes WW, WZ and W\\gamma can be run with anomalous gauge boson couplings, and anomalous couplings between a Higgs and a pair of gauge bosons is included in WW, ZZ, Z\\gamma ...

  20. 16 CFR 260.3 - Structure of the guides.

    Science.gov (United States)

    2010-01-01

    ... ENVIRONMENTAL MARKETING CLAIMS § 260.3 Structure of the guides. The guides are composed of general principles and specific guidance on the use of environmental claims. These general principles and specific...

  1. 40 CFR 1065.260 - Flame-ionization detector.

    Science.gov (United States)

    2010-07-01

    .... For compression-ignition engines, two-stroke spark-ignition engines, and four-stroke spark-ignition... CONTROLS ENGINE-TESTING PROCEDURES Measurement Instruments Hydrocarbon Measurements § 1065.260 Flame... that has compensation algorithms that are functions of other gaseous measurements and the engine's...

  2. 49 CFR 260.51 - Conditions of guarantee.

    Science.gov (United States)

    2010-10-01

    ... REHABILITATION AND IMPROVEMENT FINANCING PROGRAM Loan Guarantees-Lenders § 260.51 Conditions of guarantee. (a... between the Lender and the Applicant, subject to the Administrator's approval. The maximum percentage of... allowed will depend on the total credit quality of the transaction and the level of risk believed to be...

  3. 16 CFR 260.5 - Interpretation and substantiation of environmental marketing claims.

    Science.gov (United States)

    2010-01-01

    ... environmental marketing claims. 260.5 Section 260.5 Commercial Practices FEDERAL TRADE COMMISSION GUIDES AND TRADE PRACTICE RULES GUIDES FOR THE USE OF ENVIRONMENTAL MARKETING CLAIMS § 260.5 Interpretation and substantiation of environmental marketing claims. Section 5 of the FTC Act makes unlawful deceptive acts and...

  4. 45 CFR 260.51 - What definitions apply to this subpart?

    Science.gov (United States)

    2010-10-01

    ... of Domestic Violence? § 260.51 What definitions apply to this subpart? Family Violence Option (or FVO... of domestic violence. Federally recognized good cause domestic violence waiver means a good cause domestic violence waiver that meets the requirements at §§ 260.52(c) and 260.55. Good cause domestic...

  5. 42 CFR 440.260 - Methods and standards to assure quality of services.

    Science.gov (United States)

    2010-10-01

    ... 42 Public Health 4 2010-10-01 2010-10-01 false Methods and standards to assure quality of services. 440.260 Section 440.260 Public Health CENTERS FOR MEDICARE & MEDICAID SERVICES, DEPARTMENT OF HEALTH... and Limits Applicable to All Services § 440.260 Methods and standards to assure quality of services...

  6. 20 CFR 667.260 - May WIA title I funds be spent for construction?

    Science.gov (United States)

    2010-04-01

    ... construction? 667.260 Section 667.260 Employees' Benefits EMPLOYMENT AND TRAINING ADMINISTRATION, DEPARTMENT OF LABOR ADMINISTRATIVE PROVISIONS UNDER TITLE I OF THE WORKFORCE INVESTMENT ACT Administrative Rules, Costs and Limitations § 667.260 May WIA title I funds be spent for construction? WIA title I funds must...

  7. 45 CFR 260.54 - Do States have flexibility to grant good cause domestic violence waivers?

    Science.gov (United States)

    2010-10-01

    ... domestic violence waivers? 260.54 Section 260.54 Public Welfare Regulations Relating to Public Welfare... Special Provisions Apply to Victims of Domestic Violence? § 260.54 Do States have flexibility to grant good cause domestic violence waivers? (a) Yes; States have broad flexibility to grant these waivers to...

  8. 18 CFR 260.200 - Original cost statement of utility property.

    Science.gov (United States)

    2010-04-01

    ... of utility property. 260.200 Section 260.200 Conservation of Power and Water Resources FEDERAL ENERGY...) § 260.200 Original cost statement of utility property. Any natural gas company becoming subject to the... effect of appreciating or writing up the gas plant account, the amount of the appreciation or writeup...

  9. 45 CFR 260.52 - What are the basic provisions of the Family Violence Option (FVO)?

    Science.gov (United States)

    2010-10-01

    ... Provisions Apply to Victims of Domestic Violence? § 260.52 What are the basic provisions of the Family... 45 Public Welfare 2 2010-10-01 2010-10-01 false What are the basic provisions of the Family Violence Option (FVO)? 260.52 Section 260.52 Public Welfare Regulations Relating to Public Welfare OFFICE...

  10. 30 CFR 260.3 - What is MMS's authority to collect information?

    Science.gov (United States)

    2010-07-01

    ... 30 Mineral Resources 2 2010-07-01 2010-07-01 false What is MMS's authority to collect information? 260.3 Section 260.3 Mineral Resources MINERALS MANAGEMENT SERVICE, DEPARTMENT OF THE INTERIOR OFFSHORE OUTER CONTINENTAL SHELF OIL AND GAS LEASING General Provisions § 260.3 What is MMS's authority to...

  11. 40 CFR 260.43 - Legitimate recycling of hazardous secondary materials regulated under § 260.34, § 261.2(a)(2)(ii...

    Science.gov (United States)

    2010-07-01

    ... is discarded material and is a solid waste. In determining if their recycling is legitimate, persons....43 Section 260.43 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) SOLID WASTES (CONTINUED) HAZARDOUS WASTE MANAGEMENT SYSTEM: GENERAL Rulemaking Petitions § 260.43 Legitimate recycling of...

  12. 50 CFR 260.61 - Sampling plans and procedures for determining lot compliance.

    Science.gov (United States)

    2010-10-01

    ... determining lot compliance. 260.61 Section 260.61 Wildlife and Fisheries NATIONAL MARINE FISHERIES SERVICE... Sampling plans and procedures for determining lot compliance. (a) Except as otherwise provided for in this... shall be selected from each lot in the exact number of sample units indicated for the lot size in the...

  13. 12 CFR 563b.260 - May I use previously executed proxies?

    Science.gov (United States)

    2010-01-01

    ... 12 Banks and Banking 5 2010-01-01 2010-01-01 false May I use previously executed proxies? 563b.260... FROM MUTUAL TO STOCK FORM Standard Conversions Proxy Solicitation § 563b.260 May I use previously executed proxies? You may not use previously executed proxies for the plan of conversion vote. If members...

  14. Stability of 244− 260Fm isotopes against alpha and cluster ...

    Indian Academy of Sciences (India)

    Home; Journals; Pramana – Journal of Physics; Volume 73; Issue 6. Stability of 244-260Fm isotopes against alpha and cluster radioactivity. K P Santhosh ... Taking Coulomb and proximity potentials as the interacting barrier we have studied the cold valley in the radioactive decay of 244-260Fm isotopes. It is found that in ...

  15. 17 CFR 260.7a-17 - Quality, color and size of paper.

    Science.gov (United States)

    2010-04-01

    ..., white paper, no larger than 81/2×11 inches in size. To the extent that the reduction of larger documents... paper. 260.7a-17 Section 260.7a-17 Commodity and Securities Exchanges SECURITIES AND EXCHANGE COMMISSION... Quality, color and size of paper. The application, statement or report, including all amendments and...

  16. 40 CFR 158.260 - Experimental use permit data requirements for environmental fate.

    Science.gov (United States)

    2010-07-01

    ... requirements for environmental fate. 158.260 Section 158.260 Protection of Environment ENVIRONMENTAL PROTECTION... Experimental use permit data requirements for environmental fate. All environmental fate data, as described in.... The following table shows the experimental use data requirements for environmental fate. The test...

  17. 30 CFR 260.110 - What bidding systems may MMS use?

    Science.gov (United States)

    2010-07-01

    ... 30 Mineral Resources 2 2010-07-01 2010-07-01 false What bidding systems may MMS use? 260.110 Section 260.110 Mineral Resources MINERALS MANAGEMENT SERVICE, DEPARTMENT OF THE INTERIOR OFFSHORE OUTER... MMS use? We will apply a single bidding system selected from those listed in this section to each...

  18. 30 CFR 260.111 - What conditions apply to the bidding systems that MMS uses?

    Science.gov (United States)

    2010-07-01

    ... 30 Mineral Resources 2 2010-07-01 2010-07-01 false What conditions apply to the bidding systems that MMS uses? 260.111 Section 260.111 Mineral Resources MINERALS MANAGEMENT SERVICE, DEPARTMENT OF THE... What conditions apply to the bidding systems that MMS uses? (a) For each of the bidding systems in...

  19. 75 FR 13261 - Reorganization of Foreign-Trade Zone 260 under Alternative Site Framework, Lubbock, Texas

    Science.gov (United States)

    2010-03-19

    ... DEPARTMENT OF COMMERCE Foreign-Trade Zones Board [Order No. 1668] Reorganization of Foreign-Trade Zone 260 under Alternative Site Framework, Lubbock, Texas Pursuant to its authority under the Foreign... reorganization of general-purpose zones; Whereas, the City of Lubbock, Texas, grantee of Foreign-Trade Zone 260...

  20. 49 CFR 260.31 - Execution and filing of the application.

    Science.gov (United States)

    2010-10-01

    ... Credit Risk Premium due from Applicant, if any, as provided in § 260.15. Applicant agrees to pay such Credit Risk Premium prior to the disbursement of direct or guaranteed loan, as appropriate. Such Credit Risk Premium may be refunded as provided in § 260.15. Respectfully submitted. Applicant(s) Seal(s) by...

  1. 20 CFR 1002.260 - What pension benefit plans are covered under USERRA?

    Science.gov (United States)

    2010-04-01

    ... 20 Employees' Benefits 3 2010-04-01 2010-04-01 false What pension benefit plans are covered under USERRA? 1002.260 Section 1002.260 Employees' Benefits OFFICE OF THE ASSISTANT SECRETARY FOR VETERANS' EMPLOYMENT AND TRAINING SERVICE, DEPARTMENT OF LABOR REGULATIONS UNDER THE UNIFORMED SERVICES EMPLOYMENT AND REEMPLOYMENT RIGHTS ACT OF 1994...

  2. 45 CFR 260.55 - What are the additional requirements for Federal recognition of good cause domestic violence...

    Science.gov (United States)

    2010-10-01

    ... recognition of good cause domestic violence waivers? 260.55 Section 260.55 Public Welfare Regulations Relating...) PROVISIONS What Special Provisions Apply to Victims of Domestic Violence? § 260.55 What are the additional requirements for Federal recognition of good cause domestic violence waivers? To be federally recognized, good...

  3. 17 CFR 260.7a-16 - Inclusion of items, differentiation between items and answers, omission of instructions.

    Science.gov (United States)

    2010-04-01

    ... 17 Commodity and Securities Exchanges 3 2010-04-01 2010-04-01 false Inclusion of items, differentiation between items and answers, omission of instructions. 260.7a-16 Section 260.7a-16 Commodity and... INDENTURE ACT OF 1939 Formal Requirements § 260.7a-16 Inclusion of items, differentiation between items and...

  4. 40 CFR 260.41 - Procedures for case-by-case regulation of hazardous waste recycling activities.

    Science.gov (United States)

    2010-07-01

    ... of hazardous waste recycling activities. 260.41 Section 260.41 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) SOLID WASTES (CONTINUED) HAZARDOUS WASTE MANAGEMENT SYSTEM: GENERAL Rulemaking Petitions § 260.41 Procedures for case-by-case regulation of hazardous waste recycling activities...

  5. 40 CFR 260.40 - Additional regulation of certain hazardous waste recycling activities on a case-by-case basis.

    Science.gov (United States)

    2010-07-01

    ... hazardous waste recycling activities on a case-by-case basis. 260.40 Section 260.40 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) SOLID WASTES (CONTINUED) HAZARDOUS WASTE MANAGEMENT SYSTEM: GENERAL Rulemaking Petitions § 260.40 Additional regulation of certain hazardous waste recycling...

  6. 18 CFR 260.9 - Reports by natural gas pipeline companies on service interruptions and damage to facilities.

    Science.gov (United States)

    2010-04-01

    ... pipeline companies on service interruptions and damage to facilities. 260.9 Section 260.9 Conservation of..., NATURAL GAS ACT STATEMENTS AND REPORTS (SCHEDULES) § 260.9 Reports by natural gas pipeline companies on service interruptions and damage to facilities. (a)(1) Every natural gas company must report to the...

  7. Amplifier Module for 260-GHz Band Using Quartz Waveguide Transitions

    Science.gov (United States)

    Padmanabhan, Sharmila; Fung, King Man; Kangaslahti, Pekka P.; Peralta, Alejandro; Soria, Mary M.; Pukala, David M.; Sin, Seth; Samoska, Lorene A.; Sarkozy, Stephen; Lai, Richard

    2012-01-01

    Packaging of MMIC LNA (monolithic microwave integrated circuit low-noise amplifier) chips at frequencies over 200 GHz has always been problematic due to the high loss in the transition between the MMIC chip and the waveguide medium in which the chip will typically be used. In addition, above 200 GHz, wire-bond inductance between the LNA and the waveguide can severely limit the RF matching and bandwidth of the final waveguide amplifier module. This work resulted in the development of a low-loss quartz waveguide transition that includes a capacitive transmission line between the MMIC and the waveguide probe element. This capacitive transmission line tunes out the wirebond inductance (where the wire-bond is required to bond between the MMIC and the probe element). This inductance can severely limit the RF matching and bandwidth of the final waveguide amplifier module. The amplifier module consists of a quartz E-plane waveguide probe transition, a short capacitive tuning element, a short wire-bond to the MMIC, and the MMIC LNA. The output structure is similar, with a short wire-bond at the output of the MMIC, a quartz E-plane waveguide probe transition, and the output waveguide. The quartz probe element is made of 3-mil quartz, which is the thinnest commercially available material. The waveguide band used is WR4, from 170 to 260 GHz. This new transition and block design is an improvement over prior art because it provides for better RF matching, and will likely yield lower loss and better noise figure. The development of high-performance, low-noise amplifiers in the 180-to- 700-GHz range has applications for future earth science and planetary instruments with low power and volume, and astrophysics array instruments for molecular spectroscopy. This frequency band, while suitable for homeland security and commercial applications (such as millimeter-wave imaging, hidden weapons detection, crowd scanning, airport security, and communications), also has applications to

  8. 45 CFR 260.50 - What is the purpose of this subpart?

    Science.gov (United States)

    2010-10-01

    ... of Domestic Violence? § 260.50 What is the purpose of this subpart? Under section 402(a)(7) of the... domestic violence and to waive program requirements for such individuals. This subpart explains how...

  9. 40 CFR 260.32 - Variances to be classified as a boiler.

    Science.gov (United States)

    2010-07-01

    ... WASTES (CONTINUED) HAZARDOUS WASTE MANAGEMENT SYSTEM: GENERAL Rulemaking Petitions § 260.32 Variances to... equipment are of integral design; and (c) The efficiency of energy recovery, calculated in terms of the...

  10. The X-Ray Binary KS 1731{260: Possible Analogy with Her X-1

    Directory of Open Access Journals (Sweden)

    Vojtěch Šimon

    2014-12-01

    Full Text Available The X-ray binary with the neutron star (NS, KS 1731-260, displays superorbital cycle similar to that in Her X-1. The accretion disk had the memory of the cycle-length even when this modulation sometimes disappeared in the main outburst of KS 1731-260, and during anomalous low state in Her X-1. The disk still existed during such seasons. Although irradiation of the disk by X-rays is a viable explanation for the disk precession and warping (see model of Foulkes et al., the mechanisms which give rise to the observed X-ray modulation are quite dierent for each of these systems. Variable absorption can explain this cycle only in Her X-1. We propose a variable mass accretion rate onto the NS in KS 1731-260 due to a highly variable impact of the inflowing mass stream with the changing phase of the cycle.

  11. Nonlinkage of D6S260, a putative schizophrenia locus, to bipolar affective disorder

    Energy Technology Data Exchange (ETDEWEB)

    Adams, L.J.; Mitchell, P.B. [Univ. of South Wales (Australia); Salmon, J. [Garvan Institute of Medical Research, Sydney, New South Wales (Australia)] [and others

    1996-09-20

    To examine whether genes that predispose to schizophrenia also confer a predisposition to other psychiatric disorders such as bipolar affective disorder (BAD), we tested for linkage between the recently identified schizophrenia susceptibility locus D6S260 and the inheritance of BAD in 12 large Australian pedigrees. We found no evidence for linkage over a region of 12-27 cM from the D6S260 locus, depending on the model used. Our results therefore do not provide support for the continuum theory of psychosis. 13 refs., 2 tabs.

  12. The influences of CD14 -260C>T polymorphism on survival in ICU critically ill patients.

    Science.gov (United States)

    Fallavena, Paulo R V; Borges, Thiago J; Paskulin, Diego D; Paludo, Francis J O; Goetze, Thayse B; de Oliveira, Jarbas R; Nóbrega, Otávio T; Dias, Fernando S; Alho, Clarice S

    2009-01-01

    In order to analyze the effect of the two different versions of the cluster of differentiation 14 (CD14) receptor recognizing gene on survival, we determined the -260C>T single nucleotide polymorphism (SNP) frequencies in 514 critically ill patients. We compared the -260TT homozygotes with -260C allele carriers (-260CC and -260CT genotypes) and we demonstrated--260TT patients had the highest survival rate (82% vs 64%; p T genotype groups and the main clinical predictors to exclude other risk factors that could influence the outcome from critical illness: higher age, APACHE II score, and length of stay at hospital, and the occurrence of sepsis and septic shock were risk factors to Intensive Care Unit (ICU) patient's mortality, but the -260TT genotype was protective factor toward survival (p = 0.001; OR = 3.08 95%CI = 1.54-5.98). Among septic and septic shock patients, -260TT genotype was also protective factor toward survival (p = 0.001; OR = 3.11 95%CI = 1.63-6.66 to septic patients, and p = 0.001; OR = 3.80 95%CI = 1.68-8.58 to patients with septic shock). Our results and our hypothesis suggest that the higher -260TT genotype frequency in ICU survivor patients is possibly explained by a beneficial effect on innate immunity signaling.

  13. Structural dynamics of native and V260E mutant C-terminal domain of HIV-1 integrase

    Science.gov (United States)

    Sangeetha, Balasubramanian; Muthukumaran, Rajagopalan; Amutha, Ramaswamy

    2015-04-01

    The C-terminal domain (CTD) of HIV-1 integrase is a five stranded β-barrel resembling an SH3 fold. Mutational studies on isolated CTD and full-length IN have reported V260E mutant as either homo-dimerization defective or affecting the stability and folding of CTD. In this study, molecular dynamics simulation techniques were used to unveil the effect of V260E mutation on isolated CTD monomer and dimer. Both monomeric and dimeric forms of wild type and V260E mutant are highly stable during the simulated period. However, the stabilizing π-stacking interaction between Trp243 and Trp243' at the dimer interface is highly disturbed in CTD-V260E (>6 Å apart). The loss in entropy for dimerization is -30 and -25 kcal/mol for CTD-wt and CTD-V260E respectively signifying a weak hydrophobic interaction and its perturbation in CTD-V260E. The mutant Glu260 exhibits strong attraction/repulsion with all the basic/acidic residues of CTD. In addition to this, the dynamics of CTD-wild type and V260E monomers at 498 K was analyzed to elucidate the effect of V260E mutation on CTD folding. Increase in SASA and reduction in the number of contacts in CTD-V260E during simulation highlights the instability caused by the mutation. In general, V260E mutation affects both multimerization and protein folding with a pronounced effect on protein folding rather than multimerization. This study emphasizes the importance of the hydrophobic nature and SH3 fold of CTD in proper functioning of HIV integrase and perturbing this nature would be a rational approach toward designing more selective and potent allosteric anti-HIV inhibitors.

  14. Highly ionized xenon spectra (95-260 Angstroms) excited in TFR Tokamak plasmas

    International Nuclear Information System (INIS)

    Breton, C.; Demichelis, C.; Hecq, W.; Mattioli, M.; Ramette, J.; Saoutic, B.; Bauche-Arnoult, C.; Bauche, J.; Wyart, J.F.

    1987-06-01

    The Xe spectrum in the 95-260 Angstroms spectral region, excited in TFR Tokamak plasmas, has been recorded by a grazing incidence multichannel spectrometer. Several lines in the Cu- and Zn-like isoelectronic sequences as well as a broad band (due to the superposition of unresolved transition arrays strongly mixed by configuration interaction) have been identified

  15. 77 FR 1777 - 60-Day Notice of Proposed Information Collection: DS-260, Electronic Application for Immigration...

    Science.gov (United States)

    2012-01-11

    ... DEPARTMENT OF STATE [Public Notice: 7750] 60-Day Notice of Proposed Information Collection: DS-260, Electronic Application for Immigration Visa and Alien Registration, 1405-0185 ACTION: Notice of request for... for Immigration Visa and Alien Registration. OMB Control Number: 1405-0185. Type of Request: Extension...

  16. 40 CFR 260.34 - Standards and criteria for non-waste determinations.

    Science.gov (United States)

    2010-07-01

    ... WASTES (CONTINUED) HAZARDOUS WASTE MANAGEMENT SYSTEM: GENERAL Rulemaking Petitions § 260.34 Standards and... determination that a hazardous secondary material is not discarded and therefore not a solid waste. The... determination for hazardous secondary material which is reclaimed in a continuous industrial process if the...

  17. STABILIZATION OF A MIXED WASTE SLUDGE SURROGATE CONTAINING MORE THAN 260 PPM MERCURY

    International Nuclear Information System (INIS)

    Smith, W. J.; Feizollahi, F.; Brimley, R.

    2002-01-01

    In an earlier demonstration of an innovative mercury stabilization technology for the Department of Energy, ATG's full-scale process stabilized mercury in soils that initially contained more than 260 ppm of mercury of unknown speciation. The treated waste satisfied the leaching standards for mercury that qualify wastes containing less than 260 ppm for land disposal. This paper describes the extension of that work to demonstrate a full-scale process for the stabilization of a representative sludge that contained more than 260 ppm of Hg of several mercury species. RCRA (Resource Conservation and Recovery Act) regulations now require the recovery of mercury from any waste containing more than 260 ppm of mercury, usually with thermal retorts. The results of this work with a surrogate sludge, and of the previous work with an actual soil, support a proposal now before the U.S. EPA (Environmental Protection Agency) to allow such wastes to be stabilized without retorting. The full-scale demonstration with a sulfide reagent reduced the mercury concentrations in extracts of treated sludge below the relevant leaching standard, a Universal Treatment Standard (UTS) limit of 0.025 mg mercury per liter of leachate generated by the Toxicity Characteristic Leaching Procedure (TCLP). The sulfide formulation reduced the concentration to about onehalf the UTS limit

  18. 37 CFR 260.3 - Terms for making payment of royalty fees.

    Science.gov (United States)

    2010-07-01

    ..., which initially is an unincorporated division of the Recording Industry Association of America, Inc... SUBSCRIPTION SERVICES' DIGITAL TRANSMISSIONS OF SOUND RECORDINGS AND MAKING OF EPHEMERAL PHONORECORDS § 260.3..., 2003, to the Designated Agent, less any amounts previously paid by such period to the Recording...

  19. Flux normalized charged current neutrino cross sections up to neutrino energies of 260 GeV

    CERN Document Server

    Barish, B C; Blair, R; Bodek, A; Edwards, D N; Edwards, H; Fackler, O; Fisk, E; Fukushima, Y; Jenkins, K; Kerns, Q; Kondo, T; Krafczyk, G; Lee, J; Linsay, P; Ludwig, J; Marsh, W; Messner, R; Nease, D; Sciulli, F; Segler, S; Shaevitz, M; Theriot, D

    1979-01-01

    Preliminary measurements of flux normalized charged current neutrino cross sections are presented. From a sample of 6000 neutrino events with energies between 50 and 260 GeV the authors find that sigma /sub nu //E/sub nu /=(0.67+or-0.04)*10/sup -38/ cm/sup 2//GeV independent of neutrino energy. (0 refs).

  20. 17 CFR 260.10a-5 - Eligibility of Canadian Trustees.

    Science.gov (United States)

    2010-04-01

    ... pursuant to the Trust Companies Act (Canada), R.S.C. 1985, or the Canada Deposit Insurance Corporation Act... (CONTINUED) GENERAL RULES AND REGULATIONS, TRUST INDENTURE ACT OF 1939 Rule Under Section 310 § 260.10a-5... trustee under an indenture qualified or to be qualified under the Act and filed in connection with...

  1. 30 CFR 260.120 - How does royalty suspension apply to leases issued in a sale held after November 2000?

    Science.gov (United States)

    2010-07-01

    ... 30 Mineral Resources 2 2010-07-01 2010-07-01 false How does royalty suspension apply to leases issued in a sale held after November 2000? 260.120 Section 260.120 Mineral Resources MINERALS MANAGEMENT... after November 2000? We may issue leases with suspension of royalties for a period, volume or value of...

  2. 45 CFR 260.73 - How do existing welfare reform waivers affect the participation rates and work rules?

    Science.gov (United States)

    2010-10-01

    ... participation rates and work rules? 260.73 Section 260.73 Public Welfare Regulations Relating to Public Welfare... OF HEALTH AND HUMAN SERVICES GENERAL TEMPORARY ASSISTANCE FOR NEEDY FAMILIES (TANF) PROVISIONS What... existing welfare reform waivers affect the participation rates and work rules? (a) If a State is...

  3. 50 CFR 260.103 - Operations and operating procedures shall be in accordance with an effective sanitation program.

    Science.gov (United States)

    2010-10-01

    ... be in accordance with an effective sanitation program. 260.103 Section 260.103 Wildlife and Fisheries... Operations and operating procedures shall be in accordance with an effective sanitation program. (a) All..., choppers, and containers which fail to meet appropriate and adequate sanitation requirements will be...

  4. 40 CFR 260.22 - Petitions to amend part 261 to exclude a waste produced at a particular facility.

    Science.gov (United States)

    2010-07-01

    ... the manufacturing processes or other operations and feed materials producing the waste and an assessment of whether such processes, operations, or feed materials can or might produce a waste that is not... a waste produced at a particular facility. 260.22 Section 260.22 Protection of Environment...

  5. Periodic Impact Cratering and Extinction Events Over the Last 260 Million Years

    Science.gov (United States)

    Rampino, Michael R.; Caldeira, Ken

    2015-01-01

    The claims of periodicity in impact cratering and biological extinction events are controversial. Anewly revised record of dated impact craters has been analyzed for periodicity, and compared with the record of extinctions over the past 260 Myr. A digital circular spectral analysis of 37 crater ages (ranging in age from 15 to 254 Myr ago) yielded evidence for a significant 25.8 +/- 0.6 Myr cycle. Using the same method, we found a significant 27.0 +/- 0.7 Myr cycle in the dates of the eight recognized marine extinction events over the same period. The cycles detected in impacts and extinctions have a similar phase. The impact crater dataset shows 11 apparent peaks in the last 260 Myr, at least 5 of which correlate closely with significant extinction peaks. These results suggest that the hypothesis of periodic impacts and extinction events is still viable.

  6. Genomic validation of PB 260 clone of rubber (Hevea brasiliensis) at Cikumpay Plantation by SSR marker

    Science.gov (United States)

    Royani, J. I.; Safarrida, A.; Rachmawati, I.; Khairiyah, H.; Mustika, I. P.; Suyono, A.; Rudiyana, Y.; Kubil; Nurjaya; Arianto, A.

    2017-05-01

    Rubber from Hevea brasiliensis is the only commercial natural rubber in the world. Propagation of rubber trees usually done by grafting and seed germination. BPPT had been producing rubber tree by in vitro technique with embryo somatic methods. Validation of mother plant for in vitro propagation is important to compare between mother plant and propagated plants. The aim for this research was to validation of PB 260 clone that planted at Cikumpay Plantation by SSR marker. Sampling of 10 rubber leaves were done at Cikumpay Plantation based on GPS position from the area of PB 260 clone. Rubber leaves were isolated with CTAB modification method to obtained DNA. Four of SSR primers from rubber, i.e.: hmac 4, hmac 5, hmct 1, and hmct 5, were used as primers to amplification of rubber DNA. The result showed that no band that different from 10 rubber of PB 260 clone at Cikumpay Plantation. This research will continue to compare genomic validation between mother plant and propagated plants that had been produced from BPPT.

  7. 45 CFR 260.58 - What penalty relief is available to a State whose failure to meet the work participation rates is...

    Science.gov (United States)

    2010-10-01

    ... domestic violence waivers? 260.58 Section 260.58 Public Welfare Regulations Relating to Public Welfare... Special Provisions Apply to Victims of Domestic Violence? § 260.58 What penalty relief is available to a... recognized good cause domestic violence waivers? (a)(1) We will determine that a State has reasonable cause...

  8. 45 CFR 260.59 - What penalty relief is available to a State that failed to comply with the five-year limit on...

    Science.gov (United States)

    2010-10-01

    ... good cause domestic violence waivers? 260.59 Section 260.59 Public Welfare Regulations Relating to...) PROVISIONS What Special Provisions Apply to Victims of Domestic Violence? § 260.59 What penalty relief is... provided federally recognized good cause domestic violence waivers? (a)(1) We will determine that a State...

  9. Structure-function analysis for the hydroxylation of Δ4 C21-steroids by the myxobacterial CYP260B1.

    Science.gov (United States)

    Salamanca-Pinzon, Sandra Giovanna; Khatri, Yogan; Carius, Yvonne; Keller, Lena; Müller, Rolf; Lancaster, C Roy D; Bernhardt, Rita

    2016-06-01

    Myxobacterial CYP260B1 from Sorangium cellulosum was heterologously expressed in Escherichia coli and purified. The in vitro conversion of a small focused substrate library comprised of Δ4 C21-steroids and steroidal drugs using surrogate bovine redox partners shows that CYP260B1 is a novel steroid hydroxylase. CYP260B1 performs the regio- and stereoselective hydroxylation of the glucocorticoid cortodoxone (RSS) to produce 6β-OH-RSS. The substrate-free crystal structure of CYP260B1 (PDB 5HIW) was resolved. Docking of the tested ligands into the crystal structure suggested that the C17 hydroxy moiety and the presence of either a keto or a hydroxy group at C11 determine the selectivity of hydroxylation. © 2016 Federation of European Biochemical Societies.

  10. 17 CFR 260.4d-9 - Exemption for Canadian Trust Indentures from Specified Provisions of the Act.

    Science.gov (United States)

    2010-04-01

    ...) The Canada Business Corporations Act, R. S. C. 1985; (b) The Bank Act, R. S. C. 1985; (c) The Business Corporations Act, 1982 (Ontario), S. O. 1982; or (d) The Company Act, R.S.B.C. 1979, C. 59. [56 FR 30077, July... Indentures from Specified Provisions of the Act. 260.4d-9 Section 260.4d-9 Commodity and Securities Exchanges...

  11. Demonstration of New Technologies Required for the Treatment of Mixed Waste Contaminated with {ge}260 ppm Mercury

    Energy Technology Data Exchange (ETDEWEB)

    Morris, M.I.

    2002-02-06

    The Resource Conservation and Recovery Act (RCRA) defines several categories of mercury wastes, each of which has a defined technology or concentration-based treatment standard, or universal treatment standard (UTS). RCRA defines mercury hazardous wastes as any waste that has a TCLP value for mercury of 0.2 mg/L or greater. Three of these categories, all nonwastewaters, fall within the scope of this report on new technologies to treat mercury-contaminated wastes: wastes as elemental mercury; hazardous wastes with less than 260 mg/kg [parts per million (ppm)] mercury; and hazardous wastes with 260 ppm or more of mercury. While this report deals specifically with the last category--hazardous wastes with 260 ppm or more of mercury--the other two categories will be discussed briefly so that the full range of mercury treatment challenges can be understood. The treatment methods for these three categories are as follows: Waste as elemental mercury--RCRA identifies amalgamation (AMLGM) as the treatment standard for radioactive elemental mercury. However, radioactive mercury condensates from retorting (RMERC) processes also require amalgamation. In addition, incineration (IMERC) and RMERC processes that produce residues with >260 ppm of radioactive mercury contamination and that fail the RCRA toxicity characteristic leaching procedure (TCLP) limit for mercury (0.20 mg/L) require RMERC, followed by AMLGM of the condensate. Waste with <260 ppm mercury--No specific treatment method is specified for hazardous wastes containing <260 ppm. However, RCRA regulations require that such wastes (other than RMERC residues) that exceed a TCLP mercury concentration of 0.20 mg/L be treated by a suitable method to meet the TCLP limit for mercury of 0.025 mg/L. RMERC residues must meet the TCLP value of {ge}0.20 mg/L, or be stabilized and meet the {ge}0.025 mg/L limit. Waste with {ge}260 ppm mercury--For hazardous wastes with mercury contaminant concentrations {ge}260 ppm and RCRA

  12. Association between CD14 gene C-260T polymorphism and inflammatory bowel disease: a meta-analysis.

    Directory of Open Access Journals (Sweden)

    Zhengting Wang

    Full Text Available BACKGROUND: The gene encoding CD14 has been proposed as an IBD-susceptibility gene with its polymorphism C-260T being widely evaluated, yet with conflicting results. The aim of this study was to investigate the association between this polymorphism and IBD by conducting a meta-analysis. METHODOLOGY/PRINCIPAL FINDINGS: Seventeen articles met the inclusion criteria, which included a total of 18 case-control studies, including 1900 ulcerative colitis (UC cases, 2535 Crohn's disease (CD cases, and 4004 controls. Data were analyzed using STATA software. Overall, association between C-260T polymorphism and increased UC risk was significant in allelic comparison (odds ratio [OR]  =1.21, 95% confidence interval [CI]: 1.02-1.43; P=0.027, homozygote model (OR  =1.44, 95% CI: 1.03-2.01; P=0.033, as well as dominant model (OR  =1.36, 95% CI: 1.06-1.75; P=0.016. However, there was negative association between this polymorphism and CD risk across all genetic models. Subgroup analyses by ethnicity suggested the risk-conferring profiles of -260T allele and -260 TT genotype with UC in Asians, but not in Caucasians. There was a low probability of publication bias. CONCLUSIONS/SIGNIFICANCE: Expanding previous results of individual studies, our findings demonstrated that CD14 gene C-260T polymorphism might be a promising candidate marker in susceptibility to UC, especially in Asians.

  13. Dynamic nuclear polarization by frequency modulation of a tunable gyrotron of 260 GHz

    Science.gov (United States)

    Yoon, Dongyoung; Soundararajan, Murari; Cuanillon, Philippe; Braunmueller, Falk; Alberti, Stefano; Ansermet, Jean-Philippe

    2016-01-01

    An increase in Dynamic Nuclear Polarization (DNP) signal intensity is obtained with a tunable gyrotron producing frequency modulation around 260 GHz at power levels less than 1 W. The sweep rate of frequency modulation can reach 14 kHz, and its amplitude is fixed at 50 MHz. In water/glycerol glassy ice doped with 40 mM TEMPOL, the relative increase in the DNP enhancement was obtained as a function of frequency-sweep rate for several temperatures. A 68 % increase was obtained at 15 K, thus giving a DNP enhancement of about 80. By employing λ / 4 and λ / 8 polarizer mirrors, we transformed the polarization of the microwave beam from linear to circular, and achieved an increase in the enhancement by a factor of about 66% for a given power.

  14. The observation of the therapeutic effectiveness of 131I on 260 youngster with Grave's hyperthyroidism

    International Nuclear Information System (INIS)

    Liu Binwen; Gao Xiusheng; Zhang Yahua; Pu Dongli

    2003-01-01

    Objective: To study the therapeutic effect and find new ways on treatment of Grave's hyperthyroidism in youngsters. Methods: 260 Grave's hyperthyroidism patients (age under 21 years) treated with 131 I were followed up 1-16 years later. Results: 118 of all patients were cured and 55 cases improved, failed treatment 2 cases, subclinical hypothyroidism 9 cases, clinical hypothyroidism 6 cases. 35 cases were treated with 131 I two or three times. All the patients with subclinical hypothyroidism and clinical hypothyroidism caused by 131 I were cured with medicine. 131 I treatment had no effect on growth and mentality and didn't cause leukemia nor thyroid cancer. Conclusions: The therapy of youngsters with Grave's hyperthyroidism with 131 I has the same effectiveness as adult. To the youngster Grave's patients who failed medical treatment, therapy with 131 I is safe and effective. It leads to temporary hypothyroidism which can be cured with medicine, no delayed hypothyroidism has been found

  15. C26:0-Carnitine Is a New Biomarker for X-Linked Adrenoleukodystrophy in Mice and Man.

    Directory of Open Access Journals (Sweden)

    Malu-Clair van de Beek

    Full Text Available X-linked adrenoleukodystrophy (ALD, a progressive neurodegenerative disease, is caused by mutations in ABCD1 and characterized by very-long-chain fatty acids (VLCFA accumulation. Virtually all males develop progressive myelopathy (AMN. A subset of patients, however, develops a fatal cerebral demyelinating disease (cerebral ALD. Hematopoietic stem cell transplantation is curative for cerebral ALD provided the procedure is performed in an early stage of the disease. Unfortunately, this narrow therapeutic window is often missed. Therefore, an increasing number of newborn screening programs are including ALD. To identify new biomarkers for ALD, we developed an Abcd1 knockout mouse with enhanced VLCFA synthesis either ubiquitous or restricted to oligodendrocytes. Biochemical analysis revealed VLCFA accumulation in different lipid classes and acylcarnitines. Both C26:0-lysoPC and C26:0-carnitine were highly elevated in brain, spinal cord, but also in bloodspots. We extended the analysis to patients and confirmed that C26:0-carnitine is also elevated in bloodspots from ALD patients. We anticipate that validation of C26:0-carnitine for the diagnosis of ALD in newborn bloodspots may lead to a faster inclusion of ALD in newborn screening programs in countries that already screen for other inborn errors of metabolism.

  16. C26:0-Carnitine Is a New Biomarker for X-Linked Adrenoleukodystrophy in Mice and Man

    Science.gov (United States)

    van de Beek, Malu-Clair; Dijkstra, Inge M. E.; van Lenthe, Henk; Ofman, Rob; Goldhaber-Pasillas, Dalia; Schauer, Nicolas; Schackmann, Martin; Engelen-Lee, Joo-Yeon; Vaz, Frédéric M.; Kulik, Wim; Wanders, Ronald J. A.; Engelen, Marc; Kemp, Stephan

    2016-01-01

    X-linked adrenoleukodystrophy (ALD), a progressive neurodegenerative disease, is caused by mutations in ABCD1 and characterized by very-long-chain fatty acids (VLCFA) accumulation. Virtually all males develop progressive myelopathy (AMN). A subset of patients, however, develops a fatal cerebral demyelinating disease (cerebral ALD). Hematopoietic stem cell transplantation is curative for cerebral ALD provided the procedure is performed in an early stage of the disease. Unfortunately, this narrow therapeutic window is often missed. Therefore, an increasing number of newborn screening programs are including ALD. To identify new biomarkers for ALD, we developed an Abcd1 knockout mouse with enhanced VLCFA synthesis either ubiquitous or restricted to oligodendrocytes. Biochemical analysis revealed VLCFA accumulation in different lipid classes and acylcarnitines. Both C26:0-lysoPC and C26:0-carnitine were highly elevated in brain, spinal cord, but also in bloodspots. We extended the analysis to patients and confirmed that C26:0-carnitine is also elevated in bloodspots from ALD patients. We anticipate that validation of C26:0-carnitine for the diagnosis of ALD in newborn bloodspots may lead to a faster inclusion of ALD in newborn screening programs in countries that already screen for other inborn errors of metabolism. PMID:27124591

  17. C26:0-Carnitine Is a New Biomarker for X-Linked Adrenoleukodystrophy in Mice and Man.

    Science.gov (United States)

    van de Beek, Malu-Clair; Dijkstra, Inge M E; van Lenthe, Henk; Ofman, Rob; Goldhaber-Pasillas, Dalia; Schauer, Nicolas; Schackmann, Martin; Engelen-Lee, Joo-Yeon; Vaz, Frédéric M; Kulik, Wim; Wanders, Ronald J A; Engelen, Marc; Kemp, Stephan

    2016-01-01

    X-linked adrenoleukodystrophy (ALD), a progressive neurodegenerative disease, is caused by mutations in ABCD1 and characterized by very-long-chain fatty acids (VLCFA) accumulation. Virtually all males develop progressive myelopathy (AMN). A subset of patients, however, develops a fatal cerebral demyelinating disease (cerebral ALD). Hematopoietic stem cell transplantation is curative for cerebral ALD provided the procedure is performed in an early stage of the disease. Unfortunately, this narrow therapeutic window is often missed. Therefore, an increasing number of newborn screening programs are including ALD. To identify new biomarkers for ALD, we developed an Abcd1 knockout mouse with enhanced VLCFA synthesis either ubiquitous or restricted to oligodendrocytes. Biochemical analysis revealed VLCFA accumulation in different lipid classes and acylcarnitines. Both C26:0-lysoPC and C26:0-carnitine were highly elevated in brain, spinal cord, but also in bloodspots. We extended the analysis to patients and confirmed that C26:0-carnitine is also elevated in bloodspots from ALD patients. We anticipate that validation of C26:0-carnitine for the diagnosis of ALD in newborn bloodspots may lead to a faster inclusion of ALD in newborn screening programs in countries that already screen for other inborn errors of metabolism.

  18. 20 CFR 645.260 - What health and safety provisions apply to participants in Welfare-to-Work programs?

    Science.gov (United States)

    2010-04-01

    ... Administrative Requirements § 645.260 What health and safety provisions apply to participants in Welfare-to-Work... 20 Employees' Benefits 3 2010-04-01 2010-04-01 false What health and safety provisions apply to... this part, are subject to the same health and safety standards established under State and Federal law...

  19. 30 CFR 260.123 - How do I measure natural gas production for a lease issued in a sale held after November 2000?

    Science.gov (United States)

    2010-07-01

    ... 30 Mineral Resources 2 2010-07-01 2010-07-01 false How do I measure natural gas production for a lease issued in a sale held after November 2000? 260.123 Section 260.123 Mineral Resources MINERALS... issued in a sale held after November 2000? You must measure natural gas production subject to the royalty...

  20. 45 CFR 260.74 - How do existing welfare reform waivers affect the application of the Federal time-limit provisions?

    Science.gov (United States)

    2010-10-01

    ... 45 Public Welfare 2 2010-10-01 2010-10-01 false How do existing welfare reform waivers affect the application of the Federal time-limit provisions? 260.74 Section 260.74 Public Welfare Regulations Relating to....74 How do existing welfare reform waivers affect the application of the Federal time-limit provisions...

  1. Above-ground biomass and structure of 260 African tropical forests

    Science.gov (United States)

    Lewis, Simon L.; Sonké, Bonaventure; Sunderland, Terry; Begne, Serge K.; Lopez-Gonzalez, Gabriela; van der Heijden, Geertje M. F.; Phillips, Oliver L.; Affum-Baffoe, Kofi; Baker, Timothy R.; Banin, Lindsay; Bastin, Jean-François; Beeckman, Hans; Boeckx, Pascal; Bogaert, Jan; De Cannière, Charles; Chezeaux, Eric; Clark, Connie J.; Collins, Murray; Djagbletey, Gloria; Djuikouo, Marie Noël K.; Droissart, Vincent; Doucet, Jean-Louis; Ewango, Cornielle E. N.; Fauset, Sophie; Feldpausch, Ted R.; Foli, Ernest G.; Gillet, Jean-François; Hamilton, Alan C.; Harris, David J.; Hart, Terese B.; de Haulleville, Thales; Hladik, Annette; Hufkens, Koen; Huygens, Dries; Jeanmart, Philippe; Jeffery, Kathryn J.; Kearsley, Elizabeth; Leal, Miguel E.; Lloyd, Jon; Lovett, Jon C.; Makana, Jean-Remy; Malhi, Yadvinder; Marshall, Andrew R.; Ojo, Lucas; Peh, Kelvin S.-H.; Pickavance, Georgia; Poulsen, John R.; Reitsma, Jan M.; Sheil, Douglas; Simo, Murielle; Steppe, Kathy; Taedoumg, Hermann E.; Talbot, Joey; Taplin, James R. D.; Taylor, David; Thomas, Sean C.; Toirambe, Benjamin; Verbeeck, Hans; Vleminckx, Jason; White, Lee J. T.; Willcock, Simon; Woell, Hannsjorg; Zemagho, Lise

    2013-01-01

    We report above-ground biomass (AGB), basal area, stem density and wood mass density estimates from 260 sample plots (mean size: 1.2 ha) in intact closed-canopy tropical forests across 12 African countries. Mean AGB is 395.7 Mg dry mass ha−1 (95% CI: 14.3), substantially higher than Amazonian values, with the Congo Basin and contiguous forest region attaining AGB values (429 Mg ha−1) similar to those of Bornean forests, and significantly greater than East or West African forests. AGB therefore appears generally higher in palaeo- compared with neotropical forests. However, mean stem density is low (426 ± 11 stems ha−1 greater than or equal to 100 mm diameter) compared with both Amazonian and Bornean forests (cf. approx. 600) and is the signature structural feature of African tropical forests. While spatial autocorrelation complicates analyses, AGB shows a positive relationship with rainfall in the driest nine months of the year, and an opposite association with the wettest three months of the year; a negative relationship with temperature; positive relationship with clay-rich soils; and negative relationships with C : N ratio (suggesting a positive soil phosphorus–AGB relationship), and soil fertility computed as the sum of base cations. The results indicate that AGB is mediated by both climate and soils, and suggest that the AGB of African closed-canopy tropical forests may be particularly sensitive to future precipitation and temperature changes. PMID:23878327

  2. Lightest Isotope of Bh Produced Via the 209Bi(52Cr,n)260BhReaction

    Energy Technology Data Exchange (ETDEWEB)

    Nelson, Sarah L.; Gregorich, Kenneth E.; Dragojevic, Irena; Garcia, Mitch A.; Gates, Jacklyn M.; Sudowe, Ralf; Nitsche, Heino

    2007-05-07

    The lightest isotope of Bh known was produced in the new {sup 209}Bi({sup 52}Cr,n){sup 260}Bh reaction at the Lawrence Berkeley National Laboratory's 88-Inch Cyclotron. Positive identification was made by observation of eight correlated alpha particle decay chains in the focal plane detector of the Berkeley Gas-Filled Separator. {sup 260}Bh decays with a 35{sub -9}{sup +19} ms half-life by alpha particle emission mainly by a group at 10.16 MeV. The measured cross section of 59{sub -20}{sup +29} pb is approximately a factor of four larger than compared to recent model predictions. The influences of the N = 152 and Z = 108 shells on alpha decay properties are discussed.

  3. Insertion of Balloon Retained Gastrostomy Buttons: A 5-Year Retrospective Review of 260 Patients

    International Nuclear Information System (INIS)

    Power, Sarah; Kavanagh, Liam N.; Shields, Mary C.; Given, Mark F.; Keeling, Aoife N.; McGrath, Frank P.; Lee, Michael J.

    2013-01-01

    Radiologically inserted gastrostomy (RIG) is an established way of maintaining enteral nutrition in patients who cannot maintain nutrition orally. The purpose of this study was to evaluate the safety and efficacy of primary placement of a wide bore button gastrostomy in a large, varied patient population through retrospective review. All patients who underwent gastrostomy placement from January 1, 2004 to January 1, 2009 were identified. 18-Fr gastrostomy buttons (MIC-Key G) were inserted in the majority. Follow-up ranged from 6 months to 4.5 years. A total of 260 patients (M:F 140:120, average age 59.2 years) underwent gastrostomy during the study period. Overall success rate for RIG placement was 99.6 %, with success rate of 95.3 % for primary button insertion. Indications included neurological disorders (70 %), esophageal/head and neck malignancy (21 %), and other indications (9 %). Major and minor complication rates were 1.2 and 12.8 %, respectively. Thirty-day mortality rate was 6.8 %. One third of patients underwent gastrostomy reinsertion during the study period, the main indication for which was inadvertent catheter removal. Patency rate was high at 99.5 %. The maximum number of procedures in any patient was 8 (n = 2), and the average tube dwell time was 125 days. Primary radiological insertion of a wide bore button gastrostomy is a safe technique, with high success rate, high patency rate, and low major complication rate. We believe that it is feasible to attempt button gastrostomy placement in all patients, once tract length is within limits of tube length. If difficulty is encountered, then a standard tube may simply be placed instead.

  4. Difficulty in detecting discrepancies in a clinical trial report: 260-reader evaluation.

    Science.gov (United States)

    Cole, Graham D; Shun-Shin, Matthew J; Nowbar, Alexandra N; Buell, Kevin G; Al-Mayahi, Faisal; Zargaran, David; Mahmood, Saliha; Singh, Bharpoor; Mielewczik, Michael; Francis, Darrel P

    2015-06-01

    Scientific literature can contain errors. Discrepancies, defined as two or more statements or results that cannot both be true, may be a signal of problems with a trial report. In this study, we report how many discrepancies are detected by a large panel of readers examining a trial report containing a large number of discrepancies. We approached a convenience sample of 343 journal readers in seven countries, and invited them in person to participate in a study. They were asked to examine the tables and figures of one published article for discrepancies. 260 participants agreed, ranging from medical students to professors. The discrepancies they identified were tabulated and counted. There were 39 different discrepancies identified. We evaluated the probability of discrepancy identification, and whether more time spent or greater participant experience as academic authors improved the ability to detect discrepancies. Overall, 95.3% of discrepancies were missed. Most participants (62%) were unable to find any discrepancies. Only 11.5% noticed more than 10% of the discrepancies. More discrepancies were noted by participants who spent more time on the task (Spearman's ρ = 0.22, P < 0.01), and those with more experience of publishing papers (Spearman's ρ = 0.13 with number of publications, P = 0.04). Noticing discrepancies is difficult. Most readers miss most discrepancies even when asked specifically to look for them. The probability of a discrepancy evading an individual sensitized reader is 95%, making it important that, when problems are identified after publication, readers are able to communicate with each other. When made aware of discrepancies, the majority of readers support editorial action to correct the scientific record. © The Author 2015. Published by Oxford University Press on behalf of the International Epidemiological Association.

  5. Insertion of Balloon Retained Gastrostomy Buttons: A 5-Year Retrospective Review of 260 Patients

    Energy Technology Data Exchange (ETDEWEB)

    Power, Sarah, E-mail: sarahpower28@yahoo.co.uk; Kavanagh, Liam N.; Shields, Mary C.; Given, Mark F.; Keeling, Aoife N.; McGrath, Frank P.; Lee, Michael J., E-mail: mlee@rcsi.ie [Beaumont Hospital, Department of Radiology (Ireland)

    2013-04-15

    Radiologically inserted gastrostomy (RIG) is an established way of maintaining enteral nutrition in patients who cannot maintain nutrition orally. The purpose of this study was to evaluate the safety and efficacy of primary placement of a wide bore button gastrostomy in a large, varied patient population through retrospective review. All patients who underwent gastrostomy placement from January 1, 2004 to January 1, 2009 were identified. 18-Fr gastrostomy buttons (MIC-Key G) were inserted in the majority. Follow-up ranged from 6 months to 4.5 years. A total of 260 patients (M:F 140:120, average age 59.2 years) underwent gastrostomy during the study period. Overall success rate for RIG placement was 99.6 %, with success rate of 95.3 % for primary button insertion. Indications included neurological disorders (70 %), esophageal/head and neck malignancy (21 %), and other indications (9 %). Major and minor complication rates were 1.2 and 12.8 %, respectively. Thirty-day mortality rate was 6.8 %. One third of patients underwent gastrostomy reinsertion during the study period, the main indication for which was inadvertent catheter removal. Patency rate was high at 99.5 %. The maximum number of procedures in any patient was 8 (n = 2), and the average tube dwell time was 125 days. Primary radiological insertion of a wide bore button gastrostomy is a safe technique, with high success rate, high patency rate, and low major complication rate. We believe that it is feasible to attempt button gastrostomy placement in all patients, once tract length is within limits of tube length. If difficulty is encountered, then a standard tube may simply be placed instead.

  6. The Performance of PS400 Subjected to Sliding Contact at Temperatures from 260 to 927 deg C

    Science.gov (United States)

    2016-09-14

    cobalt -based superalloy bushings loaded against reciprocating PS400-coated shaft specimens in a flat-on-cylinder configuration at Hertz contact...contact at temperatures from 260 to 927C. The tests were performed on stationary, uncoated cobalt -based superalloy bushings loaded against...surface profilometer. Test apparatus/procedure Shown in Fig. 1 is the initial test hardware. The bushings were made from a cobalt -based superalloy with an

  7. Demonstration of ATG Process for Stabilizing Mercury (<260 ppm) Contaminated Mixed Waste. Mixed Waste Focus Area. OST Reference # 2407

    Energy Technology Data Exchange (ETDEWEB)

    None, None

    1999-09-01

    Mercury contaminated wastes in many forms are present at various U. S. Department of Energy (DOE) sites. Based on efforts led by the Mixed Waste Focus Area (MWFA) and its Mercury Working Group (HgWG), the inventory of wastes contaminated with <260 ppm mercury and with radionuclides stored at various DOE sites is estimated to be approximately 6,000 m3). At least 26 different DOE sites have this type of mixed low-level waste in their storage facilities. Extraction methods are required to remove mercury from waste containing >260 ppm levels, but below 260 ppm Hg contamination levels the U. S. Environmental Protection Agency (EPA) does not require removal of mercury from the waste. Steps must still be taken, however, to ensure that the final waste form does not leach mercury in excess of the limit for mercury prescribed in the Resource Conservation and Recovery Act (RCRA) when subjected to the Toxicity Characteristic Leaching Procedure (TCLP). At this time, the limit is 0.20 mg/L. However, in the year 2000, the more stringent Universal Treatment Standard (UTS) of 0.025 mg/L will be used as the target endpoint. Mercury contamination in the wastes at DOE sites presents a challenge because it exists in various forms, such as soil, sludges, and debris, as well as in different chemical species of mercury. Stabilization is of interest for radioactively contaminated mercury waste (<260 ppm Hg) because of its success with particular wastes, such as soils, and its promise of applicability to a broad range of wastes. However, stabilization methods must be proven to be adequate to meet treatment standards. It must also be proven feasible in terms of economics, operability, and safety. To date, no standard method of stabilization has been developed and proven for such varying waste types as those within the DOE complex.

  8. CD14 C260T promoter polymorphism and the risk of cerebrovascular diseases: a meta-analysis.

    Science.gov (United States)

    Banerjee, I

    2009-01-01

    Cerebrovascular diseases (CVD) are dysfunctions of the brain, resulting from diseases of blood vessels supplying the brain. Atherosclerosis is one of the major underlying causes of CVD, in which inflammation plays a crucial role. One of the inflammatory mechanisms contributing to atherogenesis is the activation of monocytes and macrophages, which could be mediated by the bacterial endotoxin lipopolysaccharide (LPS) via its receptor CD14. The C260T (rs2569190) single-nucleotide polymorphism (SNP) in the promoter region of the CD14 gene was implicated in CVD. To assess the role of this SNP in CVD, a comprehensive meta-analysis of the available genetic data was conducted. All the case-control association studies evaluating the role of CD14 C260T in CVD were identified. Of these, 7 studies (comprising a total of 1488 patients and 1600 control subjects) were included in this meta-analysis. To measure the strength of genetic association for the gene variant, the odds ratios (ORs) were calculated using both fixed and random effects for comparisons of the alleles, the genotypes, and the dominant and recessive genotype models. The results showed there was no significant association between the T allele of C260T and the risk of CVD under the fixed effects model, OR = 0.99 (95% CI (0.89, 1.09)), P = 0.84; or the random effects model, OR = 0.99 (95% CI (0.88, 1.11)), P = 0.83. Similar results were obtained for the homozygotes and the dominant and recessive models. In conclusion, the results of this meta-analysis suggest the CD14 C260T polymorphism is not a risk factor for CVD. However, more studies in ethnically varied populations are needed to evaluate in a reliable manner the role of this SNP in CVD susceptibility.

  9. XMM-Newton Observations of the Neutron Star X-Ray Transient KS 1731-260 in Quiescence

    NARCIS (Netherlands)

    Wijnands, Rudy; Guainazzi, Matteo; van der Klis, Michiel; Méndez, Mariano

    2002-01-01

    We report on XMM-Newton observations performed on 2001 September 13-14 of the neutron star X-ray transient KS 1731-260 in quiescence. The source was detected at an unabsorbed 0.5-10 keV flux of only (4-8)×10-14 ergs cm-2 s-1, depending on the model used to fit the data, which for a distance of 7 kpc

  10. Characterization and source apportionment of organic aerosol at 260 m on a meteorological tower in Beijing, China

    Science.gov (United States)

    Zhou, Wei; Wang, Qingqing; Zhao, Xiujuan; Xu, Weiqi; Chen, Chen; Du, Wei; Zhao, Jian; Canonaco, Francesco; Prévôt, André S. H.; Fu, Pingqing; Wang, Zifa; Worsnop, Douglas R.; Sun, Yele

    2018-03-01

    Despite extensive efforts toward the characterization of submicron aerosols at ground level in the megacity of Beijing, our understanding of aerosol sources and processes at high altitudes remains low. Here we conducted a 3-month real-time measurement of non-refractory submicron aerosol (NR-PM1) species at a height of 260 m from 10 October 2014 to 18 January 2015 using an aerosol chemical speciation monitor. Our results showed a significant change in aerosol composition from the non-heating period (NHP) to the heating period (HP). Organics and chloride showed clear increases during HP due to coal combustion emissions, while nitrate showed substantial decreases from 28 to 15-18 %. We also found that NR-PM1 species in the heating season can have average mass differences of 30-44 % under similar emission sources yet different meteorological conditions. Multi-linear engine 2 (ME-2) using three primary organic aerosol (OA) factors as constraints, i.e., fossil-fuel-related OA (FFOA) dominantly from coal combustion emissions, cooking OA (COA), and biomass burning OA (BBOA) resolved from ground high-resolution aerosol mass spectrometer measurements, was applied to OA mass spectra of ACSM. Two types of secondary OA (SOA) that were well correlated with nitrate and chloride-CO, respectively, were identified. SOA played a dominant role in OA during all periods at 260 m although the contributions were decreased from 72 % during NHP to 58-64 % during HP. The SOA composition also changed significantly from NHP to HP. While the contribution of oxygenated OA (OOA) was decreased from 56-63 to 32-40 %, less oxidized OOA (LO-OOA) showed a large increase from 9-16 to 24-26 %. COA contributed a considerable fraction of OA at high altitude, and the contribution was relatively similar across different periods (10-13 %). In contrast, FFOA showed a large increase during HP due to the influences of coal combustion emissions. We also observed very different OA composition between ground level

  11. Odd-Z Transactinide Compound Nucleus Reactions Including the Discovery of 260Bh

    Energy Technology Data Exchange (ETDEWEB)

    Nelson, Sarah L. [Univ. of California, Berkeley, CA (United States)

    2008-01-01

    Several reactions producing odd-Z transactinide compound nuclei were studiedwith the 88-Inch Cyclotron and the Berkeley Gas-Filled Separator at the Lawrence Berkeley National Laboratory. The goal was to produce the same compound nucleus ator near the same excitation energy with similar values of angular momentum via differentnuclear reactions. In doing so, it can be determined if there is a preference in entrancechannel, because under these experimental conditions the survival portion of Swiatecki, Siwek-Wilcznska, and Wilczynski's"Fusion By Diffusion" model is nearly identical forthe two reactions. Additionally, because the same compound nucleus is produced, theexit channel is the same. Four compound nuclei were examined in this study: 258Db, 262Bh, 266Mt, and 272Rg. These nuclei were produced by using very similar heavy-ion induced-fusion reactions which differ only by one proton in the projectile or target nucleus (e.g.: 50Ti + 209Bi vs. 51V + 208Pb). Peak 1n exit channel cross sections were determined for each reaction in each pair, and three of the four pairs' cross sections were identical within statistical uncertainties. This indicates there is not an obvious preference of entrancechannel in these paired reactions. Charge equilibration immediately prior to fusionleading to a decreased fusion barrier is the likely cause of this phenomenon. In addition to this systematic study, the lightest isotope of element 107, bohrium, was discovered in the 209Bi(52Cr,n) reaction. 260Bh was found to decay by emission of a 10.16 MeV alpha particle with a half-life of 35$+19\\atop{-9}$ ms. The cross section is 59 pb at an excitation energy of 15.0 MeV. The effect of the N = 152 shell is also seen in this isotope's alpha particle energy, the first evidence of such an effect in Bh. All reactions studied are also compared to model predictions by Swiatecki

  12. Liver biomarker and in vitro assessment confirm the hepatic origin of aminotransferase elevations lacking histopathological correlate in beagle dogs treated with GABAA receptor antagonist NP260

    International Nuclear Information System (INIS)

    Harrill, Alison H.; Eaddy, John S.; Rose, Kelly; Cullen, John M.; Ramanathan, Lakshmi; Wanaski, Stephen; Collins, Stephen; Ho, Yu; Watkins, Paul B.; LeCluyse, Edward L.

    2014-01-01

    NP260 was designed as a first-in-class selective antagonist of α4-subtype GABA A receptors that had promising efficacy in animal models of pain, epilepsy, psychosis, and anxiety. However, development of NP260 was complicated following a 28-day safety study in dogs in which pronounced elevations of serum aminotransferase levels were observed, although there was no accompanying histopathological indication of hepatocellular injury. To further investigate the liver effects of NP260, we assayed stored serum samples from the 28-day dog study for liver specific miRNA (miR-122) as well as enzymatic biomarkers glutamate dehydrogenase and sorbitol dehydrogenase, which indicate liver necrosis. Cytotoxicity assessments were conducted in hepatocytes derived from dog, rat, and human liver samples to address the species specificity of the liver response to NP260. All biomarkers, except ALT, returned toward baseline by Day 29 despite continued drug treatment, suggesting adaptation to the initial injury. In vitro analysis of the toxicity potential of NP260 to primary hepatocytes indicated a relative sensitivity of dog > human > rat, which may explain, in part, why the liver effects were not evident in the rodent safety studies. Taken together, the data indicate that a diagnostic biomarker approach, coupled with sensitive in vitro screening strategies, may facilitate interpretation of toxicity potential when an adaptive event masks the underlying toxicity. - Highlights: • NP260 caused ALT elevations in dogs without evidence of hepatocellular injury. • SDH, GLDH, and miRNA-122 elevations occurred, confirming hepatocellular necrosis. • NP260 toxicity is greater in dog and human hepatocytes than in rat hepatocytes. • Species sensitivity may explain why the rodent studies failed to indicate risk. • Diagnostic biomarkers and hepatocyte studies aid interpretation of hepatotoxicity

  13. Onset of surface stimulated emission at 260 nm from AlGaN multiple quantum wells

    KAUST Repository

    Li, Xiaohang

    2015-12-14

    We demonstrated onset of deep-ultraviolet (DUV) surface stimulated emission (SE) from c-plane AlGaNmultiple-quantum well(MQW)heterostructuresgrown on a sapphire substrate by optical pumping at room temperature. The onset of SE became observable at a pumping power density of 630 kW/cm2. Spectral deconvolution revealed superposition of a linearly amplified spontaneous emission peak at λ ∼ 257.0 nm with a full width at half maximum (FWHM) of ∼12 nm and a superlinearly amplified SE peak at λ ∼ 260 nm with a narrow FWHM of less than 2 nm. In particular, the wavelength of ∼260 nm is the shortest wavelength of surface SE from III-nitride MQWheterostructures to date. Atomic force microscopy and scanning transmission electron microscopy measurements were employed to investigate the material and structural quality of the AlGaNheterostructures, showing smooth surface and sharp layer interfaces. This study offers promising results for AlGaNheterostructuresgrown on sapphire substrates for the development of DUV vertical cavity surface emitting lasers(VCSELs).

  14. Temporal patterns of death after trauma: evaluation of circadian, diurnal, periodical and seasonal trends in 260 fatal injuries.

    Science.gov (United States)

    Søreide, K

    2010-01-01

    Temporal patterns of trauma deaths may indicate potential for prevention or systems improvement, but have been poorly investigated in the Scandinavian trauma population. This study examines patterns in trauma deaths to the occurrence in hour and time of the day, day and time in the week, and month and season. Investigation of the temporal patterns of death in 260 fatalities undergoing autopsy. Time of death were explored according to time of the day (hour; day/night), time of the week (day of week; weekday/weekend) and time of the year (month; season) and analyzed for difference in gender, age, injury type and severity, and mechanisms of injury and death. A total of 260 trauma deaths were included, of which 125 (48%) died in hospital and 194 (75%) were male. No particular peak-hour of the day when deaths occurred was found. One-third of deaths occurred during weekends. For inhospital deaths during weekends, significantly more patients had respiratory distress (RR > 20 or Trauma deaths in a Scandinavian population did not demonstrate statistically significant differences in overall circadian, weekly or seasonal patterns of trauma death occurrence. However, the impact of fatal head injuries during spring and summer warrants further investigation.

  15. Total internal conversion coefficient of the 260. 9 keV (7/sup +/->3/sup -/) transition in sup(198m)Tl

    Energy Technology Data Exchange (ETDEWEB)

    Venkateswara Rao, N.; Suryanarayana, C.; Narayana, D.G.S.; Bhuloka Reddy, S.; Satynarayana, G.; Sastry, D.L.; Chintalapudi, S.N.

    1986-02-21

    The 1.87 hours 543.7 keV (7/sup +/) isomeric state in /sup 198/Tl is produced via /sup 197/Au(..cap alpha.., 3n)sup(198m)Tl (Esub(..cap alpha..) = 35 MeV) reaction. The total conversion coefficient of 260.9 keV (7/sup +/ -> 3/sup -/) is determined for the first time by the intensity balance method. The value of ..cap alpha..sub(T)(260.9 keV) is found to be 40.1 +- 8.6 which is in good agreement with the theoretical value of Hager and Seltzer for pure M4 transition. The gamma transition probability of the 260.9 keV (M4) is calculated using the present value of ..cap alpha..sub(T) and compared with the single-particle estimate.

  16. Reliable measurement of the Seebeck coefficient of organic and inorganic materials between 260 K and 460 K

    Energy Technology Data Exchange (ETDEWEB)

    Beretta, D.; Lanzani, G. [Center for Nano Science and Technology @PoliMi, Istituto Italiano di Tecnologia, via Pascoli 70/3, 20133 Milano (MI) (Italy); Dipartimento di Fisica, P.zza Leonardo da Vinci 32, Politecnico di Milano, 20133 Milano (MI) (Italy); Bruno, P.; Caironi, M., E-mail: mario.caironi@iit.it [Center for Nano Science and Technology @PoliMi, Istituto Italiano di Tecnologia, via Pascoli 70/3, 20133 Milano (MI) (Italy)

    2015-07-15

    A new experimental setup for reliable measurement of the in-plane Seebeck coefficient of organic and inorganic thin films and bulk materials is reported. The system is based on the “Quasi-Static” approach and can measure the thermopower in the range of temperature between 260 K and 460 K. The system has been tested on a pure nickel bulk sample and on a thin film of commercially available PEDOT:PSS deposited by spin coating on glass. Repeatability within 1.5% for the nickel sample is demonstrated, while accuracy in the measurement of both organic and inorganic samples is guaranteed by time interpolation of data and by operating with a temperature difference over the sample of less than 1 K.

  17. 260 fs and 1 nJ pulse generation from a compact, mode-locked Tm-doped fiber laser.

    Science.gov (United States)

    Sobon, Grzegorz; Sotor, Jaroslaw; Pasternak, Iwona; Krajewska, Aleksandra; Strupinski, Wlodek; Abramski, Krzysztof M

    2015-11-30

    We report on generation of 260 fs-short pulses with energy of 1.1 nJ from a fully fiberized, monolithic Tm-doped fiber laser system. The design comprises a simple, graphene-based ultrafast oscillator and an integrated all-fiber chirped pulse amplifier (CPA). The system generates 110 mW of average power at 100.25 MHz repetition rate and central wavelength of 1968 nm. This is, to our knowledge, the highest pulse energy generated from a fully fiberized sub-300 fs Tm-doped laser, without the necessity of using grating-based dispersion compensation. Such compact, robust and cost-effective system might serve as a seed source for nonlinear frequency conversion or mid-infrared supercontinuum generation.

  18. New Sesquiterpene Oxidations with CYP260A1 and CYP264B1 from Sorangium cellulosum So ce56.

    Science.gov (United States)

    Schifrin, Alexander; Litzenburger, Martin; Ringle, Michael; Ly, Thuy T B; Bernhardt, Rita

    2015-12-01

    Sesquiterpenes are natural products derived from the common precursor farnesyl pyrophosphate (FPP) but are highly diverse in structure and function. Cytochrome P450 enzymes (P450s) exhibit the unique ability to introduce molecular oxygen into non-activated C-H bonds. In plant biosynthetic pathways, P450s commonly derivatize sesquiterpene hydrocarbons. However, the potential of bacterial P450s for terpene derivatization is still underinvestigated. This work compares the substrate specificities and regioselectivities of the sesquiterpene hydroxylases CYP260A1 and CYP264B1 from myxobacterium Sorangium cellulosum So ce56. Four tested substrate classes (eremophilanes, humulanes, caryophyllanes, and cedranes) were converted by both P450s. The achievable variety of oxidations is demonstrated on the model substrates (+)-nootkatone and zerumbone. Increasing the number of functionally investigated P450s, this study represents a step towards the selective derivatization of sesquiterpenes. © 2015 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.

  19. Deformation effects in the alpha accompanied cold ternary fission of even-even {sup 244-260}Cf isotopes

    Energy Technology Data Exchange (ETDEWEB)

    Santhosh, K.P.; Krishnan, Sreejith [Kannur University, School of Pure and Applied Physics, Payyanur, Kerala (India)

    2016-04-15

    Within the unified ternary fission model (UTFM), the alpha accompanied ternary fission of even-even {sup 244-260}Cf isotopes has been studied by taking the interacting barrier as the sum of Coulomb and proximity potential. For the alpha accompanied ternary fission of the {sup 244}Cf isotope, the highest yield is obtained for the fragment combination {sup 108}Ru + {sup 4}He + {sup 132}Te, which contains the near doubly magic nucleus {sup 132}Te (N = 80, Z = 52). In the case of {sup 246}Cf and {sup 248}Cf isotopes, the highest yield is obtained for the fragment combinations with the near doubly magic nucleus {sup 134}Te (N = 82, Z = 52) as the heaviest fragment. The highest yield obtained for {sup 250}Cf, {sup 252}Cf, {sup 254}Cf, {sup 256}Cf, {sup 258}Cf and {sup 260}Cf isotopes is for the fragment combination with the doubly magic nucleus {sup 132}Sn (N = 82), Z = 50 as the heaviest fragment. We have included the effect of deformation and orientation of fragments and this has revealed that in addition to the closed shell effect, ground-state deformation also plays an important role in the calculation of the relative yield of favorable fragment combinations. The computed isotopic yields for the alpha accompanied ternary fission of the {sup 252}Cf isotope are found to be in agreement with the experimental data. The emission probability and kinetic energy of the long-range alpha particle is calculated for the various isotopes of Cf and are found to be in good agreement with the experimental data. (orig.)

  20. 76 FR 36395 - Airworthiness Directives; Piper Aircraft, Inc. Models PA-24, PA-24-250, and PA-24-260 Airplanes

    Science.gov (United States)

    2011-06-22

    ..., Inc. Models PA-24, PA- 24-250, and PA-24-260 Airplanes AGENCY: Federal Aviation Administration (FAA... September 15, 2004. This SAIB alerted owners and operators of Piper Aircraft, Inc. (Piper) Models PA-23, PA-24, PA-30, and PA-39 airplanes of potential corrosion of the stabilator torque tube, attach fittings...

  1. Application of a diagnostic methodology by quantification of 26:0 lysophosphatidylcholine in dried blood spots for Japanese newborn screening of X-linked adrenoleukodystrophy

    Directory of Open Access Journals (Sweden)

    Chen Wu

    2017-09-01

    Full Text Available X-linked adrenoleukodystrophy (X-ALD is a rare inherited metabolic disease that results in the accumulation of very long chain fatty acids (VLCFA in plasma and all tissues. Recent studies regarding cerebral X-ALD (CALD treatment emphasize the importance of its early diagnosis. 26:0 lysophosphatidylcholine (LysoPC is a sensitive biomarker for newborn screening of X-ALD, while its application for Japanese DBS is unclear. Therefore, we evaluated the feasibility of 20:0 LysoPC and 24:0 LysoPC along with 26:0 LysoPC for diagnosing X-ALD in a cohort of newborns (n = 604, healthy adults (n = 50 and patients (n = 4. Results indicated that 26:0 LysoPC had strong significance for discrimination of patients by the amounts of 2.0 to 4.0 and 0.1 to 1.9 pmol/punch for patients and newborns/healthy adults, respectively. Based on these values, we recommend that further diagnostic confirmation is essential if the amount of 26:0 LysoPC in DBS is above 1.7 pmol/punch.

  2. Neonatal detection of Aicardi Goutières Syndrome by increased C26:0 lysophosphatidylcholine and interferon signature on newborn screening blood spots.

    Science.gov (United States)

    Armangue, Thais; Orsini, Joseph J; Takanohashi, Asako; Gavazzi, Francesco; Conant, Alex; Ulrick, Nicole; Morrissey, Mark A; Nahhas, Norah; Helman, Guy; Gordish-Dressman, Heather; Orcesi, Simona; Tonduti, Davide; Stutterd, Chloe; van Haren, Keith; Toro, Camilo; Iglesias, Alejandro D; van der Knaap, Marjo S; Goldbach Mansky, Raphaela; Moser, Anne B; Jones, Richard O; Vanderver, Adeline

    2017-11-01

    Aicardi Goutières Syndrome (AGS) is a heritable interferonopathy associated with systemic autoinflammation causing interferon (IFN) elevation, central nervous system calcifications, leukodystrophy and severe neurologic sequelae. An infant with TREX1 mutations was recently found to have abnormal C26:0 lysophosphatidylcholine (C26:0 Lyso-PC) in a newborn screening platform for X-linked adrenoleukodystrophy, prompting analysis of this analyte in retrospectively collected samples from individuals affected by AGS. In this study, we explored C26:0 Lyso-PC levels and IFN signatures in newborn blood spots and post-natal blood samples in 19 children with a molecular and clinical diagnosis of AGS and in the blood spots of 22 healthy newborns. We used Nanostring nCounter™ for IFN-induced gene analysis and a high-performance liquid chromatography with tandem mass spectrometry (HPLC MS/MS) newborn screening platform for C26:0 Lyso-PC analysis. Newborn screening cards from patients across six AGS associated genes were collected, with a median disease presentation of 2months. Thirteen out of 19 (68%) children with AGS had elevations of first tier C26:0 Lyso-PC (>0.4μM), that would have resulted in a second screen being performed in a two tier screening system for X-linked adrenoleukodystrophy (X-ALD). The median (95%CI) of first tier C26:0 Lyso-PC values in AGS individuals (0.43μM [0.37-0.48]) was higher than that seen in controls (0.21μM [0.21-0.21]), but lower than X-ALD individuals (0.72μM [0.59-0.84])(p<0.001). Fourteen of 19 children had elevated expression of IFN signaling on blood cards relative to controls (Sensitivity 73.7%, 95%CI 51-88%, Specificity 95%, 95% CI 78-99%) including an individual with delayed disease presentation (36months of age). All five AGS patients with negative IFN signature at birth had RNASEH2B mutations. Consistency of agreement between IFN signature in neonatal and post-natal samples was high (0.85). This suggests that inflammatory markers

  3. Basic residues R260 and K357 affect the conformational dynamics of the major facilitator superfamily multidrug transporter LmrP.

    Directory of Open Access Journals (Sweden)

    Wei Wang

    Full Text Available Secondary-active multidrug transporters can confer resistance on cells to pharmaceuticals by mediating their extrusion away from intracellular targets via substrate/H(+(Na(+ antiport. While the interactions of catalytic carboxylates in these transporters with coupling ions and substrates (drugs have been studied in some detail, the functional importance of basic residues has received much less attention. The only two basic residues R260 and K357 in transmembrane helices in the Major Facilitator Superfamily transporter LmrP from Lactococcus lactis are present on the outer surface of the protein, where they are exposed to the phospholipid head group region of the outer leaflet (R260 and inner leaflet (K357 of the cytoplasmic membrane. Although our observations on the proton-motive force dependence and kinetics of substrate transport, and substrate-dependent proton transport demonstrate that K357A and R260A mutants are affected in ethidium-proton and benzalkonium-proton antiport compared to wildtype LmrP, our findings suggest that R260 and K357 are not directly involved in the binding of substrates or the translocation of protons. Secondary-active multidrug transporters are thought to operate by a mechanism in which binding sites for substrates are alternately exposed to each face of the membrane. Disulfide crosslinking experiments were performed with a double cysteine mutant of LmrP that reports the substrate-stimulated transition from the outward-facing state to the inward-facing state with high substrate-binding affinity. In the experiments, the R260A and K357A mutations were found to influence the dynamics of these major protein conformations in the transport cycle, potentially by removing the interactions of R260 and K357 with phospholipids and/or other residues in LmrP. The R260A and K357A mutations therefore modify the maximum rate at which the transport cycle can operate and, as the transitions between conformational states are differently

  4. Advanced Coal Liquefaction Research and Development Facility, Wilsonville, Alabama. Run 260 with Black Thunder Mine subbituminous coal: Technical progress report

    Energy Technology Data Exchange (ETDEWEB)

    1992-01-01

    This report presents the results of Run 260 performed at the Advanced Coal Liquefaction R&D Facility in Wilsonville. The run was started on July 17, 1990 and continued until November 14, 1990, operating in the Close-Coupled Integrated Two-Stage Liquefaction mode processing Black Thunder mine subbituminous coal (Wyodak-Anderson seam from Wyoming Powder River Basin). Both thermal/catalytic and catalytic/thermal tests were performed to determine the methods for reducing solids buildup in a subbituminous coal operation, and to improve product yields. A new, smaller interstage separator was tested to reduce solids buildup by increasing the slurry space velocity in the separator. In order to obtain improved coal and resid conversions (compared to Run 258) full-volume thermal reactor and 3/4-volume catalytic reactor were used. Shell 324 catalyst, 1/16 in. cylindrical extrudate, at a replacement rate of 3 lb/ton of MF coal was used in the catalytic stage. Iron oxide was used as slurry catalyst at a rate of 2 wt % MF coal throughout the run. (TNPS was the sulfiding agent.)

  5. The impact of delayed biliary decompression and anti-microbial therapy in 260 patients with cholangitis-associated septic shock.

    Science.gov (United States)

    Karvellas, C J; Abraldes, J G; Zepeda-Gomez, S; Moffat, D C; Mirzanejad, Y; Vazquez-Grande, G; Esfahani, E K; Kumar, A

    2016-10-01

    Cholangitis-associated septic shock carries significant mortality. There is uncertainty regarding the most appropriate time to achieve biliary decompression. To determine whether the timing of biliary decompression and anti-microbial therapy affect the survival in cholangitis patients with septic shock. Nested retrospective cohort study of all cholangitis-associated septic shock patients (hypotension requiring vasopressors) from an international, multi-centre database between 1996 and 2011. Among 260 patients (mean age 69 years, 57% male), overall mortality was 37%. Compared to nonsurvivors (n = 96), survivors (n = 164) had lower mean admission Acute Physiology And Chronic Health Evaluation (APACHE) II (22 vs. 28, P shock, P 12 h [OR 3.40 (1.12-10.31)] were all significantly associated with increased mortality (P septic shock secondary to acute cholangitis have significant mortality. Endoscopic biliary decompression >12 h after the onset of shock and delayed receipt of appropriate anti-microbial therapy were both significantly associated with adverse hospital outcome. This might suggest that early initiation of anti-microbial therapy and urgent biliary decompression (within 12 h) could potentially improve outcomes in this high-risk patient population. © 2016 John Wiley & Sons Ltd.

  6. Process integration for simultaneous saccharification, fermentation, and recovery (SSFR): production of butanol from corn stover using Clostridium beijerinckii P260.

    Science.gov (United States)

    Qureshi, N; Singh, V; Liu, S; Ezeji, T C; Saha, B C; Cotta, M A

    2014-02-01

    A simultaneous saccharification, fermentation, and recovery (SSFR) process was developed for the production of acetone-butanol-ethanol (AB or ABE), of which butanol is the main product, from corn stover employing Clostridium beijerinckii P260. Of the 86 g L(-1) corn stover provided, over 97% of the sugars were released during hydrolysis and these were fermented completely with an ABE productivity of 0.34 g L(-1)h(-1) and yield of 0.39. This productivity is higher than 0.31 g L(-1)h(-1) when using glucose as a substrate demonstrating that AB could be produced efficiently from lignocellulosic biomass. Acetic acid that was released from the biomass during pretreatment and hydrolysis was also used by the culture to produce AB. An average rate of generation of sugars during corn stover hydrolysis was 0.98 g L(-1)h(-1). In this system AB was recovered using vacuum, and as a result of this (simultaneous product recovery), 100% sugars were used by the culture. Published by Elsevier Ltd.

  7. Demonstration of NFS DeHg Process for Stabilizing Mercury (<260 ppm) Contaminated Mixed Waste. Mixed Waste Focus Area. OST Reference Number 2229

    Energy Technology Data Exchange (ETDEWEB)

    None, None

    1999-09-01

    Mercury-contaminated wastes in many forms are present at various U. S. Department of Energy (DOE) sites. Based on efforts led by the Mixed Waste Focus Area (MWFA) and its Mercury Working Group (HgWG), the inventory of wastes contaminated with < 260 ppm mercury and with radionuclides stored at various DOE sites is estimated to be approximately 6,000 m3 (Conley, Morris, Osborne-Lee, and Hulet 1998). At least 26 different DOE sites have this type of mixed low-level waste in their storage facilities. Extraction methods are required to remove mercury from waste containing >260 ppm levels, but below 260 ppm Hg contamination levels, the U. S. Environmental Protection Agency (EPA) does not require removal of mercury from the waste. Steps must still be taken, however, to ensure that the final waste form does not leach mercury in excess of the limit for mercury prescribed in the Resource Conservation and Recovery Act (RCRA) when subjected to the Toxicity Characteristic Leaching Procedure (TCLP). At this time, the limit is 0.20mg/L. However, in the year 2000, the more stringent Universal Treatment Standard (UTS) of 0.025 mg/L will be used as the target endpoint. Mercury contamination in the wastes at DOE sites presents a challenge because it exists in various forms, such as soil, sludges, and debris. Stabilization is of interest for radioactively contaminated mercury waste (<260 ppm Hg) because of its success with particular wastes, such as soils, and its promise of applicability to a broad range of wastes. However, stabilization methods must be proven to be adequate to meet treatment standards and to be feasible in terms of economics, operability, and safety. To date, no standard method of stabilization has been developed and proven for such varying waste types as those within the DOE complex.

  8. K2-60b and K2-107b. A Sub-Jovian and a Jovian Planet from the K2 Mission

    Energy Technology Data Exchange (ETDEWEB)

    Eigmüller, Philipp; Csizmadia, Szilard; Smith, Alexis M. S.; Cabrera, Juan; Erikson, Anders [Institute of Planetary Research, German Aerospace Center, Rutherfordstrasse 2, D-12489 Berlin (Germany); Gandolfi, Davide; Barragán, Oscar [Dipartimento di Fisica, Universitá di Torino, via P. Giuria 1, I-10125 Torino (Italy); Persson, Carina M.; Fridlund, Malcolm [Department of Earth and Space Sciences, Chalmers University of Technology, Onsala Space Observatory, SE-439 92 Onsala (Sweden); Donati, Paolo; Cusano, Felice [INAF—Osservatorio Astronomico di Bologna, Via Ranzani, 1, I-40127, Bologna (Italy); Korth, Judith; Grziwa, Sascha [Rheinisches Institut für Umweltforschung an der Universität zu Köln, Aachener Strasse 209, D-50931 Köln (Germany); Prieto-Arranz, Jorge; Nespral, David; Deeg, Hans J. [Instituto de Astrofísica de Canarias, E-38205 La Laguna, Tenerife (Spain); Saario, Joonas [Nordic Optical Telescope, Apartado 474, E-38700, Santa Cruz de La Palma (Spain); Cochran, William D.; Endl, Michael [Department of Astronomy and McDonald Observatory, University of Texas at Austin, 2515 Speedway, Stop C1400, Austin, TX 78712 (United States); Guenther, Eike W. [Thüringer Landessternwarte Tautenburg, Sternwarte 5, D-07778 Tautenberg (Germany); and others

    2017-03-01

    We report the characterization and independent detection of K2-60b, as well as the detection and characterization of K2-107b, two transiting hot gaseous planets from the K2 space mission. We confirm the planetary nature of the two systems and determine their fundamental parameters combining the K2 time-series data with FIES@NOT and HARPS-N@TNG spectroscopic observations. K2-60b has a radius of 0.683 ± 0.037 R {sub Jup} and a mass of 0.426 ± 0.037 M {sub Jup} and orbits a G4 V star with an orbital period of 3.00267 ± 0.00006 days. K2-107b has a radius of 1.44 ± 0.15 R {sub Jup} and a mass of 0.84 ± 0.08 M {sub Jup} and orbits an F9 IV star every 3.31392 ± 0.00002 days. K2-60b is among the few planets at the edge of the so-called “desert” of short-period sub-Jovian planets. K2-107b is a highly inflated Jovian planet orbiting an evolved star about to leave the main sequence.

  9. K2-60b and K2-107b. A Sub-Jovian and a Jovian Planet from the K2 Mission

    Science.gov (United States)

    Eigmüller, Philipp; Gandolfi, Davide; Persson, Carina M.; Donati, Paolo; Fridlund, Malcolm; Csizmadia, Szilard; Barragán, Oscar; Smith, Alexis M. S.; Cabrera, Juan; Korth, Judith; Grziwa, Sascha; Prieto-Arranz, Jorge; Nespral, David; Saario, Joonas; Cochran, William D.; Cusano, Felice; Deeg, Hans J.; Endl, Michael; Erikson, Anders; Guenther, Eike W.; Hatzes, Artie P.; Pätzold, Martin; Rauer, Heike

    2017-03-01

    We report the characterization and independent detection of K2-60b, as well as the detection and characterization of K2-107b, two transiting hot gaseous planets from the K2 space mission. We confirm the planetary nature of the two systems and determine their fundamental parameters combining the K2 time-series data with FIES@NOT and HARPS-N@TNG spectroscopic observations. K2-60b has a radius of 0.683 ± 0.037 R Jup and a mass of 0.426 ± 0.037 M Jup and orbits a G4 V star with an orbital period of 3.00267 ± 0.00006 days. K2-107b has a radius of 1.44 ± 0.15 R Jup and a mass of 0.84 ± 0.08 M Jup and orbits an F9 IV star every 3.31392 ± 0.00002 days. K2-60b is among the few planets at the edge of the so-called “desert” of short-period sub-Jovian planets. K2-107b is a highly inflated Jovian planet orbiting an evolved star about to leave the main sequence.

  10. The CD14 C-260T single nucleotide polymorphism (SNP) modulates monocyte/macrophage activation in treated HIV-infected individuals.

    Science.gov (United States)

    Rajasuriar, Reena; Kong, Yong Yean; Nadarajah, Reshika; Abdullah, Noor Kamila; Spelman, Tim; Yuhana, Muhamad Yazli; Ponampalavanar, Sasheela; Kamarulzaman, Adeeba; Lewin, Sharon R

    2015-01-27

    HIV-infected individuals have an increased risk of cardiovascular disease (CVD). T-allele carriers of the CD14 C-260T single-nucleotide polymorphism (SNP) have reported increased expression of the LPS-binding receptor, CD14 and inflammation in the general population. Our aim was to explore the relationship of this SNP with monocyte/macrophage activation and inflammation and its association with sub-clinical atherosclerosis in HIV-infected individuals. Patients with no pre-existing CVD risk factors on suppressive antiretroviral therapy were recruited from University Malaya Medical Centre, Malaysia (n = 84). The CD14 C-260T and TLR4 SNPs, Asp299Gly and Thr399Ile were genotyped and soluble(s) CD14 and sCD163 and high-sensitivity C-reactive protein, hsCRP were measured in plasma. Subclinical atherosclerosis was assessed by measuring carotid intima media thickness (cIMT). The association between CD14 C-260T SNP carriage and cIMT was assessed in a multivariable quantile regression model where a p-value of CVD risk profile.

  11. Simultaneous measurements of particle number size distributions at ground level and 260 m on a meteorological tower in urban Beijing, China

    Science.gov (United States)

    Du, Wei; Zhao, Jian; Wang, Yuying; Zhang, Yingjie; Wang, Qingqing; Xu, Weiqi; Chen, Chen; Han, Tingting; Zhang, Fang; Li, Zhanqing; Fu, Pingqing; Li, Jie; Wang, Zifa; Sun, Yele

    2017-06-01

    Despite extensive studies into the characterization of particle number size distributions at ground level, real-time measurements above the urban canopy in the megacity of Beijing have never been performed to date. Here we conducted the first simultaneous measurements of size-resolved particle number concentrations at ground level and 260 m in urban Beijing from 22 August to 30 September. Our results showed overall similar temporal variations in number size distributions between ground level and 260 m, yet periods with significant differences were also observed. Particularly, accumulation-mode particles were highly correlated (r2 = 0. 85) at the two heights, while Aitken-mode particles presented more differences. Detailed analysis suggests that the vertical differences in number concentrations strongly depended on particle size, and particles with a mobility diameter between 100 and 200 nm generally showed higher concentrations at higher altitudes. Particle growth rates and condensation sinks were also calculated, which were 3.2 and 3.6 nm h-1, and 2.8 × 10-2 and 2.9 × 10-2 s-1, at ground level and 260 m, respectively. By linking particle growth with aerosol composition, we found that organics appeared to play an important role in the early stage of the growth (09:00-12:00 LT) while sulfate was also important during the later period. Positive matrix factorization of size-resolved number concentrations identified three common sources at ground level and 260 m, including a factor associated with new particle formation and growth events (NPEs), and two secondary factors that represent photochemical processing and regional transport. Cooking emission was found to have a large contribution to small particles and showed much higher concentration at ground level than 260 m in the evening. These results imply that investigation of NPEs at ground level in megacities needs to consider the influences of local cooking emissions. The impacts of regional emission controls on

  12. Characterization and source apportionment of organic aerosol at 260 m on a meteorological tower in Beijing, China

    Directory of Open Access Journals (Sweden)

    W. Zhou

    2018-03-01

    Full Text Available Despite extensive efforts toward the characterization of submicron aerosols at ground level in the megacity of Beijing, our understanding of aerosol sources and processes at high altitudes remains low. Here we conducted a 3-month real-time measurement of non-refractory submicron aerosol (NR-PM1 species at a height of 260 m from 10 October 2014 to 18 January 2015 using an aerosol chemical speciation monitor. Our results showed a significant change in aerosol composition from the non-heating period (NHP to the heating period (HP. Organics and chloride showed clear increases during HP due to coal combustion emissions, while nitrate showed substantial decreases from 28 to 15–18 %. We also found that NR-PM1 species in the heating season can have average mass differences of 30–44 % under similar emission sources yet different meteorological conditions. Multi-linear engine 2 (ME-2 using three primary organic aerosol (OA factors as constraints, i.e., fossil-fuel-related OA (FFOA dominantly from coal combustion emissions, cooking OA (COA, and biomass burning OA (BBOA resolved from ground high-resolution aerosol mass spectrometer measurements, was applied to OA mass spectra of ACSM. Two types of secondary OA (SOA that were well correlated with nitrate and chloride–CO, respectively, were identified. SOA played a dominant role in OA during all periods at 260 m although the contributions were decreased from 72 % during NHP to 58–64 % during HP. The SOA composition also changed significantly from NHP to HP. While the contribution of oxygenated OA (OOA was decreased from 56–63 to 32–40 %, less oxidized OOA (LO-OOA showed a large increase from 9–16 to 24–26 %. COA contributed a considerable fraction of OA at high altitude, and the contribution was relatively similar across different periods (10–13 %. In contrast, FFOA showed a large increase during HP due to the influences of coal combustion emissions. We also

  13. Custodian for elderly with memory impairment in Sweden – a study of 260 physicians’ statements to the court

    Science.gov (United States)

    2014-01-01

    Background In the modern world with new family structures, international migration and increased life expectancy, there is a growing need for legal ways of assisting elderly with impaired mental capacity to decide about their life and assets. There are few studies about the physician’s role when a court appoints proxies for vulnerable elderly. Many doctors do not know how to assess mental capacity, and most lawyers and judges know little about medicine. Methods Applications for a custodian sent to the Stockholm Chief Guardian’ Office in Sweden were used. Physician’s statements to the court for elderly with memory impairment were selected and 260 statements were scrutinized with regard to formal quality, the narrative content and the physician who wrote it. Results The quality of the statements varied from one sentence to excellent. Most statements were written by senior family practitioners or geriatricians. Seventeen % of the statements were handwritten and had more formal shortcomings than machine/computer written statements. The majority of patients needed massive help with daily life and economy. Median age was 84 years of age. MMSE score was given in 20% of the cases and varied from 6–27.A diagnosis of dementia was established in 57%. At the time of application, at least 48% were in a hospital or nursing home and at least 27% were in their private home. Only 5% were living with a spouse or a child. In 53% of the cases, the doctor knew the patient, but in 40% of the cases, the identity of the patient was not confirmed. The physician found that 54% were unable to understand the idea of getting a custodian, but out of those very vulnerable elderly, 20% had signed consent and 57% were considered able to be heard in court. Conclusions There is a large variation in the quality of physicians’ statements to the court concerning the mental capacity of elderly patients with cognitive impairment. Many statements have serious short-comings, and the system is

  14. Custodian for elderly with memory impairment in Sweden - a study of 260 physicians' statements to the court.

    Science.gov (United States)

    Björkstén, Karin S; Fälldin, Kerstin; Ulfvarson, Johanna

    2014-08-26

    In the modern world with new family structures, international migration and increased life expectancy, there is a growing need for legal ways of assisting elderly with impaired mental capacity to decide about their life and assets. There are few studies about the physician's role when a court appoints proxies for vulnerable elderly. Many doctors do not know how to assess mental capacity, and most lawyers and judges know little about medicine. Applications for a custodian sent to the Stockholm Chief Guardian' Office in Sweden were used. Physician's statements to the court for elderly with memory impairment were selected and 260 statements were scrutinized with regard to formal quality, the narrative content and the physician who wrote it. The quality of the statements varied from one sentence to excellent. Most statements were written by senior family practitioners or geriatricians. Seventeen % of the statements were handwritten and had more formal shortcomings than machine/computer written statements.The majority of patients needed massive help with daily life and economy. Median age was 84 years of age. MMSE score was given in 20% of the cases and varied from 6-27.A diagnosis of dementia was established in 57%. At the time of application, at least 48% were in a hospital or nursing home and at least 27% were in their private home. Only 5% were living with a spouse or a child. In 53% of the cases, the doctor knew the patient, but in 40% of the cases, the identity of the patient was not confirmed. The physician found that 54% were unable to understand the idea of getting a custodian, but out of those very vulnerable elderly, 20% had signed consent and 57% were considered able to be heard in court. There is a large variation in the quality of physicians' statements to the court concerning the mental capacity of elderly patients with cognitive impairment. Many statements have serious short-comings, and the system is not safe. There is a strong need for guide

  15. Correlation between Wavelength Dispersive X-ray Fluorescence (WDXRF) analysis of hardened concrete for chlorides vs. Atomic Absorption (AA) analysis in accordance with AASHTO T- 260; sampling and testing for chloride ion in concrete and concrete raw mater

    Science.gov (United States)

    2014-04-01

    A correlation between Wavelength Dispersive X-ray Fluorescence(WDXRF) analysis of Hardened : Concrete for Chlorides and Atomic Absorption (AA) analysis (current method AASHTO T-260, procedure B) has been : found and a new method of analysis has been ...

  16. Terrorism x Principle of Legality: The Consequences of Criminal Law of The Enemy at the Law N. 13.260/16

    Directory of Open Access Journals (Sweden)

    Ana Claudia da Silva Abreu

    2016-12-01

    Full Text Available The article deals with the crime of terrorism, particularly the criminal conduct introduced by law number 13.260/16. The global demand after the terrorist attacks of September 11, 2001, occurred in the United States, there is the adoption of legislative measures aimed at combating such crime. The anti-terror laws usually falls within the context of so-called Criminal Law of the enemy. However, it is necessary to analyze the principle of legality as a limit of criminalization, to set the terrorist phenomenon in the context of democratic societies. It was adopted the monographic method, while technical research, the indirect documentation.

  17. Liver biomarker and in vitro assessment confirm the hepatic origin of aminotransferase elevations lacking histopathological correlate in beagle dogs treated with GABA{sub A} receptor antagonist NP260

    Energy Technology Data Exchange (ETDEWEB)

    Harrill, Alison H., E-mail: ahharrill@uams.edu [College of Public Health, The University of Arkansas for Medical Sciences, Little Rock, AR 72205 (United States); The Hamner-University of North Carolina Institute for Drug Safety Sciences, The Hamner Institutes for Health Sciences, Research Triangle Park, NC 27709 (United States); Eaddy, John S. [The Hamner-University of North Carolina Institute for Drug Safety Sciences, The Hamner Institutes for Health Sciences, Research Triangle Park, NC 27709 (United States); Rose, Kelly [The Institute for Chemical Safety Sciences, The Hamner Institutes for Health Sciences, Research Triangle Park, NC 27709 (United States); Cullen, John M. [College of Veterinary Medicine, North Carolina State University, Raleigh, NC 27607 (United States); Ramanathan, Lakshmi [QPS, Newark, DE 19711 (United States); Wanaski, Stephen; Collins, Stephen; Ho, Yu [NeuroTherapeutics Pharma, Inc., Chicago, IL 60631 (United States); Watkins, Paul B. [The Hamner-University of North Carolina Institute for Drug Safety Sciences, The Hamner Institutes for Health Sciences, Research Triangle Park, NC 27709 (United States); Schools of Pharmacy and Medicine, The University of North Carolina at Chapel Hill, Chapel Hill, NC 27599 (United States); LeCluyse, Edward L. [The Institute for Chemical Safety Sciences, The Hamner Institutes for Health Sciences, Research Triangle Park, NC 27709 (United States)

    2014-06-01

    NP260 was designed as a first-in-class selective antagonist of α4-subtype GABA{sub A} receptors that had promising efficacy in animal models of pain, epilepsy, psychosis, and anxiety. However, development of NP260 was complicated following a 28-day safety study in dogs in which pronounced elevations of serum aminotransferase levels were observed, although there was no accompanying histopathological indication of hepatocellular injury. To further investigate the liver effects of NP260, we assayed stored serum samples from the 28-day dog study for liver specific miRNA (miR-122) as well as enzymatic biomarkers glutamate dehydrogenase and sorbitol dehydrogenase, which indicate liver necrosis. Cytotoxicity assessments were conducted in hepatocytes derived from dog, rat, and human liver samples to address the species specificity of the liver response to NP260. All biomarkers, except ALT, returned toward baseline by Day 29 despite continued drug treatment, suggesting adaptation to the initial injury. In vitro analysis of the toxicity potential of NP260 to primary hepatocytes indicated a relative sensitivity of dog > human > rat, which may explain, in part, why the liver effects were not evident in the rodent safety studies. Taken together, the data indicate that a diagnostic biomarker approach, coupled with sensitive in vitro screening strategies, may facilitate interpretation of toxicity potential when an adaptive event masks the underlying toxicity. - Highlights: • NP260 caused ALT elevations in dogs without evidence of hepatocellular injury. • SDH, GLDH, and miRNA-122 elevations occurred, confirming hepatocellular necrosis. • NP260 toxicity is greater in dog and human hepatocytes than in rat hepatocytes. • Species sensitivity may explain why the rodent studies failed to indicate risk. • Diagnostic biomarkers and hepatocyte studies aid interpretation of hepatotoxicity.

  18. Comparison of the ages of large-body impacts, flood-basalt eruptions, ocean-anoxic events and extinctions over the last 260 million years: a statistical study

    Science.gov (United States)

    Rampino, Michael R.; Caldeira, Ken

    2018-03-01

    Many studies have linked mass extinction events with the catastrophic effects of large-body impacts and flood-basalt eruptions, sometimes as competing explanations. We find that the ages of at least 10 out of a total of 11 documented extinction events over the last 260 Myr (12 out of 13 if we include two lesser extinction events) coincide, within errors, with the best-known ages of either a large impact crater (≥70 km diameter) or a continental flood-basalt eruption. The null hypothesis that this could occur by chance can be rejected with very high confidence (>99.999%). The ages of large impact craters correlate with recognized extinction events at 36 (two impacts), 66, 145 and 215 Myr ago (and possibly an event at 168 Myr ago), and the ages of continental flood basalts correlate with extinctions at 66, 94, 116, 183, 201, 252 and 259 Myr ago (and possibly at 133 Myr ago). Furthermore, at least 7 periods of widespread anoxia in the oceans of the last 260 Myr coincide with the ages of flood-basalt eruptions (with 99.999% confidence), and are coeval with extinctions, suggesting causal connections. These statistical relationships argue that most mass extinction events are related to climatic catastrophes produced by the largest impacts and large-volume continental flood-basalt eruptions.

  19. The removal of toxic metals from liquid effluents by ion exchange resins. Part II: cadmium(II/ sulphate/Lewatit TP260

    Directory of Open Access Journals (Sweden)

    Alguacil, F. J.

    2002-10-01

    Full Text Available The adsorption of cadmium (II, from aqueous sulphate solutions, on Lewatit TP260 resin has been investigated in batch equilibrium experiments. The influence of pH and temperature on metal adsorption capacity have also been examined. The kinetic performance of the resin has been assesed and the results have been correlated by the pore diffusion model. The resin has been used in mini-columns to study its performance under dynamics conditions. The desorption of metal ion is achieved using sulphuric acid (0.25M and 0.5M.

    Se estudia la adsorción de cadmio(II, de disoluciones en medio sulfato, sobre la resina Lewatit TP260. La adsorción del metal se ha investigado en función del pH, la temperatura y el tiempo de contacto con la resina. Los estudios cinéticos permiten correlacionar el proceso de intercambio iónico con el modelo de difusión en poro. Se ha empleado el sistema en mini columnas para evaluar el comportamiento de la resina bajo condiciones dinámicas. La desorción del metal se lleva a cabo con disoluciones de ácido sulfúrico (0,25M y 0,5M.

  20. P-ρ-T measurements of H{sub 2}O up to 260 GPa under laser-driven shock loading

    Energy Technology Data Exchange (ETDEWEB)

    Kimura, T. [Geodynamics Research Center, Ehime University, 2-5 Bunkyo-cho, Matsuyama, Ehime 790-8577 (Japan); Graduate School of Engineering, Osaka University, Suita, Osaka 565-0871 (Japan); Ozaki, N.; Kodama, R. [Graduate School of Engineering, Osaka University, Suita, Osaka 565-0871 (Japan); Photon Pioneers Center, Osaka University, Suita, Osaka 565-0871 (Japan); Sano, T.; Sakawa, Y. [Institute of Laser Engineering, Osaka University, Suita, Osaka 565-0871 (Japan); Okuchi, T. [Institute for Study of the Earth’s Interior, Okayama University, Misasa, Tottori 682-0193 (Japan); Sano, T.; Miyanishi, K.; Terai, T.; Kakeshita, T. [Graduate School of Engineering, Osaka University, Suita, Osaka 565-0871 (Japan); Shimizu, K. [KYOKUGEN, Center for Science and Technology under Extreme Conditions, Osaka University, Toyonaka, Osaka 560-8531 (Japan)

    2015-04-28

    Pressure, density, and temperature data for H{sub 2}O were obtained up to 260 GPa by using laser-driven shock compression technique. The shock compression technique combined with the diamond anvil cell was used to assess the equation of state models for the P-ρ-T conditions for both the principal Hugoniot and the off-Hugoniot states. The contrast between the models allowed for a clear assessment of the equation of state models. Our P-ρ-T data totally agree with those of the model based on quantum molecular dynamics calculations. These facts indicate that this model is adopted as the standard for modeling interior structures of Neptune, Uranus, and exoplanets in the liquid phase in the multi-Mbar range.

  1. Pulmonary gas exchange and acid-base state at 5,260 m in high-altitude Bolivians and acclimatized lowlanders

    DEFF Research Database (Denmark)

    Wagner, Hans Peter; Araoz, Mauricio; Boushel, Robert Christopher

    2002-01-01

    was 8 Torr lower in L than in N (P PO2 was the same such that, at maximal O2 uptake, alveolar-arterial PO2 difference was lower in N (5.3 +/- 1.3 Torr) than in L (10.5 +/- 0.8 Torr), P = 0.004. Calculated O2 diffusing capacity was 40% higher in N than in L and, if referenced to maximal...... when breathing air at 5,260 m compared with breathing 55% O2; 2) very little ventilatory response to acute hypoxemia (judged by arterial pH and arterial PCO2 responses to hyperoxia); 3) during exercise, greater pulmonary diffusing capacity than in L, allowing maintenance of arterial PO2 despite lower...

  2. Achados cirúrgicos em 260 casos de impressão basilar e/ou malformação de Arnold-Chiari

    Directory of Open Access Journals (Sweden)

    José Alberto Gonçalves da Silva

    1994-09-01

    Full Text Available A impressão basilar é malformação frequentemente observada no Nordeste do Brasil. No período de 1971 a 1992 foram operados, em nosso Serviço, 260 pacientes com malformações occipitocervicais, sendo 29 (11,1% casos de impressão basilar pura, 18 (6,9% com malformação de Arnold-Chiari e 213 (81,9% com impressão basilar associada à malformação de Arnold-Chiari. São relatados os achados cirúrgicos do plano ósseo, da dura-máter, do tecido nervoso e dos vasos da fossa posterior.

  3. Age at puberty, ovulation rate, and uterine length of developing gilts fed two lysine and three metabolizable energy concentrations from 100 to 260 d of age.

    Science.gov (United States)

    Calderón Díaz, J A; Vallet, J L; Lents, C A; Nonneman, D J; Miles, J R; Wright, E C; Rempel, L A; Cushman, R A; Freking, B A; Rohrer, G A; Phillips, C; DeDecker, A; Foxcroft, G; Stalder, K

    2015-07-01

    The objective of this study was to determine the effect of ad libitum feeding diets differing in standard ileal digestible (SID) lysine and ME concentrations that bracket those fed to developing gilts in U.S. commercial settings. Average SID lysine and ME concentrations in diets currently fed to developing gilts were obtained from a poll of the U.S. commercial swine industry. Crossbred Large White × Landrace gilts (n = 1,221), housed in groups, were randomly allotted to 6 corn-soybean diets in a 2 × 3 factorial arrangement formulated to provided 2 SID lysine and 3 ME concentrations. Gilts received grower diets formulated to provide 1.02% (control = survey average) or 0.86% (control minus 15%) SID lysine and 2.94, 3.25, or 3.57 (survey average ME ± 10%) Mcal of ME/kg from 100 d of age until approximately 90 kg BW. Then, gilts were fed finisher diet containing 0.85% (control = survey average) or 0.73% (control minus 15%) SID lysine and 2.94, 3.26, or 3.59 (control ± 10%) Mcal of ME/kg until 260 d of age. Gilts were weighed, and backfat thickness and loin muscle area were recorded at the beginning of the trial and then every 28 d. Starting at 160 d of age, gilts were exposed daily to vasectomized boars and observed for behavioral estrus. At approximately 260 d of age, gilts were slaughtered and their reproductive tract was collected. Each reproductive tract was examined to determine whether the gilt was cyclic, the stage of estrus cycle, ovulation rate, and uterine length. Data were evaluated for normality and analyzed using mixed model methods. Average age at puberty was 193 d of age with a range from 160 to 265 d. When all gilts on trial at 160 d of age were included in the analysis, 91.0% reached puberty as determine by observation of standing estrus. Differences between dietary treatments on age at puberty or measurements of the reproductive tract were not detected. Growth rates to 160 d were not limiting for attainment of puberty in response to daily boar

  4. Mental health benefits of neighbourhood green space are stronger among physically active adults in middle-to-older age: evidence from 260,061 Australians.

    Science.gov (United States)

    Astell-Burt, Thomas; Feng, Xiaoqi; Kolt, Gregory S

    2013-11-01

    While many studies report that green spaces promote mental health, some suggest the psychological benefits of physical activity are amplified if participation occurs within greener environs. We investigated whether this relationship could be observed among adults in middle-to-older age. Multilevel logit regression was used to investigate association between green space and psychological distress (Kessler scores of 22+) among 260,061 Australians over 45 years old living in New South Wales (2006-2009). Physical activity was measured using the Active Australia survey. Percentage green space was estimated within a 1-kilometre of residence. In comparison to residents of the least green areas, those in the greenest neighbourhoods were at a lower risk of psychological distress (Odds Ratio 0.83, 95% CI: 0.76, 0.92) and were less sedentary (0.81: 0.77, 0.87). An interaction was observed between physical activity and green space (p=0.0028). More green space did not appear to benefit mental health among the least active (0.99: 0.85, 1.15), but there was a protective association for the more physically active (0.82: 0.67, 0.99). For adults in middle-to-older age, green spaces are not only important for promoting physical activity, but the mental health benefits of greener environs appear contingent upon those active lifestyles. © 2013.

  5. LONG-TERM OPTICAL OBSERVATIONS OF TWO LMXBs: UW CrB (=MS 1603+260) AND V1408 Aql (=4U 1957+115)

    International Nuclear Information System (INIS)

    Mason, Paul A.; Robinson, Edward L.; Bayless, Amanda J.; Hakala, Pasi J.

    2012-01-01

    We present new optical photometry of two low-mass X-ray binary stars, UW CrB (MS 1603+260) and V1408 Aql (4U 1957+115). UW CrB is an eclipsing binary and we refine its eclipse ephemeris and measure an upper limit to the rate of change of its orbital period, | P-dot | -11 (unitless). The light curve of UW CrB shows optical counterparts of type I X-ray bursts. We tabulate the times, orbital phases, and fluences of 33 bursts and show that the optical flux in the bursts comes primarily from the accretion disk, not from the secondary star. The new observations are consistent with a model in which the accretion disk in UW CrB is asymmetric and precesses in the prograde direction with a period of ∼5.5 days. The light curve of V1408 Aql has a low-amplitude modulation at its 9.33 hr orbital period. The modulation remained a nearly pure sine curve in the new data as it was in 1984 and 2008, but its mean amplitude was lower, 18% against 23% in the earlier data. A model in which the orbital modulation is caused by the varying aspect of the heated face of the secondary star continues to give an excellent fit to the light curve. We derive a much improved orbital ephemeris for the system.

  6. 260 Résumé

    African Journals Online (AJOL)

    AKA BOKO

    Bioactive compounds produced by Cyanobacteria isolated from some aquatic ecosystems in Morocco. During hot periods, several aquatic ecosystems are characterized by blooms of cyanobacteria. The cyanobacteria are able to produce bioactive products which have a broad spectrum of properties such as antibacterial, ...

  7. Prevalence of hereditary factors predisposing to thrombosis in 260 patients diagnosed as thrombosis and investigated at Hospital Israelita Albert Einstein, São Paulo, Brazil

    Directory of Open Access Journals (Sweden)

    João Carlos de Campos Guerra

    2005-06-01

    Full Text Available Objective: To evaluate the prevalence of genetic polymorphism incoagulation factors in thromboembolic disease in patients withclinical suspicion of thrombosis. Methods: A retrospective casecollection was performed searching all patients with clinicalsuspicion of thrombosis who were submitted to coagulation factoranalysis at the Hospital Israelita Albert Einstein from November2003 to April 2004. We included 260 patients, 118 male and 142female, mean age of 46 years. Prothrombin mutation and Leiden Vfactor were evaluated with multiplex PCR. Protein C, S and lupusanticoagulant were studied in coagulation assays. AntithrombinIII was studied by chromogenic assay. Anticardiolipin was evaluatedthrough an immunoenzymatic method and homocysteine by animmunometric method. Results: Factor V Leiden was found in 22cases (8.3 %, one homozygote and 21 heterozygotes. Prothrombinmutation was found in 18 cases (6.8%, one homozygote and 17heterozygotes. Forty cases with genetic alteration showed 34 caseswith thrombosis (85%, 29 venous thrombosis and 4 arterialthrombosis. One hundred and seven patients were tested foranticardiolipin antibodies: 21 were anticardiolipin antibody positives(19.6%, and 15 of them had IgG antibodies, 3 IgM and 3 IgA. Sixteenof the 21 patients had thrombosis, 11 venous thrombosis and 5arterial thrombosis. Lupus anticoagulant was found in two patients,both with thrombosis. There was only one case ofhyperhomocystinemia, with thrombosis. Protein C, protein S andantithrombin III deficiencies were found in 63 cases (12%. Out of31 cases with thrombosis (49,2 %, 26 cases had venous thrombosisand 5 had arterial thrombosis. Conclusion: Thromboembolicdisease is clearly associated with genetic factors but there isconsensus its cause is multifactorial. Genetic alterations, however,should be studied when there is clinical evidence of thrombosis,at least in young patients.

  8. Monodisperse 130 kDa and 260 kDa Recombinant Human Hemoglobin Polymers as Scaffolds for Protein Engineering of Hemoglobin-Based Oxygen Carriers

    Directory of Open Access Journals (Sweden)

    Jacqueline F. Aitken

    2012-01-01

    Full Text Available A recombinant 130 kDa dihemoglobin which is made up of a single-chain tetra-α globin and four β globins has been expressed as a soluble protein in E. coli. The sequence of the single chain tetra-α is: αI-Gly-αII-(SerGlyGly5Ser-αIII-Gly-αIV. This dihemoglobin has been purified and characterized in vitro by size exclusion chromatography, electrospray mass spectroscopy, equilibrium oxygen binding, and analytical ultracentrifugation. The observed values of P50 and nmax for the dihemoglobin are slightly lower than those observed for the recombinant hemoglobin rHb1.1 (a “monohemoglobin” comprised of two β globins and an αI-Gly-αII diα-globin chain. Titration of the deoxy form of dihemoglobin with CO shows that all eight heme centers bind ligand. In vivo, dihemoglobin showed increased circulating halflife and a reduced pressor response in conscious rats when compared to rHb1.1. These observations suggest that dihemoglobin is an oxygen carrying molecule with desirable in vivo properties and provides a platform for an isooncotic hemoglobin solution derived solely from a recombinant source. A 260 kDa tetrahemoglobin has also been produced by chemical crosslinking of a dihemoglobin that contains a Lys16Cys mutation in the C-terminal α-globin subunit. Tetrahemoglobin also shows reduced vasoactivity in conscious rats that is comparable to that observed for dihemoglobin.

  9. Phylogeny and diversification of B-function MADS-box genes in angiosperms: evolutionary and functional implications of a 260-million-year-old duplication.

    Science.gov (United States)

    Kim, Sangtae; Yoo, Mi-Jeong; Albert, Victor A; Farris, James S; Soltis, Pamela S; Soltis, Douglas E

    2004-12-01

    B-function MADS-box genes play crucial roles in floral development in model angiosperms. We reconstructed the structural and functional implications of B-function gene phylogeny in the earliest extant flowering plants based on analyses that include 25 new AP3 and PI sequences representing critical lineages of the basalmost angiosperms: Amborella, Nuphar (Nymphaeaceae), and Illicium (Austrobaileyales). The ancestral size of exon 5 in PI-homologues is 42 bp, typical of exon 5 in other plant MADS-box genes. This 42-bp length is found in PI-homologues from Amborella and Nymphaeaceae, successive sisters to all other angiosperms. Following these basalmost branches, a deletion occurred in exon 5, yielding a length of 30 bp, a condition that unites all other angiosperms. Several shared amino acid strings, including a prominent "DEAER" motif, are present in the AP3- and PI-homologues of Amborella. These may be ancestral motifs that were present before the duplication that yielded the AP3 and PI lineages and subsequently were modified after the divergence of Amborella. Other structural features were identified, including a motif that unites the previously described TM6 clade and a deletion in AP3-homologues that unites all Magnoliales. Phylogenetic analyses of AP3- and PI-homologues yielded gene trees that generally track organismal phylogeny as inferred by multigene data sets. With both AP3 and PI amino acid sequences, Amborella and Nymphaeaceae are sister to all other angiosperms. Using nonparametric rate smoothing (NPRS), we estimated that the duplication that produced the AP3 and PI lineages occurred approximately 260 mya (231-290). This places the duplication after the split between extant gymnosperms and angiosperms, but well before the oldest angiosperm fossils. A striking similarity in the multimer-signalling C domains of the Amborella proteins suggests the potential for the formation of unique transcription-factor complexes. The earliest angiosperms may have been

  10. Induction of Mitochondrial Changes Associated with Oxidative Stress on Very Long Chain Fatty Acids (C22:0, C24:0, or C26:0-Treated Human Neuronal Cells (SK-NB-E

    Directory of Open Access Journals (Sweden)

    Amira Zarrouk

    2012-01-01

    Full Text Available In Alzheimer's disease, lipid alterations point towards peroxisomal dysfunctions. Indeed, a cortical accumulation of saturated very long chain fatty acids (VLCFAs: C22:0, C24:0, C26:0, substrates for peroxisomal β-oxidation, has been found in Alzheimer patients. This study was realized to investigate the effects of VLCFAs at the mitochondrial level since mitochondrial dysfunctions play crucial roles in neurodegeneration. On human neuronal SK-NB-E cells treated with C22:0, C24:0, or C26:0 (0.1–20 μM; 48 h, an inhibition of cell growth and mitochondrial dysfunctions were observed by cell counting with trypan blue, MTT assay, and measurement of mitochondrial transmembrane potential (Δψm with DiOC6(3. A stimulation of oxidative stress was observed with DHE and MitoSOX used to quantify superoxide anion production on whole cells and at the mitochondrial level, respectively. With C24:0 and C26:0, by Western blotting, lower levels of mitochondrial complexes III and IV were detected. After staining with MitoTracker and by transmission electron microscopy used to study mitochondrial topography, mass and morphology, major changes were detected in VLCFAs treated-cells: modification of the cytoplasmic distribution of mitochondria, presence of large mitochondria, enhancement of the mitochondrial mass. Thus, VLCFAs can be potential risk factors contributing to neurodegeneration by inducing neuronal damages via mitochondrial dysfunctions.

  11. Demonstration of GTS Duratek Process for Stabilizing Mercury Contaminated (<260 ppm) Mixed Wastes. Mixed Waste Focus Area. OST Reference No. 2409

    International Nuclear Information System (INIS)

    1999-01-01

    Mercury-contaminated wastes in many forms are present at various U. S. Department of Energy (DOE) sites. At least 26 different DOE sites have this type of mixed low-level waste in their storage facilities, totaling approximately 6,000 m 3 . Mercury contamination in the wastes at DOE sites presents a challenge because it exists in various forms, such as soil, sludges, and debris, as well as in different chemical species of mercury. Stabilization is of interest for radioactively contaminated mercury waste (<260 ppm Hg) because of its success with particular wastes, such as soils, and its promise of applicability to a broad range of wastes. However, stabilization methods must be proven to be adequate to meet treatment standards. They must also be proven feasible in terms of economics, operability, and safety. This report summarizes the findings from a stabilization technology demonstration conducted by GTS Duratek, Inc. Phase I of the study involved receipt and repackaging of the material, followed by preparations for waste tracking. Phase II examined the bench-scale performance of grouting at two different loadings of waste to grouted mass. Phase III demonstrated in-drum mixing and solidification using repackaged drums of sludge. Phase IV initially intended to ship final residues to Envirocare for disposal. The key results of the demonstration are as follows: (1) Solidification tests were performed at low and high waste loading, resulting in stabilization of mercury to meet the Universal Treatment Standard of 0.025 mg/L at the low loading and for two of the three runs at the high loading. The third high-loading run had a Toxicity Characteristic Leaching Procedure (TCLP) of 0.0314 mg/L. (2) Full-drum stabilization using the low loading formula was demonstrated. (3) Organic compound levels were discovered to be higher than originally reported, including the presence of some pesticides. Levels of some radionuclides were much higher than initially reported. (4

  12. Demonstration of GTS Duratek Process for Stabilizing Mercury Contaminated (<260 ppm) Mixed Wastes. Mixed Waste Focus Area. OST Reference No. 2409

    Energy Technology Data Exchange (ETDEWEB)

    None, None

    1999-09-01

    Mercury-contaminated wastes in many forms are present at various U. S. Department of Energy (DOE) sites. At least 26 different DOE sites have this type of mixed low-level waste in their storage facilities, totaling approximately 6,000 m3. Mercury contamination in the wastes at DOE sites presents a challenge because it exists in various forms, such as soil, sludges, and debris, as well as in different chemical species of mercury. Stabilization is of interest for radioactively contaminated mercury waste (<260 ppm Hg) because of its success with particular wastes, such as soils, and its promise of applicability to a broad range of wastes. However, stabilization methods must be proven to be adequate to meet treatment standards. They must also be proven feasible in terms of economics, operability, and safety. This report summarizes the findings from a stabilization technology demonstration conducted by GTS Duratek, Inc. Phase I of the study involved receipt and repackaging of the material, followed by preparations for waste tracking. Phase II examined the bench-scale performance of grouting at two different loadings of waste to grouted mass. Phase III demonstrated in-drum mixing and solidification using repackaged drums of sludge. Phase IV initially intended to ship final residues to Envirocare for disposal. The key results of the demonstration are as follows: (1) Solidification tests were performed at low and high waste loading, resulting in stabilization of mercury to meet the Universal Treatment Standard of 0.025 mg/L at the low loading and for two of the three runs at the high loading. The third high-loading run had a Toxicity Characteristic Leaching Procedure (TCLP) of 0.0314 mg/L. (2) Full-drum stabilization using the low loading formula was demonstrated. (3) Organic compound levels were discovered to be higher than originally reported, including the presence of some pesticides. Levels of some radionuclides were much higher than initially reported. (4

  13. Study of the angular correlations of light charged particles for the reaction {sup 35}CI (260 MeV) + {sup 24}Mg; Etude des correlations angulaires de particules legeres chargees dans la reaction {sup 35}CI (260 MeV) + {sup 24}Mg

    Energy Technology Data Exchange (ETDEWEB)

    Mahboub, D.

    1996-10-30

    This work is focussed on the investigation of deformed nuclei. The asymmetric fusion-fission of light heavy-ions (A {<=}60) with a high excitation energy (T {approx} 4 MeV) had lead to a large deformation of the compound nucleus at the scission point. The angular correlations between light particles (LP) and their emitting fragments has been used to probe the deformation of nucleus. Exclusive measurements were performed for the {sup 35}Cl (260 MeV) + {sup 24}Mg system leading to the {sup 59}Cu compound nucleus (CN). The comparison between the energy spectra of LP`s and a statistical calculation carried out by a Monte-Carlo code CASCADE has suggested a deformation of 1.3 (for an oblate shape) of the CN within the frame work of fusion-evaporation process. The source velocity spectrum of {alpha} particles and angular correlations of LP`s have showed that pre-scission and pre-equilibrium emissions are negligible in the present reaction. Finally the confrontation of the data with the statistical code GEMINI has pointed out the sequential emission character of the LP`s from the fission fragments. (author). 175 refs.

  14. A synthesis of magmatic Ni-Cu-(PGE) sulfide deposits in the ∼260 Ma Emeishan large igneous province, SW China and northern Vietnam

    Science.gov (United States)

    Wang, Christina Yan; Wei, Bo; Zhou, Mei-Fu; Minh, Dinh Huu; Qi, Liang

    2018-04-01

    Magmatic Ni-Cu-(PGE) sulfide deposits in the ca. 260-Ma Emeishan large igneous province (LIP) are all hosted in relatively small, mafic-ultramafic intrusions with surface areas usually less than 1 km2. These deposits are mainly distributed in the Danba, Panzhihua-Xichang (Panxi), Huili, Yuanmou, Midu, Funing and Jinping regions in SW China and the Ta Khoa region in northern Vietnam. They include Ni-Cu-(PGE) sulfide-dominated, Ni-Cu sulfide-dominated, and PGE-dominated types. Sulfide ores of the Ni-Cu-(PGE) and Ni-Cu sulfide-dominated deposits contain more than 10 vol% sulfides and have low PGE concentrations relative to the ores that contain <3 vol% sulfides in the PGE-dominated deposits. The parental magmas of the host mafic-ultramafic intrusions may have been derived primarily from low-Ti picritic magmas that were produced by high degrees of partial melting of a depleted mantle source. The primary low-Ti picrites of the Emeishan LIP have relatively restricted εNd(t) and γOs(t) isotopic compositions, however, some of the host intrusions exhibit a large range of both εNd(t) (-9.5 to +0.8) and γOs(t) (+5.4 to +77), indicating that they experienced variable degrees of crustal contamination during emplacement. In addition, sulfides from sulfide ores of the Ban Phuc intrusion in northern Vietnam and those from sulfide veins in country rocks have δ34S values ranging from -6.7 to -3.4‰, whereas sulfides from sulfide ores of the Baimazhai No.3, Yingpanjie, Jinbaoshan and Nantianwan intrusions in SW China have highly variable δ34S ranging from -0.2 to +21.4‰, indicating the addition of crustal sulfur into the mantle-derived mafic magmas. Platinum-group minerals (PGM) are abundant in the Ni-Cu-(PGE) sulfide-bearing intrusions, and they span a wide range of composition. More than 130 PGM grains have been identified in the Pt-Pd-rich Jinbaoshan intrusion, whereas only one small froodite (PdBi2) grain was observed in the Ni-Cu sulfide-dominated Baimazhai No. 3

  15. 49 CFR 260.3 - Definitions.

    Science.gov (United States)

    2010-10-01

    ... subtitle IV of title 49, United States Code. (s) Subsidy cost of a direct loan means the net present value... the net present value, at the time when the guaranteed loan is disbursed, of the following estimated...

  16. 50 CFR 260.101 - Lavatory accommodations.

    Science.gov (United States)

    2010-10-01

    ... water, soap, and single service towels, shall be provided. Such accommodations shall be in or near... personnel handling products. (b) Sufficient containers with covers shall be provided for used towels and... operative, in good repair, and in a sanitary condition. ...

  17. 49 CFR 260.35 - Environmental assessment.

    Science.gov (United States)

    2010-10-01

    ... Associate Administrator for Railroad Development at the earliest possible stage in project development in... Zone Management Act (16 U.S.C. 1451), and the Endangered Species Act (16 U.S.C. 1531). Appropriate... environmental impact of the project for which the applicant is seeking financial assistance, FRA will need to...

  18. Thiokol 260-SL Nozzle Development Program

    Science.gov (United States)

    1967-01-01

    excited by the above environments were investigated. These were: (a) lateral vibration of the nozzle exit cone as a cantilever beam , (b) radial vibration...under the debulking roller to prevent springback of the material. The cooling of the wrapped tape tended to set the material and prevent subsequent...between sheets of nylon were then placed at intervals on the surface of the shell as shown in Figure 10. The convergent ablative stack was then

  19. Publications | Page 260 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Results. 2591 - 2600 of 6380. Hidden links: Irrigation, malaria, and gender. In African countries, where the weather is extremely variable, irrigation is seen as one obvious way to increase agricultural production. But, irrigation affects more than the crops that grow in farmers' fields. In fact, researchers around... A new vision ...

  20. Publications | Page 260 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    IDRC works with developing-country researchers and institutions to build local capacity through funding, knowledge sharing, and training. Through books, articles, research publications, and studies, we aim to widen the impact of our investment and advance development research. We share the results of our funded ...

  1. 50 CFR 648.260 - Specifications.

    Science.gov (United States)

    2010-10-01

    ...); discards; stock status; recent estimates of recruitment; virtual population analysis results and other estimates of stock size; sea sampling, port sampling, and survey data or, if sea sampling data are unavailable, length frequency information from port sampling and/or surveys; impact of other fisheries on the...

  2. 40 CFR 260.10 - Definitions.

    Science.gov (United States)

    2010-07-01

    ... Administrator to list the hazardous waste in part 261, subpart D, of this chapter, or a constituent listed in...-generated. (13) Such other devices as the Administrator may, after notice and comment, add to this list on... providing treatment. Qualified Ground-Water Scientist means a scientist or engineer who has received a...

  3. 77 FR 260 - Forest Resource Coordinating Committee

    Science.gov (United States)

    2012-01-04

    ... the Food, Conservation, and Energy Act of 2008 to advise the Secretary of Agriculture on priorities... fish and wildlife agency. An owner of nonindustrial private forest land. Two conservation organization representatives. A representative from an Indian Tribe. A representative from a State Technical Committee...

  4. Publications | Page 260 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Patronage or partnership: Local capacity building in humanitarian crises. It is early 1998, on the outskirts of Bujumbura, the capital of Burundi. "People are dying like flies," says an understandably emotional American missionary running a refugee camp for four thousand Hutus. Asked by a reporter about a.

  5. 32 CFR 260.3 - Definitions.

    Science.gov (United States)

    2010-07-01

    ...-controlled property. Cafeteria. A food dispensing facility capable of providing a broad variety of prepared foods and beverages (including hot meals) primarily through the use of a line where the customer serves... facilities are always provided. The DoD Component food dispensing facilities that conduct cafeteria-type...

  6. 50 CFR 260.102 - Equipment.

    Science.gov (United States)

    2010-10-01

    ... FOOD PRODUCTS INSPECTION AND CERTIFICATION Inspection and Certification of Establishments and Fishery..., packaging, or storing any processed products or any ingredients used in the manufacture or production thereof, shall be of such design, material, and construction as will: (a) Enable the examination...

  7. 50 CFR 260.98 - Premises.

    Science.gov (United States)

    2010-10-01

    ... Products for Human Consumption Requirements for Plants Operating Under Continuous Inspection on A Contract... offensive odors; (b) Improperly stored equipment, litter, waste, refuse, and uncut weeds or grass within the...

  8. Echo outbursts in KS 1731-260

    Czech Academy of Sciences Publication Activity Database

    Šimon, Vojtěch

    2010-01-01

    Roč. 513, April (2010), A71/1-A71/10 ISSN 0004-6361 R&D Projects: GA ČR GA205/08/1207 Institutional research plan: CEZ:AV0Z10030501 Keywords : stars * accretion disks * X-rays binaries Subject RIV: BN - Astronomy, Celestial Mechanics, Astrophysics Impact factor: 4.410, year: 2010

  9. 50 CFR 260.104 - Personnel.

    Science.gov (United States)

    2010-10-01

    ... belongings, eat food, drink beverages, chew gum, or use tobacco in any form in areas where food or food... Wildlife and Fisheries NATIONAL MARINE FISHERIES SERVICE, NATIONAL OCEANIC AND ATMOSPHERIC ADMINISTRATION... FOOD PRODUCTS INSPECTION AND CERTIFICATION Inspection and Certification of Establishments and Fishery...

  10. 32 CFR 260.6 - Procedures.

    Science.gov (United States)

    2010-07-01

    ..., signifying its agreement or alternate selection of a location and its selection of type of vending facility... owned building in which the lessor or any of its tenants have an existing restaurant or other food... substantial direct competition with such restaurant or other food operation, the requirement to provide a...

  11. 50 CFR 260.86 - Approved identification.

    Science.gov (United States)

    2010-10-01

    ... assure compliance with the requirements for wholesomeness established for the raw product and of sanitation established for the preparation and processing operations, and (2) has been certified by an... part to assure compliance with the requirements for wholesomeness established for the raw product and...

  12. 50 CFR 260.99 - Buildings and structures.

    Science.gov (United States)

    2010-10-01

    ... each room and compartment thereof to prevent excessive condensation of moisture and to insure sanitary... condensation, the Director may require that suitable facilities be provided to prevent the condensate from...

  13. 16 CFR 260.2 - Scope of guides.

    Science.gov (United States)

    2010-01-01

    ... directly or by implication, through words, symbols, emblems, logos, depictions, product brand names, or through any other means, including marketing through digital or electronic means, such as the Internet or...

  14. 38 CFR 3.260 - Computation of income.

    Science.gov (United States)

    2010-07-01

    ... 38 Pensions, Bonuses, and Veterans' Relief 1 2010-07-01 2010-07-01 false Computation of income. 3... Computation of income. For entitlement to pension or dependency and indemnity compensation, income will be... calendar year. (d) Proportionate income limitations; computation. Income limitations will be computed...

  15. 16 CFR 260.7 - Environmental marketing claims.

    Science.gov (United States)

    2010-01-01

    ... brand name like “Eco-Safe” would be deceptive if, in the context of the product so named, it leads...., decompose into elements found in nature within a reasonably short period of time after customary disposal... not meet the elements for an unqualified photodegradable claim, i.e., that the product will not only...

  16. Dicty_cDB: SSA260 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available RP11-626A3 map 2, WORKING DRAFT SEQUENCE, 29 unordered pieces. 42 6.4 1 AE014305 |AE014305.1 Homo sapiens chromosome 13q34 schizophre...nia region contig 1 section 2 of 11 of the complete sequence. 42 6.4 1 BZ851208 |BZ

  17. Dicty_cDB: VSF260 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ektt*wtwcclrwk*sylrygw*f ww*knfk*prtyey*nlgmgksfryekanrcsqfcnl*wyw*ylchwwllf*gfs*ksml *y*ke*melfrtnd*tt*r*cf...lrwk*sylrygw*f ww*knfk*prtyey*nlgmgksfryekanrcsqfcnl*wyw*ylchwwllf*gfs*ksml *y*ke*melfrtnd*tt*r*cfnlc*isslki

  18. 27 CFR 24.260 - Serial numbers or filling date.

    Science.gov (United States)

    2010-04-01

    ... liters or each case used for removing wine for consumption or sale will be marked with a serial number or... States or foreign wine is recased, the cases will be marked with the date of recasing, preceded by the... BUREAU, DEPARTMENT OF THE TREASURY LIQUORS WINE Storage, Treatment and Finishing of Wine Bottling...

  19. Dicty_cDB: VSA260 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available quence. 250 0.0 10 CB909775 |CB909775.1 USDA-FP_101518 Adult Alate Brown Citrus Aphid Toxoptera citricida cD...103145 Adult Alate Brown Citrus Aphid Toxoptera citricida cDNA clone WHWTC-42_B01 5', mRNA sequence. 54 3e-0...8D10A.19C CE21417 ;, mRNA sequence. 64 4e-09 2 CD450786 |CD450786.1 USDA-FP_102764 Adult Alate Brown Citrus Aphid...D451804 |CD451804.1 USDA-FP_104110 Adult Alate Brown Citrus Aphid Toxoptera citricida cDNA clone WHWTC-51_A1...1 5', mRNA sequence. 54 6e-09 3 CB814948 |CB814948.1 USDA-FP_100421 Adult Alate Brown Citrus Aphid Toxoptera

  20. 7 CFR 1493.260 - Facility payment guarantee.

    Science.gov (United States)

    2010-01-01

    ...; or, in the absence of specific information regarding declared customs value, the fair market...; or in the absence of an arms-length transaction, the fair market value of the services at the time... amend the facility payment guarantee so as to change the guaranteed value must have the concurrence of...

  1. 23 CFR 260.407 - Implementation and reimbursement.

    Science.gov (United States)

    2010-04-01

    ... and private agencies, institutions, individuals, and the National Highway Institute to provide highway... tuition and direct educational expenses (including incidental training, equipment, and program materials...

  2. (260-IJBCS-Article-Dr Birang à Madong)

    African Journals Online (AJOL)

    RHUMSIKI

    saturation levels, soils of cocoa farms seem to present a higher fertility status than those of the rest of land-use ... carbon, total nitrogen, C/N ratio , available P, ..... Inorganic nitrogen. In. Methods of Soil Analysis, Part II (2nd edn), Page AL, Miller RH, Keeney DR. (eds). American Society of Agronomy: Madison, Wisconsin ...

  3. 21 CFR 520.260 - n-Butyl chloride capsules.

    Science.gov (United States)

    2010-04-01

    ... be followed in 1/2 to 1 hour with a teaspoonful to a tablespoonful of milk of magnesia or 1 or 2 milk of magnesia tablets. Normal rations may be resumed 4 to 8 hours after treatment. Puppies and kittens...

  4. 7 CFR 65.260 - United States country of origin.

    Science.gov (United States)

    2010-01-01

    ... OF BEEF, PORK, LAMB, CHICKEN, GOAT MEAT, PERISHABLE AGRICULTURAL COMMODITIES, MACADAMIA NUTS, PECANS... States country of origin means in the case of: (a) Beef, pork, lamb, chicken, and goat: (1) From animals... Hawaii and transported for a period of not more than 60 days through Canada to the United States and...

  5. 33 CFR 106.260 - Security measures for access control.

    Science.gov (United States)

    2010-07-01

    ... means used to establish the identity of individuals not in possession of a TWIC and the means by which... with the individual's claim of loss or theft. (3) If an individual cannot present his or her TWIC for... set out in paragraph (c) of this section. (2) Screen persons and personal effects going aboard the OCS...

  6. Aerospace Technology Curriculum Guide. Invest in Success. Vo. Ed. #260.

    Science.gov (United States)

    Idaho State Dept. of Education, Boise. Div. of Vocational Education.

    This document contains standards for an articulated secondary and postsecondary curriculum in aerospace technology. The curriculum standards can be used to ensure that vocational programs meet the needs of local business and industry. The first part of the document contains a task list and student performance standards for the aerospace technology…

  7. 49 CFR 260.53 - Lenders' functions and responsibilities.

    Science.gov (United States)

    2010-10-01

    ... that are eligible and financially feasible; (4) Obtaining valid evidence of debt and collateral in accordance with sound lending practices; (5) Supervising construction, where appropriate; (6) Distributing... environmental issues related to a proposed project or items that may require extensive environmental review...

  8. 7 CFR 2.60 - Chief, Forest Service.

    Science.gov (United States)

    2010-01-01

    ..., universities, and others; institute a cash award program to reward scientific, engineering, and technical...) Coordinate mapping work of USDA including: (i) Clearing mapping projects to prevent duplication; (ii) Keeping... assistance that promotes sustainable development and global environmental stability; share technical...

  9. All projects related to | Page 260 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Topic: INFECTIOUS DISEASES, DISEASE VECTORS, PREVENTIVE MEDICINE, ENVIRONMENTAL ASPECTS. Region: Nepal, Central Asia, Far East Asia, South Asia. Program: Food, Environment, and Health. Total Funding: CA$ 509,050.00. Reducing Vulnerability to the Threat of Japanese Encephalitis in Nepal. Project.

  10. 40 CFR Appendix Ix to Part 261 - Wastes Excluded Under §§ 260.20 and 260.22

    Science.gov (United States)

    2010-07-01

    ...) SOLID WASTES (CONTINUED) IDENTIFICATION AND LISTING OF HAZARDOUS WASTE Pt. 261, App. IX Appendix IX to... manage industrial solid waste. This exclusion was published on April 6, 1999.1. The constituent..., accurate and complete. In the event that any of this information is determined by EPA in its sole...

  11. : tous les projets | Page 260 | CRDI - Centre de recherches pour le ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Sujet: WOMEN'S PARTICIPATION, POLITICAL PARTICIPATION, WOMEN'S RIGHTS, GENDER DISCRIMINATION, GENDER EQUALITY. Région: Pakistan, Central Asia, Far East Asia, South Asia. Programme: Gouvernance et justice. Financement total : CA$ 125,700.00. Femmes et représentation au Pakistan : voix d'en ...

  12. 43 CFR 2.60 - Request for notification of existence of records: Submission.

    Science.gov (United States)

    2010-10-01

    ... them may contact the system manager for assistance in determining which official is most likely to be... the Privacy Act whether a system of records contains records pertaining to them shall address inquiries to the system manager having responsibility for the system unless the system notice describing the...

  13. S. Afr. J. Anim ^Sci d 257-260 (1975) THE INHERITANCE OF HAIR ...

    African Journals Online (AJOL)

    It is common practice in karakul sheep breeding to base selection on the visual appraisal of karakul lambs and to apply. a scoring sy'sfem for the main characters viz; curl type, pattern, hair quality and hair length. Measurement is practically restricted to birth weight only but this character plays a minor role in lamb selec- tion.

  14. 49 CFR 260.23 - Form and content of application generally.

    Science.gov (United States)

    2010-10-01

    ... analysis that includes: (1) A statement, together with supporting evidence including copies of all market analyses and studies that have been performed to determine present and future demand for rail services or... financial assistance provided; Applicant's opinion of the value of this security and the basis for such...

  15. 33 CFR 334.260 - York River, Va.; naval restricted areas.

    Science.gov (United States)

    2010-07-01

    ...″ W. (b) The regulations. (1) All persons and all vessels other than naval craft are forbidden to...-fishing are prohibited, and no permanent obstructions may at any time be placed in the area described in... published periods of operation, fishing or other aquatic activities are forbidden in the area. No vessel...

  16. 45 CFR 260.31 - What does the term “assistance” mean?

    Science.gov (United States)

    2010-10-01

    ..., payments, vouchers, and other forms of benefits designed to meet a family's ongoing basic needs (i.e., for... expenses). (2) It includes such benefits even when they are: (i) Provided in the form of payments by a TANF...) Work subsidies (i.e., payments to employers or third parties to help cover the costs of employee wages...

  17. 21 CFR 111.260 - What must the batch record include?

    Science.gov (United States)

    2010-04-01

    ..., LABELING, OR HOLDING OPERATIONS FOR DIETARY SUPPLEMENTS Production and Process Control System: Requirements... record must include the following: (a) The batch, lot, or control number: (1) Of the finished batch of... that quality control personnel: (1) Reviewed the batch production record, including: (i) Review of any...

  18. Stability of 244−260Fm isotopes against alpha and cluster radioactivity

    Indian Academy of Sciences (India)

    Theor. Phys. 113, 305 (2005). [46] G Royer, J. Phys. G: Nucl. Part. Phys. 26, 1149 (2000). [47] R K Gupta and W Greiner, Int. J. Mod. Phys. E3, 335 (1994). [48] P Moller, J R Nix, W D Myers and W J Swiatecki, At. Data Nucl. Data Tables 59,. 185 (1995). [49] S Wang, D Snowden-Ifft, P B Price, K J Moody and E K Hulet, Phys.

  19. 45 CFR 260.30 - What definitions apply under the TANF regulations?

    Science.gov (United States)

    2010-10-01

    ... meaning specified at § 263.0(b) of this chapter. Adult means an individual who is not a “minor child,” as... Mayor of the District of Columbia. IEVS means the Income and Eligibility Verification System operated... participation rates. It means, for a month, a State where: (1)(i) The average rate of total unemployment...

  20. 45 CFR 260.35 - What other Federal laws apply to TANF?

    Science.gov (United States)

    2010-10-01

    ... (ASSISTANCE PROGRAMS), ADMINISTRATION FOR CHILDREN AND FAMILIES, DEPARTMENT OF HEALTH AND HUMAN SERVICES... Disabilities Act of 1990; and (4) Title VI of the Civil Rights Act of 1964. (b) The limitation on Federal... laws, including Federal employment laws (such as the Fair Labor Standards Act (FLSA), the Occupational...

  1. 29 CFR 1952.260 - Description of the plan as initially approved.

    Science.gov (United States)

    2010-07-01

    ... participation in the review proceeding, procedures for prompt restraint or elimination of imminent danger... Occupational Safety and Health Act of 1970, and is consistent with the Constitution and laws of Michigan. The...

  2. 45 CFR 260.34 - When do the Charitable Choice provisions of TANF apply?

    Science.gov (United States)

    2010-10-01

    ... Amendment to the United States Constitution. (2) Neither the Federal government nor a State or local... receives direct Federal TANF or State MOE funds under this part, and participation must be voluntary for...) The participation of a religious organization in, or its receipt of funds from, a TANF program does...

  3. 75 FR 260 - Airworthiness Directives; Empresa Brasileira de Aeronautica S.A. (EMBRAER) Model ERJ 170...

    Science.gov (United States)

    2010-01-05

    ...-1231; Directorate Identifier 2009-NM-212-AD] RIN 2120-AA64 Airworthiness Directives; Empresa Brasileira..., except Federal holidays. For service information identified in this proposed AD, contact Empresa... amends Sec. 39.13 by adding the following new AD: Empresa Brasileira de Aeronautica S.A. (EMBRAER...

  4. Calibration of a Micronal flame photometer model B-260. Intercomparison of the analytical results for potassium

    International Nuclear Information System (INIS)

    Alencar, Lucia Maria Laboissiere; Dalston, Regina Celia Reboucas.

    1983-01-01

    In its environmental monitoring program, NUCLEBRAS analyzes systematically environmental samples in order to determine the total alpha and beta activities. In most of these samples, 40 K is present in measurable quantities and can therefore be used for measuring beta activity since it is almost a 100% beta emitter. A method using a flame photometer for measuring the potassium concentration in water is presented. 5 refs., 28 figs., 25 tabs

  5. A 130-260-Ghz, 1-Mw Free-Electron Maser for Fusion

    NARCIS (Netherlands)

    Urbanus, W. H.; Bongers, W. A.; van Dijk, G.; van der Geer, C. A. J.; Vanieperen, J. P.; Vanderlinden, A.; Manintveld, P.; Sterk, A. B.; Tulupov, A. V.; Verhoeven, A. G. A.; van der Wiel, M. J.; Bratman, V. L.; Denisov, G. G.; Varfolomeev, A. A.; Ivanchenkov, S. N.; Khlebnikov, A. S.; Catellino, M.; Salop, A.; Caplan, M.

    1995-01-01

    We report on design work and testing of several main components of the FOM-Fusion-FEM project. Measurements on the electron gun are presented, showing a uniform beam current profile and a low halo current. A time-dependent simulation study of the interaction between the electron beam and the

  6. 41 CFR 102-34.260 - May we replace a Government-owned motor vehicle sooner?

    Science.gov (United States)

    2010-07-01

    ... mechanical repairs that exceed the fair market value of the motor vehicle. Determine the fair market value by adding the current market value of the motor vehicle plus any capitalized motor vehicle additions (such...

  7. Stability of 244−260Fm isotopes against alpha and cluster radioactivity

    Indian Academy of Sciences (India)

    The computed half-life values, barrier penetrability and other char- acteristics of 244−250Fm isotopes with zero angular momentum transfers. Here the interacting potential is taken as VC + Vp. Parent Emitted Daughter Q-value Penetrability. Decay log10(T1/2) nuclei cluster nuclei. (MeV) P constant Present I Present II.

  8. Insertion of balloon retained gastrostomy buttons: a 5-year retrospective review of 260 patients.

    LENUS (Irish Health Repository)

    Power, Sarah

    2013-04-01

    Radiologically inserted gastrostomy (RIG) is an established way of maintaining enteral nutrition in patients who cannot maintain nutrition orally. The purpose of this study was to evaluate the safety and efficacy of primary placement of a wide bore button gastrostomy in a large, varied patient population through retrospective review.

  9. Recovery of butanol from Clostridium beijerinckii P260 fermentation broth by supercritical CO

    Science.gov (United States)

    Butanol is a superior biofuel to ethanol because of its blend properties and higher energy density. However, its recovery by distillation from the fermentation broth is energy intensive. For this reason, we studied butanol recovery by supercritical CO2 extraction from simulated and actual fermentati...

  10. 260 E-Learning: A Veritable Tool for Preparing Business Education ...

    African Journals Online (AJOL)

    User

    2010-10-17

    Oct 17, 2010 ... learning. The digital form of ICT has altered everything about education, causing many commonly practiced methods and techniques of teaching and learning ... that in the field of e-learning, software agents have been developed with its potential ..... (2001). Agent assistance: From problem solving to music.

  11. Difficulty in detecting discrepancies in a clinical trial report: 260-reader evaluation

    OpenAIRE

    Cole, Graham D; Shun-Shin, Matthew J; Nowbar, Alexandra N; Buell, Kevin G; Al-Mayahi, Faisal; Zargaran, David; Mahmood, Saliha; Singh, Bharpoor; Mielewczik, Michael; Francis, Darrel P

    2015-01-01

    Background: Scientific literature can contain errors. Discrepancies, defined as two or more statements or results that cannot both be true, may be a signal of problems with a trial report. In this study, we report how many discrepancies are detected by a large panel of readers examining a trial report containing a large number of discrepancies. Methods: We approached a convenience sample of 343 journal readers in seven countries, and invited them in person to participate in a study. They were...

  12. Developing a Scope 3 Inventory. Case: Finnair and Carbon Disclosure Project Nordic 260 Report

    OpenAIRE

    Merilä, Outi

    2013-01-01

    The objective of this project-based thesis is to create a roadmap and an inventory tool for a comprehensive scope 3 greenhouse gas (GHG) inventory for the commissioning company Finnair to be used in the company’s Carbon Disclosure Project (CDP) reporting. A scope 3 inventory includes all indirect GHGs resulting from Finnair’s activities. Finnair has participated in CDP reporting since 2008, being one of 6,000 companies providing information about their environmental strategies and GHG emissio...

  13. Extreme phenophase delays and their relationship with natural forcings in Beijing over the past 260 years

    Science.gov (United States)

    Liu, Yang; Zhang, Mingqing; Fang, Xiuqi

    2018-03-01

    By merging reconstructed phenological series from published articles and observations of China Phenology Observation Network (CPON), the first blooming date of Amygdalus davidiana (FBA) in Beijing between 1741 and 2000 is reconstructed. The Butterworth method is used to remove the multi-year variations for generating the phenological series of annual variations in the first blooming date of A. davidiana. The extreme delay years in the phenological series are identified using the percentage threshold method. The characteristics of the extreme delays and the correspondence of these events with natural forcings are analysed. The main results are as follows. In annual phenological series, the extreme delays appeared in single year as main feature, only A.D.1800-1801, 1816-1817 and 1983-1984 were the events of two consecutively extreme years. Approximately 85% of the extreme delays occurred during 1-2 years after the large volcanic eruptions (VEI ≥ 4) in the eastern rim or the western rim of the Pacific Ocean, as the same proportion of the extreme delays followed El Niño events. About 73% years of the extreme delays fall in the valleys of sunspot cycles or the Dalton minimum period in the year or the previous year. According to the certainty factor (CF), the large eruptions have the greatest influence to the extreme delays; sunspot activity is the second, and ENSO is the last one. The extreme phenological delayed year is most likely to occur after a large eruption, which particularly occurs during El Niño year and its previous several years were in the descending portion or valley of sunspot phase.

  14. 12 CFR 250.260 - Miscellaneous interpretations; gold coin and bullion.

    Science.gov (United States)

    2010-01-01

    ... 12 Banks and Banking 3 2010-01-01 2010-01-01 false Miscellaneous interpretations; gold coin and... interpretations; gold coin and bullion. The Board has received numerous inquiries from member banks relating to...) May gold in the form of coins or bullion be counted as vault cash in order to satisfy reserve...

  15. Oral cavity squamous cell carcinoma in 260 patients aged 80 years or more

    International Nuclear Information System (INIS)

    Ortholan, Cecile; Lusinchi, Antoine; Italiano, Antoine; Bensadoun, Rene-Jean; Auperin, Anne; Poissonnet, Gilles; Bozec, Alexandre; Arriagada, Rodrigo; Temam, Stephane; Benezery, Karen; Thariat, Juliette; Tao Yungan; Janot, Francois; Mamelle, Gerard; Vallicioni, Jacques; Follana, Philippe; Peyrade, Frederic; Sudaka, Anne; Bourhis, Jean; Dassonville, Olivier

    2009-01-01

    Purpose: We report the experience of two French cancer centers in the treatment of oral cavity squamous cell carcinoma (SCC) in patients aged ≥80 years. Materials and methods: Two hundred and sixty patients aged ≥80 years with a primary oral cavity SCC were included in this retrospective analysis. Results: Sex ratio was near to 1. Tobacco or alcohol intoxication was the main risk factor for 66% of men and 16% of women and leukoplakia, lichen planus, or oral traumatism for 55% of women and 11% of men (p < 0.0001). Two hundred patients received a loco-regional (LR) treatment with a curative intent (surgery and/or radiotherapy), 29 with a palliative intent and 31 did not receive a LR treatment. Curative treatments were initially planned to be adapted to age in 118 patients (59%). The median disease-specific survival (DSS) was 29 months. In multivariate analysis, the independent prognostic factors for DSS were stage (HR = 0.42 [0.24-0.72]), age (HR = 0.43 [0.24-0.75]) and performance status (HR = 0.50 [0.27-0.95]). The median overall survival (OS) was 14 months. In multivariate analysis, the independent prognostic factors for OS were age (HR = 0.52 [0.35-0.79]), stage (HR = 0.56 [0.38-0.84]), tumor differentiation (HR = 0.60 [0.33-0.93]) and performance status (HR = 0.6 [0.37-0.97]). In patients treated with a curative intent, treatment adapted to age was not associated with a decreased overall survival or disease-specific survival as compared with the standard treatment. However, prophylactic lymph node treatment in stages I-II tumors decreased the rate of nodal recurrence from 38% to 6% (p = 0.01). Conclusion: This study emphasizes the need for prospective evaluation of standard and adapted schedules in elderly patients with oral cavity cancer.

  16. 49 CFR 260.25 - Additional information for Applicants not having a credit rating.

    Science.gov (United States)

    2010-10-01

    ... statement and a spread sheet showing unaudited monthly and year-to-date income statement data up to the date... income statement; (ii) Forecasted year-end balance sheets. These spread sheets shall be accompanied by a... corresponding to those used in this section, the following information: (a) A narrative statement detailing...

  17. Unstable cyclic modulation during the main outburst of KS 1731-260

    Czech Academy of Sciences Publication Activity Database

    Šimon, Vojtěch

    2012-01-01

    Roč. 17, č. 8 (2012), s. 697-704 ISSN 1384-1076 R&D Projects: GA ČR GA205/08/1207 Institutional support: RVO:67985815 Keywords : X-rays * close binaries * circumstellar matter Subject RIV: BN - Astronomy, Celestial Mechanics, Astrophysics Impact factor: 1.850, year: 2012

  18. 50 CFR 260.97 - Conditions for providing fishery products inspection service at official establishments.

    Science.gov (United States)

    2010-10-01

    ... limited to, size and complexity of operations, volume and variety of products produced, and adequacy of... contracting party will: (1) Use only wholesome raw material which has been handled or stored under sanitary conditions and is suitable for processings; maintain the official establishment(s), designated on the...

  19. C26:0-Carnitine Is a New Biomarker for X-Linked Adrenoleukodystrophy in Mice and Man

    NARCIS (Netherlands)

    van de Beek, Malu-Clair; Dijkstra, Inge M. E.; van Lenthe, Henk; Ofman, Rob; Goldhaber-Pasillas, Dalia; Schauer, Nicolas; Schackmann, Martin; Engelen-Lee, Joo-Yeon; Vaz, Frédéric M.; Kulik, Wim; Wanders, Ronald J. A.; Engelen, Marc; Kemp, Stephan

    2016-01-01

    X-linked adrenoleukodystrophy (ALD), a progressive neurodegenerative disease, is caused by mutations in ABCD1 and characterized by very-long-chain fatty acids (VLCFA) accumulation. Virtually all males develop progressive myelopathy (AMN). A subset of patients, however, develops a fatal cerebral

  20. Polarized proton induced pion production on 10B at 200, 225, 250 and 260 MeV incident energies

    International Nuclear Information System (INIS)

    Ziegler, W.; Auld, E.G.; Falk, W.R.; Giles, G.L.; Jones, G.; Lolos, G.J.; McParland, B.

    1985-02-01

    The angular distributions of both the differential cross-section and the analyzing power are presented for the 10 B(p,π) 11 B reaction leading to the ground and first excited states of 11 B. The differential cross-section shows very little angular structure or energy dependence, but the analyzing power exhibits a considerable energy dependence for both states. This dependence, similar to that observed for the 12 C(p,π + ) 13 C reaction, may be a signature of the fact that single-particle final states are involved

  1. Review on the Book: Pochekaev R.Yu. The Golden Horde Law (Kazan, 2009. 260 p. » 231

    Directory of Open Access Journals (Sweden)

    E.G. Sayfetdinova

    2015-06-01

    Full Text Available This paper contains a review of the R.Yu. Pochekaev’s book “The Golden Horde Law”. The reviewer points out that the Pochekaev’s book is a significant academic research in both the study of the Golden Horde history and the law system of the Eurasian Turkic-Mongol peoples. This book is published by the Center for Research on the Golden Horde Civilization at the Sh.Marjani Institute of History of the Academy of Sciences of the Republic of Tatarstan. For several years, the author of this book, R.Yu. Pochekaev, has been concerned with the the history of the Golden Horde State and its law system. He has published a number of works on this topic, the main conclusions of which are reflected in this generalizing work. The study is based on a wide range of sources (annals and chronicles, memoirs of contemporaries, bureaucratic and numismatic materials and numerous studies including the works of foreign specialists in the original language. In his book, the author organically combines the latest achievements of research on both the Golden Horde history and theory and history of law. The book will be of interest to experts of the Golden Horde history and Orientalists, who are often faced with the legal aspects of the material under study.

  2. 40 CFR 260.30 - Non-waste determinations and variances from classification as a solid waste.

    Science.gov (United States)

    2010-07-01

    ... PROTECTION AGENCY (CONTINUED) SOLID WASTES (CONTINUED) HAZARDOUS WASTE MANAGEMENT SYSTEM: GENERAL Rulemaking... that are reclaimed in a continuous industrial process; and (e) Hazardous secondary materials that are... 40 Protection of Environment 25 2010-07-01 2010-07-01 false Non-waste determinations and variances...

  3. Strategic Forum. Number 260. November 2010. Private Contractors in Conflict Zones: The Good, the Bad, and the Strategic Impact

    Science.gov (United States)

    2010-11-01

    procedures, and institutions to deal with the presence of armed contractors in conflict zones. The Montreux Document is an example of such an effort and...Business Operations. Initial Observations,” accessed at <http:// defensenewsstand.com/showdoc.asp?docid=5192010_may19a>. 36 See The Montreux Document...Geneva, Switzerland: Inter- national Committee of the Red Cross, August 2009), available at <www.icrc.org/web/eng/siteeng0.nsf/htmlall/ montreux

  4. A Two-Color Fourier Transform Mm-Wave Spectrometer for Gas Analysis Operating from 260-295 GHZ

    Science.gov (United States)

    Steber, Amanda L.; Harris, Brent J.; Lehmann, Kevin K.; Pate, Brooks H.

    2013-06-01

    We have designed a two-color mm-wave spectrometer for Fourier transform mm-wave spectroscopy that uses consumer level components for the tunable synthesizers, digital control of the pulse modulators, and digitization of the coherent free induction decay (FID). The excitation pulses are generated using an x24 active multiplier chain (AMC) that produces a peak power of 30 mW. The microwave input to the AMC is generated in a frequency up conversion circuit that accepts a microwave input frequency from about 2-4 GHz. This circuit also generates the input to the mm-wave subhamonic mixer that creates the local oscillator from a separate 2-4 GHz microwave input. Excitation pulses at two independently tunable frequencies are generated using a dual-channel source based on a low-cost, wideband synthesizer integrated circuit (Valon Technology Model 5008). The outputs of the synthesizer are pulse modulated using a PIN diode switch that is driven using the arbitrary waveform generator (AWG) output of a USB-controlled high-speed digitizer / arbitrary waveform generator combination unit (Tie Pie HS-5 530 XM). The two pulses are combined using a Wilkinson power divider before input to the up conversion circuit. The FID frequency is down converted in a two-stage mixing process to 65 MHz. The two LO frequencies used in the receiver are provided by a second Valon 5008. The FID is digitized at 200 MSamples/s using the 12-bit Tie Pie digitizer. The digital oscilloscope (and its AWG channel) and the two synthesizers use a 10 MHz reference signal from a Rubidium clock to permit time-domain signal averaging. A key feature of the digital oscilloscope is its deep memory of 32 Mpts (complemented by the 64 Mpt memory in the 240 MS/s AWG). This makes it possible to perform several one- and two-color coherent measurements, including pulse echoes and double-resonance spectroscopy, in a single "readout" experiment to speed the analysis of mm-wave rotational spectra. The spectrometer sensitivity and frequency accuracy are illustrated by high-speed measurements of OCS rotational transitions for low-abundance isotopes. Examples of pulse echo measurements to determine the collisional relaxation rate and two-color double-resonance measurements to confirm the presence of a molecular species will be illustrated using OCS as the room-temperature gas sample.

  5. 45 CFR 260.33 - When are expenditures on State or local tax credits allowable expenditures for TANF-related...

    Science.gov (United States)

    2010-10-01

    ... State or local tax credits allowable expenditures for TANF-related purposes? (a) To be an allowable expenditure for TANF-related purposes, any tax credit program must be reasonably calculated to accomplish one... credit to be an allowable expenditure. (2) Under a State Earned Income Tax Credit (EITC) program, the...

  6. 18 CFR 2.60 - Facilities and activities during an emergency-accounting treatment of defense-related expenditures.

    Science.gov (United States)

    2010-04-01

    ... RULES GENERAL POLICY AND INTERPRETATIONS Statements of General Policy and Interpretations Under the..., such as those described in paragraph (a) of this section, to be prudent investment for ratemaking purposes. (c) When a person, not otherwise subject to the jurisdiction of the Commission, files an...

  7. 33 CFR 162.260 - Channel leading to San Juan Harbor, P.R.; use, administration, and navigation.

    Science.gov (United States)

    2010-07-01

    ... prosecution of the work shall not obstruct the channel unnecessarily. (g) The dredge will slack lines running... greater than 4 miles an hour, and the propelling machinery shall be stopped when crossing the lines to the... by day and four white lights hung in a vertical line by night to indicate the passing side. (d...

  8. Pregnancy Outcome of Chorionic Villus Sampling on 260 Couples with Beta- Thalassemia Trait in North of Iran

    Directory of Open Access Journals (Sweden)

    Nesa Asnafi

    2010-05-01

    Full Text Available "nChorionic villus sampling (CVS is a new method and its true risk of fetal loss and complications is not still clearly determined. The objective of this study was to review the clinical pregnancy outcome of transabdominal CVS (TA-CVS performed on women with minor beta thalassemia. TA-CVS performed on 300 women with a singleton pregnancy and we could follow 213 women until delivery. Data regarding induced legal abortion, spontaneous abortion, vaginal leakage, Vaginal bleeding and deformity of extremities ( limb reduction were obtained by questionnaire in five years. All CVS were performed by one operator. The mean gestation at time of CVS was 82.4±11.3 days. 79.2% of the procedures were made between 10-13 completed weeks and in other women (20.7% TA-CVS was performed at 13-16 weeks. The majority (86.9% required only one puncture. There were 47 pregnancy terminations because of fetal major beta thalassemia diagnosis (18 %. The rate of spontaneous abortion in our study was over ally (1.4% and in two patients vaginal bleeding was noticed. We didn't find any vaginal leakage and limb reduction in our survey. TA-CVS is an accurate and safe procedure in experienced hands. It should be considered as one of the safe available procedures for women who require prenatal genetic diagnosis and wish to receive earlier diagnostic information for probable termination of pregnancy.

  9. Epidemiologic features of von Willebrand's disease in Doberman pinschers, Scottish terriers, and Shetland sheepdogs: 260 cases (1984-1988)

    Science.gov (United States)

    Brooks, M; Dodds, W J; Raymond, S L

    1992-04-15

    During a study period from 1985 through 1988, plasma von Willebrand's factor antigen (vWF:Ag) concentration was measured as a marker for prevalence of the von Willebrand's disease (vWD) trait in Doberman Pinschers (doberman, n = 5,554), Scottish Terriers (scottie, n = 1,363), and Shetland Sheepdogs (sheltie, n = 4,279). Significant increase in prevalence of the trait was seen in scotties and shelties during this period. In 1988, 73% of dobermans, 30% of scotties, and 28% of shelties tested had abnormal vWF:Ag concentration (less than 50% vWF:Ag). We found significant differences between breeds with respect to age and vWF:Ag concentration of clinically affected dogs at time of diagnosis. The affected dobermans were older (doberman mean age, 4.6 years; scottie mean age, 1.7 years; sheltie mean age, 1.9 years) and had higher concentration of plasma vWF:Ag (doberman mean vWF:Ag, 15%; scottie mean vWF:Ag, 0%; sheltie mean vWF:Ag, 8%). Bleeding in affected dogs of all 3 breeds was observed predominantly from mucosal surfaces and from cutaneous sites of surgery or trauma. The most common site of mucosal bleeding in scotties and shelties was oral or nasal cavity, and in dobermans was the urogenital tract. Differences in clinical manifestations of vWD in purebred dogs may reflect heterogeneous defects within the vWF gene, causing a variety of abnormalities in production, structure, and function of vWF protein. Analogous to vWD in human beings, acquired deficiencies of vWF may also contribute to the clinical variability of vWD in dogs.

  10. Decision 2010-021 : TransAlta Wind Ardenville wind plant and substation : application no. 1604970, proceeding ID 260

    International Nuclear Information System (INIS)

    2010-01-01

    TransAlta Wind, a wholly owned subsidiary of TransAlta Corporation, filed an application in April 2009 to construct and operate the Ardenville wind farm and substation in Alberta. The wind farm consists of 23 wind turbines, each rated at 3 MW, for a total installed capacity of 69 MW. The wind farm would be connected to the Alberta Interconnected Electric System at the substation. TransAlta anticipates that a new 138-kV transmission line will be required and has contacted the transmission facilities for the future applications. The Alberta Utilities Commission issued a notice to all interested parties and landholders within 2 km of the proposed wind farm. Two residents raised concerns regarding the use of fossil fuels and alternative fuels, ecological impacts and aesthetic impacts of wind farms and land values. Upon review of information, the Commission was satisfied that approval of the application was in the public interest and that the wind farm complies with all regulatory requirements, including sound levels. Pursuant to sections 11, 14 and 15 of the Hydro and Electric Energy Act, the Commission approved the application and granted approval to TransAlta Wind to construct and operate the Ardenville wind power plant and substation.

  11. Functional Expression of the Thiolase Gene thl from Clostridium beijerinckii P260 in Lactococcus lactis and Lactobacillus buchneri

    Science.gov (United States)

    The first step of the butanol pathway involves an acetyl-CoA acetyltransferase (ACoAAT), which controls the key branching point from acetyl-CoA to butanol. ACoAAT, also known as thiolase (EC 2.3.1.9), is encoded by the thl gene and catalyzes ligation of 2 acetyl-CoA into acetoacetyl-CoA. Bioinform...

  12. 33 CFR 207.260 - Yazoo Diversion Canal, Vicksburg, Miss., from its mouth at Kleinston Landing to Fisher Street...

    Science.gov (United States)

    2010-07-01

    ... Western Rivers (rivers emptying into the Gulf of Mexico and their tributaries) prescribed by the U.S... unless the logs float sufficiently high in the water to make it evident that the section will not sink en...

  13. A standardized set of 260 pictures for Modern Greek: norms for name agreement, age of acquisition, and visual complexity.

    Science.gov (United States)

    Dimitropoulou, María; Duñabeitia, Jon Andoni; Blitsas, Panagiotis; Carreiras, Manuel

    2009-05-01

    The appropriate selection of both pictorial and linguistic experimental stimuli requires a previous language-specific standardization process of the materials across different variables. Considering that such normative data have not yet been collected for Modern Greek, in this study normative data for the color version of the Snodgrass and Vanderwart picture set (Rossion & Pourtois, 2004) were collected from 330 native Greek adults. Participants named the pictures (providing name agreement ratings) and rated them for visual complexity and age of acquisition. The obtained measures represent a useful tool for further research on Greek language processing and constitute the first picture normative study for this language. The picture norms from this study and previous ones may be downloaded from brm.psychonomic-journals.org/content/supplemental.

  14. Cellulosic butanol biofuel production from sweet sorghum bagasse (SSB): Impact of hot water pretreatment and solid loadings on fermentation employing Clostridium beijerinckii P260

    Science.gov (United States)

    A novel butanol fermentation process was developed in which sweet sorghum bagasse (SSB) was pretreated using liquid hot water (LHW) pretreatment technique followed by enzymatic hydrolysis and butanol (acetone butanol ethanol; ABE) fermentation. A pretreatment temperature of 200 deg C resulted in the...

  15. The ATLAS(3D) project : I. A volume-limited sample of 260 nearby early-type galaxies: science goals and selection criteria

    NARCIS (Netherlands)

    Cappellari, Michele; Emsellem, Eric; Krajnovic, Davor; McDermid, Richard M.; Scott, Nicholas; Kleijn, G. A. Verdoes; Young, Lisa M.; Alatalo, Katherine; Bacon, R.; Blitz, Leo; Bois, Maxime; Bournaud, Frederic; Bureau, M.; Davies, Roger L.; Davis, Timothy A.; de Zeeuw, P. T.; Duc, Pierre-Alain; Khochfar, Sadegh; Kuntschner, Harald; Lablanche, Pierre-Yves; Morganti, Raffaella; Naab, Thorsten; Oosterloo, Tom; Sarzi, Marc; Serra, Paolo; Weijmans, Anne-Marie

    The ATLAS3D project is a multiwavelength survey combined with a theoretical modelling effort. The observations span from the radio to the millimetre and optical, and provide multicolour imaging, two-dimensional kinematics of the atomic (H i), molecular (CO) and ionized gas (H beta, [O iii] and [N

  16. 30 CFR 260.122 - How long will a royalty suspension volume be effective for a lease issued in a sale held after...

    Science.gov (United States)

    2010-07-01

    ... inflation unless the lease terms prescribe a different price threshold. (ii) Any natural gas produced for... after calendar year 2007 for inflation unless the lease terms prescribe a different price threshold... product, as published by the Department of Commerce, changed during the calendar year. (2) You must pay...

  17. Sharing the slope: depth partitioning of agariciid corals and associated Symbiodinium across shallow and mesophotic habitats (2-60 m) on a Caribbean reef.

    NARCIS (Netherlands)

    Bongaerts, P.; Frade, P.R.; Ogier, J.J.; Hay, K.B.; van Bleijswijk, J.; Englebert, N.; Vermeij, M.J.A.; Bak, R.P.M.; Visser, P.M.; Hoegh-Guldberg, O

    2013-01-01

    Background Scleractinian corals and their algal endosymbionts (genus Symbiodinium) exhibit distinct bathymetric distributions on coral reefs. Yet, few studies have assessed the evolutionary context of these ecological distributions by exploring the genetic diversity of closely related coral species

  18. Effect of cellulosic sugar degradation products (furfural and hydroxymethylfurfural) on acetone-butanol-ethanol (ABE) fermentation using Clostridium beijerinckii P260

    Science.gov (United States)

    Studies were performed to identify chemicals present in wheat straw hydrolysate (WSH) that enhance acetone butanol ethanol (ABE) productivity. These chemicals were identified as furfural and hydroxymethyl furfural (HMF). Control experiment resulted in the production of 21.09-21.66 gL**-1 ABE with a ...

  19. SU-E-J-260: Dose Recomputation Versus Dose Deformation for Stereotactic Body Radiation Therapy in Lung Tumors: A Dosimetric Study

    International Nuclear Information System (INIS)

    Ma, M; Flynn, R; Xia, J; Bayouth, J

    2014-01-01

    Purpose: To evaluate the dosimetric accuracy between recomputed dose and deformed dose for stereotactic body radiation therapy in lung tumors. Methods: Two non-small-cell lung cancer patients were analyzed in this study, both of whom underwent 4D-CT and breath-hold CT imaging. Treatment planning was performed using the breath-hold CT images for the dose calculation and the 4D-CT images for determining internal target volumes. 4D-CT images were reconstructed with ten breathing amplitude for each patient. Maximum tumor motion was 13 mm for patient 1, and 7 mm for patient 2. The delivered dose was calculated using the 4D-CT images and using the same planning parameters as for the breath-hold CT. The deformed dose was computed by deforming the planning dose using the deformable image registration between each binned CT and the breath-hold CT. Results: For patient 1, the difference between recomputed dose and deformed mean lung dose (MLD) ranged from 11.3%(0.5 Gy) to 1.1%(0.06 Gy), mean tumor dose (MTD) ranged from 0.4%(0.19 Gy) to −1.3%(−0.6 Gy), lung V20 ranged from +0.74% to −0.33%. The differences in all three dosimetric criteria remain relatively invariant to target motion. For patient 2, V20 ranged from +0.42% to −2.41%, MLD ranged from −0.2%(−0.05 Gy) to −10.4%(−2.12 Gy), and MTD ranged from −0.5%(−0.31 Gy) to −5.3%(−3.24 Gy). The difference between recomputed dose and deformed dose shows strong correlation with tumor motion in all three dosimetric measurements. Conclusion: The correlation between dosimetric criteria and tumor motion is patient-specific, depending on the tumor locations, motion pattern, and deformable image registration accuracy. Deformed dose can be a good approximation for recalculated dose when tumor motion is small. This research is supported by Siemens Medical Solutions USA, Inc and Iowa Center for Research By Undergraduates

  20. Intraoperative iodinated contrast swallow with CT-scan delayed control for detection of early complications in laparoscopic gastric bypass: A case series of 260 cases

    Directory of Open Access Journals (Sweden)

    Vincenzo Consalvo, M.D.

    2017-01-01

    Conclusions: This study gives a contribute to the existing issue of fast track in bariatric surgery for the early diagnosis of complications and patients' readmission or non-discharge. In conclusion, the use of intraoperative iodinated water soluble contrast swallow and abdominal CT-scan at 48 h was a safe and accurate test in order to detect and treat any potential early surgical complication in LRYGB.

  1. Age at puberty, ovulation rate, and reproductive tract traits of developing gilts fed two lysine levels and three metabolizable energy levels from 100 to 260 d of age

    Science.gov (United States)

    The objective of this study was to determine the effect of feeding different lysine and metabolizable energy (ME) levels to developing gilts on age at puberty and reproductive tract measurements. Crossbred Large White × Landrace gilts (n = 1221) housed in groups from 100 d of age until slaughter (ap...

  2. 20 CFR 667.269 - What procedures and sanctions apply to violations of §§ 667.260 through 667.268?

    Science.gov (United States)

    2010-04-01

    ... investigation and resolution of the violations are provided for under the Grant Officer's resolution process at....266(b)(1)). (c) Sanctions and remedies are provided for in WIA section 181(d)(3) for violations of...

  3. The ATLAS3D project - I. A volume-limited sample of 260 nearby early-type galaxies: science goals and selection criteria

    NARCIS (Netherlands)

    Cappellari, Michele; Emsellem, Eric; Krajnović, Davor; McDermid, Richard M.; Scott, Nicholas; Verdoes Kleijn, G. A.; Young, Lisa M.; Alatalo, Katherine; Bacon, R.; Blitz, Leo; Bois, Maxime; Bournaud, Frédéric; Bureau, M.; Davies, Roger L.; Davis, Timothy A.; de Zeeuw, P. T.; Duc, Pierre-Alain; Khochfar, Sadegh; Kuntschner, Harald; Lablanche, Pierre-Yves; Morganti, Raffaella; Naab, Thorsten; Oosterloo, Tom; Sarzi, Marc; Serra, Paolo; Weijmans, Anne-Marie

    The ATLAS3D project is a multiwavelength survey combined with a theoretical modelling effort. The observations span from the radio to the millimetre and optical, and provide multicolour imaging, two-dimensional kinematics of the atomic (H I), molecular (CO) and ionized gas (Hβ, [O III] and [N I]),

  4. Apparent digestibility of diets containing sugar cane silage treatedwith chemical or microbial additives fed to lambs - DOI: 10.4025/actascianimsci.v29i1.260

    OpenAIRE

    Gentil, Renato Shinkai; ESALQ; Pires, Alexandre Vaz; ESALQ; Susin, Ivanete; ESALQ; Nussio, Luiz Gustavo; ESALQ; Mendes, Clayton Quirino; ESALQ; Mourão, Gerson Barreto; ESALQ

    2007-01-01

    A ensilagem da cana-de-açúcar propicia benefícios logísticos à propriedade,contudo, as altas concentrações de etanol encontradas nas silagens pode reduzir o consumovoluntário, e conseqüentemente, afetar o desempenho animal. Foram utilizados 12 borregosSanta Inês (49 ± 3 kg) distribuídos em um delineamento experimental de blocos completoscasualizados. As rações foram compostas por 50% de volumoso e 50% de concentrado na MS, sendo os quatro tratamentos experimentais: a) cana-de-açúcar in natura...

  5. Optical Photometry of LMXBs: UW CrB (=MS 1603+260 and V1408 Aql (=4U 1957+115

    Directory of Open Access Journals (Sweden)

    P. A. Mason

    2015-02-01

    Full Text Available We present new optical observations of V1408 Aql (= 4U 1957+115, the only low mass X-ray binary, black hole candidate known to be in a persistently soft state. We combine new broadband optical photometry with previously published data and derive a precise orbital ephemeris. The optical light curves display sinusoidal variations modulated on the orbital period as well as large night to night changes in mean intensity. The amplitude of the variations increases with mean intensity while maintaining sinusoidal shape. Considering the set of constraints placed by the X-ray and optical data we argue that V1408 Aql may harbor a very low mass black hole. Optical light curves of UW CrB display partial eclipses of the accretion disk by the donor star that vary both in depth and orbital phase. The new eclipses of UW CrB in conjunction with published eclipse timings are well fitted with a linear ephemeris. We derive an upper limit to the rate of change of the orbital period. By including the newly observed type I bursts with published bursts in our analysis, we find that optical bursts are not observed between orbital phases 0.93 and 0.07, i.e. they are not observable during partial eclipses of the disk.

  6. Erratum to "Combustion oscillation study in a kerosene fueled rocket-based combined-cycle engine combustor" [Acta Astronaut. 129 (2016) 260-270

    Science.gov (United States)

    Huang, Zhi-Wei; He, Guo-Qiang; Qin, Fei; Xue, Rui; Wei, Xiang-Geng; Shi, Lei

    2017-03-01

    The publisher regrets that in the above article we found that Table 1 is present online, in the html version in ScienceDirect, but has been omitted in error from the final version of the PDF online and in the print version. The table can be found below:

  7. Instability and breakdown of the coral-algae symbiosis upon exceedence of the interglacial pCO2 threshold (>260 ppmv): the "missing" Earth-System feedback mechanism

    Science.gov (United States)

    Wooldridge, Scott A.

    2017-12-01

    Changes in the atmospheric partial pressure of CO2 ( pCO2) leads to predictable impacts on the surface ocean carbonate system. Here, the importance of atmospheric pCO2 ecosystems. Indeed, it is concluded that this symbiotic threshold enacts a fundamental feedback mechanism needed to explain the characteristic dynamics (and drivers) of the coupled land-ocean-atmosphere carbon cycle of the Earth System since the mid-Miocene, some 25 million yr ago.

  8. Chemistry of the heaviest elements--one atom at a time

    International Nuclear Information System (INIS)

    Hoffman, Darleane C.; Lee, Diana M.

    2000-01-01

    In keeping with the goal of the Viewpoint series of the Journal of Chemical Education, this article gives a 75-year perspective of the chemistry of the heaviest elements, including a 50-year retrospective view of past developments, a summary of current research achievements and applications, and some predictions about exciting, new developments that might be envisioned within the next 25 years. A historical perspective of the importance of chemical separations in the discoveries of the transuranium elements from neptunium (Z=93) through mendelevium (Z=101) is given. The development of techniques for studying the chemical properties of mendelevium and still heavier elements on the basis of measuring the radioactive decay of a single atom (''atom-at-a-time'' chemistry) and combining the results of many separate experiments is reviewed. The influence of relativistic effects (expected to increase as Z 2 ) on chemical properties is discussed. The results from recent atom-at-a-time studies of the chemistry of the heaviest elements through seaborgium (Z=106) are summarized and show that their properties cannot be readily predicted based on simple extrapolation from the properties of their lighter homologues in the periodic table. The prospects for extending chemical studies to still heavier elements than seaborgium are considered and appear promising

  9. Digestibilidade aparente de dietas contendo silagem de cana-de-açúcar tratada com aditivo químico ou microbiano para cordeiros - DOI: 10.4025/actascianimsci.v29i1.260 Apparent digestibility of diets containing sugar cane silage treatedwith chemical or microbial additives fed to lambs - DOI: 10.4025/actascianimsci.v29i1.260

    Directory of Open Access Journals (Sweden)

    Clayton Quirino Mendes

    2007-11-01

    Full Text Available A ensilagem da cana-de-açúcar propicia benefícios logísticos à propriedade,contudo, as altas concentrações de etanol encontradas nas silagens pode reduzir o consumovoluntário, e conseqüentemente, afetar o desempenho animal. Foram utilizados 12 borregosSanta Inês (49 ± 3 kg distribuídos em um delineamento experimental de blocos completoscasualizados. As rações foram compostas por 50% de volumoso e 50% de concentrado na MS, sendo os quatro tratamentos experimentais: a cana-de-açúcar in natura (CC, bsilagem de cana-de-açúcar tratada com L. buchneri (SAD, c silagem de cana-de-açúcar tratada com 1,0% de uréia (U1,0 e d silagem de cana-de-açúcar tratada com 1,5% de uréia (U1,5. O coeficiente de digestibilidade da FDN foi menor (p0,05 para as variáveis avaliadas.Ensiling of sugar cane maycontribute to improve operational efficiency at farm level. However, the high ethanol levelfound in sugar cane ensiled without additive may reduce voluntary feed intake and mayaffect animal performance. This experiment was performed to evaluate the effects of freshsugar cane and sugar cane silage treated with microbial (Lactobacillus buchneri or chemical(urea additives on apparent digestibility of diets fed to lambs. Twelve Santa Inês lambs (49 ± 3 kg were assigned to a complete randomized block design and fed a 50:50 (concentrate:roughage ratio TMR. Experimental treatments were the roughage source: fresh sugar cane(FSC, sugar cane silage with L. buchneri (SCS + Lb, sugar cane silage with 1% urea (SCS1% or sugar cane silage with 1.5% urea (SCS1.5%. NDF digestibility coefficient waslower (p0.05 in nitrogen balance for all thecomparisons evaluated. The sugar cane ensiled improve NDF digestibility.

  10. Tuberculosis in hospital environment: clinical profile in a tertiary hospital from Ceará and level of knowledge of health personnel about control measures - doi:10.5020/18061230.2010.p260

    Directory of Open Access Journals (Sweden)

    Roberto da Justa Pires Neto

    2012-01-01

    Full Text Available (TB and to assess the knowledge of health personnel on fundamental concepts about TB and control measures for pulmonary tuberculosis in a hospital environment. Methods: The study was conducted in a tertiary hospital in Fortaleza-CE and involved patients admitted with TB and health professionals responsible for assistance. A first phase was characterized by a retrospective study of medical records of patients admitted with suspected TB. In a second stage, a cross-sectional study with application of a structured questionnaire assessed the knowledge of health personnel on TB control measures in a hospital environment. Results: Sixty-seven patients admitted with suspected TB had their medical records assessed. Among the confirmed cases, the most frequent clinical form was pulmonary (81.3%. Out of 55 patients admitted with suspected pulmonary tuberculosis, only 29 (52.7% were admitted in a respiratory isolation bed. Twenty-six patients with suspected pulmonary tuberculosis on admission stayed a total of 148 days out of a respiratory isolation bed (average 4.1 days / patient. The knowledge of 159 health professionals about TB was assessed. Regarding the transmission of TB, 107 (67.2% were unaware of airborne transmission and 109 (68.5% ignored the clinical forms that require respiratory isolation. Conclusions: Pulmonary tuberculosis is the most frequent clinical form among inpatients in a tertiary hospital in Fortaleza- CE. Considerable fraction of health personnel doesn’t know key concepts related to tuberculosis and essential for the proper and safe care.

  11. Neumonía adquirida en la comunidad en lactantes y preescolares del municipio de Turbo, Antioquia Community acquired neumonia in chil- children dren aged 2-60 months in Colombia

    Directory of Open Access Journals (Sweden)

    Ana Eugenia Arango

    2004-09-01

    Full Text Available Se estudiaron 110 niños entre los 2 y los 60 meses de edad, con diagnóstico de neumonía adquirida en la comunidad, en el Hospital Francisco Valderrama del municipio de Turbo, Antioquia, pertenecientes al programa Vida Infantil de la Universidad de Antioquia. Los criterios de inclusión fueron la taquipnea y el tiraje de acuerdo con las normas de la OMS para el diagnóstico de la infección respiratoria baja en lactantes y preescolares en países en vías de desarrollo. Los pacientes se estudiaron microbiológicamente mediante hemocultivos, prueba de látex para antígenos bacterianos en la orina, prueba de Elisa para Micoplasma pneumoniae y panel respiratorio para los virus que causan más frecuentemente dicha enfermedad. Se hicieron además hemoleucogramas y radiografías pulmonares. Todas las muestras se tomaron bajo criterios protocolizados y se trasladaron por vía aérea a la ciudad de Medellín bajo normas estrictas de conservación, para ser procesadas en el Laboratorio de Investigaciones en Infectología Pediátrica de la Universidad de Antioquia. Los exámenes más adecuados para la comprobación del diagnóstico fueron las radiografías de tórax con 77%; los hemocultivos con una positividad de 11.1%, el panel respiratorio con 3.7%, la prueba de látex para los antígenos bacterianos con 7.4% y la prueba de ELISA con 0.9%. Los hemoleucogramas tuvieron un amplio margen de variabilidad. No se encontró relación estadística entre las variables epidemiológicas estudiadas y la gravedad de la infección. El estudio confirma la escasa sensibilidad de los exámenes paraclínicos y reafirma la importancia del diagnóstico clínico temprano como base para iniciar la terapia. One hundred and ten children aged between 2 and 60 months with the diagnosis of communityacquired pneumoniae, were studied at Francisco Valderrama Hospital in the city of Turbo, Colombia; they belonged to the University of Antioquia Child Life program. Admission criteria were tachypnea and retraction according to the WHO guidelines for lower respiratory tract infection diagnosis in infants and preschool children in developing countries. Patients were studied microbiologically by means of blood cultures, urine latex aggutination test for bacterial antigens, ELISA test for Mycoplasma pneumoniae, and a panel for respiratory viruses that frequently cause this disease. Blood specimens and pulmonary radiographies were also taken under protocolized criteria and the former were transported by plane to Medellín under strict measures of preservation, in order to be processed at the Pediatric Investigation and Infectology Laboratory of the University of Antioquia. Radiographies were positive in 77% of cases, blood cultures in 11.1%, latex agglutination for bacterial antigens in 7.4%, respiratory viruses panel in 3.7%, and ELISA test in 0.9%. Hemoleucograms had a wide range of variability. Relationships between epidemiological variables and the severity of the infection were not found. The study confirms the scarce positivity of paraclinical tests and reaffirms the importance of early clinical diagnosis as the basis for starting therapy.

  12. Fenicias de Eurípides: Concepción agonal de espacio y tiempo en prólogo y párodos (vv.1-260

    Directory of Open Access Journals (Sweden)

    Graciela N. Hamamé

    2013-09-01

    Nos proponemos demostrar que el diseño espacio-temporal de prólogo y párodos construye una suerte de agón en el nivel espacial que se evidencia en el trazado de los personajes de Yocasta, Antígona y el Pedagogo en el prólogo y de las mujeres fenicias en la párodos. De modo que también resulte agonal la confrontación entre propio y ajeno, ya mencionada, como característica de la composición teatral euripidea, acorde con las realidades comunicativas de la época de representación de la tragedia y con la propuesta poética del autor.

  13. Support for the feasibility of the ages and stages questionnaire as a developmental screening tool: a cross-sectional study of South African and Zambian children aged 2-60 months.

    Science.gov (United States)

    van Heerden, Alastair; Hsiao, Celia; Matafwali, Beatrice; Louw, Julia; Richter, Linda

    2017-02-16

    There is a growing global acknowledgement that improving child survival rates is no longer sufficient. Emphasis is shifting to the improvement of health and developmental trajectories in early childhood. Screening and measurement of these trajectories in low and middle income countries is difficult, however, as they currently rely on developmental tests standardised among populations of children growing up in resource rich environments. This paper presents a comparison of one such tool adapted for use with children living in Southern Africa to children from the United States, Norway, Korea and Spain. The Ages and Stages Questionnaire version 3 (ASQ-3) was adapted and administered to 853 children living in South Africa and Zambia. Children in southern Africa were found to perform significantly better than children from other countries early in life, especially in the domains of communication, gross motor and fine motor skills. By the age of five, children in southern Africa were performing significantly worse than their peers in the domains of fine motor and problem-solving. The results indicate the applicability of the ASQ-3 in southern Africa and point to the importance of early interventions to protect the early good development of African children in order to promote positive life trajectories.

  14. ORF Alignment: NC_003424 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available HRTRARTESSVFVIDKKTSQCVHYQANERGKHYV 180 ... Query: 260 KIHCHVAKENYAARVRSLQTYDAISKDVLS...RWVYPFVPDSNLLNQTFSYQRHQIYKEEDV 319 ... KIHCHVAKENYAARVRSLQTYDAISKDVLSRWVYPFVPDSNLLNQTFSYQRHQIYKEEDV Sbjct: 241 KIHCHVAKENYA

  15. Optical simulations for the S3 project - Super separator spectrometer - gamma-electron coincidence spectroscopy of a transfermium nucleus: the 251Md101

    International Nuclear Information System (INIS)

    Dechery, Fabien

    2012-01-01

    In analogy with the atomic closed shells giving rise to the stability and high ionisation energies of noble gases, nuclear physics also has its magic numbers of protons and neutrons which enhance nuclear structure stability. Knowledge of the structure of doubly-magic nuclei, both proton and neutron numbers, is crucial to parameterize theoretical models. The discovery of the next and ultimate magic numbers will provide a strong constraint on the many predictions. These two numbers are like the centre coordinates of an area of enhanced stability of the nuclear chart, well known as 'island of stability'. These superheavy nuclei only exist due to pure quantum shell effects. My thesis work deals with two distinct, but complementary, aspects of fundamental physics with the common goal of studying these extreme mass nuclei structure. The first part corresponds to the development of a next generation instrument for nuclear physics to allow synthesis and spectroscopy studies of superheavy nuclei: the Super Separator Spectrometer S 3 . This project will be installed at SPIRAL2 (GANIL) and has been approved by the French Research National Agency (ANR) within the EQUIPEX framework. It has been designed to take advantage of the high intensity heavy ion beam from the LINAC, giving access to a wide range of physical programs. The second part corresponds to the preparation, realisation and analysis of an experiment on 251-Mendelevium in which the very first prompt gamma-electron coincidence spectroscopy was performed for a transfermium nuclei. (author) [fr

  16. Reseña de Conquistando el fin del mundo. La Misión La Candelaria y la salud de la población Selkman, Tierra del fuego 1895-1931 de Romina Casali. Prohistoria, Rosario, 2014, 260 páginas

    OpenAIRE

    Ramacciotti, Karina Inés

    2016-01-01

    Romina Casali aborda de una manera atenta, a la vez que sofisticada, los cruces entre la enfermedad, los discursos científicos y políticos en la misión salesiana La Candelaria (Río Grande) entre 1895-1931. Este estudio de caso permite reflexionar sobre fenómenos de larga duración y pasibles de ser estudiados en historia de la sociedad Selk’nam, comunidad cazadora-recolectora. La propuesta no queda atrapada en la descripción de lo local sino que de una manera madura aventura hipótesis sobre lo...

  17. María Águeda Méndez, Secretos del oficio. Avatares de la Inquisición Novohispana, México, El Colegio de México/UNAM, 2001, 260 pp. (Serie de estudios de cultura literaria novohispana, 17).

    OpenAIRE

    Vallejo Cervantes, Gabriela

    2005-01-01

    La presente obra es el resultado de una larga investigación; durante más de diez años un equipo de investigadores y becarios se han internado en los archivos inquisitoriales con el fin de constituir un catálogo de textos literarios y paraliterarios consignados en los procesos del Santo Oficio durante el siglo XVIII. María Águeda Méndez, una de las cabezas de ese equipo, ofrece en este libro un recorrido por algunos de los textos heterogéneos que formaron parte de este catálogo: las revelacion...

  18. MicroSIFT Courseware Evaluations. [Set 11 (223-259), Set 12 (260-293), and a Special Set of 99 LIBRA Reviews of Junior High School Science Software, Including Subject and Title Indexes Covering Sets 1-12 and Special Set L].

    Science.gov (United States)

    Northwest Regional Educational Lab., Portland, OR.

    This document consists of 170 microcomputer software package evaluations prepared by the MicroSIFT (Microcomputer Software and Information for Teachers) Clearinghouse at the Northwest Regional Education Laboratory. Set 11 consists of 37 packages. Set 12 consists of 34 packages. A special unnumbered set, entitled LIBRA Reviews, treats 99 packages…

  19. Microbial raw data for UV-C LED disinfection study

    Data.gov (United States)

    U.S. Environmental Protection Agency — This study evaluated ultraviolet (UV) light emitting diodes (LEDs) emitting at 260 nm, 280 nm, and the combination of 260|280 nm together for their efficacy at...

  20. Geranium molle L

    Czech Academy of Sciences Publication Activity Database

    Šumberová, Kateřina; Ducháček, M.

    2009-01-01

    Roč. 44, č. 2 (2009), s. 260-260 ISSN 1211-5258 Institutional research plan: CEZ:AV0Z60050516 Keywords : strongly endangered species * flora of fish storage pond complexes * ruderal grasslands Subject RIV: EF - Botanics

  1. 78 FR 67386 - Announcement of Funding Awards; Indian Community Development Block Grant Program Fiscal Year 2013

    Science.gov (United States)

    2013-11-12

    ...), 567,530 HC Three new housing units. Dave Shaffer, Executive Director, 27740 Jefferson Ave, Ste 260.... Dave Shaffer, Executive Director, 27740 Jefferson Ave, Ste 260, Temecula, CA 92590, 951-760-7390... Shaffer, Executive Director, 27740 Jefferson Ave, Ste 260, Temecula, CA 92590, 951-760-7390. All Mission...

  2. Penicillium expansum

    DEFF Research Database (Denmark)

    Andersen, Birgitte; Smedsgaard, Jørn; Frisvad, Jens Christian

    2004-01-01

    was examined using TLC (260 isolates), HPLC (85 isolates), and MS (22 isolates). The results showed that none of the 260 isolates produced ochratoxin A, penitrem A, or rubratoxin B. However, chaetoglobosin A and communesin B were produced consistently by all 260 isolates. Patulin and roquefortine C were...

  3. Advanced Materials Research Status and Requirements. Volume 2. Appendix: Material Properties Data Review

    Science.gov (United States)

    1986-03-01

    diamnodiphenylsulphone MPD - m- phenylene diamine K. 4-7 tc ii .’..-. THE 8DM CORPORATION TABLE 4.2-2. Key Composite Properties for the Various Epoxy Resins...260 10 Addition-PMR 83 260 1000 Addition- bismaleimide 83 230 1000 Condensation 55 350 10 Condensation 55 t320 1000 Thermoplastic 55 320 1000 Addition...PMR 55 320 500 Addition-PMR 55 290 1000 Thermoplastic 55 260 50000 Addition-PMR 55 260 10000 Additon- bismaleimide 55 260 1000 Thermoplastic 28 J350 i0

  4. Application of alpha spectrometry to the discovery of new elements by heavy-ion-beam bombardment

    International Nuclear Information System (INIS)

    Nitschke, J.M.

    1983-05-01

    Starting with polonium in 1898, α-spectrometry has played a decisive role in the discovery of new, heavy elements. For even-even nuclei, α-spectra have proved simple to interpret and exhibit systematic trends that allow extrapolation to unknown isotopes. The early discovery of the natural α-decay series led to the very powerful method of genetically linking the decay of new elements to the well-established α-emission of daughter and granddaughter nuclei. This technique has been used for all recent discoveries of new elements including Z = 109. Up to mendelevium (Z = 101), thin samples suitable for α-spectrometry were prepared by chemical methods. With the advent of heavy-ion accelerators new sample preparation methods emerged. These were based on the large momentum transfer associated with heavy-ion reactions, which produced energetic target recoils that, when ejected from the target, could be thermalized in He gas. Subsequent electrical deposition or a He-jet technique yielded samples that were not only thin enough for α-spectroscopy, but also for α- and #betta#-recoil experiments. Many variations of these methods have been developed and are discussed. For the synthesis of element 106 an aerosol-based recoil transport technique was devised. In the most recent experiments, α-spectrometry has been coupled with the magnetic analysis of the recoils. The time from production to analysis of an isotope has thereby been reduced to 10 - 6 s; while it was 10 - 1 to 10 0 s for He-jets and 10 1 to 10 3 s for rapid chemical separations. Experiments are now in progress to synthesize super heavy elements (SHE) and to analyze them with these latest techniques. Again, α-spectrometry will play a major role since the expected signature for the decay of a SHE is a sequence of α-decays followed by spontaneous fission

  5. 14 CFR 298.21 - Filing for registration by air taxi operators.

    Science.gov (United States)

    2010-01-01

    ... operator shall remain in effect until it is amended by the carrier or canceled by the Department. (c... Aviation Administration, AFS-260, or on the World Wide Web at http://www.faa.gov/avr/afs/afs200/afs260... business, if different from its mailing address, and its telephone number and fax number; (iii) The carrier...

  6. 78 FR 64192 - Endangered and Threatened Wildlife and Plants; Extending the Public Comment Periods and...

    Science.gov (United States)

    2013-10-28

    ... information meeting at the Hon-Dah Conference Center, 777 Highway 260, Pinetop, AZ 85935 (3 miles outside of...; (916) 929-7900. Hon-Dah Conference Center, 777 Highway 260, Pinetop, AZ 85935 (3 miles outside of... and to delist the gray wolf elsewhere, contact the Headquarters Office, Ecological Services; telephone...

  7. 75 FR 61356 - Hazardous Waste Management System; Identification and Listing of Hazardous Waste; Correction

    Science.gov (United States)

    2010-10-05

    ... Waste Management System; Identification and Listing of Hazardous Waste; Correction AGENCY: Environmental... thermal desorber residual solids with Hazardous Waste Numbers: F037, F038, K048, K049, K050, and K051. In... and correcting it in Table 1 of appendix IX to part 261--Waste Excluded Under Sec. Sec. 260.20 and 260...

  8. 75 FR 57686 - Hazardous Waste Management System; Identification and Listing of Hazardous Waste Amendment

    Science.gov (United States)

    2010-09-22

    ... Waste Management System; Identification and Listing of Hazardous Waste Amendment AGENCY: Environmental...) 260.20 and 260.22 allows facilities to demonstrate that a specific waste from a particular generating facility should not be regulated as a hazardous waste. Based on waste-specific information provided by the...

  9. 76 FR 33272 - Agency Information Collection Activities OMB Responses

    Science.gov (United States)

    2011-06-08

    ...; Identification of Non-Hazardous Secondary Materials That Are Solid Waste (Final Rule); 40 CFR 260.22 and 260.31(c... Number 2384.02; NSPS for Commercial and Industrial Solid Waste Incineration (CISWI) units; 40 CFR part 60... (EPA). ACTION: Notice. SUMMARY: This document announces the Office of Management and Budget (OMB...

  10. Evaluating UV-C LED disinfection performance and investigating potential dual-wavelength synergy

    Science.gov (United States)

    This study evaluated ultraviolet (UV) light emitting diodes (LEDs) emitting at 260 nm, 280 nm, and the combination of 260|280 nm together for their efficacy at inactivating Escherichia. coli, MS2 coliphage, human adenovirus type 2 (HAdV2), and Bacillus pumilus spores; research in...

  11. Browse Title Index

    African Journals Online (AJOL)

    Items 251 - 260 of 260 ... Issue, Title. Vol 46 (2006), The use of two biological formulations of Bacillus Thuringiensis and Bacillus Sphaericus in the control of mosquito vectors of malaria in drains and rice fields, Abstract. M H Ocran, F Akpabey. Vol 47 (2007), The Wildlife Trade In Ghana: A Threat To Biodiversity Conservation ...

  12. Mike O’Callaghan Federal Medical Center Campus Environmental Assessment

    Science.gov (United States)

    2012-03-01

    intrusions into imaginary surfaces in accordance with UFC 3-260-01 para 1.2.2, 1.9, attachment 6 and CFAR Part 77. Nevada Department of Transportation...Environmental Protection Aviation Safety Review and compliance per UFC 3-260- 01 para 1.2.2, 1.9, attachment 6 and CFAR Part 77 USAF and FAA

  13. Search Results | Page 26 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    2016-04-20

    Results 251 - 260 of 260 ... Wood is a scarce resource across North Africa, yet it is commonly used in rural areas as fuel for baking bread in traditional ovens. Rural households can burn through more than one tonne of firewood a year, threatening to deplete forests. Published date. April 20, 2016. Research in Action.

  14. Current Writing: Text and Reception in Southern Africa: Contact

    African Journals Online (AJOL)

    Principal Contact. Prof. Michael Chapman Editor-in-Chief English Studies, University of KwaZulu-N English Studies University of KwaZulu-Natal Howard College Campus Durban South Africa 4041. Phone: +27 31 260 1536. Fax: +27 31 260 2392. Email: chapmanm@ukzn.ac.za ...

  15. 40 CFR 60.44b - Standard for nitrogen oxides (NOX).

    Science.gov (United States)

    2010-07-01

    ...) Coal: (i) Mass-feed stoker 210 0.50 (ii) Spreader stoker and fluidized bed combustion 260 0.60 (iii) Pulverized coal 300 0.70 (iv) Lignite, except (v) 260 0.60 (v) Lignite mined in North Dakota, South Dakota...

  16. Bubble growth on an impulsively powered microheater

    NARCIS (Netherlands)

    Yin, Z.; Prosperetti, Andrea; Kim, J.

    2004-01-01

    The dynamics of single vapor bubbles in FC-72 generated by a transient heat pulse applied to a square 260 × 260 μm2 microheater are investigated for different heat fluxes between 3 and 44 MW/m2. It is found that in all cases the growth consists of two steps, a first relatively violent one, followed

  17. NCBI nr-aa BLAST: CBRC-SARA-01-0337 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-0337 ref|ZP_01069237.1| arsenical pump membrane protein [Campylobacter... jejuni subsp. jejuni 260.94] gb|EAQ59437.1| arsenical pump membrane protein [Campylobacter jejuni subsp. jejuni 260.94] ZP_01069237.1 0.67 27% ...

  18. NCBI nr-aa BLAST: CBRC-SARA-01-1189 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-1189 ref|ZP_01069237.1| arsenical pump membrane protein [Campylobacter... jejuni subsp. jejuni 260.94] gb|EAQ59437.1| arsenical pump membrane protein [Campylobacter jejuni subsp. jejuni 260.94] ZP_01069237.1 0.53 28% ...

  19. THE EFFECT OF LIGHT, TEMPERATURE AND DESICCATION ON ...

    African Journals Online (AJOL)

    DR. AMINU

    was 260/280 = 2.0; 260/230=2.1. Absobance ratio of. 1.8 or greater indicated level of purity which correlated well with subsequent restriction endonuclease digestibility at RNA in the extract. Isolation of poly (A) RNA (Affinity chromatography method): Chromatograph was carried on wet chromatography 0.34 Hitach (Japan).

  20. Photoluminescent properties of Sr2CeO4 :Eu and Sr2CeO4 : Eu ...

    Indian Academy of Sciences (India)

    Administrator

    (carbon) atmosphere exhibited single broadband range from 260 to 390 nm. The (PL) emission peaks of both the phosphors at 467 (blue), 537 (green) and 616 nm (red) generate white light under 260, 280 and 350 nm excitation wavelengths. The Commission International de l'Eclairage (CIE) colour coordinates conforms.

  1. Reaching the superlinear convergence phase of the CG method

    Czech Academy of Sciences Publication Activity Database

    Axelsson, Owe; Karátson, J.

    2014-01-01

    Roč. 260, č. 260 (2014), s. 244-257 ISSN 0377-0427 R&D Projects: GA MŠk ED1.1.00/02.0070 Institutional support: RVO:68145535 Keywords : superlinear convergence * conjugate gradient method * eigenvalues Subject RIV: BA - General Mathematics Impact factor: 1.266, year: 2014 http://www.sciencedirect.com/science/article/pii/S0377042713005451

  2. Život i djelo Dmitrija Ivanoviča Mendeljejeva - povodom 100. obljetnice smrti

    Directory of Open Access Journals (Sweden)

    Vaščić, V.

    2007-04-01

    Full Text Available The life and activities of D. I. Mendeleyev are presented primarily in view of his role in the progress of chemistry. Born in Tobolsk in 1834 to a numerous and poor family, burdened by the family's bad luck and his ill health, he graduated natural sciences in 1855 at St. Petersburg and was awarded a gold medal for exceptional success. In 1855/56 he was teacher at a secondary school in Odessa. He obtained his MSc degree in 1856 in St. Petersburg where he was appointed lecturer in 1857. He was guest scientist 1859-1861 at the University in Heidelberg where he investigated the behavior of gases under various pressures and temperatures and discovered the criticaltemperature of liquefaction. He achieved his PhD degree in 1865 in St. Petersburg with a thesis on ethanol/water mixtures. Therein he had proven the existence of alcohol hydrates. His work later enabled the elaboration of modern conceptions on solvate formation in solutions. In 1865 he was elected professor at the University in St. Petersburg where he worked until 1890 when he was forced to retire. Preparing his textbook "Fundamentals of Chemistry" in 1869, he discovered that properties of chemical elements depend periodically on atomic weights. This enabled the elaboration of a periodic system as the base for classification in chemistry, as well as for further research and development of chemical science and technology. The international scientific community accepted Mendeleyev's system with distrust and it was generally acknowledged not before three "prophecies" of Mendeleyev were realized by the discovery of gallium (1875, scandium (1879 and germanium (1886. Later, in verification of his predictions, other elements - including transuranics - were discovered. Hence, in honor of the creator of the periodic system, the element of atomic number 101 was named mendelevium (1955. Mendeleyev was reactivated in 1892 as director of the Central Bureau for Measures and Weights where he worked until

  3. Effect of pH and ionic strength on the spectrophotometric assessment of nucleic acid purity.

    Science.gov (United States)

    Wilfinger, W W; Mackey, K; Chomczynski, P

    1997-03-01

    The ratio of absorbance at 260 and 280 nm (the A260/280 ratio) is frequently used to assess the purity of RNA and DNA preparations. Data presented in this report demonstrate significant variability in the RNA A260/280 ratio when different sources of water were used to perform the spectrophotometric determinations. Adjusting the pH of water used for spectrophotometric analysis from approximately 5.4 to a slightly alkaline pH of 7.5-8.5 significantly increased RNA A260/280 ratios from approximately 1.5 to 2.0. Our studies revealed that changes in both the pH and ionic strength of the spectrophotometric solution influenced the A260/280 ratios. In addition, the ability to detect protein contamination was significantly improved when RNA was spectrophotometrically analyzed in an alkaline solution. UV spectral scans showed that the 260-nm RNA absorbance maximum observed in water was shifted by 2 nm to a lower wavelength when determinations were carried out in Na2HPO4 buffer at a pH of 8.5. We found RNA A260/280 ratios to be more reliable and reproducible when these spectrophotometric measurements were performed at pH 8.0-8.5 in 1-3 mM Na2HPO4 buffer.

  4. Fires. October-December 08

    Science.gov (United States)

    2008-10-01

    illustrated American denazification in action. In August 1945, Nuremberg’s military governors forced the Chamber of Handicraft for Middle Franconia to...Chamber of Handicraft File, Box 16-2/13, RG 260; MGLS Nuremberg, AHR, Apr 1945-Jun 1946, Monthly and Weekly Reports File, Box 8-3/13, RG 260. 15. OMGN...Denazification, Denazification File, Box 112-1/9, RG 260. 17. Ibid. 18. Georg Lämmerman Statement, 11 Aug 1945, Chamber of Handicraft File, Box 16-2/13

  5. Dynamic scaling and kinetic roughening of poly(ethylene) islands grown by vapor phase deposition

    Czech Academy of Sciences Publication Activity Database

    Choukourov, A.; Melnichuk, I.; Gordeev, I.; Kylián, O.; Hanuš, J.; Kousal, J.; Solař, P.; Hanyková, L.; Brus, Jiří; Slavínská, D.; Biederman, H.

    2014-01-01

    Roč. 565, 28 August (2014), s. 249-260 ISSN 0040-6090 Institutional support: RVO:61389013 Keywords : poly(ethylene) * physical vapor deposition * island growth Subject RIV: CD - Macromolecular Chemistry Impact factor: 1.759, year: 2014

  6. Afterparty Baselis / Maria-Kristiina Soomre

    Index Scriptorium Estoniae

    Soomre, Maria-Kristiina, 1978-

    2001-01-01

    Moodsa ja kaasaegse kunsti messist "Art 32 Basel" 13.-18. VI. Kutsutud esinejate näitusel "Art Unlimited" osalesid Ilja Kabakov, Richard Serra, James Turrell, Pipilotti Rist, Vanessa Beecroft, Atelier van Lieshout. Väljapanekud 260 galeriilt.

  7. Enucleation of the solitary epithelial cyst of pancreatic head in an adult

    African Journals Online (AJOL)

    2011-06-14

    . The impact of Laparoscopy and laparoscopic ultrasound on the management of pancreatic cystic lesions. Arch Surg 2000;135:260-4. 3. Hernandez LV, Mishra G, Forsmark C, Draganov PV, Petersen JM, Hochwald SN, et al.

  8. Transformations of Aortic Arches During Metamorphosis of the Spade-Foot Toad, Pelobates fuscus

    Czech Academy of Sciences Publication Activity Database

    Majorová, H.; Roček, Zbyněk

    2004-01-01

    Roč. 260, č. 3 (2004), s. 309 ISSN 0362-2525. [International Congress of Vertebrate Morphology /7./. 27.07.2004-01.08.2004, Boca Raton] Keywords : Anura * Circulatory System * Metamorphosis Subject RIV: EA - Cell Biology

  9. NPP Grassland: Calabozo, Venezuela, 1969-1987, R1

    Data.gov (United States)

    National Aeronautics and Space Administration — This data set contains four ASCII text files for a 260-hectare humid Trachypogon savanna at the Estacion Biologica de Los Llanos, Calabozo, Venezuela (8.93 N, -67.42...

  10. 2003 Reson 8101ER Multibeam Sonar Data from Cruise OES-03-07/AHI-03-07, Data Set Name Rota.

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Reson 8101ER multibeam Data were collected between 16-17 September 2003 (JD 259-260) aboard NOAA Survey Launch Acoustic Habitat Investigator (AHI) at Rota Island in...

  11. Studies on supramolecular gel formation using DOSY NMR

    Czech Academy of Sciences Publication Activity Database

    Nonappa, N.; Šaman, David; Kolehmainen, E.

    2015-01-01

    Roč. 53, č. 4 (2015), s. 256-260 ISSN 0749-1581 Institutional support: RVO:61388963 Keywords : DOSY * VT NMR * gel * diffusion coefficients Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 1.226, year: 2015

  12. Full text

    African Journals Online (AJOL)

    IndexCopernicus Portal System

    visible spectrophotometry. UV–visible absorption spectra were measured at 20 C on a Peltier-thermostatted Cary-Varian 1E UV–visible spectrophotometer. Quantification of oligonucleotide components used millimolar extinction coefficients ( 260).

  13. Resonance – Journal of Science Education | Indian Academy of ...

    Indian Academy of Sciences (India)

    -Medication in Wild Animals · Rajasekar Raman Sripathi Kandula · More Details Fulltext PDF. pp 254-260 Feature Article. Molecule Matters - The Quinine Story: A 100-Year Saga · Vijay Nair Sreekumar Vellalath · More Details Fulltext PDF.

  14. Ontogeny in Tertiary Frogs

    Czech Academy of Sciences Publication Activity Database

    Roček, Zbyněk

    2004-01-01

    Roč. 260, č. 3 (2004), s. 322-323 ISSN 0362-2525. [International Congress of Vertebrate Morphology /7./. 27.07.2004-01.08.2004, Boca Raton] Keywords : Anura * Tertiary * Czech Republic Subject RIV: EA - Cell Biology

  15. 75 FR 78617 - Final Flood Elevation Determinations

    Science.gov (United States)

    2010-12-16

    .... Rockport Creek Approximately 2,300 feet +260 Unincorporated Areas of downstream of Martin Hot Spring County. Luther King Boulevard. Approximately 1,300 feet +263 downstream of Martin Luther King Boulevard. Town...

  16. African Journal of Biotechnology - Vol 3, No 5 (2004)

    African Journals Online (AJOL)

    Improving bambara groundnut productivity using gamma irradiation and in vitro techniques · EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. HK Adu-Dapaah, RS Sangwan, 260-265 ...

  17. Fauna Europaea - all European animal species on the web

    DEFF Research Database (Denmark)

    de Jong, Yde; Verbeek, Melina; Michelsen, Verner

    2014-01-01

    Abstract Fauna Europaea is Europe's main zoological taxonomic index, making the scientific names and distributions of all living, currently known, multicellular, European land and freshwater animals species integrally available in one authoritative database. Fauna Europaea covers about 260...

  18. Search Results | Page 12 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    2008-01-01

    Results 111 - 120 of 260 ... ... natural resources (NR) management that contribute to mitigated health risks and sustained agro-ecosystems in highland communities. Published date. January 1, 2008. Reports. COMMUNICATION POLICY COMPETITIVENESS TELECOMMUNICATIONS CONSUMER DEMAND PRICING AFRICA ...

  19. Search Results | Page 22 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Results 211 - 220 of 260 ... Unemployment is one of the main economic, social and political problems facing governments in the Middle East and North Africa. The nature and scale of the problem are not captured by aggregate unemployment statistics. Project.

  20. Search Results | Page 13 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    2009-01-01

    Results 121 - 130 of 260 ... East African experience with submarine cable regulation : GTZ/WATRA Workshop on Submarine Cable Regulation, 12 - 13 November 2009, Accra, Ghana. Published date. January 1, 2009. Reports. TELECOMMUNICATIONS PRICING CONSUMER PROTECTION COMPETITIVENESS TELEPHONE ...

  1. Search Results | Page 6 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    2009-01-01

    Results 51 - 60 of 260 ... Trade liberalization, inter-industry wage differentials and job quality in Egyptian manufacturing. Published date. January 1, 2009. Papers. DATA COLLECTING QUESTIONNAIRES TELECOMMUNICATIONS Evaluation Access to ICT AFRICA SOUTH OF SAHARA ...

  2. Ecotoxicity and genotoxicity assessment of cytotoxic antineoplastic drugs and their metabolites

    Czech Academy of Sciences Publication Activity Database

    Zounková, R.; Kovalová, L.; Bláha, Luděk; Dott, W.

    2010-01-01

    Roč. 81, č. 2 (2010), s. 253-260 ISSN 0045-6535 Institutional research plan: CEZ:AV0Z60050516 Keywords : cytotoxic drugs * ecotoxicity * metabolite Subject RIV: EF - Botanics Impact factor: 3.155, year: 2010

  3. Proposal of new Oβ oxidation criterion for new types of the Zr1Nb alloy of fuel claddings

    Czech Academy of Sciences Publication Activity Database

    Negyesi, M.; Klouček, V.; Lorinčík, Jan; Novotný, L.; Kabátová, J.; Linhart, S.; Adámek, J.; Siegl, J.; Vrtílková, V.

    2013-01-01

    Roč. 261, August (2013), s. 260-268 ISSN 0029-5493 Institutional support: RVO:67985882 Keywords : Oxygen * Experimental methods * Kinetics equation Subject RIV: JA - Electronics ; Optoelectronics, Electrical Engineering Impact factor: 0.972, year: 2013

  4. 75 FR 62383 - Agency Information Collection Activities OMB Responses

    Science.gov (United States)

    2010-10-08

    ....04; NESHAP for Petroleum Refineries, Catalytic Cracking, Reforming and Sulfur Units; 40 CFR part 63...; Identification of Non-Hazardous Secondary Materials That Are Solid Waste (Proposed Rule); in 40 CFR 260.22 and...

  5. Resonance – Journal of Science Education | News

    Indian Academy of Sciences (India)

    -Medication in Wild Animals · Rajasekar Raman Sripathi Kandula · More Details Fulltext PDF. pp 254-260 Feature Article. Molecule Matters - The Quinine Story: A 100-Year Saga · Vijay Nair Sreekumar Vellalath · More Details Fulltext PDF.

  6. 48 CFR 552.238-72 - Identification of Products That Have Environmental Attributes.

    Science.gov (United States)

    2010-10-01

    ..., brochures, and pricelists. (iii) Online product website. (iv) Electronic data submission for GSA Advantage... claim (see 16 CFR part 260, Guides for the Use of Environmental Marketing Claims). The Government will...

  7. Magneto-plasmonics as a tool for magnetic field sensing

    Czech Academy of Sciences Publication Activity Database

    Vlček, J.; Lesňák, M.; Pištora, J.; Otipka, P.; Sobota, Jaroslav

    2013-01-01

    Roč. 58, č. 9 (2013), s. 260-264 ISSN 0447-6441 Institutional support: RVO:68081731 Keywords : plasmon resonance * magneto-optics * sensors * response factors Subject RIV: JA - Electronics ; Optoelectronics, Electrical Engineering

  8. ORF Alignment: NT_037436 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available sophila melanogaster] gb|AAN12217.1| CG32305-PA ... [Drosophila melanogaster] ... Length = 198 ... Query: 260 EPYPNVSILVA...DMVNYTHLTTTLEAPQLVEILHDLFVNFDLAANRNRAMRIKFLGDSYNC 319 ... EPYPNVSILVADMVNYTHL...TTTLEAPQLVEILHDLFVNFDLAANRNRAMRIKFLGDSYNC Sbjct: 1 ... EPYPNVSILVADMVNYTHLTTTLEAPQL

  9. Is It a Cosmetic, a Drug, or Both? (or Is It Soap?)

    Science.gov (United States)

    ... Simplified Chinese: PDF 251KB Traditional Chinese, PDF: 260KB Korean, PDF: 217KB Whether a product is a cosmetic ... does the law define a cosmetic? The Federal Food, Drug, and Cosmetic Act (FD&C Act) defines ...

  10. Právnický elektronický slovník (PES)

    Czech Academy of Sciences Publication Activity Database

    Cvrček, František

    2015-01-01

    Roč. 154, č. 3 (2015), s. 247-260 ISSN 0231-6625 Institutional support: RVO:68378122 Keywords : legal language * legal dictionaries * linguistic analysis of legal texts Subject RIV: AG - Legal Sciences

  11. East African Medical Journal - Vol 92, No 5 (2015)

    African Journals Online (AJOL)

    Uterine Rupture in a Primigravida with Mullerian Anomaly at 27 Weeks Gestation · EMAIL FULL TEXT EMAIL FULL TEXT · DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. K Kunuthia, A Kihara, RJ Kosgei, AN Bosire, 260-263 ...

  12. Biostratigraphic analysis of the top layer of sediment cores from the reference and test sites of the INDEX area

    Digital Repository Service at National Institute of Oceanography (India)

    Gupta, S.M.

    searched,identified,illustrated (Figure 1),counted,and tab-ulated for range charts (Figure 2). 260 S. M. Gupta Figure 1.Scanning electron microscopic photomicrographs of the Late Neogene radiolarian indexspecies:(1) Buccinosphaera invaginata...

  13. Circulation and water characteristics on isanosteric surfaces in the Northern Arabian Sea during February-April

    Digital Repository Service at National Institute of Oceanography (India)

    Das, V.K.; Gouveia, A.D.; Varma, K.K.

    Distribution of water characteristics and circulation were studied on 260, 160, 140, 120 and 80 cl/t surfaces using isanosteric analysis and geostrophic computation The circulation pattern consisted of several eddies and meanders The most prominent...

  14. Temperature measurements from a moored thermistor chain in Mamala Bay, Oahu, Hawaii during 1997-1998 (NODC Accession 0000625)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — A moored thermistor chain was deployed about a mile south of Honolulu Harbor in waters of about 260 feet depth. The instrument was in operation from August 1997 -...

  15. Wei et al., Afr J Tradit Complement Altern Med. (2015) 12(5):127 ...

    African Journals Online (AJOL)

    Proff.Adewunmi

    -guanidinium isothiocyanate procedure using Trizol reagent. The total RNA concentration was determined by absorbance at 260 nm with the use of a spectrophotometer. First-strand complementary. DNA (cDNA) synthesis was performed in a ...

  16. 77 FR 46752 - Agency Information Collection Activities OMB Responses

    Science.gov (United States)

    2012-08-06

    ... change. EPA ICR Number 2310.02; RCRA Definition of Solid Waste (Renewal); 40 CFR parts 260 and 261; was... Number 2173.05; EPA's Green Power Partnership and Combined Heat and Power Partnership (Renewal); was...

  17. Development of a One-Handed, Environmental Surface-Sampling Device

    Science.gov (United States)

    2016-05-01

    260 nm (A260) and 280 nm (A280). To determine the DNA concentration for each sample, the NanoDrop software used a modified Beer – Lambert equation and...Highway, Suite 1204, Arlington, VA 22202-4302. Respondents should be aware that notwithstanding any other provision of law , no person shall be...PROGRAM ELEMENT NUMBER 6. AUTHOR( S ) Angelini, Daniel; Ford, Kyle; Emanuel, Peter; Chue, Calvin (ECBC); and Williams, Kristy (Excet) 5d. PROJECT NUMBER

  18. 78 FR 41132 - Submission for OMB Review; Comment Request

    Science.gov (United States)

    2013-07-09

    .... Notice is hereby given that, pursuant to the Paperwork Reduction Act of 1995 (44 U.S.C. 3501 et seq.... Rules 7a-15 through 7a-37 (17 CFR 260.7a-15--260.7a-37) under the Trust Indenture Act of 1939 (15 U.S.C... Officer, Securities and Exchange Commission, c/o Remi Pavlik-Simon, 100 F Street NE., Washington, DC 20549...

  19. Vigna subterranea L. Verdc

    African Journals Online (AJOL)

    2012-05-14

    May 14, 2012 ... Available on website http://www.wrc.org.za. ISSN 0378-4738 (Print) = Water SA Vol. 39 No. 2 April 2013. ISSN 1816-7950 (On-line) = Water SA Vol. 39 No. 2 April 2013. 191. * To whom all correspondence should be addressed. ☎ +27 33 260 5442; fax: +27 33 260 6094; e-mail: tmabhaudhi@gmail.com.

  20. On two Psolidae (Echinodermata: Holothuroidea) from the Gulf of California, Mexico Dos Psolidae (Echinodermata: Holothuroidea) del golfo de California, México

    OpenAIRE

    Claude Massin; Michel E. Hendrickx

    2013-01-01

    Two species of holothuroids of the family Psolidae have been collected in the Gulf of California, Mexico. Psolus diomedeae Ludwig, 1894, a species previously known from the Pacific coast of Mexico and abundant in the Gulf of California was collected in 3 stations, in a depth range of 58 to 260 m. Lissothuria hancocki (Deichmann, 1941), previously reported for the California Current and the Gulf of California, was collected in one station at 260 m depth, together with P. diomedeae.Se recolecta...

  1. 1230-IJBCS-Article-Daton Sika

    African Journals Online (AJOL)

    DR GATSING

    %) quand le soleil est au zénith, avant de croître à .... température du four. La température de couplage du GC est de 260 °C. L'énergie des électrons est de 70 eV et la source des électrons est à 260 °C. Les données sont enregistrées et ...

  2. Synergic effect of n-3 polyunsaturated fatty acids and rosiglitazone in the amelioration of insulin resistance and adipose tissue inflammatinon

    Czech Academy of Sciences Publication Activity Database

    Kuda, Ondřej; Jílková, Zuzana; Rossmeisl, Martin; Flachs, Pavel; Ogston, N. C.; Mohamed-Ali, V.; Cinti, S.; Kopecký, Jan

    2007-01-01

    Roč. 50, Suppl.1 (2007), S260-S260 ISSN 0012-186X. [Annual Meeting of the European Association for the Study of Diabetes /43./. 18.09.2007-21.09.2007, Amsterdam] R&D Projects: GA ČR(CZ) GD303/03/H065 Institutional research plan: CEZ:AV0Z50110509 Keywords : cpo1 * insulin * rosiglitazone * PUFA Subject RIV: FB - Endocrinology, Diabetology, Metabolism, Nutrition

  3. A PCR method targeting internal transcribed spacers: the simultaneous detection of Babesia bigemina and Babesia bovis in cattle.

    Science.gov (United States)

    Liu, Junlong; Guan, Guiquan; Liu, Aihong; Li, Youquan; Yin, Hong; Luo, Jianxun

    2014-03-01

    In this study, two pairs of oligonucleotide primers were designed according to the nucleotide sequence of the internal transcribed spacers (ITSs) of Babesia bigemina and B. bovis isolates from China. The primers were used in a multiplex PCR to detect parasite DNA in blood samples from cattle. There was no cross reactions with B. ovata, B. major, B. sp. Kashi, Theileria annulata, T. sergenti, T. sinensis or normal bovine DNA. The sensitivity of multiplex PCR assay was 1 pg and 10 pg DNA for B. bigemina and B. bovis, respectively. A total of 260 field blood samples collected from cattle in five provinces of China were analyzed by multiplex PCR and light microscopy. PCR testing revealed that 7.3% (19/260) and 5.8% (15/260) of cattle were positive for B. bigemina and B. bovis and 1.2% (3/260) of cattle were co-infected with B. bigemina and B. bovis. Using light microscopy, 2.3% (6/260) and 1.5% (4/260) of cattle were infected by B. bigemina and B. bovis, respectively, and no co-infection was found. The results showed that the multiplex PCR developed in the present study could be an alternative diagnostic tool for the detection of B. bovis and B. bigemina infection in cattle.

  4. Evaluation of novel micronized encapsulated essential oil-containing phosphate and lactate blends for growth inhibition of Listeria monocytogenes and Salmonella on poultry bologna, pork ham, and roast beef ready-to-eat deli loaves.

    Science.gov (United States)

    Casco, G; Taylor, T M; Alvarado, C

    2015-04-01

    Essential oils and their constituents are reported to possess potent antimicrobial activity, but their use in food processing is limited because of low solubility in aqueous systems and volatilization during processing. Two proprietary noncommercial essential oil-containing phosphate blends were evaluated for antimicrobial activity against Salmonella enterica cocktail (SC)-and Listeria monocytogenes (Lm)-inoculated deli meat products made from pork, poultry, or beef. Four treatments were tested on restructured cured pork ham, emulsified chicken bologna, and restructured beef loaf: nonencapsulated essential oil with phosphate version 1 at 0.45% of final batch (EOV145; chicken and pork, or EEOV245 beef), micronized encapsulated essential oil with phosphate version 2 at 0.60% of final batch (EEOV260), a 2.0% potassium lactate (PL) control, and a negative control (CN) with no applied antimicrobial agent. Compared with the CN, none of the antimicrobial agents (EEOV260, EOV145, PL) successfully limited Lm or SC growth to deli loaves, the EEOV260 inhibited growth of SC at days 21 and 28 to the same level of efficacy as PL (0.5 log cycle). In roast beef samples, on day 35, the SC growth was inhibited ca. 0.5 log CFU/g by EEOV260 when compared with the CN. In conclusion the EEOV260 can function to replace PL to limit Salmonella and Lm growth in ready-to-eat deli products. Further testing is needed to ensure consumer acceptability.

  5. Prevalence of C. botulinum and C. perfringens spores in food products available on Polish market

    Directory of Open Access Journals (Sweden)

    Grenda Tomasz

    2017-09-01

    Full Text Available Introduction: The aim of this study was to evaluate the prevalence of Clostridium botulinum and Clostridium perfringens in food samples purchased from Polish producers. Material and Methods: The analyses were performed on 260 food samples collected in Lublin and Subcarpathian regions: 56 of smoked meat, 21 of pork meat, 20 of dairy products, 26 of vegetable and fruit preserves, 40 of ready-to-eat meals, 27 of fish preserves, and 70 of honey collected directly from apiaries. Results: C. botulinum strains were isolated from 2.3% (6/260 of samples and the isolates were classified as toxin types A (4/260 and B (2/260. C. perfringens strains were isolated from 14% (37/260 of samples. All the isolates were classified as toxin type A, 28 of them were able also to produce α toxin and 9 - β2 toxin. Conclusion: On the basis of the obtained results it could be suggested that risk assessment, especially regarding the entire honey harvesting process, should be provided in order to ensure the microbiological safety of the products to be consumed by infants and people with a weakened immune system.

  6. Remedial Investigation for Cold Regions Research and Engineering Laboratory (CRREL) Hanover, New Hampshire. Phase 2. Volume 3. Appendices. Revision 2

    Science.gov (United States)

    1994-03-18

    ADSL 19-Aug-93 AA9 13DMB UGG .260 LT7 BL146391 ADSS 7 21-Aug-93 AA9 130MB UGG .260 1.T BlT.l56191 AEAG 1-Sep-93 AA9 13DMB tJCG .260 LT BL182661 AFOC 13...085 LT7 13L145741 ADSL . 19-At:g-93 MA9 C6H6 13CC .085 LT’ 01L146391 ADSS 21-Aug-93 AA9 C6H6 IJGG .085 IT BL156791 AEAG 1-Sep-92 AA9 06146 7J,1G .085 1.T...ADTO 23-Aug-93 AA9 E7t.6H5 UGG i160 LT’ BL.145741 ADSL 19-Aug-93 AA9 ZTC6i45 13CC .160 LT’ 31.146391 ADSS 7 21-Aug-93 AA9 E706145 USC .160 LT1 3Ll5r,791

  7. Preliminary study of the regenerative processes of the dorsal cortex of the telencephalon of Lacerta viridis.

    Science.gov (United States)

    Minelli, G; del Grande, P; Mambelli, M C

    1977-01-01

    The authors removed from Lacerta viridis specimens part of the dorsal hippocampus of one telencephalic hemisphere. The animals were sacrificed 110 and 260 days after the operation; 24 hours before the operation on the encephalon, each was dosed with 6--3H thymidine. An examination of the historadiographic slides showed a clear remedial process in the operated area which, 260 days after has renewed in thickness but was still minus its characteristic cellular layer. The area of the telencephalon affected by the remedial process was examined by the authors and they have put forward the hypothesis that in relation to the type of operation performed, said area is localized prevalently in the dorsal hippocampus of the caudal half of the telencephalic hemispherg. The authors have also shown that the remedial procress, though attenuated is still in progress. 260 days after the operation.

  8. Using LEDs to stimulate the recovery of radiation damage to plastic scintillators

    Energy Technology Data Exchange (ETDEWEB)

    Wetzel, J., E-mail: james-wetzel@uiowa.edu [The University of Iowa, Iowa City, IA (United States); Tiras, E. [The University of Iowa, Iowa City, IA (United States); Bilki, B. [The University of Iowa, Iowa City, IA (United States); Beykent University, Istanbul (Turkey); Onel, Y. [The University of Iowa, Iowa City, IA (United States); Winn, D. [Fairfield University, Fairfield, CT (United States)

    2017-03-15

    In this study, we consider using LEDs to stimulate the recovery of scintillators damaged from radiation in high radiation environments. We irradiated scintillating tiles of polyethylene naphthalate (PEN), Eljen brand EJ-260 (EJN), an overdoped EJ-260 (EJ2P), and a lab-produced elastomer scintillator (ES) composed of p-terphenyl (ptp) in epoxy. Two different high-dose irradiations took place, with PEN dosed to 100 kGy, and the others to 78 kGy. We found that the ‘blue’ scintillators (PEN and ES) recovered faster and maximally higher with LEDs than without. Conversely exposing the ‘green’ scintillators (EJ-260) to LED light had a nearly negligible effect on the recovery. We hypothesize that the ‘green’ scintillators require wavelengths that match their absorption and emission spectra for LED stimulated recovery.

  9. A selective detection of lysophosphatidylcholine in dried blood spots for diagnosis of adrenoleukodystrophy by LC-MS/MS

    Directory of Open Access Journals (Sweden)

    Ryuichi Mashima

    2016-06-01

    Full Text Available X-linked adrenoleukodystrophy (X-ALD is a rare inherited metabolic disorder characterized by an impaired beta-oxidation of very long chain fatty acids in the peroxisomes. Recent studies have suggested that 1-hexacosanoyl-2-hydroxy-sn-glycero-3-phosphocholine (Lyso-PC 26:0 can be a sensitive biomarker for X-ALD. Although approximately 10-fold increase in the concentration of Lyso-PC 26:0 in DBSs from X-ALD-affected individuals were reported, whether the carriers might be distinguished from the healthy controls remained unclear. To address this question, we have validated previously developed LC-MS/MS-based analytical procedures using QC DBS. We found that the recovery of Lyso-PC 26:0 from the QC DBSs was 73.6 ± 0.3% when 2 μM of Lyso-PC 26:0 was spiked into the blood. Based on this result, the amounts of Lyso-PC 26:0 in the controls and ALD-affected individuals were 0.090 ± 0.004 (n = 11 and 1.078 ± 0.217 (n = 4 pmol/DBS, respectively. Interestingly, the concentration of Lyso-PC 26:0 in the carriers were 0.548 ± 0.095 pmol/DBS (n = 3, indicating that the carriers and the healthy controls can be distinguished. These results suggest that LC-MS/MS-based technique can be used for the detection of asymptomatic carriers and X-ALD-affected subjects in the newborn screening.

  10. New aspects of magnetocaloric effect in NiMn{sub 0.89}Cr{sub 0.11}Ge

    Energy Technology Data Exchange (ETDEWEB)

    Jaworska-Gołąb, T., E-mail: teresa.jaworska-golab@uj.edu.pl [Institute of Physics, Jagiellonian University, Łojasiewicza 11, 30-348 Kraków (Poland); Baran, S. [Institute of Physics, Jagiellonian University, Łojasiewicza 11, 30-348 Kraków (Poland); Duraj, R. [Institute of Physics, Cracow University of Technology, Podchorążych 1, 30-084 Kraków (Poland); Marzec, M. [Institute of Physics, Jagiellonian University, Łojasiewicza 11, 30-348 Kraków (Poland); Dyakonov, V. [Institute of Physics, Polish Academy of Sciences, al. Lotników 32/46, 02-668 Warszawa (Poland); A.A. Galkin Donetsk Physico-Technical Institute, 83-114 Donetsk (Ukraine); Sivachenko, A. [A.A. Galkin Donetsk Physico-Technical Institute, 83-114 Donetsk (Ukraine); Tyvanchuk, Yu. [Chemistry Department, Ivan Franko National University of Lviv, 79-005 Lviv (Ukraine); Szymczak, H. [Institute of Physics, Polish Academy of Sciences, al. Lotników 32/46, 02-668 Warszawa (Poland); Szytuła, A. [Institute of Physics, Jagiellonian University, Łojasiewicza 11, 30-348 Kraków (Poland)

    2015-07-01

    Investigations of structural and magnetic phase transitions in the NiMn{sub 0.89}Cr{sub 0.11}Ge half-Heusler alloy were carried out by DSC, XRD (80–400 K), magnetic susceptibility and magnetization (1.9–400 K, magnetic field up to 9.0 T, pressure up to 5.25 kbar) measurements. At high temperatures the sample is a single phase crystallizing in the hexagonal crystal structure (Ni{sub 2}In-type, space group P6{sub 3}/mmc) while below 260 K, down to 100 K, some amount of the hexagonal phase coexists with the orthorhombic (TiNiSi-type, space group Pnma) one. Strong magnetostructural coupling is observed. Magnetic data indicate that with increasing temperature magnetic properties of the sample change from antiferro- to ferro- and then to paramagnetic ones. The latter magnetic phase transition is associated with the crystal structure change and results in large magnetic entropy change equal to −51 J/kg K at μ{sub 0}H= 9.0 T near 260 K. Application of external pressure shifts T{sub C} towards lower temperatures. - Highlights: • # Pnma below 210 K, # P6{sub 3}/mmc above 260 K, for 210 K 260 K both phases coexist. • Magnetic transitions from antiferro- to ferro- and to paramagnetic phase detected. • Significant magnetocaloric effect observed about 260 K at ambient pressure. • Magnetostructural effect observed at 260 K (ΔV/V= 2.4%) at ambient pressure. • Magnetic measurements under hydrostatic pressure up to 5.25 kbar; (p, T) diagram.

  11. Evaluating UV-C LED disinfection performance and ...

    Science.gov (United States)

    This study evaluated ultraviolet (UV) light emitting diodes (LEDs) emitting at 260 nm, 280 nm, and the combination of 260|280 nm together for their efficacy at inactivating Escherichia. coli, MS2 coliphage, human adenovirus type 2 (HAdV2), and Bacillus pumilus spores; research included an evaluation of genomic damage. Inactivation by the LEDs was compared with the efficacy of conventional UV sources, the low-pressure (LP) and medium-pressure (MP) mercury vapor lamps. The work also calculated the electrical energy per order of reduction of the microorganisms by the five UV sources.For E. coli, all five UV sources yielded similar inactivation rates. For MS2 coliphage, the 260 nm LED was most effective. For HAdV2 and B. pumilus, the MP UV lamp was significantly more effective than the LP UV and UVC LED sources. When considering electrical energy per order of reduction, the LP UV lamp was the most efficient for E. coli and MS2, and the MPUV and LPUV were equally efficient for HAdV2 and B. pumilus spores. Among the UVC LEDs, the 280 nm LED unit required the least energy per log reduction of E. coli and HAdV2. The 280 nm and 260|280 nm LED units were equally efficient per log reduction of B. pumilus spores, and the 260 nm LED unit required the lowest energy per order of reduction of MS2 coliphage. The combination of the 260 nm and 280 nm UV LED wavelengths was also evaluated for potential synergistic effects. No dual-wavelength synergy was detected for inactivation of

  12. Inmunodeficiencias primarias celulares en la infancia: nuevas aportaciones a su diversidad, patogenia, diagnóstico y tratamiento

    OpenAIRE

    Estévez Cordero, Orlando Allende

    2014-01-01

    La Neutropenia Congénita Severa tipo 4 (SCN4 por sus siglas en ingles) está asociada a mutaciones en el gen que codifica la tercera sub-unidad catalítica de la glucose-6-fosfatasa (G6PC3). En la actualidad, todos los pacientes descritos portadores de la variante p.Gly260Arg en el gen G6PC3 muestran defectos cardíacos. En este trabajo presentamos el caso de una variante p.Gly260Arg en un paciente sin alteraciones funcionales ni estructurales en corazón. Por su parte, Interleuquina-21 (IL-21...

  13. Tutorial Guide: Computer-Aided Structural Modeling (CASM). Version 5.00

    Science.gov (United States)

    1994-04-01

    Estimate self weight: 26.0 plf. Eutwowg Sol Weight F26.0 pN 0 Update Agog Shuckne Leeds 19 Add eN Weigh >> Note: Beam weight was not smeared Into the...0.0 0.0 75.0 702.0 Floor TMpe 1 148.2 20.0 2963.2 40.0 5926.4 Beam SelO Weight 6.2 20.0 124.0 40.0 248.0 Column Self Weight 1.7 20.0 34.6 40.0 69.1 Sum

  14. Caracterisation de l’Emission d’un Radiateur Airworks (Characterization of the Emission of an Airworks Radiator)

    Science.gov (United States)

    2005-09-01

    de la bourse . DRDC Va1cartier TN 2005-260 v Intentionnellement en blanc. vi DRDC Va1cartier TN 2005-260 1. Introduction CeUe note presente la ...I’emission d’un radiateur Airworks J.-F. Lepage D. Vincent RODe Valcarlier R&D pour la defense Canada - Valcartier Note technique DRDC Valcarlier TN...Gilles Berube Scientifique en chef © Her Majesty the Queen as represented by the Minister of National Defence, 2005 © Sa rnajesre la reine

  15. A model-based approach to assess the exposure-response relationship of Lorenzo's oil in adrenoleukodystrophy.

    Science.gov (United States)

    Ahmed, Mariam A; Kartha, Reena V; Brundage, Richard C; Cloyd, James; Basu, Cynthia; Carlin, Bradley P; Jones, Richard O; Moser, Ann B; Fatemi, Ali; Raymond, Gerald V

    2016-06-01

    X-linked adrenoleukodystrophy (X-ALD) is a peroxisomal disorder, most commonly affecting boys, associated with increased very long chain fatty acids (C26:0) in all tissues, causing cerebral demyelination and adrenocortical insufficiency. Certain monounsaturated long chain fatty acids including oleic and erucic acids, known as Lorenzo's oil (LO), lower plasma C26:0 levels. The aims of this study were to characterize the effect of LO administration on plasma C26:0 concentrations and to determine whether there is an association between plasma concentrations of erucic acid or C26:0 and the likelihood of developing brain MRI abnormalities in asymptomatic boys. Non-linear mixed effects modelling was performed on 2384 samples collected during an open label single arm trial. The subjects (n = 104) were administered LO daily at ~2-3 mg kg(-1) with a mean follow-up of 4.88 ± 2.76 years. The effect of erucic acid exposure on plasma C26:0 concentrations was characterized by an inhibitory fractional Emax model. A Weibull model was used to characterize the time-to-developing MRI abnormality. The population estimate for the fractional maximum reduction of C26:0 plasma concentrations was 0.76 (bootstrap 95% CI 0.73, 0.793). Our time-to-event analyses showed that every mg l(-1) increase in time-weighted average of erucic acid and C26:0 plasma concentrations was, respectively, associated with a 3.7% reduction and a 753% increase in the hazard of developing MRI abnormality. However, the results were not significant (P = 0.5344, 0.1509, respectively). LO administration significantly reduces the abnormally high plasma C26:0 concentrations in X-ALD patients. Further studies to evaluate the effect of LO on the likelihood of developing brain MRI abnormality are warranted. © 2016 The British Pharmacological Society.

  16. The Air Force Global Reach Laydown (GR1): An Allowance Standard Review Using the Estimating Supplies Program to Develop a Requirements-Based Materiel Solution

    Science.gov (United States)

    2008-07-02

    category occurred. There were two bottles of 30 tablets of Amoxicillin and Potassium Clavulanate in the AS but the patient stream called for three...Spine (progressive) 031 Intervertebral Disc Disorders w/ Nerve Root Compression Resistant To Bed Rest/traction 032 Intervertebral Disc Disorders w...0.520 0.018 $6.04 0.260 0.009 $3.02 E 6505012036259 AMOXICILLIN AND POTASSIUM CLAVULANATE 30 TABS BT 2 3 0.260 0.020 $199.86 0.390 0.030 $299.79 A

  17. Thermal decomposition of dilute aqueous formic acid solutions

    DEFF Research Database (Denmark)

    Bjerre, A.B.; Sørensen, E.

    1992-01-01

    The aqueous-phase oxidation of formic acid and formate has been studied in a batch autoclave reactor at 260-degrees-C and 2 MPa of O2. The formate is converted to bicarbonate whereas formic acid, besides oxidation, decomposes by at least two different routes, namely a dehydration or a decarboxyla......The aqueous-phase oxidation of formic acid and formate has been studied in a batch autoclave reactor at 260-degrees-C and 2 MPa of O2. The formate is converted to bicarbonate whereas formic acid, besides oxidation, decomposes by at least two different routes, namely a dehydration...

  18. Activation of boron and phosphorus atoms implanted in polycrystalline silicon films at low temperatures

    International Nuclear Information System (INIS)

    Andoh, Nobuyuki; Sameshima, Toshiyuki; Andoh, Yasunori

    2005-01-01

    Phosphorus atoms implanted in laser crystallized polycrystalline silicon films were activated by a heat treatment in air at 260 deg. C for 1, 3 and 24 h. Analysis of ultraviolet reflectivity of phosphorus-doped silicon films implanted by ion doping method at 4 keV revealed that the thickness of the top disordered layer formed by ion bombardment was 6 nm. It is reduced to 4 nm by a 3 h heat treatment at 260 deg. C by recrystallization of disordered region. The electrical conductance of silicon films implanted increased to 1.7x10 5 S/sq after 3 h heat treatment

  19. AcEST: BP919704 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000128_B12 260 Adiantum capillus-veneris mRNA. clone: YMU001_000128_B12. BP9197...04 CL1786Contig1 Show BP919704 Clone id YMU001_000128_B12 Library YMU01 Length 260 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000128_B12. Accession BP919704 Tissue type prothallium Developmental stag...rograms, Nucleic Acids Res. 25:3389-3402. Query= BP919704|Adiantum capillus-veneris mRNA, clone: YMU001_0001...n database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP919704|Adia

  20. Waveguiding Er.sup.3+./sup./Yb.sup.3+./sup.:LiNbO.sub.3./sub. films prepared by a sol–gel method using polyvinylpyrrolidone

    Czech Academy of Sciences Publication Activity Database

    Rubešová, K.; Mikolášová, D.; Hlásek, T.; Jakeš, V.; Nekvindová, P.; Bouša, D.; Oswald, Jiří

    2016-01-01

    Roč. 176, Aug (2016), s. 260-265 ISSN 0022-2313 Institutional support: RVO:68378271 Keywords : lithium niobate * polyvinylpyrrolidone * erbium * sol –gel waveguide Subject RIV: BM - Sol id Matter Physics ; Magnetism Impact factor: 2.686, year: 2016

  1. Fiction and Conviction | Blackburn | Philosophical Papers

    African Journals Online (AJOL)

    I claim that there is nothing so unusual in the interleaving of myth or fiction and history that Williams finds in Herodotus. I also reflect on the difficulty of separating acceptance of truth from acceptance of myth, metaphor, and model, not only in history but also in science. Philosophical Papers Vol.32(3) 2003: 243-260 ...

  2. Immediate post operative complications and associated factors as ...

    African Journals Online (AJOL)

    37.0% patients had complications referable to the respiratory system, 30.6% patients each had abnormal cardiovascular parameters and shivering, 26.0% patients had hypothermia, 9.8% patients had nausea and/or vomiting, 6.0% patients presented with restlessness, 5.3% patients presented with abnormalities referable to ...

  3. Vitamin B 12 levels in patients with type 2 diabetes mellitus on ...

    African Journals Online (AJOL)

    Results: Vitamin B12 deficiency and borderline deficiency were recorded in 8.6% and 26.0% of the patients respectively. Vitamin B12 level was significantly lower in patients who have been on metformin for ≥10 years compared with patients with <10 years history of metformin use. Similarly, patients who were on metformin ...

  4. Untitled

    Indian Academy of Sciences (India)

    similar to that of rock-Salt and it also exhibits similar cleavage properties. But in other respects, lithium fluoride differs markedly from rock-salt. Though the atomic Weights of both the component elements in lithium fluoride are much smaller, its density is Substantially greater than that of rock-salt, being 260 as against 217.

  5. A search for high-mass resonances decaying to τ.sup.+./sup.τ.sup.-./sup. in pp collisions at √s = 7 TeV with the ATLAS detector

    Czech Academy of Sciences Publication Activity Database

    Aad, G.; Abajyan, T.; Abbott, B.; Böhm, Jan; Chudoba, Jiří; Gallus, Petr; Gunther, Jaroslav; Jakoubek, Tomáš; Juránek, Vojtěch; Kepka, Oldřich; Kupčo, Alexander; Kůs, Vlastimil; Lokajíček, Miloš; Marčišovský, Michal; Mikeštíková, Marcela; Myška, Miroslav; Němeček, Stanislav; Růžička, Pavel; Schovancová, Jaroslava; Šícho, Petr; Staroba, Pavel; Svatoš, Michal; Taševský, Marek; Tic, Tomáš; Valenta, J.; Vrba, Václav; Zeman, Martin

    2013-01-01

    Roč. 719, 4-5 (2013), 242-260 ISSN 0370-2693 R&D Projects: GA MŠk LA08032 Institutional support: RVO:68378271 Keywords : pair production * mass spectrum * (tau + tau - ) * scattering * Z' * leptonic decay * ATLAS * CERN LHC Coll * tau * decay modes Subject RIV: BG - Nuclear, Atomic and Molecular Physics, Colliders Impact factor: 6.019, year: 2013

  6. Cytokinin oxidase/dehydrogenase genes in barley and wheat. Cloning and heterologous expression

    Czech Academy of Sciences Publication Activity Database

    Galuszka, P.; Frébortová, Jitka; Werner, T.; Yamada, M.; Strnad, Miroslav; Schmülling, T.; Frébort, I.

    2004-01-01

    Roč. 271, č. 20 (2004), s. 3990-4002 ISSN 0014-2956 Institutional research plan: CEZ:AV0Z5038910 Keywords : cereals * cloning * cytokinin oxidase/dehydrogenase Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 3.260, year: 2004

  7. Investigating the Relationship between Effective Communication of Spouse and Father-Child Relationship (Test Pattern Causes to Education Parents)

    Science.gov (United States)

    Ataeifar, Robabeh; Amiri, Sholeh; Ali Nadi, Mohammad

    2016-01-01

    This research is targeted with the plan of father-child model or effective relationship mediating of spouses or investigating attachment style, personality traits, communication skills, and spouses' sexual satisfaction. Based on this, 260 people (father and child) were selected through random sampling method based on share. Participants were…

  8. Fractal-like dimension of nanometer Diesel soot particles

    Energy Technology Data Exchange (ETDEWEB)

    Skillas, G.; Baltensperger, U. [Paul Scherrer Inst. (PSI), Villigen (Switzerland); Siegmann, K. [Eidgenoessische Technische Hochschule, Zurich (Switzerland)

    1997-11-01

    Measurements with a low-pressure impactor and a differential mobility analyser were conducted for Diesel soot at various engine loads. By means of these measurements a fractal-like dimension of Diesel soot particles, with diameters ranging from 55 up to 260 nm, was established. (author) 2 figs., 7 refs.

  9. ICHD-II Criteria in Diagnosis of Pediatric Migraine

    Directory of Open Access Journals (Sweden)

    J Gordon Millichap

    2005-12-01

    Full Text Available The sensitivity of the new International Classification of Headache Disorders-2nd edition (ICHD-II criteria in the diagnosis of childhood migraine was evaluated in 260 patients, ages 18 and under, seen at 2 large pediatric headache centers, and reported from Children’s Hospital Medical Center, Cincinnati, OH; The Cleveland Clinic, OH; and other centers.

  10. EST Table: FS824424 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available FS824424 E_FL_fmgV_17P08_R_0 10/09/28 31 %/260 aa ref|XP_001868268.1| thymus-specif...ic serine protease [Culex quinquefasciatus] gb|EDS26459.1| thymus-specific serine protease [Culex quinquefas

  11. hp-FEM electromechanical transduction model of ionic polymer metal composites

    Czech Academy of Sciences Publication Activity Database

    Pugal, D.; Šolín, Pavel; Kim, K.; Aabloo, A.

    2014-01-01

    Roč. 260, April (2014), s. 135-148 ISSN 0377-0427 R&D Projects: GA ČR(CZ) GAP102/11/0498 Institutional support: RVO:61388998 Keywords : hp-FEM * Nernst-Planck * Poisson Subject RIV: JA - Electronics ; Optoelectronics, Electrical Engineering Impact factor: 1.266, year: 2014

  12. 76 FR 79258 - Self-Regulatory Organizations; Chicago Mercantile Exchange, Inc.; Notice of Filing and Order...

    Science.gov (United States)

    2011-12-21

    .../Brazilian Real (USD/BRL) Spot, Forwards and Swaps); CME Chapter 260H (Cleared OTC U.S. Dollar/Russian Ruble... positive or negative. This language had been adopted previously by CME for many of the cleared OTC FX NDF... 271H. These changes would add language to the cash settlement provisions in the rules governing four...

  13. Opinions and attitudes of some parents in Ilorin, North-central ...

    African Journals Online (AJOL)

    We interviewed 260 randomly selected parents in the city of Ilorin, Nigeria, using a questionnaire to ascertain socio-demographic data and details about the understanding and practice of various forms of child abuse such as hawking, child labour, physical beating, sending children to work as house-helps, and sexual abuse ...

  14. 1 POPULATION PRESSURE AND HEALTH RISKS IN URBAN ...

    African Journals Online (AJOL)

    A random selection of 260 sellers (in the built-up sections of the ... Inadequate infrastructure, as toilets, clean water and good roads among others, and a near total absence of waste management, put most of these markets at serious environmental and health risks. Many are ... Rural-urban migration and natural growth were ...

  15. Population Size and Diet of Bush Hyrax Hetrohyrax brucei (Gray ...

    African Journals Online (AJOL)

    user

    Crnokrak, P & Roff, D.A. 1999. Inbreeding depression in the wild. Heredity, 83: 260–270. Estes, R.P. 1991. The behavior guide to African mammals, including hoofed mammals, carnivores, primates. University of California Press, Berkeley, pp. 250-258. Frankham, R. 2003. Genetics and conservation biology. C.R. Biologies ...

  16. Resonance – Journal of Science Education | Indian Academy of ...

    Indian Academy of Sciences (India)

    Home; Journals; Resonance – Journal of Science Education. Edward U Lorenz. Articles written in Resonance – Journal of Science Education. Volume 20 Issue 3 March 2015 pp 260-263 Classics. Predictability: Does the Flap of a Butterfly's Wings in Brazil Set off a Tornado in Texas? Edward U Lorenz · More Details Fulltext ...

  17. Journal of Fundamental and Applied Sciences - Vol 7, No 2 (2015)

    African Journals Online (AJOL)

    Prevalence and antibiotic resistance of Staphylococci isolated from Kolea Hospital (Algeria) · EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT · DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. MN Boukhatem, MA Ferhat, RH Mohamed, N Lalaoui, 260-269. http://dx.doi.org/10.4314/jfas.v7i2.8 ...

  18. Effect of maternal age on maternal and neonatal outcomes after assisted reproductive technology

    DEFF Research Database (Denmark)

    Wennberg, Anna Lena; Opdahl, Signe; Bergh, Christina

    2016-01-01

    -linked with national medical birth registries. SETTING: Not applicable. PATIENT(S): A total of 300,085 singleton deliveries: 39,919 after ART and 260,166 after SC. INTERVENTION(S): None. MAIN OUTCOME MEASURE(S): Hypertensive disorders in pregnancy (HDP), placenta previa, cesarean delivery, preterm birth (PTB;

  19. Evaluating Measures of Optimism and Sport Confidence

    Science.gov (United States)

    Fogarty, Gerard J.; Perera, Harsha N.; Furst, Andrea J.; Thomas, Patrick R.

    2016-01-01

    The psychometric properties of the Life Orientation Test-Revised (LOT-R), the Sport Confidence Inventory (SCI), and the Carolina SCI (CSCI) were examined in a study involving 260 athletes. The study aimed to test the dimensional structure, convergent and divergent validity, and invariance over competition level of scores generated by these…

  20. 7 CFR 2902.6 - Providing product information to Federal agencies.

    Science.gov (United States)

    2010-01-01

    ... to the Federal Trade Commission Guides for the Use of Environmental Marketing Claims, 16 CFR part 260. ... ENERGY POLICY AND NEW USES, DEPARTMENT OF AGRICULTURE GUIDELINES FOR DESIGNATING BIOBASED PRODUCTS FOR... marketing claims. Manufacturers and vendors are reminded that their advertising, labeling, and other...

  1. Analysis of the essential spectrum of singular matrix differential operators

    Czech Academy of Sciences Publication Activity Database

    Ibrogimov, O. O.; Siegl, Petr; Tretter, C.

    2016-01-01

    Roč. 260, č. 4 (2016), s. 3881-3926 ISSN 0022-0396 Institutional support: RVO:61389005 Keywords : essential spectrum * system of singular differential equations * operator matrix * Schur complement * magnetohydrodynamics * Stellar equilibrium model Subject RIV: BE - Theoretical Physics Impact factor: 1.988, year: 2016

  2. Cytochrome c2-independent respiratory growth of Rhodobacter capsulatus.

    OpenAIRE

    Daldal, F

    1988-01-01

    To assess the role of cytochrome c2 as a respiratory electron carrier, we obtained a double mutant of Rhodobacter capsulatus defective in cytochrome c2 and in the quinol oxidase260. This mutant was able to grow chemoheterotrophically, indicating that an electron pathway independent of cytochrome c2 was functional between the ubiquinol:cytochrome c2 oxidoreductase and the cytochrome oxidase410.

  3. Synthesis and Electrochemical Reduction of Methyl 3-halo-1-benzothiophene-2-carboxylates

    Czech Academy of Sciences Publication Activity Database

    Rejňák, M.; Klíma, Jiří; Svoboda, J.; Ludvík, Jiří

    2004-01-01

    Roč. 69, č. 1 (2004), s. 242-260 ISSN 0010-0765 R&D Projects: GA ČR GA202/02/0840; GA AV ČR IAA4040304 Institutional research plan: CEZ:AV0Z4040901 Keywords : halobenzothiophenes * voltammetry * biaryls Subject RIV: CG - Electrochemistry Impact factor: 1.062, year: 2004

  4. Berkeley new element program

    International Nuclear Information System (INIS)

    Ghiorso, A.

    1975-09-01

    The work done with element 106 is reviewed, and a new experiment which bears on the properties of the isotope of mass 260 with atomic number 104 is discussed. It is noted that in the case of element 106 a link is demonstrated to the granddaughter as well as the daughter

  5. The 6-month effectiveness of Internet-based guided self-help for depression in adults with Type 1 and 2 diabetes mellitus

    NARCIS (Netherlands)

    Ebert, D. D.; Nobis, S.; Lehr, D.; Baumeister, H.; Riper, H.; Auerbach, R. P.; Snoek, F.; Cuijpers, P.; Berking, M.

    2017-01-01

    The aim of this research is to examine the 6-month effects of an Internet-based guided self-help intervention for comorbid depressive symptoms in people with diabetes. Participants (n = 260) with Type 1 or 2 diabetes and elevated depressive symptoms [Center for Epidemiological Studies Depression

  6. The 6-month effectiveness of Internet-based guided self-help for depression in adults with type 1 and 2 diabetes mellitus.

    NARCIS (Netherlands)

    Ebert, D.D.; Nobis, S.; Lehr, D.; Baumeister, H.; Riper, H.; Auerbach, R.; Snoek, F.J.; Cuijpers, Pim; Berking, M.

    2017-01-01

    Aim The aim of this research is to examine the 6-month effects of an Internet-based guided self-help intervention for comorbid depressive symptoms in people with diabetes. Methods Participants (n = 260) with Type 1 or 2 diabetes and elevated depressive symptoms [Center for Epidemiological Studies

  7. Constraints on water use efficiency of drought tolerant maize grown in a semi-arid environment

    Science.gov (United States)

    Identifying the constraints on crop water use efficiency (WUE) will help develop strategies to mitigate these limitations. The objectives of this research were to 1) develop a boundary function for maize using data (n=260) from research projects conducted at Bushland, TX, and 2) compare the yields o...

  8. High School Pupils' Attitudes and Self-Efficacy of Using Mobile Devices

    Science.gov (United States)

    Nikolopoulou, Kleopatra; Gialamas, Vasilis

    2017-01-01

    This paper regards a study aiming to investigate junior high school pupils' attitudes and self-efficacy of using mobile devices. A 25-item questionnaire was administered to 260 pupils aged 12-15 years old, in Greece. Pupils' attitudes were positive, and four factors were extracted, "perceived usefulness", "affection",…

  9. Search Results | Page 19 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Results 181 - 190 of 260 ... There has been tremendous growth worldwide in both the supply of and demand for quality monitoring and evaluation (M&E). ... the level of entrepreneurial activity in the Middle East and North Africa (MENA), and benchmark country and regional performance against that of other developing. Project.

  10. Coxeter groups A4, B4 and D4 for two-qubit systems

    Indian Academy of Sciences (India)

    physics pp. 247–260. Coxeter groups A4, B4 and D4 for two-qubit systems. RAMAZAN KOÇ1,∗. , M YAKUP HACIIBRAHIMO ˇGLU1 and MEHMET KOCA2 ... reflection matrices. The von Neumann entropy of each reduced density matrix is calculated. It is shown that these unitary matrix representations are naturally related to ...

  11. 78 FR 9883 - National Advisory Committee for Implementation of the National Forest System Land Management...

    Science.gov (United States)

    2013-02-12

    ... National Forest System Land Management Planning Rule AGENCY: Forest Service, USDA. ACTION: Notice of... Jasper, Ecosystem Management Coordination, 202-260-9400, [email protected] . Individuals who use... USDA Forest Service, Ecosystem Management Coordination, 201 14th Street SW., Mail Stop 1104, Washington...

  12. Dictionary of Criminal Justice Data Terminology. Terms and Definitions Proposed for Interstate and National Data Collection and Exchange.

    Science.gov (United States)

    SEARCH Group, Inc., Sacramento, CA.

    This first edition proposes standard names, phrases, and definitions in selected areas of terminology needed for the communication of basic criminal justice information and statistics between states and at the national level. Introductory pages explain the technical approach used in selecting terminology. Over 260 alphabetical entries contain…

  13. HIV and schistosomiasis : studies in Tanzania

    NARCIS (Netherlands)

    Downs, J.A.

    2016-01-01

    Schistosomiasis is a helminthic worm infection that affects 260 million people worldwide, 90% of whom live in sub-Saharan Africa. In Tanzania, where the research in this thesis was conducted, two species of schistosomes are highly endemic (Schistosoma haematobium and S. mansoni), with more than 50%

  14. 2007 Insensitive Munitions and Energetic Materials Technology Symposium

    Science.gov (United States)

    2007-10-18

    cheap melt-cast compositions will ever be truly IM? – The need to agree internationally a ‘smart’ set of tests to ensure that only genuine low...of Insensitive Munitions and Their Estimated Contribution to CV Safety", CRM 90-260 / March 1991 Enterprise Nimitz 44 40.4106 74 141 825.3 28 323

  15. 38 CFR 21.266 - Payment of subsistence allowance under special conditions.

    Science.gov (United States)

    2010-07-01

    ... subsistence allowance at the institutional rate. (Authority: 38 U.S.C. 3108(c)) (d) Extended evaluation and... institutional training in § 21.260. If an extended evaluation or independent living program is pursued on a less... institutional rate. VA may pay the cost of room and board in lieu of subsistence allowance when: (i) The...

  16. Adaptation of Organizational Justice in Sport Scale into Turkish Language: Validity and Reliability Study

    Science.gov (United States)

    Sayin, Ayfer; Sahin, Mustafa Yasar

    2017-01-01

    The present study aimed to provide a Turkish adaptation of the Organizational Justice in Sport Scale and perform reliability and validity studies. Answers provided by 260 participants who work as football, male basketball and female basketball coaches in National Collegiate Athletic Association (NCAA) were analysed using the original scale that…

  17. Invertebrate fauna associated with water hyacinth ( Eichhornia ...

    African Journals Online (AJOL)

    The invertebrate fauna associated with water hyacinth (Eichhornia crassipes) in Benin River was studied between February and August, 1990. Water hyacinth along with water samples was collected for analysis. The range of water temperature was 26.0–32.2oC, dissolved oxygen (D.O) was 1.60–14.98 mgl-1 and salinity ...

  18. Growth and body composition, feed intake, and carcass composition traits of developing gilts fed different dietary lysine and metabolizable energy levels

    Science.gov (United States)

    The objectives of this study were to manipulate the lean:fat ratio by feeding diets differing in lysine and ME content to replacement gilts housed in groups from 100 d of age until slaughter (approximately 260 d of age) to evaluate lysine and caloric efficiency between dietary treatments. Crossbred ...

  19. Optimal dietary energy and amino acids for gilt development: Growth, body composition, feed intake, and carcass composition traits

    Science.gov (United States)

    The objective of this study was to manipulate the lean to fat ratio by feeding diets differing in lysine and metabolizable energy (ME) content to replacement gilts from 100 d to 260 d of age. A secondary objective was to evaluate lysine and caloric efficiency between dietary treatments fed to develo...

  20. New floristic records in the Balkans: 7

    DEFF Research Database (Denmark)

    Tan, Kit; Issigoni, Margarita

    2008-01-01

    New chorological data are presented for 106 species and subspecies from Bulgaria (records no. 72-79, 84-94, 105-106), Greece (2-60, 95-104) and Turkey-in-Europe (1, 61-71, 80-83). The taxa belong to the following families: Amaranthaceae (18, 19), Amaryllidaceae (49, 50, 77), Apiaceae (3, 84, 85, ...

  1. A Low-Molecular Weight Dialyzable Leukocyte Extract Selectively Enhances the Development of CD4+RORt+ T Cells and IL-17 Production

    Czech Academy of Sciences Publication Activity Database

    Zajícová, Alena; Javorková, Eliška; Trošan, Peter; Chudíčková, Milada; Krulová, Magdaléna; Holáň, Vladimír

    2014-01-01

    Roč. 60, č. 6 (2014), s. 253-260 ISSN 0015-5500 R&D Projects: GA MŠk LO1309 Institutional support: RVO:68378041 Keywords : enzyme-linked immunosorbent assay * interferon * interleukin Subject RIV: EC - Immunology Impact factor: 1.000, year: 2014

  2. Virtual 3D reconstruction of embryonic head structures from physical sections

    Czech Academy of Sciences Publication Activity Database

    Janáček, Jiří; Kundrát, M.

    2004-01-01

    Roč. 260, č. 3 (2004), s. 302 ISSN 0362-2525 R&D Projects: GA AV ČR(CZ) KJB6111301 Institutional research plan: CEZ:AV0Z5011922 Keywords : embryonic head s * 3D reconstruction Subject RIV: EA - Cell Biology Impact factor: 1.528, year: 2004

  3. Total hip replacement with a superolateral bone graft for osteoarthritis secondary to dysplasia: a long-term follow-up

    NARCIS (Netherlands)

    de Jong, P. T.; Haverkamp, D.; van der Vis, H. M.; Marti, R. K.

    2006-01-01

    We evaluated the long-term results of 116 total hip replacements with a superolateral shelfplasty in 102 patients with osteoarthritis secondary to developmental dysplasia of the hip. After a mean follow-up of 19.5 years (11.5 to 26.0), 14 acetabular components (12%) had been revised. The cumulative

  4. Effects of damage to auditory cortex on the discrimination of speech sounds by rats

    Czech Academy of Sciences Publication Activity Database

    Floody, O. R.; Ouda, Ladislav; Porter, B. A.; Kilgard, M. P.

    2010-01-01

    Roč. 101, č. 2 (2010), s. 260-268 ISSN 0031-9384 R&D Projects: GA ČR GA309/07/1336 Institutional research plan: CEZ:AV0Z50390703 Keywords : auditory cortex * brain lesions * prepulse inhibition Subject RIV: FH - Neurology Impact factor: 2.891, year: 2010

  5. Staying in Tune with Music Education: Policy Awareness among Music Education Majors

    Science.gov (United States)

    Burton, Suzanne L.; Knaster, Jenna; Knieste, Maria

    2015-01-01

    A nationwide sample of undergraduate music education majors (N = 260; 69% completion rate) completed an electronic survey to determine awareness of music and general education policy and advocacy efforts. Students reported concern with the impact of policy on school music programs and their future careers. They were informed about music education…

  6. Control of Escherichia coli and Listeria monocytogenes in suckling-lamb meat evaluated using microbial challenge tests

    NARCIS (Netherlands)

    Osés, S.M.; Diez, A.M.; Gómez, E.M.; Wilches-Pérez, D.; Luning, P.A.; Jaime, I.; Rovira, J.

    2015-01-01

    Escherichia coli and Listeria monocytogenes microbial challenge tests were performed on fresh suckling-lamb meat. Hind leg slices were chilly stored under two modified atmosphere packaging (MAP) environments (A: 15%O2/60%CO2/25%N2, B: 15%O2/30%CO2/55%N2) and vacuum packaging (V). Only E. coli was

  7. Self-Esteem, Locus of Control, and Student Achievement.

    Science.gov (United States)

    Sterbin, Allan; Rakow, Ernest

    The direct effects of locus of control and self-esteem on standardized test scores were studied. The relationships among the standardized test scores and measures of locus of control and self-esteem for 12,260 students from the National Education Longitudinal Study 1994 database were examined, using the same definition of locus of control and…

  8. Estimating erosion risks associated with logging and forest roads in northwestern California

    Science.gov (United States)

    Raymond M. Rice; Jack Lewis

    1991-01-01

    Abstract - Erosion resulting from logging and road building has long been a concern to forest managers and the general public. An objective methodology was developed to estimate erosion risk on forest roads and in harvest areas on private land in northwestern California. It was based on 260 plots sampled from the area harvested under 415 Timber Harvest Plans...

  9. ACRO - a computer program for calculating organ doses from acute or chronic inhalation and ingestion of radionuclides

    International Nuclear Information System (INIS)

    Hirayama, Akio; Kishimoto, Yoichiro; Shinohara, Kunihiko.

    1978-01-01

    The computer program ACRO has been developed to calculate organ doses from acute or chronic inhalation and ingestion of radionuclides. The ICRP Task Group Lung Model (TGLM) was used for inhalation model, and a simple one-compartment model for ingestion. This program is written in FORTRAN IV, and can be executed with storage requirements of about 260 K bytes. (auth.)

  10. Research Article

    African Journals Online (AJOL)

    2016-05-15

    May 15, 2016 ... Triple super phosphate fertilizer 46% and sulfate potassium 50% were mixed similarly before cultivating by 80 kg/hec and 120 kg/hec, respectively. The studied fertilizers in this study include urea, sulfate ammonium, nitrate calcium, and nitrate ammonium with 260, 570, 775, and 400 kg/hec, respectively.

  11. Connection between Dynamically Derived Initial Mass Function Normalization and Stellar Population Parameters

    NARCIS (Netherlands)

    McDermid, Richard M.; Cappellari, Michele; Alatalo, Katherine; Bayet, Estelle; Blitz, Leo; Bois, Maxime; Bournaud, Frédéric; Bureau, Martin; Crocker, Alison F.; Davies, Roger L.; Davis, Timothy A.; de Zeeuw, P. T.; Duc, Pierre-Alain; Emsellem, Eric; Khochfar, Sadegh; Krajnović, Davor; Kuntschner, Harald; Morganti, Raffaella; Naab, Thorsten; Oosterloo, Tom; Sarzi, Marc; Scott, Nicholas; Serra, Paolo; Weijmans, Anne-Marie; Young, Lisa M.

    We report on empirical trends between the dynamically determined stellar initial mass function (IMF) and stellar population properties for a complete, volume-limited sample of 260 early-type galaxies from the ATLAS3D project. We study trends between our dynamically derived IMF normalization αdyn ≡

  12. Molecular Gas and Star Formation in Local Early-type Galaxies

    NARCIS (Netherlands)

    Bureau, M.; Davis, T. A.; Alatalo, K.; Crocker, A. F.; Blitz, L.; Young, L. M.; Combes, F.; Bois, M.; Bournaud, F.; Cappellari, M.; Davies, R. L.; de Zeeuw, P. T.; Duc, P. -A; Emsellem, E.; Khochfar, S.; Krajnović, D.; Kuntschner, H.; Lablanche, P. -Y; McDermid, R. M.; Morganti, R.; Naab, T.; Oosterloo, T.; Sarzi, M.; Scott, N.; Serra, P.; Weijmans, A.; Carignan, Claude; Combes, François; Freeman, Ken C.

    2011-01-01

    The molecular gas content of local early-type galaxies is constrained and discussed in relation to their evolution. First, as part of the ATLAS3D survey, we present the first complete, large (260 objects), volume-limited single-dish survey of CO in normal local early-type galaxies. We find a

  13. Search Results | Page 26 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Results 251 - 260 of 280 ... Understanding Obstacles to Peace in the Great Lakes Region : Actors, Interests and Strategies. Africa's Great Lakes region is home to violent and prolonged conflicts that cause a lot of suffering and block socioeconomic progress. Several initiatives are underway to bring peace to the region. Project ...

  14. Modulatory Effect of Vitamin C and E on Dihydroartemisinin ...

    African Journals Online (AJOL)

    Abstract: The modulatory effect of vitamin C and E supplementation during dihydroartemisinin administration on the body weight and serum liver enzymes in wistar albino rats investigated. Thirty two adult albino rats weighing between 180 – 260g were used. There were divided into four groups of eight rats each. Group A ...

  15. Search Results | Page 26 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Results 251 - 260 of 8491 ... This project aims to use nanomaterials (a nanometer is one billionth of a meter) to provide new, inexpensive techniques to purify water that also address the increasingly important issue of antimicrobial resistance. Project. -. Building parliamentary research capacity: The case of Shan state's ...

  16. Dynamics of formation of ferromanganese nodules in the Indian Ocean

    Digital Repository Service at National Institute of Oceanography (India)

    Mukhopadhyay, R.; Ghosh, A.K.

    -Marine Letters 15, 59–62. Ghosh, A. K., Mukhopadhyay, R., 1999. Mineral Wealth of the Ocean. AA. Balkema, Rotterdam, 260 p. and Oxford & IBH Publication, New Delhi, 266p. Glasby, G. P., 2000. Lesson learned from deep-sea mining. Science 289, 551...

  17. Impact on Adults of Dramatized Television Programs.

    Science.gov (United States)

    Gorney, Roderic; And Others

    Psychosocial adaptations are sometimes affected by experiences that are ordinarily considered to be amusements. In 1974, a field study was undertaken by the Program on Psychosocial Adaptation and the Future to determine if it is possible to measure the effect of television on adult viewers. A sample of 260 couples, controlled for demographic…

  18. Mass Entertainment and Human Survival: Television's Potential for Prosocial Effects on Adults.

    Science.gov (United States)

    Loye, David

    Psychosocial adaptations are sometimes affected by experiences that are ordinarily considered to be amusements. In 1974, a field study was undertaken by the Program on Psychosocial Adaptation and the Future to determine if it is possible to measure the effect of television on adult viewers. A sample of 260 couples, controlled for demographic…

  19. A Resource Guide on Indian Arts and Crafts for Elementary and Secondary Teachers.

    Science.gov (United States)

    Fagot, Madeleine

    American Indian arts and crafts reference materials (published 1923-1973) are listed in this annotated resource guide for elementary and secondary school teachers. Approximately 260 listings are given for: books, films and filmstrips, maps and charts, picture sets, magazines, bibliographies and indexes, slide kits, transparencies, distributor's…

  20. Family Rejection, Social Isolation, and Loneliness as Predictors of Negative Health Outcomes (Depression, Suicidal Ideation, and Sexual Risk Behavior) among Thai Male-to-Female Transgender Adolescents

    Science.gov (United States)

    Yadegarfard, Mohammadrasool; Meinhold-Bergmann, Mallika E.; Ho, Robert

    2014-01-01

    This study examined the influence of family rejection, social isolation, and loneliness on negative health outcomes among Thai male-to-female transgender adolescents. The sample consisted of 260 male respondents, of whom 129 (49.6%) were self-identified as transgender and 131 (50.4%) were self-identified as cisgender (nontransgender). Initial…

  1. ASP53, a thermostable protein from Acacia erioloba seeds that protects target proteins against thermal denaturation

    CSIR Research Space (South Africa)

    Mtwisha, L

    2007-02-01

    Full Text Available of samples in 100mM phosphate (K+) pH 7.4 were determined at temperatures between 20 and 80◦C. Spectra were obtained over the range 200–260 nm with a Jasco J-810 spectropolarimeter (Victoria, BC, Canada) with a 1-cm path length quartz cell at a protein...

  2. Fourth Power Diophantine Equations in Gaussian Integers

    Indian Academy of Sciences (India)

    25

    Fourth Power Diophantine Equations in Gaussian Integers. 7. 7. U. Schneiders and H.G. Zimmer, The rank of elliptic curves upon quadratic extensions,. Computational Number Theory (A. Petho, H.C. Williams,H.G. Zimmer, eds.), de Gruyter,. 239-260, Berlin, (1991). 8. Y. Suzuki, On the Diophantine Equation 2aX4 + 2bY 4 ...

  3. Regulation of Isoprenoid Pheromone Biosynthesis in Bumblebee Males

    Czech Academy of Sciences Publication Activity Database

    Prchalová, Darina; Buček, Aleš; Brabcová, Jana; Žáček, Petr; Kindl, Jiří; Valterová, Irena; Pichová, Iva

    2016-01-01

    Roč. 17, č. 3 (2016), s. 260-267 ISSN 1439-4227 R&D Projects: GA MŠk LO1302; GA ČR GA15-06569S Institutional support: RVO:61388963 Keywords : biosynthesis * Bombus spp. * gene expression * isoprenoids * pheromones * transcriptional regulation Subject RIV: CE - Biochemistry Impact factor: 2.847, year: 2016

  4. Prevalent Diseases Identified in Semi-Industrial Poultry Farming in ...

    African Journals Online (AJOL)

    This study was conducted in 2003-2007 with the aim of identifying prevalent diseases in modern poultry farming in Mali. It covered 22 modern layer farms located in the suburban areas of Bamako District and of Sikasso and Segou towns. Analyses focused on a total of 536 samples, 260 sera, 254 eggs, 149 organ samples, ...

  5. The ATLAS3D project - III. A census of the stellar angular momentum within the effective radius of early-type galaxies: unveiling the distribution of fast and slow rotators

    NARCIS (Netherlands)

    Emsellem, Eric; Cappellari, Michele; Krajnović, Davor; Alatalo, Katherine; Blitz, Leo; Bois, Maxime; Bournaud, Frédéric; Bureau, Martin; Davies, Roger L.; Davis, Timothy A.; de Zeeuw, P. T.; Khochfar, Sadegh; Kuntschner, Harald; Lablanche, Pierre-Yves; McDermid, Richard M.; Morganti, Raffaella; Naab, Thorsten; Oosterloo, Tom; Sarzi, Marc; Scott, Nicholas; Serra, Paolo; van de Ven, Glenn; Weijmans, Anne-Marie; Young, Lisa M.

    We provide a census of the apparent stellar angular momentum within one effective radius of a volume-limited sample of 260 early-type galaxies (ETGs) in the nearby Universe, using the integral-field spectroscopy obtained in the course of the ATLAS3D project. We exploit the λR parameter (previously

  6. The ATLAS(3D) project : III. A census of the stellar angular momentum within the effective radius of early-type galaxies: unveiling the distribution of fast and slow rotators

    NARCIS (Netherlands)

    Emsellem, Eric; Cappellari, Michele; Krajnovic, Davor; Alatalo, Katherine; Blitz, Leo; Bois, Maxime; Bournaud, Frederic; Bureau, Martin; Davies, Roger L.; Davis, Timothy A.; de Zeeuw, P. T.; Khochfar, Sadegh; Kuntschner, Harald; Lablanche, Pierre-Yves; McDermid, Richard M.; Morganti, Raffaella; Naab, Thorsten; Oosterloo, Tom; Sarzi, Marc; Scott, Nicholas; Serra, Paolo; van de Ven, Glenn; Weijmans, Anne-Marie; Young, Lisa M.

    We provide a census of the apparent stellar angular momentum within one effective radius of a volume-limited sample of 260 early-type galaxies (ETGs) in the nearby Universe, using the integral-field spectroscopy obtained in the course of the ATLAS(3D) project. We exploit the lambda(R) parameter

  7. Comparison of membrane bioreactor technology and conventional ...

    African Journals Online (AJOL)

    GREG

    2013-05-08

    May 8, 2013 ... 4,500 600. Total floor space requirement (m2) 1, 300 260. Effluent COD (mg/L). 90. 30. Effluent BOD5 (mg/L). 30. 5. Effluent TSS (mg/L). 30. 0 soon disappear, and the process advantages should lead to rapid installation of the MBR system by the wastewater treatment industry (Drioli and Giorno, 2009).

  8. Sustainable household egg production to enhance household food ...

    African Journals Online (AJOL)

    A simple method of keeping laying hens has been developed with the aim of improving family nutrition through the provision of high ... Hens are purchased at point of lay and are kept for 52 weeks during which time they would lay approximately 260 eggs .... heard of existing units. Results from field workers are that the.

  9. Fire Protection Informational Exchange

    Science.gov (United States)

    2016-07-01

    batteries were charged at 260 amps and 30 volts. • Time to first visible signs of thermal runaway ranged from 30 to 70 minutes. 1 uNcLAssiFIED The... casas . JP-8 Spray fires as large as 8 GPH were used in most tests. All flame extinction times were less than 475 ms. Note: 1 Current prototype weights

  10. Transforming Biology Assessment with Machine Learning: Automated Scoring of Written Evolutionary Explanations

    Science.gov (United States)

    Nehm, Ross H.; Ha, Minsu; Mayfield, Elijah

    2012-01-01

    This study explored the use of machine learning to automatically evaluate the accuracy of students' written explanations of evolutionary change. Performance of the Summarization Integrated Development Environment (SIDE) program was compared to human expert scoring using a corpus of 2,260 evolutionary explanations written by 565 undergraduate…

  11. Computer training and professional library activities in Nigeria ...

    African Journals Online (AJOL)

    This paper investigated computer training and professional library activities in Nigeria. Stratified quota sampling technique coupled with questionnaire method was used for data collection. There were 260 subjects from the libraries in the South-West Nigeria out of which 245 responded and 213 copies of their questionnaire ...

  12. Ovoce, koření a léčiva z raně novověké jímky hradčanského špitálu

    Czech Academy of Sciences Publication Activity Database

    Čulíková, Věra

    2008-01-01

    Roč. 60, č. 2 (2008), s. 229-260 ISSN 0323-1267 Institutional research plan: CEZ:AV0Z80020508 Keywords : Prague-Hradčany * post-Medieval * carpological analyse * xylotomical analyse * imported species * introduced species Subject RIV: AC - Archeology, Anthropology, Ethnology

  13. Mutations converting cyclodextrin glycosyltransferase from a transglycosylase into a starch hydrolase

    NARCIS (Netherlands)

    Leemhuis, Hans; Dijkstra, Bauke W.; Dijkhuizen, Lubbert

    2002-01-01

    Cyclodextrin glycosyltransferase (CGTase) efficiently catalyzes transglycosylation of oligo-maltodextrins, although the enzyme also has a low hydrolytic activity. Its +2 substrate binding subsite, which contains the conserved Phe184 and Phe260 residues, has been shown to be important for this

  14. Analysis of genetic diversity and population structure among exotic ...

    African Journals Online (AJOL)

    The present study was performed to study genetic relationships and population differentiation of 90 introduced sugarcane accessions in Ethiopia by means of 22 SSR molecular markers. The 22 SSR markers amplified a total of 260 alleles, of which 230 were polymorphic with a mean of 10.45 alleles per SSR locus.

  15. Evaluation of the Semipermeable Membrane Device (SPMD) as a Passive In Situ Concentrator of Military Organic Chemicals in Water

    National Research Council Canada - National Science Library

    Petty, J

    1997-01-01

    ...., 1 ng/L, 10 ng/L, and 100 ng/L) at water temperatures ranging from I 00C to 260C. The data are indicative of concentration independent sampling rates for the 23 OC pesticides employed in this research...

  16. Occurrence of microsporidia and other pathogens in associated living spruce bark beetles (Coleoptera:Scolytidae) in an Austrian forest

    Czech Academy of Sciences Publication Activity Database

    Haidler, B.; Wegensteiner, R.; Weiser, Jaroslav

    2003-01-01

    Roč. 26, č. 1 (2003), s. 257-260 ISSN 1027-3115. [European Meeting "Entomopathogens and Insect Parasitic Nematodes /8./. Atheny, 29.05.2001-02.06.2001] Institutional research plan: CEZ:AV0Z5007907 Keywords : spruce bark beetles * Scolitidae Subject RIV: GF - Plant Pathology, Vermin, Weed, Plant Protection

  17. Body Mass Index in Pregnancy Does Not Affect Peroxisome ...

    African Journals Online (AJOL)

    Background: Obesity in pregnancy can contribute to epigenetic changes. Aim: To assess whether body mass index (BMI) in pregnancy is associated with changes in the methylation of the peroxisome proliferator‑activated receptor γ (PPAR) promoter region (−359 to − 260) in maternal and neonatal leukocytes. Subjects and ...

  18. Search Results | Page 26 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Results 251 - 260 of 8491 ... Women supporting women: Networked civic engagement to foster effective women's leadership for inclusive policymaking. “Women supporting Women” is an applied ... Transitions in Sub-Saharan Africa. What limits women's ability to become financially self-sufficient from an early age in Africa?

  19. Search Results | Page 26 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Results 251 - 260 of 8492 ... Women supporting women: Networked civic engagement to foster effective women's leadership for inclusive policymaking. “Women supporting Women” is an applied ... Transitions in Sub-Saharan Africa. What limits women's ability to become financially self-sufficient from an early age in Africa?

  20. Efficacy of a web-based intervention with mobile phone support in treating depressive symptoms in adults with type 1 and type 2 diabetes

    DEFF Research Database (Denmark)

    Nobis, Stephanie; Lehr, Dirk; Ebert, David D aniel

    2015-01-01

    OBJECTIVE: Depression is common in diabetes and linked to adverse health outcomes. This study evaluated the efficacy of a guided web-based intervention in reducing depression in adults with type 1 and type 2 diabetes. RESEARCH DESIGN AND METHODS: A total of 260 participants with diabetes and elev...

  1. Browse Title Index

    African Journals Online (AJOL)

    Items 1 - 50 of 260 ... Vol 50 (2010), Calculation of Breakthrough Time in Oil Recovery by the Use of Fractal Dimension in a Percolation Model, Abstract. CP Ogbogbo. Vol 40 (2000), Capability of Glossina tachinoides Westwood (Diptera: Glossinidae) males to made and inseminate female flies in different mating ratios to ...

  2. Hydrogen Sorption Performance of Pure Magnesium during Continued Cycling

    DEFF Research Database (Denmark)

    Vigeholm, B.; Kjøller, John; Larsen, B.

    1983-01-01

    Preliminary investigations of the hydrogen absorption - desorption by commercially pure magnesium powder under continuous operation show little or no reduction in hydrogen capacity up to 70 cycles and high temperature exposure exceeding 1200 h. Absorption was studied at 260°–425°C and hydrogen...

  3. Melting, growth, and faceting of lead precipitates in aluminum

    DEFF Research Database (Denmark)

    Gråbæk, L.; Bohr, J.; Andersen, H.H.

    1992-01-01

    National Laboratory, and showed large superheating as well as supercooling during repeated heating cycles. The as-implanted precipitates had a characteristic size of approximately 140 angstrom, which grew to 210-260 angstrom during repeated heating cycles. A detailed annealing study shows that the growth...

  4. Potentials of agricultural waste and grasses in pulp and papermaking

    African Journals Online (AJOL)

    Potentials of some agricultural waste and grasses were investigated. Potassium hydroxide from wood ash was used as alkali for pulping. Results from visopan Microscope showed that banana stalk has the highest fibre length of 2.60 mm and Bahaman grass has the least fibre length of 0.85 mm. Runkel Ratio (RK) for ...

  5. Analysis of individual tree volume equations for Cupressus ...

    African Journals Online (AJOL)

    Three different volume equations were fitted to individual tree volume (V) data collected on 260 Cupressus lusitanica trees from 49 plantations in Munessa Shashemene Forest, Ethiopia. The data were first split randomly into equation development and equation testing data sets of equal size. Diameter at breast height (D) ...

  6. Book Review: The Drug Effect | Kriegler | South African Crime ...

    African Journals Online (AJOL)

    Title: The Drug Effect: Health, Crime and Society Editors: Suzanne Fraser and David Moore Publisher: Cambridge University Press Price: R500.00 (incl. VAT and postage) Pages: 260. Availability: Published. Available through all academic bookstores. ISBN: 978-0-521-15605-9 ...

  7. Book Review :The Essential Guide to Rocky Mountain Mushrooms by Habitat

    Science.gov (United States)

    A mushroom guide book, 'The Essential Guide to Rocky Mountain Mushrooms by Habitat' by Cathy L. Cripps, Vera S. Evenson, and Michael Kou (University of Illinois Press, 260 pages), is reviewed in non-technical fashion from the standpoints of format, comprehensiveness, and clarity. Postive features (...

  8. Bayesian estimation of the parameters of the birnbaum-saunders ...

    African Journals Online (AJOL)

    Bayesian estimation of the parameters of the birnbaum-saunders distribution. K Robert, LO Odongo. Abstract. No Abstract > East African Journal of Statistics Vol. 1 (3) 2007: pp.248-260. Full Text: EMAIL FULL TEXT EMAIL FULL TEXT · DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT.

  9. Self-Esteem as Mediator and Moderator of the Relationship between Social Support and Subjective Well-Being among Chinese University Students

    Science.gov (United States)

    Kong, Feng; Zhao, Jingjing; You, Xuqun

    2013-01-01

    This study examined both the mediating and moderating effects of global self-esteem on the relationship between social support and subjective well-being among Chinese university students. Three hundred and ninety-one university students (260 males and 131 females) from two different Chinese universities completed the social support scale, the…

  10. Breast Lumps in NAUTH, Nnewi :A 5 year Review | Egwuonwu ...

    African Journals Online (AJOL)

    The clinical diagnosis were breast cancer in 260 patients (47.3%), fibroadenoma in 175 (31.8%), fibrocystic changes in 67 (12.2%) patients. The others were different types of benign diseases. Histopathology report was available in 294 patients with 161(54.8%), 56(19.0%) and 46(15.6%) patients diagnosed respectively as ...

  11. Mammalian Toxicity of Munition Compounds. Phase III. Effects of Lifetime Exposure. Part I. 2,4-Dinitrotoluene

    Science.gov (United States)

    1979-11-01

    appeared normal except for a regular cardiac arrhythmia (one slow beat after every 4 or 5 normal beats); similar patterns have been occasionally... newborn . 260 "I.[, 2. Method if The conditioning, mating, and establishment of pregnancy in rats and LI .. mice are as previously described. The drug

  12. Pediatric Palliative Care: A Personal Story

    Medline Plus

    Full Text Available ... views 4:24 The Ugly Truth of Pediatric Cancer - Duration: 5:21. KidsCancerChannel 63,260 views 5: ... 50. PCC4UProject 42,853 views 12:50 Childhood Cancer: Palliative Care - Duration: 3:29. American Cancer Society ...

  13. 78 FR 4978 - Proposed Agency Information Collection Activities; Comment Request

    Science.gov (United States)

    2013-01-23

    ... hours 100 Recent Records. 213.118--Continuous Weld Rail 728 railroads...... 728 revised plans.. 4 hours... hours 260 213.341--Initial Inspection--New 2 railroads........ 2 reports 16 hours 32 Rail and Welds...--Continuous Weld Rail-- 2 railroads........ 150 records........ 10 minutes........ 253 History--Records. 213...

  14. Transcending the Impasse: Rethinking the 'State' and 'Development ...

    African Journals Online (AJOL)

    sulaiman.adebowale

    2008-04-09

    Apr 9, 2008 ... cal Reflection on Collectivist and Individualist Societies', Journal of Political. Economy, Vol. 102, No. 5, pp. 912-950. Griffin, K., 1993, 'Policy Options for Rural Development', Oxford Bulletin of Eco- nomics and Statistics, Vol. 35, No. 4, pp. 245-260. Grindle, M. S. and Thomas, J. W., 1989, 'Policy Makers, ...

  15. Search Results | Page 26 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Results 251 - 260 of 1128 ... Managing Agricultural Biodiversity for Nutrition, Health, Livelihoods and Sustainable Production Systems (Sub-Saharan Africa) ... Africa food systems appears to be getting worse as evidenced by the increase in micronutrient deficiencies, chronic diseases and low resistance to infectious diseases.

  16. Investigating the Association between Home-School Dissonance and Disruptive Classroom Behaviors for Urban Middle School Students

    Science.gov (United States)

    Tyler, Kenneth M.; Burris, Jennifer L.; Coleman, Sean T.

    2018-01-01

    Disruptive classroom behaviors are a major schooling dilemma in urban schools. While several contextual and motivational factors have been statistically associated with disruptive classroom behaviors, one overlooked factor has been home-school dissonance. The current study examined the relationship between 260 middle school students' reports of…

  17. Checklist of the birds of Aruba, Curaçao and Bonaire, South Caribbean

    NARCIS (Netherlands)

    Prins, T.G.; Reuter, J.H.; Debrot, A.O.; Wattel, J.; Nijman, V.

    2009-01-01

    We present an updated checklist of the birds of the islands of Aruba, Curaçao and Bonaire, and the islets of Klein Curaçao and Klein Bonaire, southern Caribbean, and compare this with earlier checklists (K.H. Voous, Stud. Fauna Curaçao Carib. Isl. 7: 1-260, 1957; Ardea 53: 205-234, 1965; Birds of

  18. Effect of indium doping on zinc oxide films prepared by chemical ...

    Indian Academy of Sciences (India)

    Administrator

    Assuncao V, Fortunato E, Marques A, Aguas H, Ferreira I,. Costa M E V and Martins R 2003 Thin Solid Films 427. 401. Ataev B M, Bagamadova A M, Djabrailov A M, Mamedo V V and Rabadanov R A 1995 Thin Solid Films 260 19. Ataev B M, Bagamadova A M, Mamedov V V, Omaev A K and. Rabadanov M R 1999 J. Cryst.

  19. Constitutive Negative Regulation of R Proteins in Arabidopsis also via Autophagy Related Pathway?

    Czech Academy of Sciences Publication Activity Database

    Pečenková, Tamara; Sabol, P.; Kulich, I.; Ortmannová, Jitka; Žárský, Viktor

    2016-01-01

    Roč. 7, MAR 4 (2016), s. 260 ISSN 1664-462X R&D Projects: GA ČR(CZ) GA15-14886S Institutional support: RVO:61389030 Keywords : resistance * autophagy * R Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 4.298, year: 2016

  20. Studies of base pair sequence effects on DNA solvation based on all ...

    Indian Academy of Sciences (India)

    pdb1. 2.00. CATGGCCATG. 158d.pdb1. 1.90. CCAAGCTTGG. 167d.pdb1. 2.30. CCATTAATGG. 194d.pdb1. 2.30. CGCGTTAACGCG. 196d.pdb1. 1.70. CTCTCGAGAG. 1bd1.pdb1. 1.60. CCAGGCCTGG. 1bdn.pdb1. 2.60. CGCAAAAATGCG.

  1. A DNA Melting Exercise for a Large Laboratory Class

    Science.gov (United States)

    Levine, Lauren A.; Junker, Matthew; Stark, Myranda; Greenleaf, Dustin

    2015-01-01

    A simple and economical experimental setup is described that enables multiple individuals or groups within a laboratory class to measure the thermal melting of double stranded DNA simultaneously. The setup utilizes a basic spectrophotometer capable of measuring absorbance at 260 nm, UV plastic cuvettes, and a stirring hot plate. Students measure…

  2. Genetic diversity in African nutmeg (Monodora myristica) accessions ...

    African Journals Online (AJOL)

    sunny

    2014-10-15

    Oct 15, 2014 ... The purity of DNA was determined by calculating the ratio of absorbance at 260 nm to that of 280 nm. DNA concentration and purity was also determined by running the samples on 0.8% agarose gel. Polymerase chain reactions (PCR) were carried out in a Peltier thermal cycler (BioRAD DNA engine) using ...

  3. Butanol production from food waste: a novel process for producing sustainable energy and reducing environmental pollution

    Science.gov (United States)

    Efficient utilization of food waste for fuel and chemical production can positively influence both the energy and environmental sustainability. In these studies we investigated use of food waste to produce butanol by Clostridium beijerinckii P260. In control fermentation, 40.5 g/L of glucose (initia...

  4. Clean Hands Count

    Medline Plus

    Full Text Available ... What is Public Health?? - Duration: 5:34. Let's Learn Public Health 26,260 views 5:34 N. ... step by step approach - Duration: 9:28. Let's Learn Public Health 8,545 views 9:28 Loading ...

  5. The Challenge of Utilizing Information and Communication ...

    African Journals Online (AJOL)

    This paper, The Challenge of Utilizing Information and Communication Technology in Book Editing: A Study of Select Publishing Houses in Nigeria is a survey research. Two hundred and sixty (260) book editors working in the 87 NPA member firms within Ibadan and Ikeja, Lagos metropolis in Southwest Nigeria constituted ...

  6. Helminth parasites of the tropical gar, Atractosteus tropicus Gill, from Tabasco, Mexico

    Czech Academy of Sciences Publication Activity Database

    Salgado-Maldonado, G.; Moravec, František; Cabanas-Carranza, G.; Aguilar-Aguilar, R.; Sánchez-Nava, P.; Báez-Valé, R.; Scholz, Tomáš

    2004-01-01

    Roč. 90, č. 2 (2004), s. 260-265 ISSN 0022-3395 Grant - others:Consejo Nacional de Ciencia y Tecnología (MX) 27668N Institutional research plan: CEZ:AV0Z6022909 Keywords : Helminths * fish parasites * communities Subject RIV: EG - Zoology Impact factor: 1.439, year: 2004

  7. The Role of the Pharmacist in Animal Health Care: Case Study in ...

    African Journals Online (AJOL)

    In this cross-sectional study, the role of pharmacists in animal health care, particularly in the distribution of veterinary medicines in community pharmacies in Dar es Salaam was investigated. Using a semi-structured questionnaire a total of 260 pharmacists were interviewed. The study revealed that majority of the ...

  8. ONLINE RESOURCES Development of Novel microsatellite markers ...

    Indian Academy of Sciences (India)

    sony vaio

    using modified CTAB method (Ravishankar et al. 2000) with the repetition of washing step using chloroform:isoamyl alcohol (24:1) for five times till its mucilage was removed. The DNA concentration was determined using a spectrophotometer (Gene Quanta, Amersham Biosciences) by taking absorption at 260 and 280nm.

  9. Antiarrhythmic medication is superior to catheter ablation in suppressing supraventricular ectopic complexes in patients with atrial fibrillation

    DEFF Research Database (Denmark)

    Alhede, Christina; Lauridsen, Trine K; Johannessen, Arne

    2017-01-01

    to antiarrhythmic medication (AAD) is unknown. Our aims were to compare the prevalence of SVEC after AAD and CA and to estimate the association between baseline SVEC burden and AF burden during 24months of follow-up. METHODS: Patients with paroxysmal AF (N=260) enrolled in the MANTRA PAF trial were treated with AAD...

  10. Do we need radiochemical separation in activation analysis?

    Czech Academy of Sciences Publication Activity Database

    Kučera, Jan; Zeisler, R.

    2004-01-01

    Roč. 262, č. 10 (2004), s. 255-260 ISSN 0236-5731 R&D Projects: GA AV ČR IAA4048301 Institutional research plan: CEZ:AV0Z1048901 Keywords : biological reference materials * neutron activation Subject RIV: BG - Nuclear, Atomic and Molecular Physics, Colliders Impact factor: 0.457, year: 2004

  11. Closo-dodecaborate (2-) anion as a potential prosthetic group for attachment of astatine to proteins. Aspects of the labelling chemistry with Chloramine-T

    Czech Academy of Sciences Publication Activity Database

    Orlova, A.; Lebeda, Ondřej; Tolmachev, V.; Sjoberg, S.; Carsllon, J.; Lundqvist, H.

    2000-01-01

    Roč. 43, č. 43 (2000), s. 251-260 ISSN 0362-4803 Institutional research plan: CEZ:AV0Z1048901 Keywords : closo-dodecaborate (2-) anion * AT-211 * astatination Subject RIV: CH - Nuclear ; Quantum Chemistry Impact factor: 0.756, year: 2000

  12. Numerical Modeling of Pump Absorption in Coiled and Twisted Double-Clad Fibers

    Czech Academy of Sciences Publication Activity Database

    Koška, Pavel; Peterka, Pavel; Doya, V.

    2016-01-01

    Roč. 22, č. 2 (2016), s. 4401508 ISSN 1077-260X R&D Projects: GA ČR GA14-35256S; GA MŠk(CZ) LD15122 Institutional support: RVO:67985882 Keywords : double-clad optical fiber s * beam propagation method * fiber amplifiers Subject RIV: JA - Electronics ; Optoelectronics, Electrical Engineering Impact factor: 3.971, year: 2016

  13. Search Results | Page 26 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Results 251 - 260 of 1804 ... Open Crowd-Sourced Online Digital Review of Asia Pacific. An evaluation of the IDRC-supported serial, Digital Review of Asia Pacific (DirAP), revealed that the Review faced many challenges as a print publication.

  14. European Birth Cohorts for Environmental Health Research

    Czech Academy of Sciences Publication Activity Database

    Vrijheid, M.; Casas, M.; Bergström, A.; Carmichael, A.; Cordier, S.; Eggesbø, M.; Eller, E.; Fantini, M. P.; Fernández, M. F.; Fernández-Somoano, A.; Gehring, U.; Grazuleviciene, R.; Hohmann, C.; Karvonen, A. M.; Keil, T.; Kogevinas, M.; Koppen, G.; Krämer, U.; Kuehni, C. E.; Magnus, P.; Majewska, R.; Andersen, A. M. N.; Patelarou, E.; Petersen, M. S.; Pierik, F. H.; Polanska, K.; Porta, D.; Richiardi, L.; Santos, A. C.; Slama, R.; Šrám, Radim; Thijs, C.; Tischer, C.; Toft, G.; Trnovec, T.; Vandentorren, S.; Vrijkotte, T. G. M.; Wilhelm, M.; Wright, J.; Nieuwenhuijsen, M.

    2012-01-01

    Roč. 120, č. 1 (2012), s. 29-37 ISSN 0091-6765 Institutional research plan: CEZ:AV0Z50390703 Keywords : environment pollution * child health * European birth cohorts Subject RIV: DN - Health Impact of the Environment Quality Impact factor: 7.260, year: 2012

  15. 75 FR 73162 - Submission for OMB Review; Comment Request

    Science.gov (United States)

    2010-11-29

    ... military retirement and gambling winnings. Form 945-V, Payment Voucher, is used if you are making a payment.... Type of Review: Extension without change to a currently approved collection. Title: REG-106177-97 (NPRM.... Estimated Total Burden Hours: 4,258,260 hours. OMB Number: 1545-21.75. Type of Review: Extension without...

  16. Disgust domains in the prediction of contamination fear : A comparison of Dutch and US samples

    NARCIS (Netherlands)

    Sawchuk, Craig N.; Olatunji, Bunmi O.; De Jong, Peter J.

    2006-01-01

    The present study examines the disgust-contamination fear relationship among Dutch (N =260) and US (N =292) participants. US participants reported higher levels of disgust sensitivity across the majority of disgust domains and also endorsed stronger contamination fear than their Dutch counterparts.

  17. Functional screening of abundant bacteria from acidic forest soil indicates the metabolic potential of Acidobacteria subdivision 1 for polysaccharide decomposition

    Czech Academy of Sciences Publication Activity Database

    Lladó, Salvador; Žifčáková, Lucia; Větrovský, Tomáš; Eichlerová, Ivana; Baldrian, Petr

    2016-01-01

    Roč. 52, č. 2 (2016), s. 251-260 ISSN 0178-2762 R&D Projects: GA ČR(CZ) GP14-09040P EU Projects: European Commission(CZ) FP7ITN no.289949 Institutional support: RVO:61388971 Keywords : Coniferous forest * Bacterial ecology * Acidobacteria Subject RIV: EE - Microbiology, Virology Impact factor: 3.683, year: 2016

  18. Multicultural Personality Questionnaire : Development of a Short Form

    NARCIS (Netherlands)

    van der Zee, Karen; van Oudenhoven, Jan Pieter; Ponterotto, Joseph G.; Fietzer, Alexander W.

    2013-01-01

    This study reports on the development of the Multicultural Personality QuestionnaireShort Form among 511 participants. Using a split-sample scale validation design, Study 1 (N = 260) employed a principal component analysis and rigorous item selection criteria to extract a 40-item short form (MPQSF)

  19. Sero-prevalence of immunodeficiency virus, hepatitis B and C and ...

    African Journals Online (AJOL)

    Objectives: This study aimed to determine the sero-prevalence of transfusion transmitted infections (TTIs), namely immunodeficiency virus, hepatitis B and C and syphilis among blood donors. Setting: The study was carried in the blood bank at ElObeid Teaching Hospital. Material and methods: The study included 260 blood ...

  20. Risk for Asthma in Offspring of Asthmatic Mothers versus Fathers: A Meta-Analysis

    DEFF Research Database (Denmark)

    Lim, R.H.; Kobzik, L.; Dahl, Morten

    2010-01-01

    maternal and paternal odds ratios when analyzing the studies in which the patient population was 5 years or older (3.15 vs. 2.60, p = 0.14). However, in all cases the trend remained the same, that maternal asthma was a greater risk factor for asthma than paternal. Conclusions/Significance: The results show...

  1. The strength of frustration and quantum fluctuations in LiVCuO.sub.4./sub..

    Czech Academy of Sciences Publication Activity Database

    Nishimoto, S.; Drechsler, S.L.; Kuzian, R.; Richter, J.; Málek, Jiří; Schmitt, M.; van den Brink, J.; Rösner, H.

    2012-01-01

    Roč. 98, č. 3 (2012), "37007-p1"-"37007-p6" ISSN 0295-5075 Institutional research plan: CEZ:AV0Z10100520 Keywords : cuprate superconductors * neutron inelastic scattering * spin waves Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 2.260, year: 2012

  2. Status, biometrics, moult and possible relationships of the South ...

    African Journals Online (AJOL)

    The breeding population of Roseate Terns in southern Africa was estimated to be 250–260 pairs in 2000. Adult birds caught during nocturnal tern roost mist-netting on Bird Island and at Cape Recife, both in Algoa Bay, were closest to their North Atlantic counterparts in wing, bill, total head length, tail and mass ...

  3. Search Results | Page 26 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Results 251 - 260 of 8491 ... This project aims to use nanomaterials (a nanometer is one billionth of a meter) to provide new, inexpensive techniques to purify water that also address ... This project seeks to examine the links between women's economic empowerment, women's paid work, and their unpaid care responsibilities.

  4. Female morphology of Philometra hyderabadensis Rasheed, 1963 (Nematoda: Philometridae), a little-known parasite of the catfish Wallago attu Bloch & Schneider in India, as revealed by SEM observations

    Czech Academy of Sciences Publication Activity Database

    Moravec, František; Chavan, S. P.

    2012-01-01

    Roč. 83, č. 2 (2012), s. 117-122 ISSN 0165-5752 R&D Projects: GA ČR GBP505/12/G112 Institutional research plan: CEZ:AV0Z60220518 Keywords : Philometra * Wallago * India Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine Impact factor: 1.260, year: 2012

  5. Linked data-as-a-service: The semantic web redeployed

    NARCIS (Netherlands)

    Rietveld, Laurens; Verborgh, Ruben; Beek, Wouter; Vander Sande, Miel; Schlobach, Stefan

    2015-01-01

    Ad-hoc querying is crucial to access information from Linked Data, yet publishing queryable RDF datasets on the Web is not a trivial exercise. The most compelling argument to support this claim is that the Web contains hundreds of thousands of data documents, while only 260 queryable SPARQL

  6. African Crop Science Journal - Vol 20, No 4 (2012)

    African Journals Online (AJOL)

    Impact of some climatic and phenological parameters on the callogenesis and somatic embrogenesis variations in coco · EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT · DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. AE Issali, A Traoré, N Diarrassouba, J Andi Kohi Ngoran, A Sangaré, 251-260 ...

  7. 75 FR 3387 - Outer Continental Shelf Air Regulations Consistency Update for Alaska

    Science.gov (United States)

    2010-01-21

    ... AAC ] provisions, that were proposed to be incorporated by reference into part 55: 18 AAC 50.040 Federal Standards Adopted by Reference; 18 AAC 50.055 Industrial Processes and Fuel-Burning Equipment; 18 AAC 50.070 Marine Vessel Visible Emission Standards; 18 AAC 50.260 Best Available Retrofit Technology...

  8. Publications | Page 26 | IDRC - International Development Research ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Results 251 - 260 of 6381 ... Migrants in and from cities in Southern Africa play a critical role in the informal economy, yet the importance of that role is often underestimated and even invisible to researchers and policy-makers. ... Thiamin-fortified fish sauce is an efficacious means of improving dietary thiamin intake and.

  9. Causes for variation in pork quality

    NARCIS (Netherlands)

    Wal, van der P.; Engel, B.; Hulsegge, B.

    1997-01-01

    Research was carried out on 260 pigs that were slaughtered in 12 batches in the slaughter facilities of ID-DLO at Zeist. The practical circumstances were highly standardized. The 'animals' meat quality was good with only little variation; 46 animals showed a 'slightly' aberrant quality and 6

  10. One-dimensional modeling of concentration distribution in pipe flow of combined-load slurry

    Czech Academy of Sciences Publication Activity Database

    Matoušek, Václav; Krupička, Jan

    2014-01-01

    Roč. 260, July (2014), s. 42-51 ISSN 0032-5910 R&D Projects: GA ČR GA103/09/0383 Institutional support: RVO:67985874 Keywords : hydraulic transport * sediment transport * two - phase flow * experiment * bed shear Subject RIV: BK - Fluid Dynamics Impact factor: 2.349, year: 2014

  11. Physico-chemical characteristics and Heavy metal levels in Drinking ...

    African Journals Online (AJOL)

    Physico-chemical characteristics and Heavy metal levels in Drinking Water sources in Sokoto metropolis in North-western Nigeria. ... Tap water samples had similar conductivity values (180 -190μS/m), sachet water samples had conductivity values ranging from 80μS/m to 260μS/m while well water samples had highest ...

  12. Kinetics of the partial oxidation of methanol over a Fe-Mo catalyst

    NARCIS (Netherlands)

    Deshmukh, S.A.R.K.; van Sint Annaland, M.; Kuipers, J.A.M.

    2005-01-01

    The intrinsic steady-state kinetics of the partial oxidation of methanol to formaldehyde over a commercial Fe-Mo catalyst has been studied experimentally in a differentially operated reactor at temperatures of 230¿260 °C, over a wide range of methanol and oxygen concentrations. The principal

  13. A Multi-threaded Version of Field II

    DEFF Research Database (Denmark)

    Jensen, Jørgen Arendt

    2014-01-01

    in a plane of 20 x 50 mm (width x depth) with random Gaussian amplitudes were simulated using the command calc scat . Dual Intel Xeon CPU E5-2630 2.60 GHz CPUs were used under Ubuntu Linux 10.02 and Matlab version 2013b. Each CPU holds 6 cores with hyper-threading, corresponding to a total of 24 hyper...

  14. Geomorphological inventory of rock landforms on Mt. Kamenec in the Novohradské hory Mts. (the Czech Republic)

    Czech Academy of Sciences Publication Activity Database

    Rypl, J.; Kirchner, Karel; Dvořáčková, S.

    2014-01-01

    Roč. 9, č. 3 (2014), s. 253-260 ISSN 1842-4090 Institutional support: RVO:68145535 Keywords : Novohradské hory Mts. * large protection * Mt. Kamenec * GPS mapping * geomorphological inventory Subject RIV: DE - Earth Magnetism, Geodesy, Geography Impact factor: 0.630, year: 2014 http://www.ubm.ro/sites/CJEES/viewTopic.php?topicId=464

  15. Growth expectations for side activities in rural areas

    NARCIS (Netherlands)

    Markantoni, Marianna; Strijker, Dirk; Koster, Sierdjan

    2013-01-01

    Purpose – The purpose of this article is to examine growth expectations and factors influencing growth of side activities in rural areas. Design/methodology/approach – Data were collected in the rural areas of 36 Dutch municipalities by means of a detailed survey. This resulted in 260 response

  16. Firm Size, Ownership, Training Duration and Training Evaluation Practices

    Science.gov (United States)

    Asadullah, Muhammad Ali; Peretti, Jean Marie; Ali, Arain Ghulam; Bourgain, Marina

    2015-01-01

    Purpose: The purpose of this paper was to test the mediating role of training duration in relationship between firm characteristics and training evaluation practices. In this paper, the authors also investigated if this mediating effect differs with respect to the size of the firm. Design/methodology/approach: The authors collected data from 260

  17. 77 FR 75825 - Airworthiness Directives; Airbus Airplanes

    Science.gov (United States)

    2012-12-26

    ...-260-AD; Amendment 39-17293; AD 2012-25-12] RIN 2120-AA64 Airworthiness Directives; Airbus Airplanes.... SUMMARY: We are adopting a new airworthiness directive (AD) for all Airbus Model A330-200 and -300 series... 2. The FAA amends Sec. 39.13 by adding the following new AD: 2012-25-12 Airbus: Amendment 39-17293...

  18. Effect of steam explosion pre-treatment on molecular structure of ...

    African Journals Online (AJOL)

    to 260 °C and then reducing the pressure suddenly to atmospheric pressure [1]. The primary working ... surface textural roughness. The aim of the research is to provide theoretical support for the ..... Wenjie S, Hongzhang C. Study on loading coefficient in steam explosion process of corn stalk. Bioresour. Technol 2015; 179: ...

  19. Wet effluent diffusion denuder: The tool for determination of monoterpenes in forest

    Czech Academy of Sciences Publication Activity Database

    Křůmal, Kamil; Mikuška, Pavel; Večeřová, Kristýna; Urban, Otmar; Pallozzi, E.; Večeřa, Zbyněk

    2016-01-01

    Roč. 153, JUN (2016), s. 260-267 ISSN 0039-9140 R&D Projects: GA MŠk(CZ) LO1415 Institutional support: RVO:68081715 ; RVO:67179843 Keywords : diffusion denuder * monoterpene * biogenic volatile organic compounds * tenax tubes Subject RIV: CB - Analytical Chemistry , Separation; EH - Ecology, Behaviour (UEK-B) Impact factor: 4.162, year: 2016

  20. Zero-crossing angle of the np analyzing power below 300 MeV

    International Nuclear Information System (INIS)

    Davis, C.A.; Abegg, R.; Berdoz, A.R.; Birchall, J.; Campbell, J.R.; Gan, L.; Green, P.W.; Greeniaus, L.G.; Helmer, R.; Korkmaz, E.; Li, J.; Miller, C.A.; Opper, A.K.; Page, S.A.; Ramsay, W.D.; Sekulovich, A.M.; Sum, V.; van Oers, W.T.H.; Zhao, J.

    1995-01-01

    The zero point of the analyzing power for neutron-proton scattering has been measured as a function of scattering angle for 4 incident neutron energies, 174.3, 202.4, 216.5, and 260.3 MeV. The accuracy is ±0.25 degree

  1. Zero-crossing angle of the {ital np} analyzing power below 300 MeV

    Energy Technology Data Exchange (ETDEWEB)

    Davis, C.A. [TRIUMF, 4004 Wesbrook Mall, Vancouver, B.C., V6T 2A3 (Canada)]|[University of Manitoba, Department of Physics, Winnipeg, MB, R3T 2N2 (Canada); Abegg, R. [TRIUMF, 4004 Wesbrook Mall, Vancouver, B.C., V6T 2A3 (Canada)]|[University of Alberta, Department of Physics, Edmonton, AB, T6G 2N5 (Canada); Berdoz, A.R.; Birchall, J.; Campbell, J.R.; Gan, L. [University of Manitoba, Department of Physics, Winnipeg, MB, R3T 2N2 (Canada); Green, P.W.; Greeniaus, L.G. [University of Alberta, Department of Physics, Edmonton, AB, T6G 2N5 (Canada); Helmer, R. [TRIUMF, 4004 Wesbrook Mall, Vancouver, B.C., V6T 2A3 (Canada); Korkmaz, E.; Li, J. [University of Alberta, Department of Physics, Edmonton, AB, T6G 2N5 (Canada); Miller, C.A. [TRIUMF, 4004 Wesbrook Mall, Vancouver, B.C., V6T 2A3 (Canada); Opper, A.K. [University of Alberta, Department of Physics, Edmonton, AB, T6G 2N5 (Canada); Page, S.A.; Ramsay, W.D.; Sekulovich, A.M.; Sum, V.; van Oers, W.T.H.; Zhao, J. [University of Manitoba, Department of Physics, Winnipeg, MB, R3T 2N2 (Canada)

    1995-07-15

    The zero point of the analyzing power for neutron-proton scattering has been measured as a function of scattering angle for 4 incident neutron energies, 174.3, 202.4, 216.5, and 260.3 MeV. The accuracy is {plus_minus}0.25{degree}. (AIP)

  2. The guanine-rich fragile X chromosome repeats are reluctant to form tetraplexes

    Czech Academy of Sciences Publication Activity Database

    Fojtík, Petr; Kejnovská, Iva; Vorlíčková, Michaela

    2004-01-01

    Roč. 32, č. 1 (2004), s. 298-306 ISSN 0305-1048 R&D Projects: GA ČR GA204/01/0561; GA AV ČR IAA4004201 Institutional research plan: CEZ:AV0Z5004920 Keywords : fragile X chromosome syndrom * trinucleotide repeats * DNA polymorphism Subject RIV: BO - Biophysics Impact factor: 7.260, year: 2004

  3. 76 FR 62760 - Foreign-Trade Zone 277-Western Maricopa County, AZ; Application for Temporary/Interim...

    Science.gov (United States)

    2011-10-11

    ... exempt Sub-Zero from customs duty payments on the foreign components used in export production. The company anticipates that some 10 percent of the plant's shipments will be exported. On its domestic sales... (260 employees, 10 acres, 150,000 units/year) is located at 4295 N. Cotton Lane within the Palm Valley...

  4. Exploring Students' Articulation of Value in a Social Research Methods Class: Towards a Phenomenography of Value Making

    Science.gov (United States)

    Guglietti, Maria

    2015-01-01

    This study describes journalism students' value making of social research methods, such as sampling, data gathering strategies and quantitative and qualitative data analysis, by using a mixed-­method approach to analyze 260 written reflection assignments. In their reflections, 26 student participants assessed the value of their new knowledge of…

  5. Optimizing the conditions for hydrothermal liquefaction of barley straw for bio-crude oil production using response surface methodology

    DEFF Research Database (Denmark)

    Zhu, Zhe; Rosendahl, Lasse Aistrup; Toor, Saqib Sohail

    2018-01-01

    The present paper examines the conversion of barley straw to bio-crude oil (BO) via hydrothermal liquefaction. Response surface methodology based on central composite design was utilized to optimize the conditions of four independent variables including reaction temperature (factor X1, 260-340 o...

  6. Use of the industrial yeast Candida utilis for cadmium sorption

    Czech Academy of Sciences Publication Activity Database

    Kujan, Petr; Prell, Aleš; Šafář, Hynek; Sobotka, Miroslav; Řezanka, Tomáš; Holler, Pavel

    2006-01-01

    Roč. 51, č. 4 (2006), s. 257-260 ISSN 0015-5632 Institutional research plan: CEZ:AV0Z50200510 Keywords : candida utilis * cadmium * yeast Subject RIV: EE - Microbiology, Virology Impact factor: 0.963, year: 2006

  7. The relationship between students' perception of parental ...

    African Journals Online (AJOL)

    The study examined the relationship between students' perception of parental involvement in their education and academic achievement in Jos- South LGA. The correlational research design was used in which a sample of 260 students completed a self-report instrument titled Students Perception of Parental Involvement in ...

  8. ORF Alignment: NC_000117 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_000117 gi|15605324 >1jgmA 39 326 7 260 4e-33 ... ref|NP_220110.1| PHP superfamily hydrolase [Chlamydia trachomatis D/UW-3/CX] ... gb|AAC68196.1| PHP... ... trachomatis D/UW-3/CX] pir||G71494 probable php ... hydrolase - Chlamydia trachomatis (sero

  9. Teaching Computer Ergonomic Techniques: Practices and Perceptions of Secondary and Postsecondary Business Educators.

    Science.gov (United States)

    Alexander, Melody W.; Arp, Larry W.

    1997-01-01

    A survey of 260 secondary and 251 postsecondary business educators found the former more likely to think computer ergonomic techniques should taught in elementary school and to address the hazards of improper use. Both groups stated that over half of students they observe do not use good techniques and agreed that students need continual…

  10. The Practice of Information Processing Model in the Teaching of Cognitive Strategies

    Science.gov (United States)

    Ozel, Ali

    2009-01-01

    In this research, the differentiation condition of teaching the learning strategies depending on the time which the first grade of primary school teachers carried out to form an information-process skeleton on student is tried to be found out. This process including the efforts of 260 teachers in this direction consists of whether the adequate…

  11. Ocular Malignancies in HIV/AIDS Patients in a Tertiary Health ...

    African Journals Online (AJOL)

    70.0%), followed by Kaposi sarcoma (26.0%) and lymphoma (4%). The most common site of affectation was the limbus (44.8 %). Four out of six (66.7%) cases of invasive squamous cell carcinoma had enucleation, 2 (33.3%) had exenteration, ...

  12. Two convergent approaches toward novel carbocyclic C-nucleosides

    Czech Academy of Sciences Publication Activity Database

    Nencka, Radim; Šála, Michal; Dejmek, Milan; Dračínský, Martin; Holý, Antonín; Hřebabecký, Hubert

    -, č. 23 (2010), s. 4119-4130 ISSN 0039-7881 R&D Projects: GA MŠk 1M0508 Institutional research plan: CEZ:AV0Z40550506 Keywords : carbocyclic C-nucleosides * convergent approach * uracil * pyrimidines Subject RIV: CC - Organic Chemistry Impact factor: 2.260, year: 2010

  13. The Challenge of Fluid Flow -R-ES-ONANCE

    Indian Academy of Sciences (India)

    The four well-known water falls in Jog all leap over about the same depth. (about 260 my. ... nanDI". eyall; hi celasab. If. A strange ... that has fascinated all observers - ancient and modern. - is the strange mix of order and chaos that is their characteristic. At one extreme, a flow can be incredibly well-ordered. For example ...

  14. Space-time variation of hydrological processes and water resources in Rwanda : Focus on the Migina catchment

    NARCIS (Netherlands)

    Munyaneza, O.

    2014-01-01

    This book presents the hydrological research carried out in the Migina catchment (260 km2), Southern Rwanda. The main objective of the research is to explore the hydrological trends and climate linkages for catchments in Rwanda (26,338 km2), and to contribute to the understanding of dominant

  15. Space-time variation of hydrological processes and water resources in Rwanda: Focus on the Migina catchment

    NARCIS (Netherlands)

    Munyaneza, O.

    2014-01-01

    This book presents the hydrological research carried out in the Migina catchment (260 km2), Southern Rwanda. The main objective of the research is to explore the hydrological trends and climate linkages for catchments in Rwanda (26,338 km2), and to contribute to the understanding of dominant

  16. Journal of Biosciences | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    Volume 32 Issue 2 March 2007 pp 251-260 Articles. Antisense expression of a gene encoding a calcium-binding protein in transgenic tobacco leads to altered morphology and enhanced chlorophyll ... 2014 pp 931-944 Reviews. Antifreeze proteins enable plants to survive in freezing conditions · Ravi Gupta Renu Deswal.

  17. Život se sourozencem s mentálním postižením: kritické momenty, zdroje zvládání a osobní růst

    Czech Academy of Sciences Publication Activity Database

    Štěpánová, M.; Blatný, Marek

    2009-01-01

    Roč. 53, č. 3 (2009), s. 241-260 ISSN 0009-062X Institutional research plan: CEZ:AV0Z70250504 Keywords : coping * life course * posttraumatic growth Subject RIV: AN - Psychology Impact factor: 0.226, year: 2009

  18. Edward U Lorenz

    Indian Academy of Sciences (India)

    Home; Journals; Resonance – Journal of Science Education. Edward U Lorenz. Articles written in Resonance – Journal of Science Education. Volume 20 Issue 3 March 2015 pp 260-263 Classics. Predictability: Does the Flap of a Butterfly's Wings in Brazil Set off a Tornado in Texas? Edward U Lorenz · More Details Fulltext ...

  19. 2. Home 3. Journals 4. Resonance–Journal of Science Education 5 ...

    Indian Academy of Sciences (India)

    IAS Admin

    Brazil Set off a Tornado in Texas? Edward U Lorenz. Science Academies' Refresher Course in Quantum. Mechanics. Science Academies' Refresher Course in Mathematics. Information & Announcements. 278. 277. 260. 264. Face to Face. Symmetry and Mathematics: Pioneering Insights into the Structure of Physics.

  20. Commentary on the Discovery of the Beautiful Style Michigan Madonna

    Czech Academy of Sciences Publication Activity Database

    Hlobil, Ivo

    2016-01-01

    Roč. 64, 3/4 (2016), s. 256-260 ISSN 0049-5123 Institutional support: RVO:68378033 Keywords : gothic sculpture * Bohemian Beautiful Style * Madonna-torso * Museum Ann Arbor * Michigan (USA) Subject RIV: AL - Art, Architecture, Cultural Heritage