WorldWideScience

Sample records for mendelevium 257

  1. Symposium commemorating the 25th anniversary of the discovery of mendelevium

    Energy Technology Data Exchange (ETDEWEB)

    Seaborg, G.T. (ed.)

    1980-01-01

    The Symposium honoring the 25th Anniversary of the discovery of mendelevium was held at the Lawrence Berkeley Laboratory on March 28, 1980. The following three papers were presented: Chemical Properties of Mendelevium; Nuclear Properties of Mendelevium; and Radioactive Decay of Md Isotopes. Besides these papers there were introductory remarks, reminiscences, and concluding remarks.

  2. Studies on some physico-chemical properties of the monovalent mendelevium

    International Nuclear Information System (INIS)

    Kamenskaya, A.N.; Mikheev, N.B.; Novichenko, V.L.

    1979-01-01

    It was established that Md 3+ reduced by Yb 2+ or Eu 2+ co-crystallizes with NaCl in water-ethanol solutions. The co-crystallization coefficient is independent of the relative quantities of the solid and liquid phase, of the concentration of the reducing agent in the concentration range from 1 to 8 mg/ml, and of the concentration of the chloride ion in the solution. Basing on the knowledge of anomalous mixed crystals and on the thermodynamical analysis of the formation of truly isomorphical solid solutions and anomalous mixed crystals, it was shown that mendelevium co-crystallizing with NaCl is in its monovalent state. Besides, it was concluded that up to 1.5 M chloride concentration the monovalent mendelevium does not form stable chloride complexes in water-ethanol solutions. (author)

  3. 40 CFR 257.3-8 - Safety.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 24 2010-07-01 2010-07-01 false Safety. 257.3-8 Section 257.3-8... and Practices § 257.3-8 Safety. (a) Explosive gases. The concentration of explosive gases generated by... shall not pose a hazard to the safety of persons or property from fires. This may be accomplished...

  4. 7 CFR 3565.257 - Procurement actions.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 15 2010-01-01 2010-01-01 false Procurement actions. 3565.257 Section 3565.257... AGRICULTURE GUARANTEED RURAL RENTAL HOUSING PROGRAM Property Requirements § 3565.257 Procurement actions. All construction procurement actions, whether by sealed bid or by negotiation, must be conducted in a manner that...

  5. 6 CFR 25.7 - Litigation management.

    Science.gov (United States)

    2010-01-01

    ... 6 Domestic Security 1 2010-01-01 2010-01-01 false Litigation management. 25.7 Section 25.7 Domestic Security DEPARTMENT OF HOMELAND SECURITY, OFFICE OF THE SECRETARY REGULATIONS TO SUPPORT ANTI-TERRORISM BY FOSTERING EFFECTIVE TECHNOLOGIES § 25.7 Litigation management. (a) Liability for all claims...

  6. 40 CFR 257.9 - Wetlands.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 24 2010-07-01 2010-07-01 false Wetlands. 257.9 Section 257.9... Location Restrictions § 257.9 Wetlands. (a) Owners or operators of new units and lateral expansions shall not locate such units in wetlands, unless the owner or operator can make the following demonstrations...

  7. 40 CFR 257.3-6 - Disease.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 24 2010-07-01 2010-07-01 false Disease. 257.3-6 Section 257.3-6... and Practices § 257.3-6 Disease. (a) Disease Vectors. The facility or practice shall not exist or occur unless the on-site population of disease vectors is minimized through the periodic application of...

  8. 4 CFR 25.7 - Gambling.

    Science.gov (United States)

    2010-01-01

    ... 4 Accounts 1 2010-01-01 2010-01-01 false Gambling. 25.7 Section 25.7 Accounts GOVERNMENT ACCOUNTABILITY OFFICE GENERAL PROCEDURES CONDUCT IN THE GOVERNMENT ACCOUNTABILITY OFFICE BUILDING AND ON ITS GROUNDS § 25.7 Gambling. Participating in games for money or other personal property or operating gambling...

  9. 40 CFR 257.3-7 - Air.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 24 2010-07-01 2010-07-01 false Air. 257.3-7 Section 257.3-7... and Practices § 257.3-7 Air. (a) The facility or practice shall not engage in open burning of... 110 of the Clean Air Act, as amended. (c) As used in this section “open burning” means the combustion...

  10. Chemical properties of mendelevium

    Energy Technology Data Exchange (ETDEWEB)

    Hulet, E.K.

    1980-11-01

    Even with the most intense ion beams and the largest available quantities of target isotope, about 10/sup 6/ atoms at a time is all the Md that can be produced for chemical studies. This lack of sufficient sample size coupled with the very short lifetimes of the few atoms produced has severely restricted the gathering and the broadness of our knowledge concerning the properties of Md and the heavier elements. To illustrate, the literature contains a mere eleven references to the chemical studies of Md, and none of these deal with bulk properties associated with the element bound in solid phases. Some of these findings are: Md was found to be more volatile than other actinide metals which lead to the belief that it is divalent in the metallic state; separation of Md from the other actinides can be accomplished either by reduction of Md/sup 3 +/ to the divalent state or by chromatographic separations with Md remaining in the tripositive state; extraction of Md/sup 2 +/ with bis(2-ethylhexyl)phosphoric acid is much poorer than the extraction of the neighboring tripositive actinides; attempts to oxidize Md/sup 3 +/ with sodium bismuthate failed to show any evidence for Md/sup 4 +/; reduction potential of Md/sup 3 +/ was found to be close to -0.1 volt; Md/sup 3 +/ can be reduced to Md(Hg) by sodium amalgams and by electrolysis; the electrochemical behavior of Md is very similar to that of Fm and can be summarized in the equation, Md/sup 2 +/ + 2e/sup -/ = Md(Hg) and E/sup 0/ = -1.50 V.; and Md cannot be reduced to a monovalent ion with Sm/sup 2 +/.

  11. Chemical properties of mendelevium

    International Nuclear Information System (INIS)

    Hulet, E.K.

    1980-01-01

    The isotope 256 Md is nearly always employed for chemical studies of this element. This nuclide can be made by bombardment of fractions of a microgram of 254 Es with intense alpha-particle beams which will produce about 10 6 atoms of 256 Md with a half-life of 77 minutes. Even with the most intense ion beams and the largest available quantities of target isotope, about 10 6 atoms at a time is all the Md that can be produced for chemical studies. This lack of sufficient sample size coupled with the very short lifetimes of the few atoms produced has severly restricted the gathering and broadening of our knowledge concerning the properties of Md and the heavier elements. To illustrate, the literature contains a mere eleven references to the chemical studies of Md, and none of these deal with bulk properties associated with element found in solid phases. Some of these findings are: Md was found to be more volatile than other actinide metals which lead to the belief that it is divalent in the metallic state; separation of Md from the other actinides can be accomplished either by reduction of Md to the divalent state or by chromatographic separations with Md remaining in the tripositive state; extraction of Md with bis(2-ethylhexyl)phosphoric acid is much poorer than the extraction of the neighboring tripositive actinides; attempts to oxidize Md wih sodium bismuthate failed to show any evidence of Md 4+ ; standard reduction potential of Md 3+ was found to be close to -0.1 volt; Md 3+ can be reduced to Md(Hg) by sodium amalgams and by electrolysis; the electrochemical behavior of Md is very similar to that of Fm and can be summarized in the equation, Md 2+ + 2e - = Md(Hg), and E 0 = 1.5 V

  12. Chemical properties of mendelevium

    International Nuclear Information System (INIS)

    Hulet, E.K.

    1980-11-01

    Even with the most intense ion beams and the largest available quantities of target isotope, about 10 6 atoms at a time is all the Md that can be produced for chemical studies. This lack of sufficient sample size coupled with the very short lifetimes of the few atoms produced has severely restricted the gathering and the broadness of our knowledge concerning the properties of Md and the heavier elements. To illustrate, the literature contains a mere eleven references to the chemical studies of Md, and none of these deal with bulk properties associated with the element bound in solid phases. Some of these findings are: Md was found to be more volatile than other actinide metals which lead to the belief that it is divalent in the metallic state; separation of Md from the other actinides can be accomplished either by reduction of Md 3+ to the divalent state or by chromatographic separations with Md remaining in the tripositive state; extraction of Md 2+ with bis(2-ethylhexyl)phosphoric acid is much poorer than the extraction of the neighboring tripositive actinides; attempts to oxidize Md 3+ with sodium bismuthate failed to show any evidence for Md 4+ ; reduction potential of Md 3+ was found to be close to -0.1 volt; Md 3+ can be reduced to Md(Hg) by sodium amalgams and by electrolysis; the electrochemical behavior of Md is very similar to that of Fm and can be summarized in the equation, Md 2+ + 2e - = Md(Hg) and E 0 = -1.50 V.; and Md cannot be reduced to a monovalent ion with Sm 2+

  13. 27 CFR 40.257 - Processed tobacco.

    Science.gov (United States)

    2010-04-01

    ... 27 Alcohol, Tobacco Products and Firearms 2 2010-04-01 2010-04-01 false Processed tobacco. 40.257 Section 40.257 Alcohol, Tobacco Products and Firearms ALCOHOL AND TOBACCO TAX AND TRADE BUREAU, DEPARTMENT OF THE TREASURY (CONTINUED) TOBACCO MANUFACTURE OF TOBACCO PRODUCTS, CIGARETTE PAPERS AND TUBES, AND...

  14. 24 CFR 257.114 - Appraisal.

    Science.gov (United States)

    2010-04-01

    ... PROGRAM Eligibility Requirements and Underwriting Procedures § 257.114 Appraisal. (a) The property shall... Professional Appraisal Practice (USPAP), and dated no more than 180 days from the date on which the mortgage...

  15. 42 CFR 441.257 - Informed consent.

    Science.gov (United States)

    2010-10-01

    ... otherwise entitled. (ii) A description of available alternative methods of family planning and birth control... Sterilizations § 441.257 Informed consent. (a) Informing the individual. For purposes of this subpart, an individual has given informed consent only if— (1) The person who obtained consent for the sterilization...

  16. 24 CFR 207.257 - Commissioner's right to require acceleration.

    Science.gov (United States)

    2010-04-01

    ... 24 Housing and Urban Development 2 2010-04-01 2010-04-01 false Commissioner's right to require acceleration. 207.257 Section 207.257 Housing and Urban Development Regulations Relating to Housing and Urban... Mortgagee Under the Contract of Insurance § 207.257 Commissioner's right to require acceleration. Upon...

  17. 18 CFR 2.57 - Temporary certificates-pipeline companies.

    Science.gov (United States)

    2010-04-01

    ...-pipeline companies. 2.57 Section 2.57 Conservation of Power and Water Resources FEDERAL ENERGY REGULATORY... Policy and Interpretations Under the Natural Gas Act § 2.57 Temporary certificates—pipeline companies... the proposed construction is of major proportions. Pipeline companies are accordingly urged to conduct...

  18. 40 CFR 257.3-4 - Ground water.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 24 2010-07-01 2010-07-01 false Ground water. 257.3-4 Section 257.3-4... and Practices § 257.3-4 Ground water. (a) A facility or practice shall not contaminate an underground drinking water source beyond the solid waste boundary or beyond an alternative boundary specified in...

  19. 29 CFR 25.7 - Fees; cost; expenses; decisions.

    Science.gov (United States)

    2010-07-01

    ... 29 Labor 1 2010-07-01 2010-07-01 true Fees; cost; expenses; decisions. 25.7 Section 25.7 Labor... ORDER 10988 § 25.7 Fees; cost; expenses; decisions. (a) Arbitrator's fees, per diem and travel expenses, and election expenses for notices, ballots, postage, rentals, assistance, etc., shall be borne...

  20. 40 CFR 257.3-3 - Surface water.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 24 2010-07-01 2010-07-01 false Surface water. 257.3-3 Section 257.3-3... and Practices § 257.3-3 Surface water. (a) For purposes of section 4004(a) of the Act, a facility... Water Act, as amended. (b) For purposes of section 4004(a) of the Act, a facility shall not cause a...

  1. 38 CFR 21.257 - Self-employment.

    Science.gov (United States)

    2010-07-01

    ... rehabilitation plan leading to self-employment (a “self-employment plan”). The feasibility analysis must include... 38 Pensions, Bonuses, and Veterans' Relief 2 2010-07-01 2010-07-01 false Self-employment. 21.257... Employment Services § 21.257 Self-employment. (a) Approval of self-employment as a vocational goal. A program...

  2. 43 CFR 2.57 - Accounting for disclosures.

    Science.gov (United States)

    2010-10-01

    ... INFORMATION ACT Privacy Act § 2.57 Accounting for disclosures. (a) Maintenance of an accounting. (1) Where a... 43 Public Lands: Interior 1 2010-10-01 2010-10-01 false Accounting for disclosures. 2.57 Section 2... § 2.56 (c), an accounting shall be made. (2) The accounting shall record (i) the date, nature, and...

  3. 40 CFR 257.3-2 - Endangered species.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 24 2010-07-01 2010-07-01 false Endangered species. 257.3-2 Section... Disposal Facilities and Practices § 257.3-2 Endangered species. (a) Facilities or practices shall not cause or contribute to the taking of any endangered or threatened species of plants, fish, or wildlife. (b...

  4. 77 FR 22755 - Foreign-Trade Zone 257-Imperial County, CA; Site Renumbering Notice

    Science.gov (United States)

    2012-04-17

    ... DEPARTMENT OF COMMERCE Foreign-Trade Zones Board Foreign-Trade Zone 257--Imperial County, CA; Site Renumbering Notice Foreign-Trade Zone 257 was approved by the Foreign-Trade Zones Board on October 9, [email protected]trade.gov , or (202) 482-0862. Dated: April 11, 2012. Andrew McGilvray, Executive Secretary. [FR Doc...

  5. A nopA deletion mutant of Sinorhizobium fredii USDA257, a soybean symbiont, is impaired in nodulation

    Science.gov (United States)

    Sinorhizobium fredii USDA257 employs type III secretion system (T3SS) to deliver effector proteins into the host cells through filamentous surface appendages, called pili. The NopA protein is the major component of USDA257 pili. The promoter region of USDA257 nopA posses a well conserved tts box. Se...

  6. Loci and candidate genes conferring resistance to soybean cyst nematode HG type 2.5.7.

    Science.gov (United States)

    Zhao, Xue; Teng, Weili; Li, Yinghui; Liu, Dongyuan; Cao, Guanglu; Li, Dongmei; Qiu, Lijuan; Zheng, Hongkun; Han, Yingpeng; Li, Wenbin

    2017-06-14

    Soybean (Glycine max L. Merr.) cyst nematode (SCN, Heterodera glycines I,) is a major pest of soybean worldwide. The most effective strategy to control this pest involves the use of resistant cultivars. The aim of the present study was to investigate the genome-wide genetic architecture of resistance to SCN HG Type 2.5.7 (race 1) in landrace and elite cultivated soybeans. A total of 200 diverse soybean accessions were screened for resistance to SCN HG Type 2.5.7 and genotyped through sequencing using the Specific Locus Amplified Fragment Sequencing (SLAF-seq) approach with a 6.14-fold average sequencing depth. A total of 33,194 SNPs were identified with minor allele frequencies (MAF) over 4%, covering 97% of all the genotypes. Genome-wide association mapping (GWAS) revealed thirteen SNPs associated with resistance to SCN HG Type 2.5.7. These SNPs were distributed on five chromosomes (Chr), including Chr7, 8, 14, 15 and 18. Four SNPs were novel resistance loci and nine SNPs were located near known QTL. A total of 30 genes were identified as candidate genes underlying SCN resistance. A total of sixteen novel soybean accessions were identified with significant resistance to HG Type 2.5.7. The beneficial alleles and candidate genes identified by GWAS might be valuable for improving marker-assisted breeding efficiency and exploring the molecular mechanisms underlying SCN resistance.

  7. 24 CFR 983.257 - Owner termination of tenancy and eviction.

    Science.gov (United States)

    2010-04-01

    ... (iv) do not apply to the PBV program. (In the PBV program, “good cause” does not include a business or... URBAN DEVELOPMENT PROJECT-BASED VOUCHER (PBV) PROGRAM Occupancy § 983.257 Owner termination of tenancy... good cause as stated in paragraph (a) of this section; (3) Refuse to renew the lease without good cause...

  8. Agarwal Vijay K see Varma AK 247 see Varma AK 257 Banse Karl ...

    Indian Academy of Sciences (India)

    R.Narasimhan(krishtel emaging) 1461 1996 Oct 15 13:05:22

    Agarwal Vijay K see Varma A K. 247 see Varma A K. 257. Banse Karl see Lierheimer Lisa Jade. 163. Basu Sujit see Sarkar Abhijit. 297. Bawiskar S M. Momentum transport of wave zero during March: A possible predictor for the Indian summer monsoon. 153. Bhatla R see Mohanty U C. 365. Bhattacharya S. Grenvillian ...

  9. Decay properties of {sup 257}No, {sup 261}Rf, and {sup 262}Rf

    Energy Technology Data Exchange (ETDEWEB)

    Lazarev, Yu. A.; Lobanov, Yu. V.; Oganessian, Yu. Ts.; Utyonkov, V. K.; Abdullin, F. Sh.; Polyakov, A. N.; Rigol, J.; Shirokovsky, I. V.; Tsyganov, Yu. S.; Iliev, S. (and others)

    2000-12-01

    In bombardments of {sup 244}Pu targets with 114- and 120-MeV {sup 22}Ne projectiles we detected 69 {alpha}-{alpha} correlations linking {alpha} decays of {sup 261}Rf and {sup 257}No. We observed one {alpha} peak with E{sub {alpha}}=8.30{+-}0.06 MeV for {sup 261}Rf and peaks with {alpha}-particle energies 8.07--8.40 MeV for {sup 257}No. The half-life of {sup 257}No was measured to be 25{+-}3 s. No correlations were found between {alpha} decays and subsequent spontaneous fission events, from which we calculated an upper limit of 1.5% for the fission branch of {sup 257}No and estimated an upper limit of 3% for the {alpha}-decay branch of {sup 262}Rf. The cross section of the {sup 244}Pu({sup 22}Ne,5n){sup 261}Rf reaction was measured to be about 4 nb at both {sup 22}Ne energies used. We also report on some results from {sup 242}Pu+{sup 22}Ne and {sup 238}U+{sup 26}Mg bombardments.

  10. 24 CFR 960.257 - Family income and composition: Regular and interim reexaminations.

    Science.gov (United States)

    2010-04-01

    ... 24 Housing and Urban Development 4 2010-04-01 2010-04-01 false Family income and composition... and Reexamination § 960.257 Family income and composition: Regular and interim reexaminations. (a... must conduct a reexamination of family income and composition at least annually and must make...

  11. 40 CFR 257.3-5 - Application to land used for the production of food-chain crops (interim final).

    Science.gov (United States)

    2010-07-01

    ... production of food-chain crops (interim final). 257.3-5 Section 257.3-5 Protection of Environment... Application to land used for the production of food-chain crops (interim final). (a) Cadmium. A facility or... for the production of food-chain crops shall not exist or occur, unless in compliance with all...

  12. Determination of the spectroscopic stellar parameters for 257 field giant stars

    OpenAIRE

    Alves, S.; Benamati, L.; Santos, N. C.; Adibekyan, V. Zh.; Sousa, S. G.; Israelian, G.; De Medeiros, J. R.; Lovis, C.; Udry, S.

    2015-01-01

    The study of stellar parameters of planet-hosting stars, such as metallicity and chemical abundances, help us to understand the theory of planet formation and stellar evolution. Here, we present a catalogue of accurate stellar atmospheric parameters and iron abundances for a sample of 257 K and G field evolved stars that are being surveyed for planets using precise radial--velocity measurements as part of the CORALIE programme to search for planets around giants. The analysis was done using a...

  13. Photoresist processing for high-resolution DUV lithography at 257 nm

    Science.gov (United States)

    Fuller, Scott E.; Montgomery, Warren; Albelo, Jeff A.; Rodrigues, William; Buxbaum, Alex H.

    2001-09-01

    In this paper, we describe the studies conducted at Etec Systems, Inc., an Applied Materials company, using various resists from photoresist manufacturers. Etec undertook this investigation with the objective of creating 257-nm resist processes that would allow the continued use of precoated mask blanks from commercial suppliers. Successful delivery of this technology would allow the industry to adopt next-generation maskmaking systems without having to change current business practices, avoiding being forced to invest heavily in capital equipment, facilities, and the associated technology development programs necessary for local coating of mask blanks. The main criteria used to select an appropriate resist candidate were commercial availability, environmental stability, and across-plate critical dimension (CD) uniformity. The aging data provides an indication of shelf life-pre-exposure ranging from hours to months of delay. Methods for measuring the incoming plate quality are highlighted. The importance of a highly consistent, tightly controlled bake process-post-exposure bake (PEB) and post-apply bake (PAB)-is illustrated in detail. This paper also shows controlled CD structures below the wavelength: 257 nm. The authors describe the processing difficulties encountered while attempting to create a photomask manufacturing-capable process and the techniques used to address the difficulties. Bottom antireflective coatings, photobase, and chemical amplification are areas of focus, as are their resulting effects on the final photomask.

  14. The Expanding Role of Endoscopic Robotics in Mitral Valve Surgery: 1,257 Consecutive Procedures.

    Science.gov (United States)

    Murphy, Douglas A; Moss, Emmanuel; Binongo, Jose; Miller, Jeffrey S; Macheers, Steven K; Sarin, Eric L; Herzog, Alexander M; Thourani, Vinod H; Guyton, Robert A; Halkos, Michael E

    2015-11-01

    The role of robotic instruments in mitral valve (MV) surgery continues to evolve. The purpose of this study was to assess the safety, efficacy, and scope of MV surgery using a lateral endoscopic approach with robotics (LEAR) technique. From 2006 to 2013, a dedicated LEAR team performed 1,257 consecutive isolated MV procedures with or without tricuspid valve repair or atrial ablation. The procedures were performed robotically through five right-side chest ports with femoral artery or ascending aortic perfusion and balloon occlusion. Operative videos and data were recorded on all procedures and reviewed retrospectively. The mean age of all patients was 59.3 ± 20.5 years, and 8.4% (n = 105) had previous cardiac surgery. The MV repair was performed in 1,167 patients (93%). The MV replacement was performed in 88 patients (7%), and paravalvular leak repair in 2 patients. Concomitant atrial ablation was performed in 226 patients (18%), and tricuspid valve repair in 138 patients (11%). Operative mortality occurred in 11 patients (0.9%) and stroke in 9 patients (0.7%). Predischarge echocardiograms demonstrated mild or less mitral regurgitation in 98.3% of MV repair patients. At mean follow-up of 50 ± 26 months, 44 patients (3.8%) required MV reoperation. Application of the LEAR technique to all institutional isolated MV procedures increased from 46% in the first year to more than 90% in the last 3 years. Mitral valve repair or replacement, including concomitant procedures, can be performed safely and effectively using the LEAR technique. With a dedicated robotic team, the vast majority of patients with MV disorders, either isolated or with concomitant problems, can be treated using the LEAR technique. Copyright © 2015 The Society of Thoracic Surgeons. Published by Elsevier Inc. All rights reserved.

  15. Dissection of allelic interactions among Pto-miR257 and its targets and their effects on growth and wood properties in Populus.

    Science.gov (United States)

    Chen, B; Du, Q; Chen, J; Yang, X; Tian, J; Li, B; Zhang, D

    2016-08-01

    MicroRNAs (miRNAs) have important roles in the regulation of genes; however, for trees few studies have explored the potential impact of the interactions between miRNAs and their target genes. Here, we performed transcript profiling and association genetics (single-SNP, haplotype-based and multi-SNP associations) to study the genetic regulatory relationship of Pto-miR257 and its 12 target genes in 435 individuals of a natural population of Populus tomentosa. Expression profiling of Pto-miR257 and its targets showed a negative relationship between their expression levels. Of the 61 single-nucleotide polymorphisms (SNPs) detected in Pto-miR257, 6 in the pre-mature region strongly affected its secondary stability and 1 in the mature region could alter its target spectrum. Among the 1029 SNPs in the targets, 3 were located in target sites that could change the binding affinity of Pto-miR257. Single-SNP association analysis revealed that SNPs in Pto-miR257 and target genes associated with both growth and wood property traits, in agreement with haplotype-based identifications. Multi-SNP association found that 10 targets shared at least one common trait with Pto-miR257, with phenotypic variance from 0.5 to 8.5%, suggesting a possible internal genetic interaction between them. Epistasis analysis showed significant epistatic interactions among Pto-miR257 and its targets. Therefore, our study demonstrated Pto-miR257 and its 12 targets had roles in wood formation and revealed the genetic interaction network between the miRNA and its targets under additive, dominant and epistatic models. Thus, association genetics can be used to decipher the interactions between miRNAs and their target genes and to help understand the genetic architecture of complex traits.

  16. The tumour metabolism inhibitors GSAO and PENAO react with cysteines 57 and 257 of mitochondrial adenine nucleotide translocase

    Directory of Open Access Journals (Sweden)

    Park Danielle

    2012-03-01

    Full Text Available Abstract Background GSAO (4-(N-(S-glutathionylacetylamino phenylarsonous acid and PENAO (4-(N-(S-penicillaminylacetylamino phenylarsonous acid are tumour metabolism inhibitors that target adenine nucleotide translocase (ANT of the inner-mitochondrial membrane. Both compounds are currently being trialled in patients with solid tumours. The trivalent arsenical moiety of GSAO and PENAO reacts with two matrix facing cysteine residues of ANT, inactivating the transporter. This leads to proliferation arrest and death of tumour and tumour-supporting cells. Results The two reactive ANT cysteine residues have been identified in this study by expressing cysteine mutants of human ANT1 in Saccharomyces cerevisiae and measuring interaction with the arsenical moiety of GSAO and PENAO. The arsenic atom of both compounds cross-links cysteine residues 57 and 257 of human ANT1. Conclusions The sulphur atoms of these two cysteines are 20 Å apart in the crystal structures of ANT and the optimal spacing of cysteine thiolates for reaction with As (III is 3-4 Å. This implies that a significant conformational change in ANT is required for the organoarsenicals to react with cysteines 57 and 257. This conformational change may relate to the selectivity of the compounds for proliferating cells.

  17. 257__Omar_Tatsewarki

    African Journals Online (AJOL)

    User

    the soils should be embarked upon so as to monitor the toxicity level of the soil to keep it within the present non-toxic level. It is also recommended that the wastewater should be remediated to minimize and control the heavy metal contamination through phytoremediation. These measures are expected to enhance ...

  18. Mutation c.256_257delAA in RAG1 Gene in Polish Children with Severe Combined Immunodeficiency: Diversity of Clinical Manifestations.

    Science.gov (United States)

    Szaflarska, Anna; Rutkowska-Zapała, Magdalena; Kotula, Monika; Gruca, Anna; Grabowska, Agnieszka; Lenart, Marzena; Surman, Marta; Trzyna, Elżbieta; Mordel, Anna; Pituch-Noworolska, Anna; Siedlar, Maciej

    2016-12-01

    Mutations in RAG1 gene may result in different types of severe combined immunodeficiencies. In this study, we compare clinical symptoms and laboratory findings in four children with identical mutation in RAG1 gene. All of analyzed patients presented symptoms of severe combined immunodeficiencies associated or not with Omenn syndrome (OS) features. In our patients two different types of variants in RAG1 gene were detected. The first of the mutation was the deletion of AA dinucleotide at position c.256_257 (p.Lys86ValfsTer33), the second gene variant was substitution c.2867T>C (p.Ile956Thr). In Patient 1 we detected that compound heterozygous mutations involved both of the mentioned variants. Whereas, in Patients 2, 3 and 4, we confirmed the presence of the dinucleotide deletion but in a homozygous state. In all described patients, sequence analysis of RAG2 gene did not reveal any nucleotide changes. Our data show that mutation c.256_257delAA in RAG1 gene seems to occur quite frequently in the polish patients with severe combined immunodeficiency and may result in classical OS as well as in severe combined immunodeficiency without clinical and laboratory features of OS when occurred in homozygous state. The same mutation but in heterozygous state, in combination with other mutation in RAG1 gene, may result in incomplete OS.

  19. Ovarian cancer and oral contraceptives: collaborative reanalysis of data from 45 epidemiological studies including 23,257 women with ovarian cancer and 87,303 controls

    DEFF Research Database (Denmark)

    Cancer, Collaborative Group on Epidemiological Studies of Ovarian; Beral, V.; Doll, R.

    2008-01-01

    BACKGROUND: Oral contraceptives were introduced almost 50 years ago, and over 100 million women currently use them. Oral contraceptives can reduce the risk of ovarian cancer, but the eventual public-health effects of this reduction will depend on how long the protection lasts after use ceases. We...... aimed to assess these effects. METHODS: Individual data for 23,257 women with ovarian cancer (cases) and 87,303 without ovarian cancer (controls) from 45 epidemiological studies in 21 countries were checked and analysed centrally. The relative risk of ovarian cancer in relation to oral contraceptive use...... reductions, although typical oestrogen doses in the 1960s were more than double those in the 1980s. The incidence of mucinous tumours (12% of the total) seemed little affected by oral contraceptives, but otherwise the proportional risk reduction did not vary much between different histological types. In high...

  20. Ovarian cancer and oral contraceptives: collaborative reanalysis of data from 45 epidemiological studies including 23,257 women with ovarian cancer and 87,303 controls

    DEFF Research Database (Denmark)

    Cancer, Collaborative Group on Epidemiological Studies of Ovarian; Beral, V.; Doll, R.

    2008-01-01

    BACKGROUND: Oral contraceptives were introduced almost 50 years ago, and over 100 million women currently use them. Oral contraceptives can reduce the risk of ovarian cancer, but the eventual public-health effects of this reduction will depend on how long the protection lasts after use ceases. We...... aimed to assess these effects. METHODS: Individual data for 23,257 women with ovarian cancer (cases) and 87,303 without ovarian cancer (controls) from 45 epidemiological studies in 21 countries were checked and analysed centrally. The relative risk of ovarian cancer in relation to oral contraceptive use...... was estimated, stratifying by study, age, parity, and hysterectomy. FINDINGS: Overall 7308 (31%) cases and 32,717 (37%) controls had ever used oral contraceptives, for average durations among users of 4.4 and 5.0 years, respectively. The median year of cancer diagnosis was 1993, when cases were aged an average...

  1. Achieving a Net Zero Energy Retrofit – in a humid, temperate climate – lessons from the University of Hawai’i at M&#257noa

    Energy Technology Data Exchange (ETDEWEB)

    Regnier, Cindy [Lawrence Berkeley National Lab. (LBNL), Berkeley, CA (United States); Harding, Ari [Lawrence Berkeley National Lab. (LBNL), Berkeley, CA (United States); Robinson, Alastair [Lawrence Berkeley National Lab. (LBNL), Berkeley, CA (United States)

    2015-07-01

    The University of Hawai’i at M&#257noa (UHM) partnered with the US Department of Energy (DOE) and the Hawai`i Clean Energy Initiative to develop and implement solutions to retrofit exiting buildings to reduce energy consumption by at least 30% as part of DOE’s Commercial Building Partnerships (CBP) Program1. Kuykendall Hall, located on the UHM campus in Honolulu, was the focus of a CBP analysis and design collaboration among the University of Hawai’i, their consultants, and Lawrence Berkeley National Laboratory (LBNL). Kuykendall Hall consists of two 1960s-era wings – a four-story wing containing classrooms, and a seven-story tower containing offices – with a total floor area of approximately 76,000 square feet (ft²).

  2. Genome-Wide Association Study of Resistance to Soybean Cyst Nematode (Heterodera glycines) HG Type 2.5.7 in Wild Soybean (Glycine soja).

    Science.gov (United States)

    Zhang, Hengyou; Li, Chunying; Davis, Eric L; Wang, Jinshe; Griffin, Joshua D; Kofsky, Janice; Song, Bao-Hua

    2016-01-01

    Soybean cyst nematode (SCN) is the most destructive soybean pest worldwide. Host plant resistance is the most environmentally friendly and cost-effective way of mitigating SCN damage to soybeans. However, overuse of the resistant soybean [Glycine max (L.) Merr.] cultivars from limited genetic resources has resulted in SCN race shifts in many soybean-growing areas. Thus, exploration of novel sources of SCN resistance and dissection of the genetic basis are urgently needed. In this study, we screened 235 wild soybean (Glycine soja Sieb. & Zucc.) accessions to identify genotypes resistant to SCN HG Type 2.5.7 (race 5), a less investigated type but is prevalent in the southeastern US. We also dissected the genetic basis of SCN resistance using a genome-wide association study with SNPs genotyped by SoySNP50k iSelect BeadChip. In total, 43 resistant accessions (female index < 30) were identified, with 10 SNPs being significantly associated with SCN HG 2.5.7 resistance in this wild species. Furthermore, four significant SNPs were localized to linked regions of the known quantitative trait locus (QTL) rhg1 on chromosome 18. The other four SNPs on chromosome 18 and two SNPs on chromosome 19 are novel. Genes encoding disease resistance-related proteins with a leucine-rich region, a mitogen-activated protein kinase (MAPK) on chromosome 18, and a MYB transcription factor on chromosome 19 were identified as promising candidate genes. The identified SNPs and candidate genes will benefit future marker-assisted breeding and dissection of the molecular mechanisms underlying the soybean-SCN interaction.

  3. The residue I257 at S4-S5 linker in KCNQ1 determines KCNQ1/KCNE1 channel sensitivity to 1-alkanols.

    Science.gov (United States)

    Xie, Chang; Liu, Hao-wen; Pan, Na; Ding, Jiu-ping; Yao, Jing

    2016-01-01

    KCNQ1 and KCNE1 form a complex in human ventricular cardiomyocytes, which are important in maintaining a normal heart rhythm. In the present study we investigated the effects of a homologous series of 1-alkanols on KCNQ1/KCNE1 channels expressed in Xenopus oocytes. ECG recording was made in rats injected with ethanol-containing solution (0.3 mL, ip). Human KCNQ1 channel and its auxiliary subunit KCNE1 were heterologously coexpressed in Xenopus oocytes, which were superfused with ND96 solution; 1-alkanols (ethanol, 1-butanol and 1-hexanol) were delivered through a gravity-driven perfusion device. The slow-delayed rectifier potassium currents IKs (KCNQ1/KCNE1 currents) were recorded using a two-electrode voltage clamp method. Site-directed mutations (I257A) were made in KCNQ1. In ECG recordings, a low concentration of ethanol (3%, v/v) slightly increased the heart rate of rats, whereas the higher concentrations of ethanol (10%, 50%, v/v) markedly reduced it. In oocytes coexpressing KCNQ1/KCNE1 channels, ethanol, 1-butanol and 1-hexanol dose-dependently inhibited IKs currents with IC50 values of 80, 11 and 2.7 mmol/L, respectively. Furthermore, the 1-alkanols blocked the KCNQ1 channel in both open and closed states, and a four-state model could adequately explain the effects of 1-alkanols on the closed-state channel block. Moreover, the mutation of I257A at the intracellular loop between S4 and S5 in KCNQ1 greatly decreased the sensitivity to 1-alkanols; and the IC50 values of ethanol, 1-butanol and 1-hexanol were increased to 634, 414 and 7.4 mmol/L, respectively. The mutation also caused the ablation of closed-state channel block. These findings provide new insight into the intricate mechanisms of the blocking effects of ethanol on the KCNQ1 channel.

  4. Propiedades estructurales y magnéticas de aleaciones Gd0.257 -xTbxFe0.743 obtenidas por aleamiento mecánico

    Directory of Open Access Journals (Sweden)

    Mauricio Galvis-Patiño

    2017-01-01

    Full Text Available En el presente trabajo se reporta el estudio de las propiedades estructurales y magnéticas de la composición en forma de polvo de Gd0.257-xTbxFe0.743 con x=0,  0.1285,  0.257,preparados por Aleamiento Mecánico (AM en atmosfera de argón durante 72 horas mediante un molino planetario de alta energía ;la caracterización estructural se realizó por medio de Difractometría de rayos X(DRX, para la caracterización magnética se utilizó la espectroscopía Mössbauer, los ciclos de histéresis se llevaron a cabo a través de  PPMS (Physical Property Measurement System, Sistema de Medidas de Propiedades Físicas. La fase de α-Fe se presenta en los tres difractogramas mediante un pico característico cuya  intensidad disminuye al reemplazar el Tb por el Gd, presentándose la menor en x= 0 así mismo se observa un aumento de su ancho atribuible a la presencia de átomos de Gd en lugares propios del Fe. Los espectros Mössbauer (EM fueron ajustados con sextetos, dobletes, singletes y distribuciones de campo hiperfino lo que señala que el orden magnético se ve alterado al sustituir el Tb por el Gd en la composición. Las propiedades magnéticas extrínsecas de la composición en estudio, la caracterizan como materiales magnéticamente semiduros.

  5. Genome-Wide Association Study of Resistance to Soybean Cyst Nematode (Heterodera glycines HG Type 2.5.7 in Wild Soybean (Glycine soja

    Directory of Open Access Journals (Sweden)

    Hengyou Zhang

    2016-08-01

    Full Text Available Soybean cyst nematode (SCN is the most destructive soybean pest worldwide. Host plant resistance is the most environmentally friendly and cost-effective way of mitigating SCN damage to soybeans. However, overuse of the resistant soybean (Glycine max (L. Merr. cultivars from limited genetic resources has resulted in SCN race shifts in many soybean-growing areas. Thus, exploration of novel sources of SCN resistance and dissection of the genetic basis are urgently needed. In this study, we screened 235 wild soybean (Glycine soja Sieb. & Zucc. accessions to identify genotypes resistant to SCN HG Type 2.5.7 (race 5, a less investigated type but is prevalent in the southeastern US. We also dissected the genetic basis of SCN resistance using a genome-wide association study with SNPs genotyped by SoySNP50k iSelect BeadChip. In total, 43 resistant accessions (female index < 30 were identified, with ten SNPs being significantly associated with SCN HG 2.5.7 resistance in this wild species. Furthermore, four significant SNPs were localized to linked regions of the known quantitative trait locus (QTL rhg1 on chromosome 18. The other four SNPs on chromosome 18 and two SNPs on chromosome 19 are novel. Genes encoding disease resistance-related proteins with a leucine-rich region, a mitogen-activated protein kinase (MAPK on chromosome 18, and a MYB transcription factor on chromosome 19 were identified as promising candidate genes. The identified SNPs and candidate genes will benefit future marker-assisted breeding and dissection of the molecular mechanisms underlying the soybean-SCN interaction.

  6. 20 years of experience in static intensity-modulated total-body irradiation and lung toxicity. Results in 257 consecutive patients

    Energy Technology Data Exchange (ETDEWEB)

    Schneider, R.A.; Schultze, J.; Jensen, J.M.; Hebbinghaus, D.; Galalae, R.; Kimmig, B.N. [University Hospital of Schleswig-Holstein (UHK), Kiel (Germany). Dept. of Radiotherapy

    2007-10-15

    Purpose: To analyze lung complications after allogeneic or autologous transplantation following total-body irradiation (TBI) with compensators, so-called sIMRT (static intensity-modulated radiotherapy). Patients and Methods: Between 1983 and 1998, 257 patients with different hematologic malignancies underwent TBI in six fractions to a total dose of 12 Gy within 3 consecutive days (212 with 11 Gy lung dose) prior to allogeneic (n = 174) or autologous (n = 83) transplantation. 40 patients were < 16 years of age. Minimum follow-up time was 5 years. Median follow-up period was 110 months (13-231 months). Results: 5-year survival rate was 47.9%, 5-year tumor-related mortality 23%, 5-year treatment-related mortality 29.2% (12 Gy lung dose: 53.3% {+-} 14.6%, 11 Gy: 24.1% {+-} 5.7%). Interstitial pneumonitis (IP) developed in 28 of 257 patients (10.9% {+-} 3.8%). IP incidences in the allogeneic and autologous groups were 14.4% ({+-} 5.6%) and 3.6% (0-7.6%), respectively. IP incidences with 12/11 Gy lung dose were 22% ({+-} 12%)/8.5% ({+-} 3.7%). IP mortality was 9.3% ({+-} 3.6%). 13 of 28 patients with IP had a cytomegalovirus infection, five an acute graft-versus-host disease grade IV of the lungs. IP incidences with 12/11 Gy lung dose were 25% (9-50%)/4.2% (0.2-19.1%) in patients < 16 years, and 20.7% (9.4-37.4%) and 13.3% ({+-} 6.5%) in older patients after allogeneic transplantation. Conclusion: Compensator-generated static intensity-modulated TBI with a total dose of 12 Gy and a lung dose of 11 Gy is a modern and comfortable treatment with moderate lung toxicity, small dose inhomogeneities and little setup failure before transplantation. Especially patients < 16 years of age benefit from lung dose reduction.

  7. Genome-Wide Association Study of Resistance to Soybean Cyst Nematode (Heterodera glycines) HG Type 2.5.7 in Wild Soybean (Glycine soja)

    Science.gov (United States)

    Zhang, Hengyou; Li, Chunying; Davis, Eric L.; Wang, Jinshe; Griffin, Joshua D.; Kofsky, Janice; Song, Bao-Hua

    2016-01-01

    Soybean cyst nematode (SCN) is the most destructive soybean pest worldwide. Host plant resistance is the most environmentally friendly and cost-effective way of mitigating SCN damage to soybeans. However, overuse of the resistant soybean [Glycine max (L.) Merr.] cultivars from limited genetic resources has resulted in SCN race shifts in many soybean-growing areas. Thus, exploration of novel sources of SCN resistance and dissection of the genetic basis are urgently needed. In this study, we screened 235 wild soybean (Glycine soja Sieb. & Zucc.) accessions to identify genotypes resistant to SCN HG Type 2.5.7 (race 5), a less investigated type but is prevalent in the southeastern US. We also dissected the genetic basis of SCN resistance using a genome-wide association study with SNPs genotyped by SoySNP50k iSelect BeadChip. In total, 43 resistant accessions (female index resistance in this wild species. Furthermore, four significant SNPs were localized to linked regions of the known quantitative trait locus (QTL) rhg1 on chromosome 18. The other four SNPs on chromosome 18 and two SNPs on chromosome 19 are novel. Genes encoding disease resistance-related proteins with a leucine-rich region, a mitogen-activated protein kinase (MAPK) on chromosome 18, and a MYB transcription factor on chromosome 19 were identified as promising candidate genes. The identified SNPs and candidate genes will benefit future marker-assisted breeding and dissection of the molecular mechanisms underlying the soybean-SCN interaction. PMID:27582748

  8. The structure of monoacylglycerol lipase from Bacillus sp. H257 reveals unexpected conservation of the cap architecture between bacterial and human enzymes.

    Science.gov (United States)

    Rengachari, Srinivasan; Bezerra, Gustavo A; Riegler-Berket, Lina; Gruber, Christian C; Sturm, Christian; Taschler, Ulrike; Boeszoermenyi, Andras; Dreveny, Ingrid; Zimmermann, Robert; Gruber, Karl; Oberer, Monika

    2012-07-01

    Monoacylglycerol lipases (MGLs) catalyse the hydrolysis of monoacylglycerol into free fatty acid and glycerol. MGLs have been identified throughout all genera of life and have adopted different substrate specificities depending on their physiological role. In humans, MGL plays an integral part in lipid metabolism affecting energy homeostasis, signalling processes and cancer cell progression. In bacteria, MGLs degrade short-chain monoacylglycerols which are otherwise toxic to the organism. We report the crystal structures of MGL from the bacterium Bacillus sp. H257 (bMGL) in its free form at 1.2Å and in complex with phenylmethylsulfonyl fluoride at 1.8Å resolution. In both structures, bMGL adopts an α/β hydrolase fold with a cap in an open conformation. Access to the active site residues, which were unambiguously identified from the protein structure, is facilitated by two different channels. The larger channel constitutes the highly hydrophobic substrate binding pocket with enough room to accommodate monoacylglycerol. The other channel is rather small and resembles the proposed glycerol exit hole in human MGL. Molecular dynamics simulation of bMGL yielded open and closed states of the entrance channel and the glycerol exit hole. Despite differences in the number of residues, secondary structure elements, and low sequence identity in the cap region, this first structure of a bacterial MGL reveals striking structural conservation of the overall cap architecture in comparison with human MGL. Thus it provides insight into the structural conservation of the cap amongst MGLs throughout evolution and provides a framework for rationalising substrate specificities in each organism. Copyright © 2012 Elsevier B.V. All rights reserved.

  9. Observation of a Neutral Structure near the DD[over ¯]^{*} Mass Threshold in e^{+}e^{-}→(DD[over ¯]^{*})^{0}π^{0} at sqrt[s]=4.226 and 4.257 GeV.

    Science.gov (United States)

    Ablikim, M; Achasov, M N; Ai, X C; Albayrak, O; Albrecht, M; Ambrose, D J; Amoroso, A; An, F F; An, Q; Bai, J Z; Ferroli, R Baldini; Ban, Y; Bennett, D W; Bennett, J V; Bertani, M; Bettoni, D; Bian, J M; Bianchi, F; Boger, E; Boyko, I; Briere, R A; Cai, H; Cai, X; Cakir, O; Calcaterra, A; Cao, G F; Cetin, S A; Chang, J F; Chelkov, G; Chen, G; Chen, H S; Chen, H Y; Chen, J C; Chen, M L; Chen, S Chen; Chen, S J; Chen, X; Chen, X R; Chen, Y B; Cheng, H P; Chu, X K; Cibinetto, G; Dai, H L; Dai, J P; Dbeyssi, A; Dedovich, D; Deng, Z Y; Denig, A; Denysenko, I; Destefanis, M; De Mori, F; Ding, Y; Dong, C; Dong, J; Dong, L Y; Dong, M Y; Du, S X; Duan, P F; Fan, J Z; Fang, J; Fang, S S; Fang, X; Fang, Y; Fava, L; Feldbauer, F; Felici, G; Feng, C Q; Fioravanti, E; Fritsch, M; Fu, C D; Gao, Q; Gao, X L; Gao, X Y; Gao, Y; Gao, Z; Garzia, I; Goetzen, K; Gong, W X; Gradl, W; Greco, M; Gu, M H; Gu, Y T; Guan, Y H; Guo, A Q; Guo, L B; Guo, R P; Guo, Y; Guo, Y P; Haddadi, Z; Hafner, A; Han, S; Hao, X Q; Harris, F A; He, K L; He, X Q; Held, T; Heng, Y K; Hou, Z L; Hu, C; Hu, H M; Hu, J F; Hu, T; Hu, Y; Huang, G M; Huang, G S; Huang, J S; Huang, X T; Huang, Y; Hussain, T; Ji, Q; Ji, Q P; Ji, X B; Ji, X L; Jiang, L W; Jiang, X S; Jiang, X Y; Jiao, J B; Jiao, Z; Jin, D P; Jin, S; Johansson, T; Julin, A; Kalantar-Nayestanaki, N; Kang, X L; Kang, X S; Kavatsyuk, M; Ke, B C; Kiese, P; Kliemt, R; Kloss, B; Kolcu, O B; Kopf, B; Kornicer, M; Kühn, W; Kupsc, A; Lange, J S; Lara, M; Larin, P; Leng, C; Li, C; Li, Cheng; Li, D M; Li, F; Li, F Y; Li, G; Li, H B; Li, H J; Li, J C; Li, Jin; Li, K; Li, K; Li, Lei; Li, P R; Li, T; Li, W D; Li, W G; Li, X L; Li, X M; Li, X N; Li, X Q; Li, Z B; Liang, H; Liang, J J; Liang, Y F; Liang, Y T; Liao, G R; Lin, D X; Liu, B J; Liu, C X; Liu, D; Liu, F H; Liu, Fang; Liu, Feng; Liu, H B; Liu, H H; Liu, H H; Liu, H M; Liu, J; Liu, J B; Liu, J P; Liu, J Y; Liu, K; Liu, K Y; Liu, L D; Liu, P L; Liu, Q; Liu, S B; Liu, X; Liu, Y B; Liu, Z A; Liu, Zhiqing; Loehner, H; Lou, X C; Lu, H J; Lu, J G; Lu, Y; Lu, Y P; Luo, C L; Luo, M X; Luo, T; Luo, X L; Lyu, X R; Ma, F C; Ma, H L; Ma, L L; Ma, M M; Ma, Q M; Ma, T; Ma, X N; Ma, X Y; Maas, F E; Maggiora, M; Mao, Y J; Mao, Z P; Marcello, S; Messchendorp, J G; Min, J; Mitchell, R E; Mo, X H; Mo, Y J; Morales, C Morales; Moriya, K; Muchnoi, N Yu; Muramatsu, H; Nefedov, Y; Nerling, F; Nikolaev, I B; Ning, Z; Nisar, S; Niu, S L; Niu, X Y; Olsen, S L; Ouyang, Q; Pacetti, S; Pan, Y; Patteri, P; Pelizaeus, M; Peng, H P; Peters, K; Pettersson, J; Ping, J L; Ping, R G; Poling, R; Prasad, V; Qi, M; Qian, S; Qiao, C F; Qin, L Q; Qin, N; Qin, X S; Qin, Z H; Qiu, J F; Rashid, K H; Redmer, C F; Ripka, M; Rong, G; Rosner, Ch; Ruan, X D; Sarantsev, A; Savrié, M; Schoenning, K; Schumann, S; Shan, W; Shao, M; Shen, C P; Shen, P X; Shen, X Y; Sheng, H Y; Shi, M; Song, W M; Song, X Y; Sosio, S; Spataro, S; Sun, G X; Sun, J F; Sun, S S; Sun, X H; Sun, Y J; Sun, Y Z; Sun, Z J; Sun, Z T; Tang, C J; Tang, X; Tapan, I; Thorndike, E H; Tiemens, M; Ullrich, M; Uman, I; Varner, G S; Wang, B; Wang, D; Wang, D Y; Wang, K; Wang, L L; Wang, L S; Wang, M; Wang, P; Wang, P L; Wang, S G; Wang, W; Wang, W P; Wang, X F; Wang, Y D; Wang, Y F; Wang, Y Q; Wang, Z; Wang, Z G; Wang, Z H; Wang, Z Y; Wang, Z Y; Weber, T; Wei, D H; Wei, J B; Weidenkaff, P; Wen, S P; Wiedner, U; Wolke, M; Wu, L H; Wu, L J; Wu, Z; Xia, L; Xia, L G; Xia, Y; Xiao, D; Xiao, H; Xiao, Z J; Xie, Y G; Xiu, Q L; Xu, G F; Xu, J J; Xu, L; Xu, Q J; Xu, X P; Yan, L; Yan, W B; Yan, W C; Yan, Y H; Yang, H J; Yang, H X; Yang, L; Yang, Y; Yang, Y X; Ye, M; Ye, M H; Yin, J H; Yu, B X; Yu, C X; Yu, J S; Yuan, C Z; Yuan, W L; Yuan, Y; Yuncu, A; Zafar, A A; Zallo, A; Zeng, Y; Zeng, Z; Zhang, B X; Zhang, B Y; Zhang, C; Zhang, C C; Zhang, D H; Zhang, H H; Zhang, H Y; Zhang, J; Zhang, J J; Zhang, J L; Zhang, J Q; Zhang, J W; Zhang, J Y; Zhang, J Z; Zhang, K; Zhang, L; Zhang, X Y; Zhang, Y; Zhang, Y N; Zhang, Y H; Zhang, Y T; Zhang, Yu; Zhang, Z H; Zhang, Z P; Zhang, Z Y; Zhao, G; Zhao, J W; Zhao, J Y; Zhao, J Z; Zhao, Lei; Zhao, Ling; Zhao, M G; Zhao, Q; Zhao, Q W; Zhao, S J; Zhao, T C; Zhao, Y B; Zhao, Z G; Zhemchugov, A; Zheng, B; Zheng, J P; Zheng, W J; Zheng, Y H; Zhong, B; Zhou, L; Zhou, X; Zhou, X K; Zhou, X R; Zhou, X Y; Zhu, K; Zhu, K J; Zhu, S; Zhu, S H; Zhu, X L; Zhu, Y C; Zhu, Y S; Zhu, Z A; Zhuang, J; Zotti, L; Zou, B S; Zou, J H

    2015-11-27

    A neutral structure in the DD[over ¯]^{*} system around the DD[over ¯]^{*} mass threshold is observed with a statistical significance greater than 10σ in the processes e^{+}e^{-}→D^{+}D^{*-}π^{0}+c.c. and e^{+}e^{-}→D^{0}D[over ¯]^{*0}π^{0}+c.c. at sqrt[s]=4.226 and 4.257 GeV in the BESIII experiment. The structure is denoted as Z_{c}(3885)^{0}. Assuming the presence of a resonance, its pole mass and width are determined to be [3885.7_{-5.7}^{+4.3}(stat)±8.4(syst)]  MeV/c^{2} and [35_{-12}^{+11}(stat)±15(syst)]  MeV, respectively. The Born cross sections are measured to be σ[e^{+}e^{-}→Z_{c}(3885)^{0}π^{0},Z_{c}(3885)^{0}→DD[over ¯]^{*}]=[77±13(stat)±17(syst)]  pb at 4.226 GeV and [47±9(stat)±10(syst)]  pb at 4.257 GeV. The ratio of decay rates B[Z_{c}(3885)^{0}→D^{+}D^{*-}+c.c.]/B[Z_{c}(3885)^{0}→D^{0}D[over ¯]^{*0}+c.c.] is determined to be 0.96±0.18(stat)±0.12(syst), consistent with no isospin violation in the process, Z_{c}(3885)^{0}→DD[over ¯]^{*}.

  10. GSK3 beta forms a tetrameric complex with endogenous PS1-CTF/NTF and beta-catenin. Effects of the D257/D385A and FAD-linked mutations.

    Science.gov (United States)

    Tesco, G; Tanzi, R E

    2000-01-01

    We have previously shown that the endogenous C-terminal fragment of presenilin 1 co-immunoprecipitates with endogenous beta-catenin. Since PS1 has been suggested to be involved in beta-catenin stabilization, we further investigated whether GSK3 beta, responsible for beta-catenin phosphorylation and degradation, is part of the PS1/beta-catenin complex. In naïve H4 and CHO cells, PS1 co-immunoprecipitated with both endogenous beta-catenin and GSK3 beta. In addition, GSK3 beta endogenously binds to the PS1-CTF/NTF complex and beta-catenin in naïve CHO cells. GSK3 beta also co-immunoprecipitated with PS1 full length in CHO cell lines overexpressing PS1 wild type. Given that it has been recently shown that PS1 mutations of aspartate 257 or 385 result in prevention of PS1 endoproteolysis and inhibition of gamma-secretase activity, we also tested whether PS1 endoproteolysis is required for beta-catenin/GSK3 beta/PS1 binding and whether PS1 FAD-linked mutations affect GSK3 beta recruitment in the PS1/beta-catenin complex. GSK3 beta was detected in PS1 immunoprecipitates from H4 cell lines overexpressing PS1 wild type, delta E10, A286E, L246V and in CHO cell lines overexpressing aspartate or M146L mutations. The latter data show that the absence of PS1 endoproteolysis (D257A/D385A and delta E10) or the presence of PS1-FAD mutations does not interfere with beta-catenin/GSK3 beta/PS1 complex formation.

  11. Antifungal properties of peptidomimetics with an arginine-[β-(2,5,7-tri-tert-butylindol-3-yl)alanine]-arginine motif against Saccharomyces cerevisiae and Zygosaccharomyces bailii.

    Science.gov (United States)

    Larsen, Camilla Eggert; Larsen, Camilla Josephine; Franzyk, Henrik; Regenberg, Birgitte

    2015-05-01

    Due to increased occurrence of infections and food spoilage caused by yeast, there is an unmet need for new antifungal agents. The arginine-β-(2,5,7-tri-tert-butylindol-3-yl) alanine-arginine (R-Tbt-R) motif was previously proved useful in the design of an antifungal tripeptide. Here, an array of peptidomimetics based on this motif was investigated for antifungal and hemolytic activity. The five most promising modified tetrapeptide analogues ( 6: and 9-12: contain an additional C-terminal hydrophobic residue, and these were found to exhibit antifungal activity against Saccharomyces cerevisiae (MIC 6 and 12 μg mL(-1)) and Zygosaccharomyces bailii (MIC 6-25 μg mL(-1)). Four compounds ( 6: and 9-11: , had limited hemolytic activity (<10% hemolysis at 8 × MIC). Determination of their killing kinetics revealed that compound 9: displayed fungicidal effect. Testing against cells from an S. cerevisiae deletion mutant library indicated that interaction with yeast-specific fungal sphingolipids, most likely constitutes a crucial step in the mode of action. Interestingly, a lack of activity of peptidomimetics 6: and 9-11: towards Candida spp. was shown to be due to degradation or sequestering by the yeast. Due to their ultrashort nature, antifungal activity and low toxicity, the four compounds may have potential as leads for novel preservatives. © FEMS 2015. All rights reserved. For permissions, please e-mail: journals.permissions@oup.com.

  12. 40 CFR 257.21 - Applicability.

    Science.gov (United States)

    2010-07-01

    ... biological processes affecting contaminant fate and transport; and (2) Contaminant fate and transport... and environmental receptors; (2) Design of the unit; (3) Age of the unit; (4) The size of the unit... alternative technology; (iii) Climatic factors that may influence the selection, use, and reliability of...

  13. 17 CFR 257.1 - General instructions.

    Science.gov (United States)

    2010-04-01

    ... responsibility of the company's designated official shall be to make reasonable inquiry as to the due performance... company, insofar as such person is accountable to the company or to its security holders for such records... relevant to any transaction recorded by the company be preserved for such period as the Commission may...

  14. Publications | Page 257 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    IDRC works with developing-country researchers and institutions to build local capacity through funding, knowledge sharing, and training. Through books, articles, research publications, and studies, we aim to widen the impact of our investment and advance development research. We share the results of our funded ...

  15. 24 CFR 257.7 - Definitions.

    Science.gov (United States)

    2010-04-01

    ... following— (1) The person's father, mother, stepfather, stepmother, brother, sister, stepbrother, stepsister, son, daughter, stepson, stepdaughter, grandparent, grandson, granddaughter, father-in-law, mother-in-law, brother-in-law, sister-in-law, son-in-law, daughter-in-law, the spouse of any of the foregoing...

  16. Publications | Page 257 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    A public talk with Globe and Mail journalist Doug Saunders. A third of humanity is on the move—usually from farms ... This study looks at backward linkages to the manufacturing sector in the oil and gas value chain in Angola as a potential driver of industrial development. The study employs a sub-sectoral approach rather ...

  17. 262 257 Profitability Analysis of Three Met

    African Journals Online (AJOL)

    2008-12-02

    Dec 2, 2008 ... The returns to other variable costs were 29 kobo ... that all Suya products should be registered with National Agency for Food and Drug Administrative ..... Bunnet, R.B. and Okunrolifa, P.O. (1999). General Geography in Diagrams for West. Africa. Seventh Edition, Longman Group. Limited. Central Bank of ...

  18. 40 CFR 25.7 - Advisory groups.

    Science.gov (United States)

    2010-07-01

    ... relation to activities conducted with EPA financial assistance, program regulations elsewhere in this... civic, social, recreational, environmental or public health perspective in the area and which does not... such actions as placing notices or announcements in the newspapers or other media, mailing written...

  19. 17 CFR 257.2 - Schedule.

    Science.gov (United States)

    2010-04-01

    ...) Automobiles, other vehicles and related garage equipment records 3 years after disposition, termination of... firms and regulatory commission accountants.) 6 years after date of report. (b) Internal audit reports...

  20. Publications | Page 257 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Legume diversification in smallholder tobacco systems of Malawi : climate risk management and market opportunities; end of project report (open access). The project ... This study looks at backward linkages to the manufacturing sector in the oil and gas value chain in Angola as a potential driver of industrial development.

  1. 40 CFR 257.2 - Definitions.

    Science.gov (United States)

    2010-07-01

    ... wastewater treatment plant, water supply treatment plant, or air pollution control facility or any other such... waste treatment plant, water supply treatment plant, or air pollution control facility and other... Federal Water Pollution Control Act, as amended (86 Stat. 880), or source, special nuclear, or byproduct...

  2. 40 CFR Appendix II to Part 257 - Appendix II to Part 257

    Science.gov (United States)

    2010-07-01

    ... Drying: Liquid sludge is allowed to drain and/or dry on under-drained sand beds, or paved or unpaved... will be a minimum of five turnings of the windrow. Heat drying: Dewatered sludge cake is dried by... contact with the sludge at the point where it leaves the dryer is in excess of 80 °C. Heat treatment...

  3. 40 CFR 257.1 - Scope and purpose.

    Science.gov (United States)

    2010-07-01

    ... Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) SOLID WASTES CRITERIA FOR...) of the Resource Conservation and Recovery Act (The Act). Unless otherwise provided, the criteria in... disposal units that receive conditionally exempt small quantity geterator (CESQG) waste do not present...

  4. 257-IJBCS-Article-Dr Y M A Y Bandara

    African Journals Online (AJOL)

    RHUMSIKI

    All rights reserved. Original Paper http://indexmedicus.afro.who.int. DNA fingerprinting and phylogenetic study of some indica rice varieties using SSR markers. Y.M.A.Y. BANDARA *, W. W. R. W. M. D. K. WEERASOORIYA and ..... unique genetic makeup. This is obvious because most of the morphological characters.

  5. 14 CFR 257.6 - Effective and compliance dates.

    Science.gov (United States)

    2010-01-01

    ... the selling carrier is not the transporting carrier and (ii) Of the transporting carrier's identity... transportation involving a code-share arrangement of the transporting carrier's corporate name and any other name...

  6. 7 CFR 2.57 - Administrator, Food and Nutrition Service.

    Science.gov (United States)

    2010-01-01

    ...) Section 110 of the Hunger Prevention Act of 1988 (7 U.S.C. 612c note). (3) Administer those functions...) Represent the Department at conferences, meetings and other contacts where consumer affairs issues are...

  7. 257-IJBCS-Article-Dr Y M A Y Bandara

    African Journals Online (AJOL)

    RHUMSIKI

    these varieties are grown on commercial scale in 17 Asian, African and South American countries. Sri Lanka commands the highest national average rice yield, 3.7 t/ha ..... Alberta and Center for International. Forestry Research. Ye-yun X, Zhan Z, Yi-ping X, Long-ping Y. 2005. Identification and purity test of super hybrid rice ...

  8. Dicty_cDB: SHA257 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available , partial cds. 32 0.022 4 AF134658 |AF134658.1 Plasmodium falciparum strain SEN16 from Senegal CG2 omega rep... falciparum strain SEN10 from Senegal CG2 omega repeat (cg2) gene, partial cds. 32 0.028 4 AF134672 |AF13467

  9. All projects related to | Page 257 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Research on the links between tobacco farming and health problems among men, women, and children in Bangladesh will examine the health and ... was a London-based news agency that bought news features from developing world correspondents and distributed them to news media organizations around the world.

  10. Nigeria: Power and Democracy in Africa. Headline Series No. 257.

    Science.gov (United States)

    Herskovits, Jean

    This booklet traces the emergence of a democratic government in Nigeria through military dictatorship to the writing of a constitution fashioned on the American model. Chapters include: (1) "Prologue"; (2) "Nigeria Defined"; (3) "Tragedy and Recovery: The First Republic and the Federal Military Government"; (4)…

  11. 40 CFR 257.27 - Selection of remedy.

    Science.gov (United States)

    2010-07-01

    ... currently available, but which may offer significant advantages over already available technologies in terms...; (6) Resource value of the aquifer including: (i) Current and future uses; (ii) Proximity and... and those substances are present in concentrations such that cleanup of the release from the unit...

  12. 40 CFR 257.25 - Assessment monitoring program.

    Science.gov (United States)

    2010-07-01

    ... additional monitoring well at the facility boundary in the direction of contaminant migration and sample this... documenting this demonstration must be certified by a qualified ground-water scientist or approved by the...

  13. 40 CFR 180.257 - Chloroneb; tolerances for residues.

    Science.gov (United States)

    2010-07-01

    ..., sugar, tops 0.2 Cowpea, forage 2.0 Cowpea, hay 2.0 Cattle, fat 0.2 Cattle, meat 0.2 Cattle, meat... byproducts 0.2 Milk 0.05 Sheep, fat 0.2 Sheep, meat 0.2 Sheep, meat byproducts 0.2 Soybean, forage 2.0...

  14. 14 CFR 257.4 - Unfair and deceptive practice.

    Science.gov (United States)

    2010-01-01

    ... violation of 49 U.S.C. 41712 unless, in conjunction with such holding out or sale, carriers and ticket... Unfair and deceptive practice. The holding out or sale of scheduled passenger air transportation...

  15. Dicty_cDB: CFD257 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available pid:none) Homo sapiens PAC clone RP5-897G10 ... 73 2e-11 BC108289_1( BC108289 |pid:none) Homo sapiens picc...olo (presynaptic ... 73 2e-11 BC001304_1( BC001304 |pid:none) Homo sapiens piccolo ...(presynaptic ... 73 2e-11 (Q9Y6V0) RecName: Full=Protein piccolo; AltName: Full=Aczonin; 73 2e-11 (Q9JKS6) RecName: Full=Protein picc

  16. Standardized UXO Technology Demonstration Site, Blind Grid Scoring Record No. 257

    National Research Council Canada - National Science Library

    Overbay, Larry, Jr; Robitaille, George; Boutin, Matthew; Fling, Rick; McClung, Christina

    2005-01-01

    ...) utilizing the APG Standardized UXO Technology Demonstration Site Blind Grid. The scoring record was coordinated by Larry Overbay and the Standardized UXO Technology Demonstration Site Scoring Committee...

  17. S. Afr. J. Anim ^Sci d 257-260 (1975) THE INHERITANCE OF HAIR ...

    African Journals Online (AJOL)

    It is common practice in karakul sheep breeding to base selection on the visual appraisal of karakul lambs and to apply. a scoring sy'sfem for the main characters viz; curl type, pattern, hair quality and hair length. Measurement is practically restricted to birth weight only but this character plays a minor role in lamb selec- tion.

  18. 76 FR 39927 - Submission for Review: Marital Status Certification Survey, RI 25-7

    Science.gov (United States)

    2011-07-07

    ... estimate of the burden of the proposed collection of information, including the validity of the methodology... remarried before reaching age 55 and, thus, are no longer eligible for benefits. Analysis Agency: Retirement.... OMB Number: 3206-0033. Frequency: On occasion. Affected Public: Individuals or Households. Number of...

  19. 76 FR 82000 - Submission for Review: Marital Status Certification Survey, RI 25-7

    Science.gov (United States)

    2011-12-29

    ... estimate of the burden of the proposed collection of information, including the validity of the methodology..., widowers, and former spouses receiving survivor annuities from OPM have remarried before reaching age 55.... Frequency: Annually. Affected Public: Individuals or households. Number of Respondents: 24,000. Estimated...

  20. 257 Etude du cycle sexuel et l'inversion sexuelle de Pagellus bellottii

    African Journals Online (AJOL)

    User

    Résumé. Pagellus bellottii appartient à la famille des Sparidae. Il est hermaphrodite protérogyne et est fréquent dans les débarquements au Sénégal. Le but de ce travail est d'étudier la biologie de ce poisson qui présente un intérêt économique car il est consommé localement mais aussi exporté vers les pays de l'union.

  1. TASK 2.5.7 FIELD EXPERIMENTS TO EVALUATE COOL-COLORED ROOFING

    Energy Technology Data Exchange (ETDEWEB)

    Miller, William A [ORNL; Cherry, Nigel J [ORNL; Allen, Richard Lowell [ORNL; Childs, Phillip W [ORNL; Atchley, Jerald Allen [ORNL; Ronnen, Levinson [Lawrence Berkeley National Laboratory (LBNL); Akbari, Hashem [Lawrence Berkeley National Laboratory (LBNL); Berhahl, Paul [Lawrence Berkeley National Laboratory (LBNL)

    2010-03-01

    Aesthetically pleasing dark roofs can be formulated to reflect like a highly reflective white roof in the near infrared portion of the solar spectrum. New paint pigments increase the near infrared reflectance of exterior finishes by minimizing the absorption of near-infrared radiation (NIR). The boost in the NIR reflectance drops the surface temperatures of roofs and walls, which in turn reduces cooling-energy use and provides savings for the homeowner and relief for the utilities. In moderate and hot climates, a roof surface with high solar reflectance and high thermal emittance was shown by Akbari et al. (2004) and by Parker and Sherwin (1998) to reduce the exterior temperature and produce savings in comfort cooling. The new cool color pigments can potentially reduce emissions of carbon dioxide, which in turn reduces metropolitan heat buildup and urban smog. The pigments can also help conserve water resources otherwise used to clean and process fuel consumed by fossil-fuel driven power plants. Cool roofs also result in a lower ambient temperature that further decreases the need for air conditioning, retards smog formation, and improves thermal comfort. Parker, Sonne and Sherwin (2002) demonstrated that white barrel and white flat tiles reduced cooling energy consumption by 22% of the base load used by an adjacent and identical home having direct nailed dark shingles. Part of the savings was due to the reflectance of the white tiles; however, another part was due to the mass of the tile and to the venting occurring within the double batten installation. With, Cherry and Haig (2009) have studied the influence of the thermal mass and batten space ventilation and have found that, referenced to an asphalt shingle system, it can be equivalent to an additional 28 points of solar reflectivity. The double batten arrangement has wooden counter battens laid vertically (soffit-to-ridge) against the roof deck, and then the conventional battens are laid horizontally across the counter battens, providing a nailing surface for the concrete tile. This double batten construction forms an inclined air channel running from the soffit to the ridge. The bottom surface of the channel is formed by the roof decking and is relatively flat and smooth. The top surface is created by the underside of the roofing tiles, and is designed to be an air permeable covering to alleviate the underside air pressure and minimize wind uplift on the tiles. The resulting air flows also have a cooling influence which further complicates prediction of the heat penetrating through the deck because an accurate measure of the airflow is required to predict the heat transfer. Measured temperatures and heat flows at the roof surface, within the attic and at the ceiling of the houses are discussed as well as the power usage to help gauge the benefit of cool-pigmented reflective roof products fitted with and without ventilation above the roof deck. Ventilation occurring above the deck is an inherent feature for tile roof assemblies, and is formed by an air space between the exterior face of the roof sheathing and the underside of the tile. The greater the tile s profile the greater is the effect of the ventilation which herein is termed above-sheathing ventilation (ASV). However, because of the complexity of the thermally induced flow, little credit is allowed by state and federal building codes. ASHRAE (2005) provides empirical data for the effective thermal resistance of plane air spaces. A -in. (0.0191-m) plane air space inclined at 45 with the horizontal has an RUS-0.85 (RSI-0.15) . Our intent is to help further deploy cool color pigments in roofs by conducting field experiments to evaluate the new cool-colored roofing materials in the hot climate of Southern California. The collected data will be used to showcase and market the performance of new cool-roof products and also to help formulate and validate computer codes capable of calculating the heat transfer occurring within the attic and the whole building. Field measures and computer predictions showed that the demonstration home without a NIR-reflective tile coating and without above-sheathing ventilation had the greatest roof deck heat flow and subsequently the highest electrical usage. The house with both NIR paint pigments on the tile and with ASV had the least deck heat flows and therefore caused the home to consume the least amount of energy. The relative performance of the reflective coating and the ventilation individually is less obvious, but it is clear that the combination of a reflective tile with ASV is the preferred solution for the best energy saving.

  2. 40 CFR 257.23 - Ground-water sampling and analysis requirements.

    Science.gov (United States)

    2010-07-01

    .... Ground-water elevations in wells which monitor the same waste management area must be measured within a... theory test, then the data should be transformed or a distribution-free theory test should be used. If...

  3. Data supporting Boyes et al., Neurotoxicology 53, 257-270, 2016

    Data.gov (United States)

    U.S. Environmental Protection Agency — Visual evoked potential data from rats exposed to toluene Electroretinogram data from rats exposed to toluene Counts of rod and m-cone photoreceptor cells in retinas...

  4. Agarwal AK see Narang Geetika 257 Arés-Gastesi Pablo The ...

    Indian Academy of Sciences (India)

    On CNC commuting contractive tuples. 299. Biswas Indranil see Arés-Gastesi Pablo. 51. Bongioanni B. Sobolev spaces associated to the harmonic oscillator. 337. Chakraborty Partha Sarathi. On equivariant Dirac operators for SUq (2). 531. Chamizo Fernando. Non-Euclidean visibility problems. 147. Changjian Zhao.

  5. Sinorhizobium fredii USDA257 Translocates NopP into Vigna unguiculata Root Nodules

    Science.gov (United States)

    Type III secretion systems (T3SSs), which are found in many Gram-negative bacterial pathogens, inject virulence proteins directly into host cells during infection. T3SSs are also present in some strains of rhizobia, bacteria that form symbiotic associations with legumes and fix nitrogen in speciali...

  6. : tous les projets | Page 257 | CRDI - Centre de recherches pour le ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Sujet: URBAN AREAS, DRUG TRAFFIC, CONFLICTS, VIOLENCE, EMERGENCY RELIEF. Région: Brazil, South America, Colombia, Haiti, North and Central America, Mexico. Programme: Gouvernance et justice. Financement total : CA$ 505,000.00. Action humanitaire dans les autres situations de violence. Projet.

  7. 24 CFR 257.120 - Appreciation sharing or up-front payment

    Science.gov (United States)

    2010-04-01

    ... the Act, the amount of the appreciation in value of a property securing an H4H program mortgage that... appreciation may be established to the satisfaction of FHA: (1) In the case of— (i) A sale of the property to...'s interest in appreciation. Upon sale or disposition of a property securing an H4H program mortgage...

  8. Nwidu et al., Afr J Tradit Complement Altern Med. (2014) 11(2):257 ...

    African Journals Online (AJOL)

    cadewumi

    Andreo et al., 2006). Carpolobia ... The chromatographic fingerprint of the C. lutea stem-bark extract was established using a Jasco (Tokyo, Japan), liquid chromatograph equipped ..... Biology 315 – Quantitative Biology Lecture Notes. University ...

  9. 3-(2-Fluorophenylsulfinyl-2,5,7-trimethyl-1-benzofuran

    Directory of Open Access Journals (Sweden)

    Hong Dae Choi

    2013-06-01

    Full Text Available In the title compound, C17H15FO2S, the benzofuran ring system, being essentially planar, with an r.m.s. deviation from the least-squares plane of 0.009 (2 Å, makes a dihedral angle of 79.02 (5° with the plane of the 2-fluorophenyl group. In the crystal, molecules are linked by pairs of weak C—H...O hydrogen bonds into centrosymmetric dimers.

  10. 40 CFR Appendix I to Part 257 - Maximum Contaminant Levels (MCLs)

    Science.gov (United States)

    2010-07-01

    ... Drinking Water Act Chemical CAS No. MCL -(mg/l) Arsenic 7440-38-2 0.05 Barium 7440-39-3 1.0 Benzene 71-343... 0.004 Lead 7439-92-1 0.05 Mercury 7439-97-6 0.002 Methoxychlor 72-43-5 0.1 Nitrate 10.0 Selenium...

  11. Buli. Mater. Sci., Vol. 20, No. 2, April 1997, pp. 247-257. (C

    Indian Academy of Sciences (India)

    material for commercial applications. It has been known to exhibit ultra-low thermal expansion, good thermal shock resistance, high-thermal stability and high-chemical durability (Yang et al 1991). It is largely used as refractory materials in industrial furnaces and as heat exchangers in gas turbines. Its other applications are ...

  12. Retraction: Aydin, B. Statistical Convergent Topological Sequence Entropy Maps of the Circle. Entropy 2004, 6, 257–261

    Directory of Open Access Journals (Sweden)

    Kevin H. Knuth

    2014-02-01

    Full Text Available The editors were made aware that a paper published in Entropy in 2004 [1] may have plagiarized an earlier paper by Roman Hric published in 2000 [2]. After checking with specialized plagiarism software, we found that this claim is indeed correct and almost the entire paper is a verbatim copy of the earlier one. After confirmation of this fact, the editors of Entropy have decided to retract the paper immediately. [...

  13. 47 CFR 90.257 - Assignment and use of frequencies in the band 72-76 MHz.

    Science.gov (United States)

    2010-10-01

    ... authorization and use of frequencies in the 72-76 MHz band by mobile stations in the Industrial/Business Pool...) SAFETY AND SPECIAL RADIO SERVICES PRIVATE LAND MOBILE RADIO SERVICES Standards for Special Frequencies or... interference caused by his operations. (v) All applications seeking authority to operate with a separation of...

  14. Health hazard evaluation report HETA 82-257-1571, Manufacturing Chemists, Inc. , Indianapolis, Indiana. [Analyses for zeranol

    Energy Technology Data Exchange (ETDEWEB)

    Aw, T.C.; Stephenson, R.L.; Smith, A.B.; Glueck, C.J.

    1985-03-01

    Environmental and breathing-zone samples were analyzed for zeranol at Manufacturing Chemists, Incorporated (SIC-2879, SIC-0219), Indianapolis, Indiana, in May of 1984. The survey was requested by the State Industrial Hygiene Compliance Section to assist in evaluating the occurrence of breast symptoms, weight gain, and gynecomastia in employees and their children. Questionnaire interviews were conducted with 11 workers (5 males) and 14 comparisons (8 males). There is no current Federal standard for zeranol. Exposed workers reported a higher, though statistically insignificant, prevalence of breast symptoms than comparisons. The authors conclude that workers have a considerable exposure to zeranol which poses a potential health risk. Recommendations include improving engineering controls and not allowing employees to take work clothing home.

  15. Magnetic properties of PrMn2-xFexGe2-57Fe Moessbauer spectroscopy

    International Nuclear Information System (INIS)

    Wang, J L; Campbell, S J; Cadogan, J M; Tegus, O; Studer, A J; Hofmann, M

    2006-01-01

    We have investigated the magnetic behaviour of PrMn 2-x Fe x Ge 2 compounds with x = 0.4, 0.6 and 0.8 over the temperature range 4.2-350 K using ac magnetic susceptibility, dc magnetization and 57 Fe Moessbauer effect spectroscopy, as well as neutron diffraction for the PrMn 1.2 Fe 0.8 Ge 2 compound. Replacement of Mn with Fe leads to contraction of the unit cell and a shortening of the Mn-Mn spacing, resulting in modification of the magnetic structure. PrMn 1.6 Fe 0.4 Ge 2 is an intralayer antiferromagnet at room temperature and ferromagnetic below T C inter ∼230 K with additional ferromagnetic ordering of the Pr sublattice detected below T C Pr ∼30 K. Re-entrant ferromagnetism has been observed in PrMn 1.4 Fe 0.6 Ge 2 with four magnetic transitions (T N intra ∼333 K, T C inter ∼168 K, T N inter ∼152 K and T C Pr ∼40 K). Moreover, it was found that T C inter and T C Pr increase with applied field while T N inter decreases. PrMn 1.2 Fe 0.8 Ge 2 is antiferromagnetic with T N intra ∼242 K and T N inter ∼154 K. The magnetic transition temperatures for all compounds are also marked by changes in the 57 Fe magnetic hyperfine field and the electric quadrupole interaction parameters. The 57 Fe transferred hyperfine field at 4.5 K in PrMn 1.6 Fe 0.4 Ge 2 and PrMn 1.4 Fe 0.6 Ge 2 is reduced (below the ordering temperature of the Pr sublattice) compared with that at 80 K (above T C Pr ), indicating that the transferred hyperfine field from Pr acts in the opposite direction to that from the Mn atoms. The neutron data for PrMn 1.2 Fe 0.8 Ge 2 demonstrate that an anisotropic thermal expansion occurs within the interplanar antiferromagnetic range

  16. SU-E-J-257: A PCA Model to Predict Adaptive Changes for Head&neck Patients Based On Extraction of Geometric Features From Daily CBCT Datasets

    International Nuclear Information System (INIS)

    Chetvertkov, M; Siddiqui, F; Chetty, I; Kim, J; Kumarasiri, A; Liu, C; Gordon, J

    2015-01-01

    Purpose: Using daily cone beam CTs (CBCTs) to develop principal component analysis (PCA) models of anatomical changes in head and neck (H&N) patients and to assess the possibility of using these prospectively in adaptive radiation therapy (ART). Methods: Planning CT (pCT) images of 4 H&N patients were deformed to model several different systematic changes in patient anatomy during the course of the radiation therapy (RT). A Pinnacle plugin was used to linearly interpolate the systematic change in patient for the 35 fraction RT course and to generate a set of 35 synthetic CBCTs. Each synthetic CBCT represents the systematic change in patient anatomy for each fraction. Deformation vector fields (DVFs) were acquired between the pCT and synthetic CBCTs with random fraction-to-fraction changes were superimposed on the DVFs. A patient-specific PCA model was built using these DVFs containing systematic plus random changes. It was hypothesized that resulting eigenDVFs (EDVFs) with largest eigenvalues represent the major anatomical deformations during the course of treatment. Results: For all 4 patients, the PCA model provided different results depending on the type and size of systematic change in patient’s body. PCA was more successful in capturing the systematic changes early in the treatment course when these were of a larger scale with respect to the random fraction-to-fraction changes in patient’s anatomy. For smaller scale systematic changes, random changes in patient could completely “hide” the systematic change. Conclusion: The leading EDVF from the patientspecific PCA models could tentatively be identified as a major systematic change during treatment if the systematic change is large enough with respect to random fraction-to-fraction changes. Otherwise, leading EDVF could not represent systematic changes reliably. This work is expected to facilitate development of population-based PCA models that can be used to prospectively identify significant anatomical changes early in treatment. This work is supported in part by a grant from Varian Medical Systems, Palo Alto, CA

  17. Chronic lymphocytic leukemia of Emu-TCL1 transgenic mice undergoes rapid cell turnover that can be offset by extrinsic CD257 to accelerate disease progression

    NARCIS (Netherlands)

    Enzler, Thomas; Kater, Arnon P.; Zhang, Weizhou; Widhopf, George F.; Chuang, Han-Yu; Lee, Jason; Avery, Esther; Croce, Carlo M.; Karin, Michael; Kipps, Thomas J.

    2009-01-01

    Results of heavy-water labeling studies have challenged the notion that chronic lymphocytic leukemia (CLL) represents an accumulation of noncycling B cells. We examined leukemia cell turnover in Emu-TCL1 transgenic (TCL1-Tg) mice, which develop a CLL-like disease at 8 to 12 months of age. We found

  18. Genome-wide association study of soybean cyst nematode (Heterodera glycines Ichinohe) HG type 2.5.7 (race 1) resistance in wild soybean (Glycine soja Sieb. & Zucc.)

    Science.gov (United States)

    Soybean cyst nematode (SCN) is one of the most destructive pathogens of soybean plants worldwide. Thus far, most of the commercial SCN-resistant soybean cultivars have been developed from very limited resistant germplasm resources. Overuse of these limited resistant sources has resulted in SCN race ...

  19. Comparison of reactions for the production of 258,257Db: 208Pb(51V,xn) and 209Bi(50Ti,xn)

    Energy Technology Data Exchange (ETDEWEB)

    Gates, Jacklyn M.; Nelson, Sarah L.; Gregorich, Kenneth E.; Dragojevic, Irena; Dullmann, Christoph E.; Ellison, Paul A.; Folden III, Charles M.; Garcia, Mitch A.; Stavsetra, Liv; Sudowe, Ralf; Hoffman, Darleane C.; Nitsche, Heino

    2008-09-29

    Excitation functions for the 1n and 2n exit channels of the 208Pb(51V,xn)259-xDb reaction were measured. A maximum cross section of the 1n exit channel of 2070+1100/-760 pb was measured at an excitation energy of 16.0 +- 1.8 MeV. For the 2n exit channel, a maximum cross section of 1660+450/-370 pb was measured at 22.0 +- 1.8 MeV excitation energy. The 1n excitation function for the 209Bi(50Ti,n)258Db reaction was remeasured, resulting in a cross section of 5480+1750/-1370 pb at an excitation energy of 16.0 +- 1.6 MeV, in agreement with previous values [F. P. Hebberger, et al., Eur. Phys. J. A 12, 57 (2001)]. Differences in cross section maxima are discussed in terms of the fusion probability below the barrier.

  20. Organizational Issues, Structure, and Processes of Care in 257 ICUs in Latin America: A Study From the Latin America Intensive Care Network.

    Science.gov (United States)

    Estenssoro, Elisa; Alegría, Leyla; Murias, Gastón; Friedman, Gilberto; Castro, Ricardo; Nin Vaeza, Nicolas; Loudet, Cecilia; Bruhn, Alejandro; Jibaja, Manuel; Ospina-Tascon, Gustavo; Ríos, Fernando; Machado, Flavia R; Biasi Cavalcanti, Alexandre; Dubin, Arnaldo; Hurtado, F Javier; Briva, Arturo; Romero, Carlos; Bugedo, Guillermo; Bakker, Jan; Cecconi, Maurizio; Azevedo, Luciano; Hernandez, Glenn

    2017-08-01

    Latin America bears an important burden of critical care disease, yet the information about it is scarce. Our objective was to describe structure, organization, processes of care, and research activities in Latin-American ICUs. Web-based survey submitted to ICU directors. ICUs located in nine Latin-American countries. Individual ICUs. None. Two hundred fifty-seven of 498 (52%) of submitted surveys responded: 51% from Brazil, 17% Chile, 13% Argentina, 6% Ecuador, 5% Uruguay, 3% Colombia, and 5% between Mexico, Peru, and Paraguay. Seventy-nine percent of participating hospitals had less than 500 beds; most were public (59%) and academic (66%). ICUs were mainly medical-surgical (75%); number of beds was evenly distributed in the entire cohort; 77% had 24/7 intensivists; 46% had a physician-to-patient ratio between 1:4 and 7; and 69% had a nurse-to-patient ratio of 1 ≥ 2.1. The 24/7 presence of other specialists was deficient. Protocols in use averaged 9 ± 3. Brazil (vs the rest) had larger hospitals and ICUs and more quality, surveillance, and prevention committees, but fewer 24/7 intensivists and poorer nurse-to-patient ratio. Although standard monitoring, laboratory, and imaging practices were almost universal, more complex measurements and treatments and portable equipment were scarce after standard working hours, and in public hospitals. Mortality was 17.8%, without differences between countries. This multinational study shows major concerns in the delivery of critical care across Latin America, particularly in human resources. Technology was suboptimal, especially in public hospitals. A 24/7 availability of supporting specialists and of key procedures was inadequate. Mortality was high in comparison to high-income countries.

  1. Nr 257 - Opinion presented on the behalf of the Commission of sustainable development and land planning on the finance bill for 2013 (nr 235), Volumes 1-10, ecology, sustainable development and planning, regional policies, research and higher education

    International Nuclear Information System (INIS)

    Krabal, Jacques; Sermier, Jean-Marie; Gaillard, Genevieve; Baupin, Denis; Pauvros, Remi; Benisti, Jacques Alain; Fromantin, Jean-Christophe; Calmette, Alain; Plisson, Philippe; Ginesy, Charles-Ange

    2012-01-01

    This huge document comprises ten volumes which present and discuss public programs (objectives, strategies, plans, and actions), public finances, economic activity data and evolutions, debates by commissions, and amendments on different issues. A first set of issues deals with ecology, sustainable development and planning: protection of the environment and risk prevention (volume 1), and then with sustainable development policies (vol. 2), landscapes, water, biodiversity, and geographic and cartographic information (vol. 3), ecological transition (vol. 4), road, railway and water transports (vol. 5), air transports (vol. 6), maritime affairs (vol. 7). The next volume addresses regional policies (vol. 8). The last parts concern research and higher education: research in the field of sustainable development (vol. 9) and in the fields of environments and resources (vol. 10)

  2. Tensile/compressive behaviour of non-lyered tetragonal Ni.sub.52.8./sub.Mn.sub.25.7./sub.Ga.sub.21.5./sub. alloy

    Czech Academy of Sciences Publication Activity Database

    Söderberg, O.; Straka, L.; Novák, Václav; Heczko, O.; Hannula, S.-P.; Lindroos, V. K.

    2004-01-01

    Roč. 386, - (2004), s. 27-33 ISSN 0921-5093 Institutional research plan: CEZ:AV0Z1010914 Keywords : Ni-Mn-Ga alloys * tensile testing * twinning Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 1.445, year: 2004

  3. Comment on "Application of the variable projection scheme for frequency-domain full-waveform inversion" (M. Li, J. Rickett, and A. Abubakar, GEOPHYSICS, 78, no. 6, R249-R257)

    NARCIS (Netherlands)

    Aravkin, Aleksandr Y.; Herrmann, Felix J.; van Leeuwen, Tristan

    In the paper “Application of the variable projection scheme for frequency-domain full-waveform inversion,” Li et al. (2013) discuss a method for source estimation in the context of frequency-domain full-waveform inversion (FWI). This method is an extension of earlier work by Aravkin et al. (2012),

  4. Chemistry of the heaviest elements--one atom at a time

    International Nuclear Information System (INIS)

    Hoffman, Darleane C.; Lee, Diana M.

    2000-01-01

    In keeping with the goal of the Viewpoint series of the Journal of Chemical Education, this article gives a 75-year perspective of the chemistry of the heaviest elements, including a 50-year retrospective view of past developments, a summary of current research achievements and applications, and some predictions about exciting, new developments that might be envisioned within the next 25 years. A historical perspective of the importance of chemical separations in the discoveries of the transuranium elements from neptunium (Z=93) through mendelevium (Z=101) is given. The development of techniques for studying the chemical properties of mendelevium and still heavier elements on the basis of measuring the radioactive decay of a single atom (''atom-at-a-time'' chemistry) and combining the results of many separate experiments is reviewed. The influence of relativistic effects (expected to increase as Z 2 ) on chemical properties is discussed. The results from recent atom-at-a-time studies of the chemistry of the heaviest elements through seaborgium (Z=106) are summarized and show that their properties cannot be readily predicted based on simple extrapolation from the properties of their lighter homologues in the periodic table. The prospects for extending chemical studies to still heavier elements than seaborgium are considered and appear promising

  5. The discovery of 260Md and the decay properties of 258Fm, 258m,gMd and 259Md

    International Nuclear Information System (INIS)

    Lougheed, R.W.; Hulet, E.K.; Dougan, R.J.; Wild, J.F.; Dupzyk, R.J.; Henderson, C.M.; Moody, K.J.; Hahn, R.L.; Suemmerer, K.; Bethune, G.

    1986-01-01

    We have discovered a new neutron-rich isotope, 260 Md, from 18 O and 22 Ne bombardments of 254 Es. We observed a spontaneous-fission (SF) activity with a half-life of 32 days in electromagnetically separated fractions with mass number 260 from these bombardments and we measured the mass and kinetic energy distributions of this SF activity. The mass distribution was symmetric with the principal energy peak at a total kinetic energy (TKE) of 234 MeV, similar to previous observations for heavy fermium isotopes. Surprisingly, we also observed a smaller symmetric component with a TKE of 195 MeV. We interpret these two peaks in the TKE distribution as arising from two types of fission in the same nucleus, or bimodal fission. The observed fission activity may be either from the SF decay of 260 Md or from 260 Fm which would arise from electron-capture (EC) decay of 260 Md. We have eliminated the possible β - decay of 260 Md by measuring β - -SF time correlations for the decay of 260 Md and we plan to determine whether 260 Md decays by EC by measuring time correlations between fermium X-rays and SF events. We also measured various properties of the heavy fermium and mendelevium isotopes and obtained 1. more accurate cross-sections for the neutron-rich mendelevium isotopes which we use to predict the production rates of yet undiscovered nuclides, 2. improved half-life measurements for 258m,g Md and 259 Md, 3. confirmation of the EC decay of 258m Md by measurement of the fermium X-rays preceding the SF decay of 258 Fm and 4. very substantially improved mass and TKE distributions for the SF decay of 258 Fm and 259 Md. (orig.)

  6. Impact of BCRP/MXR, MRP1 and MDR1/P-Glycoprotein on thermoresistant variants of atypical and classical multidrug resistant cancer cells

    DEFF Research Database (Denmark)

    Stein, Ulrike; Lage, Hermann; Jordan, Andreas

    2002-01-01

    and thermoresistance was investigated in the parental human gastric carcinoma cell line EPG85-257P, the atypical MDR subline EPG85-257RNOV, the classical MDR subline EPG85-257RDB and their thermoresistant counterparts EPG85-257P-TR, EPG85-257RNOV-TR and EPG85-257RDB-TR. Within the atypical MDR subline EPG85-257RNOV...... expression of BCRP/MXR and of MRP1 were clearly enhanced (vs. parental and classical MDR lines). MDR1/PGP expression was distinctly elevated in the classical MDR subline EPG85-257RDB (vs. parental and atypical MDR sublines). In all thermoresistant counterparts basal expression of BCRP/MXR, MRP1 and MDR1/PGP...

  7. ORF Alignment: NC_006814 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available EREEAFDKVASQLV Sbjct: 1 ... LPASLISNRYVSDLKPYIGKTMKLKITEIDPNKNRLILSHKDLVEEEREEAFDKVASQLV 60 ... Query: 257 DRHRIS...LSIKQTEPSPFE 274 ... DRHRISLSIKQTEPSPFE Sbjct: 121 DRHRISLSIKQTEPSPFE 138

  8. Optical simulations for the S3 project - Super separator spectrometer - gamma-electron coincidence spectroscopy of a transfermium nucleus: the 251Md101

    International Nuclear Information System (INIS)

    Dechery, Fabien

    2012-01-01

    In analogy with the atomic closed shells giving rise to the stability and high ionisation energies of noble gases, nuclear physics also has its magic numbers of protons and neutrons which enhance nuclear structure stability. Knowledge of the structure of doubly-magic nuclei, both proton and neutron numbers, is crucial to parameterize theoretical models. The discovery of the next and ultimate magic numbers will provide a strong constraint on the many predictions. These two numbers are like the centre coordinates of an area of enhanced stability of the nuclear chart, well known as 'island of stability'. These superheavy nuclei only exist due to pure quantum shell effects. My thesis work deals with two distinct, but complementary, aspects of fundamental physics with the common goal of studying these extreme mass nuclei structure. The first part corresponds to the development of a next generation instrument for nuclear physics to allow synthesis and spectroscopy studies of superheavy nuclei: the Super Separator Spectrometer S 3 . This project will be installed at SPIRAL2 (GANIL) and has been approved by the French Research National Agency (ANR) within the EQUIPEX framework. It has been designed to take advantage of the high intensity heavy ion beam from the LINAC, giving access to a wide range of physical programs. The second part corresponds to the preparation, realisation and analysis of an experiment on 251-Mendelevium in which the very first prompt gamma-electron coincidence spectroscopy was performed for a transfermium nuclei. (author) [fr

  9. The Use of the Delphi and Other Consensus Group Methods in Medical Education Research: A Review.

    Science.gov (United States)

    Humphrey-Murto, Susan; Varpio, Lara; Wood, Timothy J; Gonsalves, Carol; Ufholz, Lee-Anne; Mascioli, Kelly; Wang, Carol; Foth, Thomas

    2017-10-01

    Consensus group methods, such as the Delphi method and nominal group technique (NGT), are used to synthesize expert opinions when evidence is lacking. Despite their extensive use, these methods are inconsistently applied. Their use in medical education research has not been well studied. The authors set out to describe the use of consensus methods in medical education research and to assess the reporting quality of these methods and results. Using scoping review methods, the authors searched the Medline, Embase, PsycInfo, PubMed, Scopus, and ERIC databases for 2009-2016. Full-text articles that focused on medical education and the keywords Delphi, RAND, NGT, or other consensus group methods were included. A standardized extraction form was used to collect article demographic data and features reflecting methodological rigor. Of the articles reviewed, 257 met the inclusion criteria. The Modified Delphi (105/257; 40.8%), Delphi (91/257; 35.4%), and NGT (23/257; 8.9%) methods were most often used. The most common study purpose was curriculum development or reform (68/257; 26.5%), assessment tool development (55/257; 21.4%), and defining competencies (43/257; 16.7%). The reporting quality varied, with 70.0% (180/257) of articles reporting a literature review, 27.2% (70/257) reporting what background information was provided to participants, 66.1% (170/257) describing the number of participants, 40.1% (103/257) reporting if private decisions were collected, 37.7% (97/257) reporting if formal feedback of group ratings was shared, and 43.2% (111/257) defining consensus a priori. Consensus methods are poorly standardized and inconsistently used in medical education research. Improved criteria for reporting are needed.

  10. ORF Alignment: NC_006512 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available 60 ... Query: 297 VSCHDYQAKDFVRVIAPDDSDFRNLVEIFQEAGSWKEFNSLTSEKGLVLDTDEVLNPYME 356 ... VSCHDYQAKDFVRVIAP...DDSDFRNLVEIFQEAGSWKEFNSLTSEKGLVLDTDEVLNPYME Sbjct: 121 VSCHDYQAKDFVRVIAPDDSDFRNLV...EIFQEAGSWKEFNSLTSEKGLVLDTDEVLNPYME 180 ... Query: 417 FSWTYPSKRRGQRIQLK 433 ... FSWTYPSKRRGQRIQLK Sbjct: 241 FSWTYPSKRRGQRIQLK 257

  11. ORF Alignment: NC_005362 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available EREEAF+ VASQLV Sbjct: 1 ... LPASLISNRYVSDLKPYIGKTMKLKITEIDPNKNRLILSHKDLVEEEREEAFDKVASQLV 60 ... Query: 257 XRHRIS...LSIKQTLPSPFE 274 ... RHRISLSIKQT PSPFE Sbjct: 121 DRHRISLSIKQTEPSPFE 138

  12. ORF Alignment: NC_004369 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available SGTPSSVDG 60 ... Query: 137 WEDEKLGHAGGPGNFPHFCNIRPNPGQMPTATIDEVKAHTGLLIDARDPDRYAGRRELLD 196 ... WEDEKLG...HAGGPGNFPHFCNIRPNPGQMPTATIDEVKAHTGLLIDARDPDRYAGRRELLD Sbjct: 121 WEDEKLGHAGGPGNFP...HFCNIRPNPGQMPTATIDEVKAHTGLLIDARDPDRYAGRRELLD 180 ... Query: 257 AMEHAGLPGAAHYVGGWSQWSANPKNPVER 286 ... AMEHAGLPGAAHYVGGWSQWSANPKNPVER Sbjct: 241 AMEHAGLPGAAHYVGGWSQWSANPKNPVER 270

  13. ORF Alignment: NC_003551 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available Query: 8 ... LPEEGEIVMATVERVEDHGAFVTLDEYPGVDGYIHISEVASGWVKNIRDYVKEGQKVVAK 67 ... LPEEGEIVMATVERVEDHGAF...VTLDEYPGVDGYIHISEVASGWVKNIRDYVKEGQKVVAK Sbjct: 1 ... LPEEGEIVMATVERVEDHGAFVTLDEYPGVDGYIHISEVASGWVKNIRDYVKEGQKV...itiation ... factor 2 alpha subunit (eIF-2-alpha) ... Length = 257 ...

  14. Application of alpha spectrometry to the discovery of new elements by heavy-ion-beam bombardment

    International Nuclear Information System (INIS)

    Nitschke, J.M.

    1983-05-01

    Starting with polonium in 1898, α-spectrometry has played a decisive role in the discovery of new, heavy elements. For even-even nuclei, α-spectra have proved simple to interpret and exhibit systematic trends that allow extrapolation to unknown isotopes. The early discovery of the natural α-decay series led to the very powerful method of genetically linking the decay of new elements to the well-established α-emission of daughter and granddaughter nuclei. This technique has been used for all recent discoveries of new elements including Z = 109. Up to mendelevium (Z = 101), thin samples suitable for α-spectrometry were prepared by chemical methods. With the advent of heavy-ion accelerators new sample preparation methods emerged. These were based on the large momentum transfer associated with heavy-ion reactions, which produced energetic target recoils that, when ejected from the target, could be thermalized in He gas. Subsequent electrical deposition or a He-jet technique yielded samples that were not only thin enough for α-spectroscopy, but also for α- and #betta#-recoil experiments. Many variations of these methods have been developed and are discussed. For the synthesis of element 106 an aerosol-based recoil transport technique was devised. In the most recent experiments, α-spectrometry has been coupled with the magnetic analysis of the recoils. The time from production to analysis of an isotope has thereby been reduced to 10 - 6 s; while it was 10 - 1 to 10 0 s for He-jets and 10 1 to 10 3 s for rapid chemical separations. Experiments are now in progress to synthesize super heavy elements (SHE) and to analyze them with these latest techniques. Again, α-spectrometry will play a major role since the expected signature for the decay of a SHE is a sequence of α-decays followed by spontaneous fission

  15. Browse Title Index

    African Journals Online (AJOL)

    Items 251 - 257 of 257 ... Vol 26, No 1 (2016), Visibility of University of Zululand and Moi University Researchers in Web of Science and Scopus from 2003 to 2013, Abstract. Dennis N. Ocholla, Janneke Mostert, Daniel C. Rotich. Vol 12, No 2 (2002), Website Design on Some Aspects of a Peoples Culture: The Binis of Edo State ...

  16. Special Advanced Studies for Pollution Prevention. Delivery Order 0058: The Monitor - Winter 2000

    Science.gov (United States)

    2001-04-01

    937) 257-3498 Lori Luburgh Phone: (937) 257-7352 1-3 Aug 2000 Navy P2 Conference The Ritz Carlton Pentagon City, Washington, DC http://206.5.146.100...E) Rate the ability of the facilities (i.e., paint booth, clean room , and tank farm) to prevent uncontrolled releases to the environment. This

  17. Medical Surveillance Monthly Report. Volume 18, Number 2, February 2011

    Science.gov (United States)

    2011-02-01

    475 584 Breast disorders (610-611) 104 452 556 80 348 428 24 104 128 Pregnancy and childbirth (630 - 679, relevant V codes) 61 257 318 61 257...detecting and clinically managing psychological and stress-related disorders (e.g., PTSD, depression , suicide ideation) among deployers. In summary

  18. Prostatic Duct Adenocarcinoma with Endometrioid Features: Report ...

    African Journals Online (AJOL)

    mn

    4, 2009. 257. 257-258. Case Report. Prostatic Duct Adenocarcinoma with Endometrioid. Features: Report of a Rare Case and Brief Review of the Literature ... 3. adenocarcinoma of the prostate: A distinctive tumor of probable prostatic duct origin. Cancer. 1976;. May;37(5):2255-62. Cohen RJ, Wheeler TM, Bonkhoff H, ...

  19. 75 FR 29766 - Government-Owned Inventions; Availability for Licensing

    Science.gov (United States)

    2010-05-27

    ... drugs against BHD, a disease which has no effective treatment options; tool for searching tumor markers... applications. UOK 257, the First BHD Tumor Cell Line, and UOK257-2 Wild Type FLCN- Restored Renal Cell Line as... and an increased risk for bilateral multifocal renal tumors. Loss of both copies of the FLCN gene has...

  20. OVA-specific CD8(+)T cells do not express granzyme B during anterior chamber associated immune deviation

    NARCIS (Netherlands)

    Ren, Y.; Yang, P.; Li, B.; Gao, Y.; Zhou, H.; Huang, X.; Zhu, L.; Kijlstra, A.

    2006-01-01

    To examine antigen (Ag)-specific CTL response during anterior chamber associated immune deviation (ACAID). Methods OVA or OVA257-264 peptide was injected into the anterior chamber (AC) of C57BL/6 mice. There were 16 mice in each ACAID group induced with OVA or OVA257-264 peptide. The mice were

  1. Radionuclides for nuclear medicine: a nuclear physicists' view

    Czech Academy of Sciences Publication Activity Database

    Cantone, M.; Haddad, F.; Harissopoulos, S.; Jensen, M.; Jokinen, A.; Koster, U.; Lebeda, Ondřej; Ponsard, B.; Ratzinger, U.; Stora, T.; Tarkanyi, F.; Van Duppen, P.

    2013-01-01

    Roč. 40, 2 Supplement (2013), S257-S257 ISSN 1619-7070. [Annual Congress of the European Association of Nuclear Medicine (EANM). 19.10.2013-23.10.2013, Lyon] Institutional support: RVO:61389005 Keywords : nuclear physics for medicine * EANM * medical radionuclides Subject RIV: BG - Nuclear, Atomic and Molecular Physics, Colliders

  2. Bulletin of Materials Science | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    Home; Journals; Bulletin of Materials Science; Volume 24; Issue 3. Issue front cover thumbnail. Volume 24, Issue 3. June 2001, pages 257-344. pp 257-264 Quasicrystals. Role of Fe substitution and quenching rate on the formation of various quasicrystalline and related phases · Varsha Khare R S Tiwari O N Srivastava.

  3. Sensemaking

    DEFF Research Database (Denmark)

    Schilhab, Theresa

    2012-01-01

    2012a Sensemaking. In D. Favareau, P. Cobley & K. Kull (Eds.) A More Developed Sign: Interpreting the work of Jesper Hoffmeyer.255-257. Tartu: Tartu University Press.......2012a Sensemaking. In D. Favareau, P. Cobley & K. Kull (Eds.) A More Developed Sign: Interpreting the work of Jesper Hoffmeyer.255-257. Tartu: Tartu University Press....

  4. Age and growth of Labeo gonius (Cyprinidae) in Kali river, Uttar Pradesh, India

    Digital Repository Service at National Institute of Oceanography (India)

    Chatterji, A.

    stream_size 4 stream_content_type text/plain stream_name Asian_Fish_Sci_5_257.pdf.txt stream_source_info Asian_Fish_Sci_5_257.pdf.txt Content-Encoding ISO-8859-1 Content-Type text/plain; charset=ISO-8859-1 ...

  5. Properties of Lactose Plasmid pLY101 in Lactobacillus casei

    OpenAIRE

    Shimizu-Kadota, Mariko

    1987-01-01

    A starter strain, Lactobacillus casei C257, was found to carry a lactose plasmid, pLY101. Restriction mapping showed that pLY101 DNA was 68.2 kilobases long. Since a non-lactose-utilizing variant of C257, MSK248, lost phospho-β-galactosidase (P-β-gal) activity and pLY101 DNA had a sequence(s) homologous to the streptococcal fragment including a P-β-gal gene, pLY101 is likely to encode a P-β-gal gene required for lactose metabolism in C257. MSK248 grew in galactose medium at a rate identical t...

  6. Table 1: Socio-demographic characteristics of respondents Variable ...

    African Journals Online (AJOL)

    Age at immunization. Frequency (n = 257). Percent. At birth. BCG. 124. 48.2. DPT1. 34. 13.2. OPV2. 12. 4.7. Don't know. 87. 33.9. Total. 257. 100. 6 week. DPT1. 120. 46.7. DPT2. 19. 7.4. HBV2. 1. 0.4. OPV2. 30. 11.7. Don't know. 87. 33.8. Total. 257. 100. 9 month. DPT2. 2. 0.8. Measles. 99. 38.5. Yellow fever. 69. 26.8.

  7. Život i djelo Dmitrija Ivanoviča Mendeljejeva - povodom 100. obljetnice smrti

    Directory of Open Access Journals (Sweden)

    Vaščić, V.

    2007-04-01

    Full Text Available The life and activities of D. I. Mendeleyev are presented primarily in view of his role in the progress of chemistry. Born in Tobolsk in 1834 to a numerous and poor family, burdened by the family's bad luck and his ill health, he graduated natural sciences in 1855 at St. Petersburg and was awarded a gold medal for exceptional success. In 1855/56 he was teacher at a secondary school in Odessa. He obtained his MSc degree in 1856 in St. Petersburg where he was appointed lecturer in 1857. He was guest scientist 1859-1861 at the University in Heidelberg where he investigated the behavior of gases under various pressures and temperatures and discovered the criticaltemperature of liquefaction. He achieved his PhD degree in 1865 in St. Petersburg with a thesis on ethanol/water mixtures. Therein he had proven the existence of alcohol hydrates. His work later enabled the elaboration of modern conceptions on solvate formation in solutions. In 1865 he was elected professor at the University in St. Petersburg where he worked until 1890 when he was forced to retire. Preparing his textbook "Fundamentals of Chemistry" in 1869, he discovered that properties of chemical elements depend periodically on atomic weights. This enabled the elaboration of a periodic system as the base for classification in chemistry, as well as for further research and development of chemical science and technology. The international scientific community accepted Mendeleyev's system with distrust and it was generally acknowledged not before three "prophecies" of Mendeleyev were realized by the discovery of gallium (1875, scandium (1879 and germanium (1886. Later, in verification of his predictions, other elements - including transuranics - were discovered. Hence, in honor of the creator of the periodic system, the element of atomic number 101 was named mendelevium (1955. Mendeleyev was reactivated in 1892 as director of the Central Bureau for Measures and Weights where he worked until

  8. Alternate Fuels Combustion Research

    Science.gov (United States)

    1983-10-01

    1000 200ooOZ HP Figure 2.5: Projected Trends in Pressure Ratios -19 - Uncmrtainty Band of Upper Lkmit 15W o:.". 0 o 120006 se 0 s 1000 00 oo 5 06* o...relations are:.’ Inefficiency -0.0173 (T10) - 2.912 for thrust level tests Inefficiency 0 . 0235 (T10) - 6.401 for power level tests 6.4 HYED3DCARMO1...0.0252 273 273 NO .n23j 0.0280 256 256 13 .0231 0.0247 257 257 14 . 0235 0.0236 257 256 8 .0228 0.0222 257 256 10 .0231 0.0211 254 255 NO .0231 0.0189 256

  9. Traženje zajedničkoga kulturnog identiteta na početku 20. Stoljeća: Josef Vajs I pokret za obnovu glagoljaškoga pjevanja u hrvatskoj I češkoj

    Czech Academy of Sciences Publication Activity Database

    Slavický, Tomáš

    2013-01-01

    Roč. 44, č. 2 (2013), s. 257-270 ISSN 0587-5455 Institutional support: RVO:68378076 Keywords : Josef Vajs * Glagolitic singing * Glagolitic liturgy Subject RIV: AL - Art, Architecture, Cultural Heritage

  10. Antiperspirants/Deodorants and Breast Cancer

    Science.gov (United States)

    ... measurements and mechanisms of toxicological actions on breast biology. Journal of Inorganic Biochemistry 2013; 128:257-261. [PubMed Abstract] Willhite CC, Karyakina NA, Yokel RA, et al. Systematic review of potential health risks posed by pharmaceutical, ...

  11. Formins: Linking Cytoskeleton and Endomembranes in Plant Cells

    Czech Academy of Sciences Publication Activity Database

    Cvrčková, F.; Oulehlová, Denisa; Žárský, Viktor

    2015-01-01

    Roč. 16, č. 1 (2015), s. 1-18 E-ISSN 1422-0067 Institutional support: RVO:61389030 Keywords : formin * actin * microtubules Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 3.257, year: 2015

  12. Resonance journal of science education

    Indian Academy of Sciences (India)

    IAS Admin

    Credit: Varsha Kulkarni, IISc). 257. Face to Face. The Challenge of. Thor. Anil Kakodkar talks to. SujataVaradarajan 277. Classroom. Optimization of the Anderson Bridge Experiment. P Arun, Kuldeep Kumar and Mamta. Chaos from Jerk Circuit.

  13. Within centre evaluation of hypercalcaemia discriminant

    DEFF Research Database (Denmark)

    Nielsen, Bo Friis; Conradsen, Knut

    1996-01-01

    Diagnostic hypercalcaemia discriminant functions, discriminating between clinically significant and non-significant hypercalcaemia, were tested 5 years after their development in order to evaluate the impact of time on their diagnostic capacity. Two populations, consisting of 257 and 129 patients...

  14. Disease: H01616 [KEGG MEDICUS

    Lifescience Database Archive (English)

    Full Text Available ... AUTHORS ... Kawai Y, Suenaga M, Watanabe H, Sobue G ... TITLE ... Cognitive impairment in spinocerebellar degeneration. ... JOURNAL ... Eur Neurol 61:257-68 (2009) DOI:10.1159/000206850 ...

  15. Radioactive waste management and advanced nuclear fuel cycle technologies

    International Nuclear Information System (INIS)

    2007-01-01

    In 2007 ENEA's Department of Nuclear Fusion and Fission, and Related Technologies acted according to national policy and the role assigned to ENEA FPN by Law 257/2003 regarding radioactive waste management and advanced nuclear fuel cycle technologies

  16. Occlusal tooth wear in patients of a dental school's prosthodontic department in Xi'an, China

    NARCIS (Netherlands)

    Meng, M.; Zhang, Q.; Witter, D.J.; Bronkhorst, E.M.; Creugers, N.H.J.; Ma, C.; Zhang, S.

    2014-01-01

    PURPOSE: To assess the relationships between occlusal tooth wear and occlusal conditions, chewing side preference, and occlusal guidance scheme. MATERIALS AND METHODS: A total of 257 Chinese adult dental school patients were categorized according to a hierarchical functional classification system.

  17. Insect hormones: more than 50-years after the discovery of insect juvenile hormobne analogues (JHA, juvenoids)

    Czech Academy of Sciences Publication Activity Database

    Sláma, Karel

    2013-01-01

    Roč. 6, č. 4 (2013), s. 257-333 ISSN 1874-9828 Institutional support: RVO:60077344 Keywords : juvenile hormone (JH) * activation neurohormone (AH) pseudojuvenile effects * terpenoid juvenoids Subject RIV: ED - Physiology

  18. Fuzzy Modelling and Simulation - The Evaluating Scales Problem

    Czech Academy of Sciences Publication Activity Database

    Vrba, Josef

    2001-01-01

    Roč. 41, - (2001), s. 257-288 ISSN 0232-9298 Institutional research plan: CEZ:AV0Z4072921 Keywords : fuzzy evaluating scale * membership asymmetry * fuzzy arithmetic Subject RIV: CI - Industrial Chemistry, Chemical Engineering

  19. Raman, Prof. Rajiva

    Indian Academy of Sciences (India)

    Date of birth: 9 December 1948. Specialization: Human Molecular Genetics & Cytogenetics, Gene Expression & Chromatin Organization in Development and Sex Determination Address: Professor Emeritus, Department of Zoology, Banaras Hindu University, Varanasi 221 005, U.P. Contact: Residence: (0542) 257 0967

  20. The Conference from the Prague Perspective

    Czech Academy of Sciences Publication Activity Database

    Hrubec, Marek

    2017-01-01

    Roč. 43, č. 3 (2017), s. 256-257 ISSN 0191-4537 Institutional support: RVO:67985955 Keywords : Critical Theory * Conference Philosophy and Social Science * Prague Subject RIV: AA - Philosophy ; Religion

  1. New Fellows and Honorary Fellow

    Indian Academy of Sciences (India)

    Date of birth: 14 October 1947. Specialization: Membrane Biology, Yeast Genetics & Molecular Biology and Medical Mycology Address: Director, Amity Institute of Biotechnology, Amity University, Amity Education Valley, Gurgaon 122 413, Haryana Contact: Office: (0124) 233 7015. Residence: (0124) 257 3443

  2. Isolating dividing neural and brain tumour cells for gene expression profiling

    Czech Academy of Sciences Publication Activity Database

    Endaya, B.; Cavanagh, B.; Alowaidi, F.; Walker, T.; de Pennington, N.; Ng, J.-M.; Lam, P.Y.P.; Mackay-Sim, A.; Neužil, Jiří; Meedeniya, A.C.B.

    2016-01-01

    Roč. 257, JAN 15 2016 (2016), s. 121-133 ISSN 0165-0270 Institutional support: RVO:86652036 Keywords : Cell division * Click chemistry * FACS Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 2.554, year: 2016

  3. AcEST: DK960686 [AcEST

    Lifescience Database Archive (English)

    Full Text Available NVISWNAMLAAYTYCGCNDGVLELFDQMLFQ 196 V TAL+ + +L +A VF+ ++V+SWNA++A C + V + +M + Sbjct: 192 VFMTALI----RSRKLAEALEVFEACRGKDVVSWNAVMAG...D S Sbjct: 199 RSRKLAEALEVFEACRGKDVVSWNAVMAGLVQFCCGEVPGF-WRRMCCEGVKPDNFAFSG 257 Q

  4. High Efficiency Large-Angle Pancharatnam Phase Deflector Based on Dual Twist Design

    Science.gov (United States)

    2016-12-16

    al.6, we choose the azo dye Brilliant Yellow (BY) as the alignment layer for the reactive mesogen (RM257). The RM257 layer thickness is chosen to...provide the desired half-wave retardation. Figure 2a shows a schematic of the polarization holography setup to expose the photo- alignment layer. The...To visualize the resulting interference pattern, a linear polarizer can be placed in front of a CCD camera with a 20x objective lens that is

  5. Knighthoods of christ: Essays on the history of the crusades and the knights Templar

    DEFF Research Database (Denmark)

    Fonnesberg-Schmidt, Iben

    2008-01-01

    Anmeldelse af Knighthoods of Christ: Essays on the History of the Crusades and the Knights Templar. Presented to Malcolm Barber, ed. Norman Housley (Aldershot: Ashgate, 2007; pp. xxiii + 257. £55). Udgivelsesdato: 2008......Anmeldelse af Knighthoods of Christ: Essays on the History of the Crusades and the Knights Templar. Presented to Malcolm Barber, ed. Norman Housley (Aldershot: Ashgate, 2007; pp. xxiii + 257. £55). Udgivelsesdato: 2008...

  6. BHD Tumor Cell Line and Renal Cell Carcinoma Line | NCI Technology Transfer Center | TTC

    Science.gov (United States)

    Scientists at the National Cancer Institute  have developed a novel renal cell carcinoma (RCC) cell line designated UOK257, which was derived from the surgical kidney tissue of a patient with hereditary Birt-Hogg-Dube''''(BHD) syndrome and companion cell line UOK257-2 in which FLCN expression has been restored by lentivirus infection. The NCI Urologic Oncology Branch seeks parties interested in licensing or collaborative research to co-develop, evaluate, or commercialize kidney cancer tumor cell lines.

  7. Isolamento de dermatófitos em animais domésticos em Vila Real, Portugal

    OpenAIRE

    Coelho,A.C.; Alegria,N.; Rodrigues,J.

    2008-01-01

    During a six-year period from 2000 to 2006, 257 animal samples (fur and skin desquamation) were submitted to mycological examination in the Laboratory of Microbiology at the Universidade de Trás-os-Montes e Alto Douro, Vila Real, Portugal. Dermathophytes were cultured from 38 of 257 (14.8%) specimens. Chi-squared test was used to compare differences between independent groups. The most frequent isolated dermathophyte was Microsporum canis (47.4%). Other isolated dermathophytes were: Trichophy...

  8. Dermathophytes isolated from domestic animals in Vila Real, Portugal

    OpenAIRE

    Coelho, A.C.; Alegria, N.; Rodrigues, J.

    2008-01-01

    During a six-year period from 2000 to 2006, 257 animal samples (fur and skin desquamation) were submitted to mycological examination in the Laboratory of Microbiology at the Universidade de Trás-os-Montes e Alto Douro, Vila Real, Portugal. Dermathophytes were cultured from 38 of 257 (14.8%) specimens. Chi-squared test was used to compare differences between independent groups. The most frequent isolated dermathophyte was Microsporum canis (47.4%). Other isolated dermathophytes were: Trichophy...

  9. Inhibition of Cell Growth and Shoot Development by a Specific Nucleotide Sequence in a Noncoding Viroid RNA

    Science.gov (United States)

    Qi, Yijun; Ding, Biao

    2003-01-01

    Viroids are small noncoding and infectious RNAs that replicate autonomously and move systemically throughout an infected plant. The RNAs of the family Pospiviroidae contain a central conserved region (CCR) that has long been thought to be involved in replication. Here, we report that the CCR of Potato spindle tuber viroid (PSTVd) also plays a role in pathogenicity. A U257A change in the CCR converted the intermediate strain PSTVdInt to a lethal strain that caused severe growth stunting and premature death of infected plants. PSTVd with nucleotide U257 changed to C or G did not cause such symptoms. The pathogenic effect of the U257A substitution was abolished by a C259U substitution in the same RNA. Analyses of the pathogenic effects of the U257A substitution in three other PSTVd variants established A257 as a new pathogenicity determinant that functions independently and synergistically with the classic pathogenicity domain. The U257A substitution did not alter PSTVd secondary structure, replication levels, or tissue tropism. The stunted growth of PSTVdIntU257A-infected tomato plants resulted from restricted cell expansion but not cell division or differentiation. This was correlated positively with the downregulated expression of an expansin gene, LeExp2. Our results demonstrate that specific nucleotides in a noncoding, pathogenic RNA have a profound effect in altering distinct cellular responses, which then lead to well-defined alterations in plant growth and developmental patterns. The feasibility of correlating viroid RNA sequence/structure with the altered expression of specific host genes, cellular processes, and developmental patterns makes viroid infection a valuable system in which to investigate host factors for symptom expression and perhaps also to characterize the mechanisms of RNA regulation of gene expression in plants. PMID:12782729

  10. TP53 gene polymorphism: Importance to cancer, ethnicity and birth ...

    Indian Academy of Sciences (India)

    class has 8 to 13 and E class, which is the lowest, has 0 to 7 points. The sedentary variables were defined on the 2004- .... 1 to 14 cigarettes. 833 (25.7). 204 (30.3). 119 (30.9). ≥15 cigarettes. 257 (7.9). 65 (9.7). 46 (12). Premature birth. <37 weeks. 144 (5.4). 26 (5.2) l13 (4.7). 0.874. ≥37 weeks. 2.523 (94.6). 471 (94.8).

  11. EFSA CEF Panel (Panel on Food Contac t Materials, Enzymes, Flavourings and Processing Aids , 2013. Scientific Opinion on Flavouring Group Evaluation 2 07 (FGE.2 07 )

    DEFF Research Database (Denmark)

    Beltoft, Vibe Meister; Binderup, Mona-Lise; Lund, Pia

    The Panel on Food Contact Materials, Enzymes, Flavourings and Processing Aids of the European Food Safety Authority was requested to evaluate the genotoxic potential of one flavouring substance, 2,6-dimethyl-2,5,7-octatriene-1-ol acetate [FL-no: 09.931], from subgroup 1.1.2 of FGE.19, which......-no: 09.034] and santalyl phenylacetate [FL-no: 09.712] from FGE.19 subgroup 2.1 for which 2,6-dimethyl-2,5,7-octatriene-1-ol acetate [FL-no: 09.931] is representative. © European Food Safety Authority, 2013...

  12. checkCIF/PLATON report Datablock: shelxl

    Indian Academy of Sciences (India)

    1. Hall group. -P 1. -P 1. Moiety formula C34 H40 Fe Mo2 O4 S ? Sum formula. C34 H40 Fe Mo2 O4 S. C34 H40 Fe Mo2 O4 S. Mr. 792.45. 792.45. Dx,g cm-3. 1.565. 1.565. Z. 4. 4. Mu (mm-1). 1.257. 1.257. F000. 1608.0. 1608.0. F000'. 1596.55.

  13. Pediatric Palliative Care: A Personal Story

    Medline Plus

    Full Text Available ... Little Stars 12,195 views 10:35 Childhood Cancer: Palliative Care - Duration: 3:29. American Cancer Society 4,257 views 3:29 The Ugly Truth of Pediatric Cancer - Duration: 5:21. KidsCancerChannel 62,434 views 5: ...

  14. Social Appraisal of Adult ADHD: Stigma and Influences of the Beholder's Big Five Personality Traits

    Science.gov (United States)

    Canu, Will H.; Newman, Matthew L.; Morrow, Tara L.; Pope, Daniel L. W.

    2008-01-01

    Objective: This study investigates social stigma associated with a diagnosis of ADHD in adulthood and whether Big Five personality traits predict appraisals of affected individuals. Method: A sample of 257 undergraduates rate the desirability of targets with ADHD, minor medical problems, and with no appreciable weakness, across several social…

  15. Levels of Satisfaction with Leisure Time in Foreign Students

    Science.gov (United States)

    Akdeniz, Hakan; Simsek, Sinem Didem; Kavi, Onur; Uzuner, Muhammet Eyup; Sekban, Gulsah

    2018-01-01

    The aim of this study was to investigate levels of satisfaction with leisure time in foreign students of Kocaeli University. In the collection of the data, the Leisure Satisfaction Scale (LSS) and demographic status questionnaire were used; 257 male and 103 female students participated. In the LSS scores for the separate domains, participants…

  16. Low-temperature time-resolved spectroscopic study of the major light-harvesting complex of Amphidinium carterae

    Czech Academy of Sciences Publication Activity Database

    Šlouf, V.; Fuciman, M.; Johanning, S.; Hofmann, E.; Frank, H.A.; Polívka, Tomáš

    2013-01-01

    Roč. 117, 1-3 (2013), s. 257-265 ISSN 0166-8595 R&D Projects: GA ČR(CZ) GAP205/11/1164 Institutional support: RVO:60077344 Keywords : Dinoflagellates * Energy transfer * Light- harvesting * Carotenoid Subject RIV: BO - Biophysics Impact factor: 3.185, year: 2013

  17. Susceptibility of some multiple resistant bacteria to garlic extract

    African Journals Online (AJOL)

    GREGO

    2007-03-19

    Mar 19, 2007 ... cold with headache, fever and sore throat. Garlic extracts are also known to be effective against Helicobacter pylori, the cause of gastric ..... Antimicrob. Agents 12: 257-262. Klein JO (1999). Management of acute otitis media in an era of increasing antibiotic resistance, Int. J. Pediatric Otorhinolaringology,.

  18. Preparation of Mn-Zn ferrite nanoparticles and their silica-coated clusters: magnetic properties and transverse relaxivity

    Czech Academy of Sciences Publication Activity Database

    Kaman, Ondřej; Kuličková, Jarmila; Herynek, Vít; Koktan, Jakub; Maryško, Miroslav; Dědourková, T.; Knížek, Karel; Jirák, Zdeněk

    2017-01-01

    Roč. 427, Apr (2017), s. 251-257 ISSN 0304-8853 Institutional support: RVO:68378271 ; RVO:68378041 Keywords : magnetic nanoparticles * Mn-Zn ferrite * hydrothermal synthesis * magnetic resonance imaging * transverse relaxivity Subject RIV: BM - Solid Matter Physics ; Magnetism OBOR OECD: Condensed matter physics (including formerly solid state physics, supercond.) Impact factor: 2.630, year: 2016

  19. Stipa ucrainica (Poaceae): a recently recognized native species of the Bulgarian flora

    Czech Academy of Sciences Publication Activity Database

    Apostolova, I.; Petrova, A. S.; Meshinev, T.; Danihelka, Jiří

    2008-01-01

    Roč. 14, č. 2 (2008), s. 257-262 ISSN 1310-7771 R&D Projects: GA MŠk(CZ) LC06073 Institutional research plan: CEZ:AV0Z60050516 Keywords : Bulgaria * feather grass * steppes Subject RIV: EF - Botanics

  20. Determination of total sulfur in agricultural samples by high-resolution continuum source flame molecular absorption spectrometry.

    Science.gov (United States)

    Virgilio, Alex; Raposo, Jorge L; Cardoso, Arnaldo A; Nóbrega, Joaquim A; Gomes Neto, José A

    2011-03-23

    The usefulness of molecular absorption was investigated for the determination of total sulfur (S) in agricultural samples by high-resolution continuum source flame molecular absorption spectrometry. The lines for CS at 257.595, 257.958, and 258.056 nm and for SH at 323.658, 324.064, and 327.990 nm were evaluated. Figures of merit, such as linear dynamic range, sensitivity, linear correlation, characteristic concentration, limit of detection, and precision, were established. For selected CS lines, wavelength-integrated absorbance equivalent to 3 pixels, analytical curves in the 100-2500 mg L(-1) (257.595 nm), 250-2000 mg L(-1) (257.958 nm), and 250-5000 mg L(-1) (258.056 nm) ranges with a linear correlation coefficient better than 0.9980 were obtained. Results were in agreement at a 95% confidence level (paired t test) with those obtained by gravimetry. Recoveries of S in fungicide and fertilizer samples were within the 84-109% range, and the relative standard deviation (n=12) was typically <5%.

  1. Why Did This Happen to Me? Cognitive Schema Disruption and Posttraumatic Stress Disorder in Victims of Sexual Trauma

    Science.gov (United States)

    Wright, Caroline Vaile; Collinsworth, Linda L.; Fitzgerald, Louise F.

    2010-01-01

    Many trauma researchers have proposed cognitive schemas as a heuristic device to understand the elusive process of integrating traumatic events. We examined the schemas of a sample (N = 257) of female participants classified by exposure to sexual trauma, nonsexual trauma, and no trauma experience. Cognitive schema was assessed with the Traumatic…

  2. Annual Report of the Inhalation Toxicology Research Institute 1991-1992

    Science.gov (United States)

    1992-12-01

    monkey exposure system. 60 During the experiment, the monkey’s mouth was taped closed to ensure nasal breathing. A specially made face mask with a... Osteogenesis . Clin. Orthop. Rel. Res. 269: 257-265, 1991. Bagi, C. M. and S. C. Miller: Dose-Related Effects of 1,25-Dihydroxyvitamin D3 on Growth

  3. CPAP Tips

    Medline Plus

    Full Text Available ... 2:02 Philips Respironics Dream Station CPAP Machine Review - Duration: 8:29. The CPAP Shop 257,130 ... TheLankyLefty27 175,878 views 9:40 CPAP Machine Review - Duration: 9:35. Ali Thompson 44,315 views ...

  4. Author Details

    African Journals Online (AJOL)

    Sheikh, TL. Vol 10, No 2 (2012) - Articles Anxiety and Depression Symptomatology in Migraine: Retrospective Review of 257 Cases from Kaduna, Northern Nigeria Abstract · Vol 12, No 2 (2014) - Articles Predictive Values of Electroencephalography (EEG) in Epilepsy Patients with Abnormal Behavioural Symptoms

  5. The pig as an experimental model for clinical craniofacial research

    Czech Academy of Sciences Publication Activity Database

    Štembírek, Jan; Kyllar, M.; Putnová, I.; Stehlík, L.; Buchtová, Marcela

    2012-01-01

    Roč. 46, č. 4 (2012), s. 269-279 ISSN 0023-6772 R&D Projects: GA ČR(CZ) GP304/08/P289 Institutional research plan: CEZ:AV0Z50450515 Keywords : platelet rich plasma * streptococcus suis serotype 2 * implant surface coatings Subject RIV: EG - Zoology Impact factor: 1.257, year: 2012

  6. Guild composition and seasonal distribution of insects on Protea ...

    African Journals Online (AJOL)

    1990-06-12

    Jun 12, 1990 ... with special reference to insect-plant interactions. Ph.D. thesis, University of Stellenbosch, Stellenbosch. 117 pp. DONNELLY, D. & GILIOMEE, J.H. 1985. Community structure of epigaeic ants (Hymenoptera: Formicidae) in fynbos. 249 vegetation in the Jonkershoek Valley. J. eN. Soc. sth. Afr. 48: 247-257.

  7. Vertical migration of 85Sr, 137Cs and 131I in various arable and undisturbed soils

    Czech Academy of Sciences Publication Activity Database

    Palágyi, Š.; Palágyiová, Jana

    2003-01-01

    Roč. 257, č. 2 (2003), s. 353-359 ISSN 0236-5731 Institutional research plan: CEZ:AV0Z1048901 Keywords : radionuclides migration * model s of migration * soil profiles Subject RIV: DL - Nuclear Waste, Radioactive Pollution ; Quality Impact factor: 0.472, year: 2003

  8. Energy transfer processes in Ca.sub.3./sub.Tb.sub.2-x./sub.Eu.sub.x./sub.Si.sub.3./sub.O.sub.12./sub. (x = 0–2)

    Czech Academy of Sciences Publication Activity Database

    Carrasco, I.; Bartosiewicz, Karol; Nikl, Martin; Piccinelli, F.; Bettinelli, M.

    2015-01-01

    Roč. 48, Oct (2015), s. 252-257 ISSN 0925-3467 EU Projects: European Commission(XE) 316906 - LUMINET Institutional support: RVO:68378271 Keywords : phosphors * silico-carnotite * luminescence * energy transfer Subject RIV: BH - Optics, Masers, Lasers Impact factor: 2.183, year: 2015

  9. Germination, growth and physiological responses of Senegalia ...

    African Journals Online (AJOL)

    For plants growth and physiological responses, seedlings were individually cultivated in plastic bags (25×12 cm) containing non-sterile soil and watered with four salt solutions (0, 86, 171 and 257 mM NaCl). Four months after the plants' cultivation, the results showed that for all species, the salinity reduced significantly the ...

  10. Childhood body mass index and height in relation to site-specific risks of colorectal cancers in adult life

    DEFF Research Database (Denmark)

    Jensen, Britt W; Gamborg, Michael; Gögenur, Ismail

    2017-01-01

    As colorectal cancers have a long latency period, their origins may lie early in life. Therefore childhood body mass index (BMI; kg/m(2)) and height may be associated with adult colorectal cancer. Using a cohort design, 257,623 children from The Copenhagen School Health Records Register born from...

  11. A variational method for multiphase volume-preserving interface motions

    Czech Academy of Sciences Publication Activity Database

    Švadlenka, Karel; Ginder, E.; Omata, S.

    2014-01-01

    Roč. 257, Feb (2014), s. 157-179 ISSN 0377-0427 Institutional support: RVO:67985840 Keywords : mean curvature flow * volume preservation * multiphase Subject RIV: BA - General Mathematics Impact factor: 1.266, year: 2014 http://www.sciencedirect.com/science/article/pii/S0377042713004391

  12. Cast Coil Transformer Fire Susceptibility and Reliability Study

    Science.gov (United States)

    1991-04-01

    Transformers," 29th Annual Petroleum and Chemical Industry Conference, St. Louis, Missouri, IEEE Paper, #PCI-82-F, 275-60, August 30-September 1, 1982, pp. 257...375 150 560 For comparison only I Acetic acid (vinegar) 10 25 15 37 Acetylsalicylic acid ( aspirin ) - 5 - - Ammiio [" 25 18 35 27 Perctloroothylono 5

  13. 75 FR 1685 - HOPE for Homeowners Program; Statutory Transfer of Program Authority to HUD and Conforming...

    Science.gov (United States)

    2010-01-12

    ... advisory responsibilities. 2. Inheritance exception to present ownership interest requirement (Sec. 257.104... on behalf of the mortgagee for real estate taxes, premiums for required hazard and mortgage insurance... property acquired by the mortgagor through inheritance. (c) Meet such other requirements as HUD may adopt...

  14. PATTERNS OF SEVEN AND COMPLICATED MALARIA IN CHILDREN

    African Journals Online (AJOL)

    GB

    2017-03-01

    Mar 1, 2017 ... 86 years old. Twenty-five surveys (45.7% of respondents) were 12-50 years, 19 studies (26.8% of respondents) were 12-70 years and 7 surveys. (25.7% of respondents) were 12-86 years ... performance of screening procedures. The levels ..... suggest fear of mastectomy and other hospital related factors as ...

  15. I psychologové mají svou olympiádu. Úspěch české psychologie na mezinárodním fóru

    Czech Academy of Sciences Publication Activity Database

    Klicperová-Baker, Martina

    (2016) ISSN 2336-257X R&D Projects: GA MŠk LG15038 Institutional support: RVO:68081740 Keywords : psychologists * Czech psychology * international forum Subject RIV: AN - Psychology http://veda-a-technika.eurozpravy.cz/veda/165538-i-psychologove-maji-svou-olympiadu-uspech-ceske-psychologie-na-mezinarodnim-foru/

  16. Simulation of Seed Digestion by Birds: How Does It Reflect the Real Passage Through a Pigeon's Gut?

    Czech Academy of Sciences Publication Activity Database

    Vazačová, Kristýna; Münzbergová, Zuzana

    2013-01-01

    Roč. 48, č. 2 (2013), s. 257-269 ISSN 1211-9520 R&D Projects: GA ČR GAP505/10/0593 Institutional support: RVO:67985939 Keywords : Canary Islands * endozoochory * scarification Subject RIV: EF - Botanics Impact factor: 1.612, year: 2013

  17. The financial feasibility of producing fish and vegetables through aquaponics

    NARCIS (Netherlands)

    Bosma, Roel H.; Lacambra, Lysette; Landstra, Ynze; Perini, Chiara; Poulie, Joline; Schwaner, Marie J.; Yin, Yi

    2017-01-01

    Aquaponics, producing fish and vegetables in a closed-loop water system, reduces fertilizer use and water discharge, and is therefore promoted as a sustainable venture. A recent global study found that the majority of 257 surveyed aquaponics farms made losses, but the reasons have been poorly

  18. 160-IJBCS-Article-Dr Bulus Adzu

    African Journals Online (AJOL)

    RHUMSIKI

    The in vitro and in vivo antimalarial activity of Cardiospermum halicacabum L. and Momordica foelida. Schumch. Et Thonn. J. Ethnopharmacol.,. 99: 137-143. Zamora-Martinez MC, Pola CNP. 1992. Medicinal plants used in some rural populations of Oaxaca, Puebla and. Veracruz, Mexico. J. Ethnopharmacol.,. 35: 229–257.

  19. On phase-space representations of quantum mechanics using ...

    Indian Academy of Sciences (India)

    Academia Colombiana de Ciencias Exactas, Físicas y Naturales, ACCEFYN, Bogotá, Colombia. E-mail: dcamposr@cable.net.co; dcr257@gmail.com. MS received 21 September 2015; accepted 20 October 2015; published online 16 July 2016. Abstract. A phase-space formulation of quantum mechanics is proposed by ...

  20. Improvement in tensile properties of PVC–montmorillonite ...

    Indian Academy of Sciences (India)

    Figueras F et al 1990 Clays Clay Miner. 38 257. Gacitua William, Ballerini A and Zhang J 2005 Maderas. Ciencia y tecnologia 7 159. Gong Fl, Feng M, C Zhao, Zhang S and Yang M 2004 Polym. Degrad. Stabil. 84 289. Hussain Farzana, Hojjati Mehdi, Okamoto Masami and Gorga. Russell E 2006 J. Compos. Mater. 40 1511.

  1. How Does Disaggregating a Pooled Inventory Affect a Marine Aircraft Group?

    Science.gov (United States)

    2014-12-01

    the relative impact on readiness of each root cause and possible solutions to increase readiness. We also recommend further research into the...service levels of two- location inventory systems. IIE Transactions, 21(3), 250–257. doi:10.1080/07408178908966229 49 INITIAL DISTRIBUTION LIST 1

  2. AcEST: BP917308 [AcEST

    Lifescience Database Archive (English)

    Full Text Available NCH Xyloglucan endotransglycosylase OS=Annona... 48 2e-04 tr|Q38696|Q38696_ACTDE Xyloglucan endotransglycosy...EC 257 >tr|B8XXI4|B8XXI4_ANNCH Xyloglucan endotransglycosylase OS=Annona cherimol

  3. 75 FR 39940 - Notice of Debarment; Schools and Libraries Universal Service Support Mechanism

    Science.gov (United States)

    2010-07-13

    ... business hours at the FCC Reference Information Center, Portal II, 445 12th Street, SW., Room CY-A257... regular business hours at the contractor, Best Copy and Printing, Inc., Portal II, 445 12th Street, SW... civil judgment for attempt or commission of criminal fraud, theft, embezzlement, forgery, bribery...

  4. JUNE NJCP 2009 FINAL sp.cdr

    African Journals Online (AJOL)

    User

    peritonea dialysis. Atherosclerosis. 1987;65”257-264. Role of free radical in pathogenesis of diabetes nephropathy. Ann. Afri. Med 2004;3”55-62. Gyslipideamia,. Lipid oxidation and free radicals in diabetic nephropathy: an overview. Highland Med Res. J. 2004;2:1-7. 10. Attman P-O,Alaupovic P. 11. Parra HJ, Mezdone H, ...

  5. Caesarean section at Usmanu Danfodiyo University Teaching ...

    African Journals Online (AJOL)

    Results: A total of 4,115 deliveries were recorded during the study period and 435 of them (10.6%) were through caesarean section (CS). Emergency CS accounted for 65.1% of caesarean deliveries.The mean age was 28±6 years. Previous CS was the commonest indication for caesarean section (25.7%). Elective CS had ...

  6. Effect of prolonged exposure to sublethal concentrations of DDT and DDE on protein expression in human pancreatic beta cells

    Czech Academy of Sciences Publication Activity Database

    Pavlíková, N.; Smetana, P.; Halada, Petr; Kovář, J.

    2015-01-01

    Roč. 142, OCT 2015 (2015), s. 257-263 ISSN 0013-9351 Grant - others:OPPK(CZ) CZ.2.16/3.1.00/24023 Source of funding: O - operačné programy Keywords : Diabetes * DDT/E * Alpha-enolase Subject RIV: CE - Biochemistry Impact factor: 3.088, year: 2015

  7. Download this PDF file

    African Journals Online (AJOL)

    improved IITA genotypes (TMS 30001, TMS. 91934, TMS 4(2) 1425, TMS 30572, TMS. 50395, TMS30555); four landraces commonly ..... A simulation model of the growth of the cassava crop and its use to estimate cassava productivity in northern Australia. Agricultural Systems 23:237-257. Fukai S, Alcoy AB, Liamelo A B, ...

  8. Effect of nifedipine, imipramine and sertraline on the antidepressant ...

    African Journals Online (AJOL)

    DR ORIAFOH

    2012-06-28

    Jun 28, 2012 ... Ann. Nuclear Med. 11(3): 213-218. Kozisek ME, Middlemas D, Bylund DB (2008). The differential regulation of BDNF and TrkB levels in juvenile rats after four days of escitalopram and desipramine treatment. Neuropharmacol. 54(2):. 251-257. Kreydiyyeh SI (2000). Cyclic AMP and furosemide stimulate the ...

  9. Efficacy of combined traditional Chinese medicine spray with ...

    African Journals Online (AJOL)

    2017-09-03

    Sep 3, 2017 ... Choi HK, Jung GW, Moon KH, Xin ZC, Choi YD,. Lee WH, Rha KH, Choi YJ, Kim DK. Clinical study of. SS-cream in patients with lifelong premature ejaculation. Urology 2000; 55(2): 257-261. 32. Busato W, Galindo CC. Topical anaesthetic use for treating premature ejaculation: a double-blind, random-.

  10. Two-year oscillation cycle in abundance of soybean aphid in Indiana

    Czech Academy of Sciences Publication Activity Database

    Rhainds, M.; Yoo, H. J. S.; Kindlmann, Pavel; Voegtlin, D.; Castillo, D.; Rutledge, C.; Sadof, C.; Yaninek, S.; O'Neil, R. J.

    2010-01-01

    Roč. 12, č. 3 (2010), s. 251-257 ISSN 1461-9555 Institutional research plan: CEZ:AV0Z60870520 Keywords : Aphididae * Aphis glycines * autumn migration * Hemiptera * heteroecy * Rhamnus * seesaw effect * soybean aphid Subject RIV: EH - Ecology, Behaviour Impact factor: 1.484, year: 2010

  11. Thermal stability of alumina thin films containing γ-Al.sub.2./sub.O.sub.3./sub. phase prepared by reactive magnetron sputtering

    Czech Academy of Sciences Publication Activity Database

    Musil, Jindřich; Blažek, J.; Zeman, P.; Prokšová, Š.; Šašek, M.; Čerstvý, R.

    2010-01-01

    Roč. 257, č. 3 (2010), s. 1058-1062 ISSN 0169-4332 Institutional research plan: CEZ:AV0Z10100520 Keywords : Al 2 O 3 (alumina) * annealing * thermal stability * nanocrystalline material * sputtering Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 1.795, year: 2010

  12. Browse Title Index

    African Journals Online (AJOL)

    Items 1 - 50 of 257 ... Vol 42, No 2 (2014), A comparative analysis of two land reform models: The Mashishimale Farm Management Model and the Nkumbuleni Strategic ... Vol 43, No 2 (2015), Adapted SERVQUAL for evaluating the provision of information as an agricultural extension service in South Africa, Abstract PDF.

  13. Cutaneous Leishmaniasis

    Science.gov (United States)

    2011-06-01

    intracellular amastigotes are usually abundant. Diagnosis The different parasitologic techniques for confirming Leishmania infection are variously...effective, depending on whether the syndrome under examination is oligoparasitic or polyparasitic. A confirmed parasitologic diagnosis is es- tablished by...1990;43:257-259. 23. Grimaldi G Jr, Tesh RB. Leishmaniases of the New World: current concepts and implications for future research . Clin Microbiol Rev

  14. On the Eulerian formulation of a stress induced platelet activation function

    Czech Academy of Sciences Publication Activity Database

    Bodnár, Tomáš

    2014-01-01

    Roč. 257, November (2014), s. 91-95 ISSN 0025-5564 Institutional support: RVO:61388998 Keywords : blood flow * platelet * stress * activation Subject RIV: BK - Fluid Dynamics Impact factor: 1.303, year: 2014 http://www.sciencedirect.com/science/article/pii/S0025556414001163

  15. Author Impact Metrics in Communication Sciences and Disorder Research

    Science.gov (United States)

    Stuart, Andrew; Faucette, Sarah P.; Thomas, William Joseph

    2017-01-01

    Purpose: The purpose was to examine author-level impact metrics for faculty in the communication sciences and disorder research field across a variety of databases. Method: Author-level impact metrics were collected for faculty from 257 accredited universities in the United States and Canada. Three databases (i.e., Google Scholar, ResearchGate,…

  16. Hand hygiene amongst dental professionals in a tertiary dental clinic ...

    African Journals Online (AJOL)

    Results: One-quarter (25.7%) of the respondents washes their hands before wearing gloves and 98.1% wash their hands when they are visibly soiled. Less than half (46.7%) washed their hand when the worn gloves are torn. Majority strongly agreed that hand washing helps to prevent transmission of infection to patients ...

  17. Occurrence of microsporidia and other pathogens in associated living spruce bark beetles (Coleoptera:Scolytidae) in an Austrian forest

    Czech Academy of Sciences Publication Activity Database

    Haidler, B.; Wegensteiner, R.; Weiser, Jaroslav

    2003-01-01

    Roč. 26, č. 1 (2003), s. 257-260 ISSN 1027-3115. [European Meeting "Entomopathogens and Insect Parasitic Nematodes /8./. Atheny, 29.05.2001-02.06.2001] Institutional research plan: CEZ:AV0Z5007907 Keywords : spruce bark beetles * Scolitidae Subject RIV: GF - Plant Pathology, Vermin, Weed, Plant Protection

  18. Bahari A see Riazian M 319 Bastani Mehdi A highly accurate ...

    Indian Academy of Sciences (India)

    AUTHOR INDEX. Abdi A see Talebian M. 803. Adhav K S see Katore S D. 101. Ahn Choon Ki. Robust chaos synchronization based on ada- ptive fuzzy delayed feedback H∞ control. 361. Aldaavati Mojtaba Mostajab see Tabbakh Farshid. 257. Akarsu Mustafa see Aydogu Senem. 147. Amirhashchi Hassan.

  19. On the extrema of Dirichlet's first eigenvalue of a family of punctured ...

    Indian Academy of Sciences (India)

    Home; Journals; Proceedings – Mathematical Sciences; Volume 122; Issue 2. On the Extrema of Dirichlet's First Eigenvalue of a Family of Punctured Regular Polygons in Two Dimensional Space Forms. A R Aithal Rajesh Raut. Volume 122 Issue 2 May 2012 pp 257-281 ...

  20. Disorder-induced broadening of transverse acoustic phonons in SixGe1-x mixed crystals

    Czech Academy of Sciences Publication Activity Database

    Beraud, A.; Kulda, Jiří; Yonenaga, I.; Foret, M.; Salce, B.; Courtens, E.

    2004-01-01

    Roč. 350, č. 1 (2004), s. 254-257 ISSN 0921-4526 R&D Projects: GA AV ČR KSK1010104 Keywords : disordered crystals * acoustic branches Subject RIV: BG - Nuclear, Atomic and Molecular Physics, Colliders Impact factor: 0.679, year: 2004

  1. Nutritional status, lifestyle and knowledge of predisposing factors on ...

    African Journals Online (AJOL)

    The growing trend of hyperlipidemia in most developing countries has resulted largely from changes in lifestyle, diet and lack of adequate exercise which have led to ... About 39.8% of respondents were within the age bracket (29-39 years), 25.7% had family history of diabetes mellitus, 25.2% hypertension and 11.7% had ...

  2. Crystal structure of the 14-3-3zeta:serotonin N-acetyltransferase complex. A role for scaffolding in enzyme regulation

    Czech Academy of Sciences Publication Activity Database

    Obšil, Tomáš; Ghirlando, R.; Klein, D. C.; Ganguly, S.; Dyda, F.

    2001-01-01

    Roč. 105, č. 2 (2001), s. 257-267 ISSN 0092-8674 Institutional research plan: CEZ:AV0Z5011922 Keywords : 14-3-3 * AANAT * crystal structure Subject RIV: BO - Biophysics Impact factor: 29.210, year: 2001

  3. Effects of melatonin on ischemia and reperfusion injury of the rat heart

    Czech Academy of Sciences Publication Activity Database

    Szárszoi, Ondrej; Asemu, Girma; Vaněček, Jiří; Ošťádal, Bohuslav; Kolář, František

    2001-01-01

    Roč. 15, č. 3 (2001), s. 251-257 ISSN 0920-3206 R&D Projects: GA ČR GA306/98/0470; GA MŠk LN00A069 Institutional research plan: CEZ:AV0Z5011922 Keywords : melatonin * heart * ischemia Subject RIV: ED - Physiology Impact factor: 1.009, year: 2001

  4. Genetic differential susceptibility in literacy-delayed children: A randomized controlled trial on emergent literacy in kindergarten

    NARCIS (Netherlands)

    Plak, Rachel D.; Kegel, Cornelia A. T.; Bus, Adriana G

    In this randomized controlled trial, 508 5-year-old kindergarten children participated, of whom 257 were delayed in literacy skills because they belonged to the lowest quartile of a national standard literacy test. We tested the hypothesis that some children are more susceptible to school-entry

  5. The January 2007 windstorm and its impact on microseisms observed in the Czech Republic

    Czech Academy of Sciences Publication Activity Database

    Holub, Karel; Rušajová, Jana; Sandev, M.

    2008-01-01

    Roč. 17, č. 1 (2008), s. 47-53 ISSN 0941-2948 Institutional research plan: CEZ:AV0Z30860518 Keywords : secondary microseisms * microseismic storm * windstorm Kyrill Subject RIV: DC - Siesmology, Volcanology, Earth Structure Impact factor: 1.257, year: 2008

  6. Effects of nutrient and water level changes on the composition and size structure of zooplankton communities in shallow lakes under different climatic conditions: a pan-European mesocosm experiment

    Czech Academy of Sciences Publication Activity Database

    Tavşanoglu, Ü.N.; Šorf, Michal; Stefanidis, K.; Brucet, S.; Turkan, S.; Agasild, H.; Baho, D.L.; Scharfenberger, U.; Hejzlar, Josef; Papastergiadou, E.; Adrian, R.; Angeler, D.G.; Zingel, P.; Çakiroglu, A.I.; Ozen, A.; Drakare, S.; Sondergaard, M.; Jeppesen, E.; Beklioglu, M.

    2017-01-01

    Roč. 51, č. 2 (2017), s. 257-273 ISSN 1386-2588 EU Projects: European Commission(XE) 244121 - REFRESH Institutional support: RVO:60077344 Keywords : climate change * water level change * zooplankton * size structure * mesocosms Subject RIV: EH - Ecology, Behaviour OBOR OECD: Ecology Impact factor: 1.500, year: 2016

  7. 24 CFR 4001.102 - Cross-reference.

    Science.gov (United States)

    2010-04-01

    ... section 203 of the National Housing Act (12 U.S.C. 1709) apply to mortgages on one-family dwellings to be insured under section 257 of the National Housing Act (12 U.S.C. 1701z-22), except the following... contract regarding use of dwelling for transient or hotel purposes; 203.17(d) Maturity; 203.18 Maximum...

  8. Kreslení strukturních vzorců

    Czech Academy of Sciences Publication Activity Database

    Řápková, R.; Holý, P.; Vyskočil, V.; Podešva, Jiří; Drašar, P.

    2018-01-01

    Roč. 112, č. 4 (2018), s. 257-261 ISSN 0009-2770 Institutional support: RVO:61389013 Keywords : chemical structures * recommendations, graphical Subject RIV: CD - Macromolecular Chemistry OBOR OECD: Polymer science Impact factor: 0.387, year: 2016 http://www.chemicke-listy.cz/ojs3/index.php/chemicke-listy/article/view/3071

  9. Evaluation of Games in Games and Physical Activity Course Curriculum in Terms of Common Basic Skills

    Science.gov (United States)

    Inan, Mehmet; Ozden, Bülent; Dervent, Fatih; Küçüktepe, Coskun

    2016-01-01

    The purpose of this study was to provide an overview of the games in the "I am Playing Games" (IPG) compilation booklet that was used in the Games and Physical Activity (GPA) curriculum. 257 games in IPG compilation booklet were coded whether they had elements that would enable development of common basic skills or not. Common basic…

  10. Differences in Students' School Motivation: A Latent Class Modelling Approach

    Science.gov (United States)

    Korpershoek, Hanke; Kuyper, Hans; van der Werf, Greetje

    2015-01-01

    In this study, we investigated the school motivation of 7,257 9th grade students in 80 secondary schools across the Netherlands. Using a multiple goal perspective, four motivation dimensions were included: performance, mastery, extrinsic, and social motivation. Our first aim was to identify distinct motivation profiles within our sample, using the…

  11. Un simulateur de convertisseur d'électronique de puissance ...

    African Journals Online (AJOL)

    MM

    S. A. Zulkifli “Investigation on various Voltage Controllers for 3 phase rectifier using Arduino as a Low Cost. Microcontroller”, Trans Tech Publications, Switzerland, Applied Mechanics and Materials, Vol. 793, 2015, PP. 257-261. [15]. M. H. Rashid, H. M. Rashid, Spice for Power Electronics and Electric Power 2nd Edition, ...

  12. Relativistic Beaming and Orientation Effects in BL Lacertae Objects ...

    Indian Academy of Sciences (India)

    Stickel, M., Padovani, P., Urry, C. M., Fried, H. 1991, Astrophys. J., 374, 431. Stocke, J. T., Liebert, J., Schmidt, G. et al. 1985, Astrophys. J., 298, 619. Stocke, J. T., Morris, S. L., Giola, I. M. et al. 1991, Astrophys. J. Suppl., 76, 813. Ubachukwu, A. A. 1998, Astrophys. Space Sci., 257, 23. Ubachukwu, A. A. 2002, Astrophys.

  13. Apoteóza Sokola, armády a nového člověka: rané recepce Janáčkovy Sinfonietty

    Czech Academy of Sciences Publication Activity Database

    Zapletal, Miloš

    2016-01-01

    Roč. 53, 2/3 (2016), s. 257-287 ISSN 0018-7003 Institutional support: RVO:68378076 Keywords : Leoš Janáček * Sinfonietta * reception of music * Janáček reception * reception studies Subject RIV: AL - Art, Architecture, Cultural Heritage

  14. Integrated, Distributed Fault Management for Communication Networks

    Science.gov (United States)

    1998-04-26

    er- ences", Machine Learning, vol. 3, pp. 9-44, 1988 [33] G. Tesauro , \\Practical Issues in Temporal Di erence Learning", Ma- chine Learning, vol. 8, pp...257-277, 1992 [34] G. Tesauro , \\Temporal Di erence Learning and TD-Gammon", Com- munications of the ACM, vol. 38, no. 3, pp. 58-68, 1995 [35] S

  15. Learning Long-Range Vision for an Offroad Robot

    Science.gov (United States)

    2008-09-01

    Tesauro , 1992), since randomly-initialized narrow networks are quickly trapped in local minima. Recent research has suggested a new paradigm for training... Tesauro , G. (1992). Practical issues in temporal difference learning. Machine Learning, 8:257– 277. Thompson, B., Marks, R., and Choi, J. (2002

  16. Effect of different treatments of copper surface on its total hemispherical absorptivity bellow 77 K

    Czech Academy of Sciences Publication Activity Database

    Musilová, Věra; Králík, Tomáš; Hanzelka, Pavel; Srnka, Aleš

    2007-01-01

    Roč. 47, č. 4 (2007), s. 257-261 ISSN 0011-2275 R&D Projects: GA AV ČR IBS2065109 Institutional research plan: CEZ:AV0Z20650511 Keywords : metals * structural materials * heat transfer * radiant properties * cryostats Subject RIV: JA - Electronics ; Optoelectronics, Electrical Engineering Impact factor: 0.981, year: 2007

  17. Differences in pathogenicity among strains of the same or different avian leukosis virus subgroups

    Czech Academy of Sciences Publication Activity Database

    Průková, Dana; Vernerová, Z.; Pilčík, Tomáš; Stepanets, Volodymyr; Indrová, Marie; Geryk, Josef; Plachý, Jiří; Hejnar, Jiří; Svoboda, Jan

    2007-01-01

    Roč. 36, č. 1 (2007), s. 15-27 ISSN 0307-9457 R&D Projects: GA ČR GA523/04/0489 Institutional research plan: CEZ:AV0Z50520514 Keywords : chi cken * wasting disease * ALV Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 1.257, year: 2007

  18. Sanjay Kumar, Prof.

    Indian Academy of Sciences (India)

    Sanjay Kumar, Prof. Ph.D. (Banaras). Date of birth: 1 January 1965. Specialization: Condensed Matter Theory, Biological Physics, Statistical Physics Address: Department of Physics, Banaras Hindu University, Varanasi 221 005, U.P.. Contact: Office: (0542) 670 1552. Residence: (0542) 257 5896. Mobile: 94515 85427

  19. Effects Of Socio-Economic Characteristics Of Farmers On Savings ...

    African Journals Online (AJOL)

    24.5% attended post secondary education, 25.7% have family size of 7-9 people, 78.9% indicated farming as their main occupation, 35.8% also indicated farming as their secondary occupation with 49.5% giving reasons as some of farm income, 26.1% have farming experience over 25 years, 53% have annual income of ...

  20. Vocalisations of the silvery mole-rat: comparasion of vocal repertoires in subterrane an rodents with different socials systems

    Czech Academy of Sciences Publication Activity Database

    Knotková, E.; Veitl, S.; Šumbera, R.; Sedláček, František; Burda, H.

    2009-01-01

    Roč. 18, č. 3 (2009), s. 241-257 ISSN 0952-4622 Institutional research plan: CEZ:AV0Z60870520 Keywords : silvery mole-rat * bathyergidae * vocal communication Subject RIV: EG - Zoology Impact factor: 1.050, year: 2009

  1. John, Prof. Pucadyil Ittoop

    Indian Academy of Sciences (India)

    Date of birth: 18 March 1941. Specialization: Plasma Physics, Intense Particle Beams and Industrial Applications of Plasma Address: 7C, Skyline Hillview, Kanjikuzhy, Kottayam 686 004, Kerala Contact: Residence: (0481) 257 0431. Mobile: 85890 72431. Email: john.pucadyil@gmail.com. YouTube; Twitter; Facebook; Blog ...

  2. Solvent extraction of strontium into nitrobenzene using hydrogen dicarbollylcobaltate in the presence of 12-crown-4

    Czech Academy of Sciences Publication Activity Database

    Vaňura, P.; Makrlík, E.; Vobecký, Miloslav

    2003-01-01

    Roč. 257, č. 2 (2003), s. 437-440 ISSN 0236-5731 R&D Projects: GA MŠk LN00B084 Institutional research plan: CEZ:AV0Z4031919; CEZ:MSM 230000009 Keywords : strontium * extraction Subject RIV: CB - Analytical Chemistry, Separation Impact factor: 0.472, year: 2003

  3. Development of Real-Time Reverse Transcriptase PCR Assays for the Detection of Punta Toro Virus and Pichinde Virus

    Science.gov (United States)

    2016-09-09

    tested against a panel of 153 extracted viral nucleic acid samples. West Nile virus (UCC# Flavi022) and dengue virus 154 serotypes 1-4 (UCC# Flavi029...256 phlebotomus fever virus (Sicilian type). Am J Trop Med Hyg 25, 456-462. 257 Birmingham, K., Kenyon, G., 2001. Lassa fever is unheralded problem in

  4. Isoflurane as a solvent for electrochemistry. Electrooxidation study of icosahedral carborane anions in four different solvents

    Czech Academy of Sciences Publication Activity Database

    Wahab, Abdul; Kvapilová, Hana; Klíma, Jiří; Michl, Josef; Ludvík, Jiří

    2013-01-01

    Roč. 689, JAN 2013 (2013), s. 257-261 ISSN 1572-6657 R&D Projects: GA MŠk ME09002; GA ČR GC203/09/J058 Institutional support: RVO:61388955 ; RVO:61388963 Keywords : isoflurane * relative permitivity * icosahedral carborane anions Subject RIV: CG - Electrochemistry Impact factor: 2.871, year: 2013

  5. Naval Air Systems Command-Naval Research Laboratory Workshop on Basic Research Needs for Synthetic Hydrocarbon Jet Aircraft Fuels Held at Naval Research Laboratory, Washington, DC on June 15 and 16, 1978

    Science.gov (United States)

    1978-01-01

    257 mixtures of the synfuels in JP-5 were as favorable for microbial growth as JP-5 alone. Cladosporium resinae #1 and Candida are examples of this...been made from sources deemed likely to harbor fuel-tolerant organisms. Cladosporium resinae #6 is a fungus isolated from a creosoted piling in

  6. A multiplex set of microsatellite markers for the scarlet rosefinch (Carpodacus erythrinus)

    Czech Academy of Sciences Publication Activity Database

    Poláková, Radka; Vyskočilová, Martina; Martin, J.-F.; Mays Jr., H. L.; Hill, G. E.; Bryja, Josef; Albrecht, Tomáš

    2007-01-01

    Roč. 7, č. 6 (2007), s. 1375-1378 ISSN 1471-8278 R&D Projects: GA ČR GA206/06/0851 Grant - others:NSF(US) DEB-0077804 Institutional research plan: CEZ:AV0Z60930519 Keywords : Carpodacus * cross-amplification * heterozygosity * microsatellites Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 1.257, year: 2007

  7. Surface refinement and electronic properties of graphene layers grown on copper substrate: An XPS, UPS and EELS study

    Czech Academy of Sciences Publication Activity Database

    Siokou, A.; Ravani, F.; Karakalos, S.; Frank, Otakar; Kalbáč, Martin; Galiotis, C.

    2011-01-01

    Roč. 257, č. 23 (2011), s. 9785-9790 ISSN 0169-4332 R&D Projects: GA MŠk LC510; GA AV ČR IAA400400911 Institutional research plan: CEZ:AV0Z40400503 Keywords : graphene * XPS * EELS Subject RIV: CG - Electrochemistry Impact factor: 2.103, year: 2011

  8. Resonance – Journal of Science Education | News

    Indian Academy of Sciences (India)

    Mahlburg's Work on Crank Functions - Ramanujan's Partitions Revisited · Nagesh Juluru Arni S R Srinivasa Rao · More Details Fulltext PDF. pp 244-256 Classroom. Optimization of the Anderson Bridge Experiment · P Arun Kuldeep Kumar Mamta · More Details Fulltext PDF. pp 257-267 Classroom. Chaos from Jerk Circuit.

  9. Open woodland in Europe in the Mesolithic and in the Middle Ages: Can there be a connection?

    Czech Academy of Sciences Publication Activity Database

    Szabó, Péter

    2009-01-01

    Roč. 257, č. 12 (2009), s. 2327-2330 ISSN 0378-1127 R&D Projects: GA AV ČR IAA600050812 Institutional research plan: CEZ:AV0Z60050516 Keywords : primeval forest structure * Vera Hypothesis * historical ecology Subject RIV: EF - Botanics Impact factor: 1.950, year: 2009

  10. High-E.sub.T./sub. isolated-photon plus jets production in pp collisions at √s = 8 TeV with the ATLAS detector

    Czech Academy of Sciences Publication Activity Database

    Aaboud, M.; Aad, G.; Abbott, B.; Chudoba, Jiří; Havránek, Miroslav; Hejbal, Jiří; Hladík, Ondřej; Jakoubek, Tomáš; Kepka, Oldřich; Kupčo, Alexander; Kůs, Vlastimil; Lokajíček, Miloš; Lysák, Roman; Marčišovský, Michal; Mikeštíková, Marcela; Němeček, Stanislav; Penc, Ondřej; Šícho, Petr; Staroba, Pavel; Svatoš, Michal; Taševský, Marek; Vrba, Václav

    2017-01-01

    Roč. 918, May (2017), s. 257-316 ISSN 0550-3213 Institutional support: RVO:68378271 Keywords : ATLAS * CERN LHC Coll * experimental results * 8000 GeV-cms Subject RIV: BF - Elementary Particles and High Energy Physics OBOR OECD: Particles and field physics Impact factor: 3.678, year: 2016

  11. The American in Europe as Portrayed in American Literature of Late Nineteenth and Early Twentieth Centuries

    Science.gov (United States)

    1990-05-22

    Gradual Making Of The Making Of Americans," 257. 3 Stein, Narration, 6. 128 into one great rhythm. It is like a Beethoven symphony in that it consolidates...all of the little melodies into a great swelling and ebbing piece of music . I think that through her theories, Stein advocates the need of man to

  12. Journal of Biosciences | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    -444 Volume 21 May 1996 INR 100 USD 20. Morphogens, Genes and Development. Editor: M. K. Chandrashekaran. pp 101-257 Volume 21 April 1996 INR 100 USD 20. Heat Shock Proteins. Guest Editor: S. C. Lakhotia. pp 511-661 Volume ...

  13. Effects of calorie restriction on the lifespan and healthspan of POLG mitochondrial mutator mice.

    Directory of Open Access Journals (Sweden)

    Shinichi Someya

    Full Text Available Mitochondrial DNA (mtDNA mutations are thought to have a causative role in age-related pathologies. We have shown previously that mitochondrial mutator mice (PolgD257A/D257A, harboring a proofreading-deficient version of the mtDNA polymerase gamma (POLG, accumulate mtDNA mutations in multiple tissues and display several features of accelerated aging. Calorie restriction (CR is known to delay the onset of age-related diseases and to extend the lifespan of a variety of species, including rodents. In the current study we investigated the effects of CR on the lifespan and healthspan of mitochondrial mutator mice. Long-term CR did not increase the median or maximum lifespan of PolgD257A/D257A mice. Furthermore, CR did not reduce mtDNA deletions in the heart and muscle, accelerated sarcopenia, testicular atrophy, nor improve the alterations in cardiac parameters that are present in aged mitochondrial mutator mice. Therefore, our findings suggest that accumulation of mtDNA mutations may interfere with the beneficial action of CR in aging retardation.

  14. New methodology for capillary electrophoresis with ESI-MS detection: Electrophoretic focusing on inverse electromigration dispersion gradient. High-sensitivity analysis of sulfonamides in waters

    Czech Academy of Sciences Publication Activity Database

    Malá, Zdeňka; Gebauer, Petr; Boček, Petr

    2016-01-01

    Roč. 935, SEP (2016), s. 249-257 ISSN 0003-2670 R&D Projects: GA ČR(CZ) GA16-09135S Institutional support: RVO:68081715 Keywords : electrophoretic focusing * CE-ESI-MS * capillary electrophoresis Subject RIV: CB - Analytical Chemistry, Separation Impact factor: 4.950, year: 2016

  15. Clinical impact of the use of additional ultrasonography in diagnostic breast imaging.

    NARCIS (Netherlands)

    Vercauteren, L.D.; Kessels, A.G.; Weijden, T.T. van der; Koster, D.; Severens, J.L.; Engelshoven, JM van; Flobbe, K.

    2008-01-01

    The degree of adherence with evidence-based guidelines for the use of breast ultrasonography was determined in clinical practice of radiologists in six hospitals. Additional ultrasonography was performed in 2,272 (53%) of all 4,257 patients referred for mammography. High adherence rates (mean: 95%)

  16. Medical Students' Satisfaction and Academic Performance with Problem-Based Learning in Practice-Based Exercises for Epidemiology and Health Demographics

    Science.gov (United States)

    Jiménez-Mejías, E.; Amezcua-Prieto, C.; Martínez-Ruiz, V.; Olvera-Porcel, M. C.; Jiménez-Moleón, J. J.; Lardelli Claret, P.

    2015-01-01

    The aim of this study was to evaluate the effect of problem-based learning (PBL) on university students' satisfaction with and academic performance in a course on epidemiology and social and demographic health. The participants in this interventional study were 529 students (272 in the intervention group and 257 in the control group) enrolled in a…

  17. Laparoscopic myomectomy for infertile patients with intramural fibroids

    African Journals Online (AJOL)

    family history, polycystic ovarian syndrome, diabetes and hypertension.3,4 Patients with uterine fibroids usually .... The pre-operative work-up included a thorough history, examination, confirmation of ovulation in the fertility group, and a ... had artificial insemination (AI). Of the non-pregnant group, 9/35 (25.7%) attempted ...

  18. Surgical decompression for traumatic spinal cord injury in a tertiary ...

    African Journals Online (AJOL)

    The spectrum of injuries included cervical 27 (77.1%), thoracic 7 (20.0%), and lumbar vertebrae 1 (2.9%). The outcome as measured by Frankel's grade at 6 months after surgery showed improvement in 9 (25.7%) patients following intervention. All patients who presented with Frankel's Grade C and D improved to Grade E ...

  19. High-temperature oxidation of silicide-aluminide layer on the TiAl6V4 alloy prepared by liquid-phase siliconizing

    Czech Academy of Sciences Publication Activity Database

    Kubatík, Tomáš František

    2016-01-01

    Roč. 50, č. 2 (2016), s. 257-261 ISSN 1580-2949 Institutional support: RVO:61389021 Keywords : TiAl6V4 * silicides * high-temperature oxidation * liquid-phase silicon izing Subject RIV: JG - Metallurgy Impact factor: 0.436, year: 2016

  20. Management of Records in Public Secondary Schools of Lagos ...

    African Journals Online (AJOL)

    This article investigated management of records in public secondary schools of Lagos State, Nigeria. Simple random sampling technique with questionnaire, observation and interview methods were usedfor data collection through ten research assistants. 257 school managers (principals) were randomly sampledfrom a ...

  1. Exploring exercise behavior, intention and habit strength relationships

    NARCIS (Netherlands)

    de Bruijn, G.J.; Rhodes, R.E.

    2011-01-01

    The purpose of this study was to explore the relevance of integrating exercise habit strength within the framework of the theory of planned behavior. Data were obtained from 538 undergraduate students [mean age=21.19 (SD=2.57); 28.4% males] using validated questionnaires and analyzed using

  2. Influence of nutrient supply on growth, carbohydrate, and nitrogen metabolic relations in Typha angustifolia

    Czech Academy of Sciences Publication Activity Database

    Steibachová; Vojtíšková, L.; Tylová, E.; Soukup, A.; Novická, H.; Votrubová, O.; Lipavslá, H.; Čížková, Hana

    2006-01-01

    Roč. 57, - (2006), s. 246-257 ISSN 0098-8472 Institutional research plan: CEZ:AV0Z60870520 Keywords : Wetland plant * Nitrogen * Phosphorus * Storage carbohydrates * Starch * C/N balance * Eutrophication Subject RIV: EF - Botanics Impact factor: 1.820, year: 2006

  3. Jiří George Kukla a velká klimatologie globálních změn

    Czech Academy of Sciences Publication Activity Database

    Cílek, Václav

    2003-01-01

    Roč. 58, č. 9 (2003), s. 257-258 ISSN 1210-258X Institutional research plan: CEZ:AV0Z3013912 Keywords : J. G. Kukla * climatology * ice age Subject RIV: DB - Geology ; Mineralogy http://www.casopis.ochranaprirody.cz/res/ data /004/000514.pdf

  4. Elemental characterization of the new Czech meteorite "Morávka" by neutron and photon activation analysis

    Czech Academy of Sciences Publication Activity Database

    Řanda, Zdeněk; Kučera, Jan; Soukal, Ladislav

    2003-01-01

    Roč. 257, č. 2 (2003), s. 275-283 ISSN 0236-5731 Institutional research plan: CEZ:AV0Z1048901 Keywords : Czech meteorite * photon activation analysis Subject RIV: DD - Geochemistry Impact factor: 0.472, year: 2003

  5. Knihy kuchyňských účtů z let 1705-1706 z fondu Šternberk-Manderscheid jako pramen k dějinám aristokratických dvorů. Několik předběžných poznámek

    Czech Academy of Sciences Publication Activity Database

    Franc, Martin

    2002-01-01

    Roč. 52, č. 1 (2002), s. 257-277 ISSN 0036-5246 R&D Projects: GA MŠk LN00A041 Institutional research plan: CEZ:AV0Z8063914 Keywords : Sternberg-Manderscheid Archive * court management Subject RIV: AB - History

  6. Pushbroom Stereo for High-Speed Navigation in Cluttered Environments

    Science.gov (United States)

    2014-09-01

    Black Sheep Caipirinha8, a 34 inch (86cm) wingspan delta wing with a 2000kV brushless DC motor and 8-inch propeller9 (Figure 5). All outdoor flights...12-state Kalman filter from [7]) and connects to our low-level interface, a firmware-modified APM 2.57, which provides access to our servo motors

  7. Thiochrome enhances acetylcholine affinity at muscarinic M4 receptors: receptor subtype selectivity via cooperativity rather than affinity

    Czech Academy of Sciences Publication Activity Database

    Lazareno, S.; Doležal, Vladimír; Popham, A.; Birdsall, N. J. M.

    2004-01-01

    Roč. 65, č. 1 (2004), s. 257-266 ISSN 0026-895X R&D Projects: GA ČR GA305/01/0283; GA ČR GA309/02/1331 Institutional research plan: CEZ:AV0Z5011922 Keywords : muscarinic receptors * thiochrome * allosteric effect Subject RIV: ED - Physiology Impact factor: 5.080, year: 2004

  8. Use of the industrial yeast Candida utilis for cadmium sorption

    Czech Academy of Sciences Publication Activity Database

    Kujan, Petr; Prell, Aleš; Šafář, Hynek; Sobotka, Miroslav; Řezanka, Tomáš; Holler, Pavel

    2006-01-01

    Roč. 51, č. 4 (2006), s. 257-260 ISSN 0015-5632 Institutional research plan: CEZ:AV0Z50200510 Keywords : candida utilis * cadmium * yeast Subject RIV: EE - Microbiology, Virology Impact factor: 0.963, year: 2006

  9. Pukupuku arunachalensis sp. nov. (Coleoptera, Scarabaeidae, Rutelinae) from Arunachal Pradesh, India

    Czech Academy of Sciences Publication Activity Database

    Gupta, D.; Chandra, K.; Bezděk, Aleš

    2017-01-01

    Roč. 2017, č. 257 (2017), s. 1-11 ISSN 2118-9773 Institutional support: RVO:60077344 Keywords : new species * taxonomy * Northeast India Subject RIV: EG - Zoology OBOR OECD: Zoology Impact factor: 0.649, year: 2016 http://www.europeanjournaloftaxonomy.eu/index. php /ejt/issue/view/264

  10. Context-dependent associations between variation in risk of ischemic heart disease and variation in the 5' promoter region of the apolipoprotein E gene in Danish women

    DEFF Research Database (Denmark)

    Stengård, Jari H; Dyson, Greg; Frikke-Schmidt, Ruth

    2010-01-01

    : In a sample of 3686 female and 2772 male participants of the Copenhagen City Heart Study who were free of IHD events, 576 individuals (257 women, 7.0% and 319 men, 11.5%) were diagnosed as having developed IHD in 6.5 years of follow-up. Using a stepwise Patient Rule-Induction Method modeling strategy...

  11. A screening method for banana weevil (Cosmopolites sordidus ...

    African Journals Online (AJOL)

    EJIRO

    2010-07-26

    Jul 26, 2010 ... Diferencias sexuales en la morfologia externa de. Cosmopolites sordidus Germar (Coleoptera: Curculionidae). Ciencias. Biol. l, La Habana 1: 1-11. Mesquita ALM, Alvers EJ, Caldas RC (1984). Resistance of banana cultivars to Cosmopolites sordidus (Germar). Fruits, 39(4): 254-257. Mitchell G (1978).

  12. The Relations between the Organizational Happiness and the Organizational Socialization Perceptions of Teachers: The Sample of Physical Education and Sport

    Science.gov (United States)

    Tosten, Rasim; Avci, Yunus Emre; Sahin, Erhan

    2018-01-01

    The main purpose of this research is to examine the relationship between levels of organizational happiness and organizational socialization of physical education and sport teachers. The research is quantitative and correlational model. The population of the research is composed of 257 physical education and sports teachers working in Siirt…

  13. Der spätgotische Turmwächter des Altstädter Turms der Karlsbrücke. Neue Fragen einer einzigartigen Statue

    Czech Academy of Sciences Publication Activity Database

    Hlobil, Ivo

    2013-01-01

    Roč. 61, č. 3 (2013), s. 257-267 ISSN 0049-5123 R&D Projects: GA ČR GA13-39192S Institutional support: RVO:68378033 Keywords : Watchman * Late Gothic sculpture * Charles Bridge * Prague Subject RIV: AL - Art, Architecture, Cultural Heritage http://www.umeni-art.cz/cz/default.aspx

  14. The Use of Portfolios to Foster Professionalism: Attributes, Outcomes, and Recommendations

    Science.gov (United States)

    Franco, Renato Soleiman; Franco, Camila Ament Giuliani dos Santos; Pestana, Olívia; Severo, Milton; Ferreira, Maria Amélia

    2017-01-01

    The main objective of this research was to review the characteristics of portfolios and their outcomes for teaching professionalism to undergraduate medical students. A systematic review on the use of portfolios in teaching professionalism to medical students identified 1,257 papers. Of these, 11 articles met all inclusion criteria. According to…

  15. a new analytical modeling method for photovoltaic solar cells based

    African Journals Online (AJOL)

    Zieba Falama R, Dadjé A, Djongyang N and Doka S.Y

    2016-05-01

    May 1, 2016 ... Solar energy applications have been increasing gradually throughout the world. This is due to the decrease in the cost of ... system which also require a good sizing in order to avoid losses or lack of energy. The evaluation of the maximum ..... Revue des énergies renouvelables. Vol. 13 N°2(2010) 257-264.

  16. All projects related to Bangladesh | Page 4 | IDRC - International ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Region: South Asia, Central Asia, Far East Asia, Bangladesh, India, Pakistan. Total Funding: CA$ 257,800.00. Human Rights and Peace Audit on Partition in South Asia - Phase II. Project. In South Asia, people's social, political and cultural aspirations often get articulated as movements for territorially defined political ...

  17. Raně středověký sídelní areál v západní části hradčanského ostrohu

    Czech Academy of Sciences Publication Activity Database

    Boháčová, Ivana; Herichová, Iva

    2008-01-01

    Roč. 19, - (2008), s. 257-308 ISSN 0231-6390 R&D Projects: GA ČR GA404/05/2671 Institutional research plan: CEZ:AV0Z80020508 Keywords : stronghold * Early Middle Ages * archaeology * settlement * Prague Subject RIV: AC - Archeology, Anthropology, Ethnology

  18. Protective cytokinin action switches to damaging during senescence of detached wheat leaves in continuous light

    Czech Academy of Sciences Publication Activity Database

    Vlčková, A.; Špundová, M.; Kotabová, E.; Novotný, R.; Doležal, Karel; Nauš, J.

    2006-01-01

    Roč. 126, č. 2 (2006), s. 257-267 ISSN 0031-9317 R&D Projects: GA AV ČR IBS4055304 Grant - others:FRVŠ MŠk FRVŠ 3190/2005 Institutional research plan: CEZ:AV0Z50380511 Keywords : senescence * cytokinin * Triticum aestivum Subject RIV: EF - Botanics Impact factor: 2.169, year: 2006

  19. QTL list: sex1.2 [PGDBj Registered plant list, Marker list, QTL list, Plant DB link and Genome analysis methods[Archive

    Lifescience Database Archive (English)

    Full Text Available QT64750 Cucumis sativus Cucurbitaceae sex1.2 Number of female nodes on mainstem gynoecious (F) trait (sex...1.1), determinate (de) trait (sex1.2) ... LG_01 ... 25.7 7.3 ... 10.1007/s00122-003-1277-1 12827247

  20. The 2001 Virginia Rural Homeless Survey

    OpenAIRE

    Koebel, C. Theodore; Murphy, Michelle; Brown, Adam

    2001-01-01

    The Virginia Center for Housing Research was commissioned by the Virginia Housing Study Commission, the Virginia Interagency Action Council for the Homeless, and the Virginia Department of Housing and Community Development to conduct this research in response to House Joint Resolution 257 requesting a study of the number and needs of homeless people living in rural areas of the Commonwealth.

  1. Interaction of polyunsaturated fatty acids and sodium butyrate during apoptosis in HT-29 human colon adenocarcinoma cells

    Czech Academy of Sciences Publication Activity Database

    Hofmanová, Jiřina; Vaculová, Alena; Lojek, Antonín; Kozubík, Alois

    2005-01-01

    Roč. 44, č. 1 (2005), s. 40-51 ISSN 1436-6207 R&D Projects: GA ČR(CZ) GA525/01/0419 Institutional research plan: CEZ:AV0Z50040507 Keywords : colon cancer * diet * butyrate Subject RIV: BO - Biophysics Impact factor: 2.257, year: 2005

  2. An Afterschool Program for Economically Disadvantaged Youth: Perceptions of Parents, Staff, and Students

    Science.gov (United States)

    Hall, Katrina W.; Williams, Lunetta M.; Daniel, Larry G.

    2010-01-01

    The present study investigated perceived effects of an afterschool program located in 6 Title 1 schools on students' achievement, self-esteem, and attitudes. Data sources comprised surveys (n = 257), 5 focus groups (n= 23), and an individual interview with the program director (n = 1). Survey data indicated overall satisfaction with the program.…

  3. Application of polyaniline dispersions by means of screen printing

    Czech Academy of Sciences Publication Activity Database

    Držková, M.; Peřinka, N.; Hajná, Milena; Kaplanová, M.; Stejskal, Jaroslav

    2013-01-01

    Roč. 19, č. 2013 (2013), s. 257-268 ISSN 1211-5541 R&D Projects: GA TA ČR TE01020022 Institutional support: RVO:61389013 Keywords : polyaniline * colloids * screen printing Subject RIV: JA - Electronics ; Optoelectronics, Electrical Engineering

  4. Ultrastructure of the mature spermatozoon of Eubothrium rugosum (Batsch, 1786) with a re-assessment of the spermatozoon ultrastructure of Eubothrium crassum (Bloch, 1779) (Cestoda: Bothriocephalidea)

    Czech Academy of Sciences Publication Activity Database

    Bruňanská, M.; Fagerholm, H. P.; Nebesářová, Jana; Kostič, B.

    2010-01-01

    Roč. 47, č. 4 (2010), s. 257-263 ISSN 0440-6605 Institutional research plan: CEZ:AV0Z60220518 Keywords : ultrastructure * spermatozoon * Eubothrium * Bothriocephalidea * Cestoda Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine Impact factor: 0.847, year: 2010

  5. Effectiveness of a worksite mindfulness-related multi-component health promotion intervention on work engagement and mental health: Results of a randomized controlled trial

    NARCIS (Netherlands)

    Berkel, J. van; Boot, C.R.L.; Proper, K.I.; Bongers, P.M.; Beek, A.J. van der

    2014-01-01

    Objectives: The aim of the present study was to evaluate the effectiveness of a worksite mindfulness-related multicomponent health promotion intervention on work engagement, mental health, need for recovery and mindfulness. Methods: In a randomized controlled trial design, 257 workers of two

  6. Geomorphological research of large-scale slope instability at Machu Picchu, Peru

    Czech Academy of Sciences Publication Activity Database

    Vilímek, V.; Zvelebil, J.; Klimeš, Jan; Patzelt, Z.; Astete, F.V.; Kachlík, F.; Hartvich, Filip

    2007-01-01

    Roč. 89, č. 3-4 (2007), s. 241-257 ISSN 0169-555X Institutional research plan: CEZ:AV0Z30460519 Keywords : natural hazard * Machu Picchu * landslides Subject RIV: DB - Geology ; Mineralogy Impact factor: 1.854, year: 2007 www.elsevier.com/locate/geomorphology

  7. METHODS OF AVAILABLE POTASSIUM ASSESSMENT IN ...

    African Journals Online (AJOL)

    AGROSEARCH UIL

    An alternative rationale for corn N fertilizer recommendations. J. Prod. Agric. 7: 243-249. Vanotti, M. B. and Bundy, L. G. 1994b. Corn nitrogen recommendations based on yield response data. J. Prod. Agric. 7: 249-256. Wild, A. A. 1971. The potassium status of soils in the savanna zone of Nigeria. Expl. Agric. 7: 257-270. 87.

  8. Complexity in behavioural organization and strongylid infection among wild chimpanzees

    Czech Academy of Sciences Publication Activity Database

    Burgunder, J.; Pafčo, B.; Petrželková, Klára Judita; Modrý, David; Hashimoto, C.; MacIntosh, A. J. J.

    2017-01-01

    Roč. 129, July (2017), s. 257-268 ISSN 0003-3472 Institutional support: RVO:60077344 Keywords : behavioural complexity * chimpanzees * fractal analysis * health monitoring * Pan troglodytes schweinfurthii * strongylid infection Subject RIV: EG - Zoology OBOR OECD: Zoology Impact factor: 2.869, year: 2016

  9. Complexity in behavioural organization and strongylid infection among wild chimpanzees

    Czech Academy of Sciences Publication Activity Database

    Burgunder, J.; Pafčo, B.; Petrželková, Klára Judita; Modrý, D.; Hashimoto, C.; MacIntosh, A. J. J.

    2017-01-01

    Roč. 129, July (2017), s. 257-268 ISSN 0003-3472 Institutional support: RVO:68081766 Keywords : behavioural complexity * chimpanzees * fractal analysis * health monitoring * Pan troglodytes schweinfurthii * strongylid infection Subject RIV: EG - Zoology OBOR OECD: Zoology Impact factor: 2.869, year: 2016

  10. Parnassiana nova : LI. Bemerkungen über Parnassius in den Karpathen und der Tschechoslowakei

    NARCIS (Netherlands)

    Eisner, C.; Zelný, J.

    1977-01-01

    Parnassius mnemosyne mesoleucus Fruhstorfer, natio gynaecotropaintensa (natio nova) Zelný (1956) hat in seinen Arbeiten „Parnassius mnemosyne mesoleucus Fruhstorfer aus der Kleinen Fatra" (Zeitschrift der Wiener Entomologischen Gesellschaft, 41: 257-263) sich ausführlich über die in den

  11. Physical and Biological Processes Underlying the Sudden Appearance of a Red-Tide Surface Patch in the Nearshore

    Science.gov (United States)

    2010-01-01

    dollars annually to aquaculture 3 (Alonso- Rodriguez and Paez-Osuna, 2003), threaten marine mammal and human health 4 (Anderson, 1997), and inhibit...Bate (1988) The influence of current direction on longshore distribution of surf phytoplankton. Botanica Marina , 31(3), 257–262. Clancy, M., and C

  12. New Grandparents' Mental Health: The Protective Role of Optimism, Self-Mastery, and Social Support

    Science.gov (United States)

    Ben Shlomo, Shirley; Taubman - Ben-Ari, Orit

    2012-01-01

    The current study examines the contribution of optimism, self-mastery, perceived social support, and background variables (age, physical health, economic status) to mental health following the transition to grandparenthood. The sample consisted of 257 first-time Israeli grandparents (grandmothers and grandfathers, maternal and paternal) who were…

  13. Land restitution through the lens of environmental law: Some ...

    African Journals Online (AJOL)

    Land reform may strongly impact on the environment and sustainable development as protected in section 24 of the Constitution since it involves vast hectares of land, other environmental media and people. Restitution of land processes in terms of section 25(7), as one of the components of land reform, often does not take ...

  14. Multiplex ligation-dependent probe amplification (MLPA) screening for exon copy number variation in the calcium sensing receptor gene: no large rearrangements identified in patients with calcium metabolic disorders

    DEFF Research Database (Denmark)

    Nissen, Peter H; Christensen, Signe E; Wallace, Andrew

    2010-01-01

    . Patients and methods. The study included 257 patient samples referred to our laboratory for molecular genetic analysis of the CASR gene. A total of 245 were patients suspected to have FHH, while the remaining 12 samples represent patients with a phenotype of idiopathic hypocalcaemia/hypoparathyroidism. All...

  15. Awareness, willingness and use of Voluntary HIV testing and ...

    African Journals Online (AJOL)

    Awareness, willingness and use of Voluntary HIV testing and counseling services by students of a university in south-south Nigeria. ... (significantly more females than males, OR=1.67, 95%CI: 1.04-2.68). Fear of positive result (39.1%) and stigma (25.7%) were the leading demotivators for those unwilling to have VHTC.

  16. 76 FR 62330 - Radio Broadcasting Services; Alamo, GA; Alton, MO; Boscobel, WI; Buffalo, OK; Cove, AR; Clayton...

    Science.gov (United States)

    2011-10-07

    ... Broadcasting Services; Alamo, GA; Alton, MO; Boscobel, WI; Buffalo, OK; Cove, AR; Clayton, LA; Daisy, AR; Ennis...) 418-2180. SUPPLEMENTARY INFORMATION: This is a synopsis of the Commission's Notice of Proposed Rule... FCC's Reference Information Center at Portals II, CY-A257, 445 Twelfth Street, SW., Washington, DC...

  17. Estimates of biological nitrogen fixation by Pterocarpus lucens in a ...

    African Journals Online (AJOL)

    TonukariJ

    2002-11-15

    Nov 15, 2002 ... Nitrogen fixation in Pterocarpus erinaceus and P. lucens using the. 15N labelling methods. Ar. Soil Res. Rehabil. 12:257-253. Unkovich MJ, Pate JS, Sanford P, Amstrong EL (1994). Potential precision of the 15N natural abundance method in field estimates of nitrogen fixation by crop and pasture legumes.

  18. Book Review: Everyone's guide to divorce and separation | Strong ...

    African Journals Online (AJOL)

    Book Title: Everyone's guide to divorce and separation. Book Author: Bertus Preller. 2013, Zebra Press, Cape Town. 205 pages. ISBN number: 978 1 77022 5299 (Paperback). Price: ZAR 257.00. Full Text: EMAIL FULL TEXT EMAIL FULL TEXT · DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT.

  19. The Cyclization Mechanism of Cyclodextrin Glycosyltransferase (CGTase) as Revealed by a γ-Cyclodextrin-CGTase Complex at 1.8-Å Resolution

    NARCIS (Netherlands)

    Uitdehaag, Joost C.M.; Kalk, Kor H.; Veen, Bart A. van der; Dijkhuizen, Lubbert; Dijkstra, Bauke W.

    1999-01-01

    The enzyme cyclodextrin glycosyltransferase is closely related to α-amylases but has the unique ability to produce cyclodextrins (circular α(1→4)-linked glucoses) from starch. To characterize this specificity we determined a 1.8-Å structure of an E257Q/D229N mutant cyclodextrin glycosyltransferase

  20. The cyclization mechanism of cyclodextrin glycosyltransferase (CGTase) as revealed by a gamma-cyclodextrin-CGTase complex at 1.8-angstrom resolution

    NARCIS (Netherlands)

    Uitdehaag, JCM; Kalk, KH; Dijkhuizen, L; Dijkstra, BW

    1999-01-01

    The enzyme cyclodextrin glycosyltransferase is closely related to alpha-amylases but has the unique ability to produce cyclodextrins (circular alpha(1-->4)-linked glucoses) from starch. To characterize this specificity we determined a 1.8-Angstrom structure of an E257Q/D229N mutant cyclodextrin

  1. Teachers' Teaching Experience and Students' Learning Outcomes ...

    African Journals Online (AJOL)

    This article examined teachers' teaching experience and students' learning outcomes in the secondary schools in Ondo State Nigeria. As a correlational survey, the study population comprised all the 257 secondary schools that presented students for the year 2003 senior secondary certificate (SSC) examinations in the ...

  2. Media Exposure, Current and Future Body Ideals, and Disordered Eating among Preadolescent Girls: A Longitudinal Panel Study

    Science.gov (United States)

    Harrison, Kristen; Hefner, Veronica

    2006-01-01

    Internalization of the thin body ideal is considered by many to account for the relationship between media exposure and disordered eating among girls and young women, but almost all supporting research has employed adolescent and adult samples. Using longitudinal panel survey data collected from 257 preadolescent girls at 2 points in time 1 year…

  3. Untitled

    Indian Academy of Sciences (India)

    Ann. Chem., 1852, 83, 257; 1856, 98, 213. Z. anorg, allgem. Chem., 1952, 269, 279. Rec. Trav, Chem., 1957, 76, 1005. Jour. Sci, and Ind. Res., 1959, 18 B, No. 12, 537–539. Larsen, E. M., Howatson, J., J. Am. Chem. Soc., 1952, 74, 3489. Gammill, A. M. and. Wittenberg, L. Venkataraman, K. N. and. Vasudeva Murthy, A. R..

  4. Re-training needs of village extension agents in Nigeria: A study of ...

    African Journals Online (AJOL)

    Areas agents felt they had highest competence were principles of crop production (X=2.75) and Animal Nutrition (X=2.57). Subject matter areas of relevance and competence have been identified. There are several areas in agriculture in which the agents need functional training. Keywords: Re-Training Extension Agents, ...

  5. KAPPA: A Package for Synthesis of Optically Thin Spectra for the Non-Maxwellian kappa-distributions Based on the Chianti Database

    Czech Academy of Sciences Publication Activity Database

    Dzifčáková, Elena; Dudík, Jaroslav; Kotrč, Pavel; Fárník, František; Zemanová, Alena

    2015-01-01

    Roč. 217, č. 1 (2015), 14/1-14/14 ISSN 0067-0049 R&D Projects: GA ČR GAP209/12/1652 Institutional support: RVO:67985815 Keywords : numerical method * radiation mechanisms * coronae Subject RIV: BN - Astronomy, Celestial Mechanics, Astrophysics Impact factor: 11.257, year: 2015

  6. Journal of Genetics | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    Home; Journals; Journal of Genetics. Parvinder Kumar. Articles written in Journal of Genetics. Volume 87 Issue 3 December 2008 pp 257-259 Research Note. Double trisomy with 48, XXX+21 karyotype in a Down's syndrome child from Jammu and Kashmir, India · Wahied Khawar Balwan Parvinder Kumar T. R. Raina ...

  7. Investigating the Factors Affecting Resiliency in Mothers of Children with and without Intellectual Disability

    Science.gov (United States)

    Bayrakli, Hatice; Kaner, Sema

    2012-01-01

    In this study, the effect of quantity and quality of social support and problem-focused coping style on mothers' resilience was examined by conducting a structural equation modeling. The sample of the research consisted of 257 mothers of children with intellectual disability, and 234 mothers of typically-developing children. The data were gathered…

  8. Voltammetry on Mercury and Carbon Electrodes as a Tool for Studies of Metallothionein Interactions with Metal Ions

    Czech Academy of Sciences Publication Activity Database

    Šestáková, Ivana; Mader, P.

    2000-01-01

    Roč. 46, č. 2 (2000), s. 257-267 ISSN 0145-5680 R&D Projects: GA ČR GV204/97/K084 Institutional research plan: CEZ:AV0Z4040901; CEZ:A54/98:Z4-040-9-ii Subject RIV: CG - Electrochemistry Impact factor: 1.449, year: 2000

  9. Comité Scientifique de la Revue des Sciences et de la Technologie ...

    African Journals Online (AJOL)

    MICROSIM

    Ecological Indicators,1, 261 – 270. [11] Wekbeker G. & Cory G., 1988. Robo nucleotide reductase activity and growth of glutathione depleted mouse leukemia 1210 cells in vitro. Cancer letters, 40, 257 – 264. [12] Bradford M., 1976. A rapid and sensitive method for the quantification of microgram quantities of protein utilizing ...

  10. Spectrally-Temporally Adapted Spectrally Modulated Spectrally Encoded (SMSE) Waveform Design for Coexistent CR-Based SDR Applications

    Science.gov (United States)

    2010-03-01

    Only and Spectrally-Temporally adapted SMSE signals at var - ious levels channel estimate MSE. Results based on a maximum BER constraint of PB = 10 −2...57. Tian, Z. and G. B. Giannakis. “A Wavelet Approach to Wideband Spectrum Sensing for Cognitive Radios”. Proceedings of the 1st International

  11. Transition metal-modified polyoxometalates supported on carbon as ...

    Indian Academy of Sciences (India)

    Author Affiliations. Romina A Frenzel1 Gustavo P Romanelli1 Mirta N Blanco1 Luis R Piz1. Centro de Investigación y Desarrollo en Ciencias Aplicadas ``Dr. Jorge J. Ronco” (CINDECA), CCT-LaPlata-CONICET, Facultad de Ciencias Exactas, Universidad Nacional de La Plata, 47 N° 257 (B1900AJK) La Plata, Argentina ...

  12. Evaluation of interspecific DNA variability in poplars using AFLP and ...

    African Journals Online (AJOL)

    STORAGESEVER

    2009-10-19

    Oct 19, 2009 ... Silvae Genetica, 52: 5-6. Klosterman AD, Budowle B, Daselaar P (1993). PCR amplification and detection of human D1S80 VNTR locus. Amplification conditions, population genetics and application in forensic analysis. Int. J. Leg. Med. 105: 257-264. Krauss SL (2000). Patterns and mating in Persoonia ...

  13. issues related to methane emission from enteric fermentation ...

    African Journals Online (AJOL)

    JACQUES

    2016-03-23

    Mar 23, 2016 ... Plant part Yield (%). Citrus aurantifolia (Christm). Swing Lime. AP 2086 HNB. Fruit peel. 0.8. Eucalyptus citriodora Hook. Lemon scent. AAC 181 HNB. Leaves. 2.57 ... enteric methane production owing to their antimicrobial activity (Bodas et al., 2012). Antimicrobial properties of EO depend on their chemical.

  14. Comparison of intraspinal and intrathecal implantation of induced pluripotent stem cell-derived neural precursors for the treatment of spinal cord injury in rats

    Czech Academy of Sciences Publication Activity Database

    Amemori, Takashi; Růžička, Jiří; Romanyuk, Nataliya; Jhanwar-Uniyal, M.; Syková, Eva; Jendelová, Pavla

    2015-01-01

    Roč. 6, Dec (2015), s. 257 ISSN 1757-6512 R&D Projects: GA MŠk(CZ) LH12024 Institutional support: RVO:68378041 Keywords : spinal cord injury * human induced pluripotent stem cells * cell therapy * cell application route Subject RIV: FH - Neurology Impact factor: 4.504, year: 2015

  15. Predicting Alcohol, Cigarette, and Marijuana Use from Preferential Music Consumption

    Science.gov (United States)

    Oberle, Crystal D.; Garcia, Javier A.

    2015-01-01

    This study investigated whether use of alcohol, cigarettes, and marijuana may be predicted from preferential consumption of particular music genres. Undergraduates (257 women and 78 men) completed a questionnaire assessing these variables. Partial correlation analyses, controlling for sensation-seeking tendencies and behaviors, revealed that…

  16. 75 FR 6600 - Proposed Flood Elevation Determinations

    Science.gov (United States)

    2010-02-10

    .... of Marion County. Approximately 0.7 mile None +1,390 upstream of Old Mill Road. Spring Creek At... 1.5 mile None +1,257 Town of Rockland. downstream of Old State Route 17. At the confluence with +1... At the Delaware County +487 +490 Town of Fremont, Town boundary. of Cochecton, Town of Delaware, Town...

  17. Mesoporous molecular sieves as advanced supports for olefin metathesis catalysts

    Czech Academy of Sciences Publication Activity Database

    Balcar, Hynek; Čejka, Jiří

    2013-01-01

    Roč. 257, 21-22 (2013), s. 3107-3124 ISSN 0010-8545 R&D Projects: GA AV ČR IAA400400805; GA ČR GBP106/12/G015 Institutional support: RVO:61388955 Keywords : Olefin metathesis * mesoporous molecular sieves * Heterogeneous catalysts Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 12.098, year: 2013

  18. Theoretical studies of the active-site structure, spectroscopic and thermodynamic properties, and reaction mechanism of multicopper oxidases

    Czech Academy of Sciences Publication Activity Database

    Rulíšek, Lubomír; Ryde, U.

    2013-01-01

    Roč. 257, č. 2 (2013), s. 445-458 ISSN 0010-8545 Institutional support: RVO:61388963 Keywords : multi-copper oxidases * QM/MM calculations * multireference calculations * theoretical spectroscopy Subject RIV: CA - Inorganic Chemistry Impact factor: 12.098, year: 2013

  19. Isolation and characterization of microsatellites in Neogobius kessleri (Perciformes, Gobiidae) and cross-species amplification within the family Gobiidae

    Czech Academy of Sciences Publication Activity Database

    Vyskočilová, Martina; Ondračková, Markéta; Šimková, A.; Martin, J.-F.

    2007-01-01

    Roč. 7, č. 4 (2007), s. 701-704 ISSN 1471-8278 R&D Projects: GA ČR GP524/05/P291 Institutional research plan: CEZ:AV0Z60930519 Keywords : cross-amplification * Gobiidae * microsatellites * Neogobius * primers * Proterorhinus Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 1.257, year: 2007

  20. Biohydrology research after Landau 2013 conference

    Czech Academy of Sciences Publication Activity Database

    Lichner, Ľ.; Cerdà, A.; Rajkai, K.; Tesař, Miroslav

    Roč. 62, č. 4 ( 2014 ), s. 253-257 ISSN 0042-790X Institutional support: RVO:67985874 Keywords : biohydrology * hydrological research * biological and hydrological systems * hydrological processes Subject RIV: DA - Hydrology ; Limnology Impact factor: 1.486, year: 2014

  1. Does Burnout Begin with Student-Teaching? Analyzing Efficacy, Burnout, and Support during the Student-Teaching Semester

    Science.gov (United States)

    Fives, Helenrose; Hamman, Doug; Olivarez, Arturo

    2007-01-01

    The burnout process may begin as early as the student-teaching experience [Gold, Y., 1985. Does teacher burnout begin with student teaching? "Education", 105, 254-257]. Data from 49 student-teachers in the southwest United States were gathered twice during their student-teaching practicum. Data assessing teacher efficacy, teacher…

  2. HlyA knock out yields a safer Escherichia coli A0 34/86 variant with unaffected colonization capacity in piglets

    Czech Academy of Sciences Publication Activity Database

    Sheshko, Valeria; Hejnová, Jana; Řeháková, Z.; Šinkora, J.; Faldyna, M.; Alexa, P.; Felsberg, Jürgen; Němcová, R.; Bomba, A.; Šebo, Peter

    2006-01-01

    Roč. 48, - (2006), s. 257-266 ISSN 0928-8244 R&D Projects: GA ČR GA523/03/0186 EU Projects: European Commission(XE) 503240 - MUVAPRED Institutional research plan: CEZ:AV0Z50200510 Keywords : escherichia coli * haemolysin * colonization Subject RIV: EE - Microbiology, Virology Impact factor: 2.281, year: 2006

  3. CPAP Tips

    Medline Plus

    Full Text Available ... Dry Mouth and Tongue With CPAP. Why it's Bad. How to Fix Mouth Leaking. Anatomy of the Mouth Leak. - Duration: 9:40. TheLankyLefty27 176,257 views 9:40 Choosing a CPAP Mask for Sleep Apnea Treatment - Duration: 4:37. TheLankyLefty27 182,751 views 4: ...

  4. Prevalence of Intestinal Parasites among Pupils in Rural North ...

    African Journals Online (AJOL)

    Background: The study determined the prevalence of intestinal parasitism among pupils in rural schools (Almajiris) in Konduga local Government Area of Borno state. Materials and Methods: A total of 257 stool specimens were collected at random among pupils (Almajiris) in rural quranic schools; the stools were processed ...

  5. Monatomic Fe and Co wires at the Pt surface step edge: theory of the unconventional magnetic anisotropy

    Czech Academy of Sciences Publication Activity Database

    Shick, Alexander; Máca, František; Oppeneer, P.M.

    290-291, - (2005), s. 257-260 ISSN 0304-8853 R&D Projects: GA ČR(CZ) GA202/04/0583 Institutional research plan: CEZ:AV0Z10100520 Keywords : anisotropy theory * magnetic moments, orbital * nanocrystalline materials Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 0.985, year: 2005

  6. International Physiotherapy Eduication

    African Journals Online (AJOL)

    brownb

    didactic and clinical teaching practices and options, and also provides insights into the future of professional .... ability to perform a specific task in a given situation, while cultural competence involves the nuances and. 2 .... Job satisfaction traits of Nigerian physiotherapists. Physiotherapy Theory and Practice 17: 257-. 268.

  7. Ruth Benedictová v Československu (léto 1948)

    Czech Academy of Sciences Publication Activity Database

    Kubáčková, Patricie

    2015-01-01

    Roč. 102, č. 3 (2015), s. 257-279 ISSN 0009-0794 Institutional support: RVO:68378092 Keywords : Ruth Benedict * UNESCO seminary in Poděbrady in 1948 * method of the research of national character at a distance Subject RIV: AI - Linguistics

  8. Unigene BLAST: CBRC-RMAC-05-0024 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-RMAC-05-0024 gnl|UG|Mmu#S33383720 PREDICTED: Macaca mulatta Golgi autoantigen, gol...gin subfamily a, 5, transcript variant 5 (GOLGA5), mRNA /cds=p(257,2452) /gb=XM_001094180 /gi=109084646 /ug=Mmu.16245 /len=2971 2.4 31% ...

  9. Microbial colonization of silicone voice prostheses used in laryngectomized patients

    NARCIS (Netherlands)

    Eerenstein, S. E.; Grolman, W.; Schouwenburg, P. F.

    1999-01-01

    The aim of this study was to identify the microbial colonization of dysfunctioning voice prostheses in laryngectomized patients and determine the influence of patient radiation therapy on prosthesis life span. In a 40-month period, 257 outpatient voice prosthesis replacements were carried out in a

  10. Leveraging Affective Learning for Developing Future Airmen

    Science.gov (United States)

    2009-11-01

    brings a generic, systematic ap- proach based on foundations-of-learning principles and stan- dard system theory to the ID process ( Tennyson , 989...solving: Ef- fects on learning. Cognitive Science, 12(2), 257–285. Tennyson , R. D. (989). Cognitive science update of instructions systems design models

  11. Genetic modification of dividing cells using episomally maintained S/MAR DNA vectors

    Directory of Open Access Journals (Sweden)

    Suet-Ping Wong

    2013-01-01

    Full Text Available The development of episomally maintained DNA vectors to genetically modify dividing cells efficiently and stably, without the risk of integration-mediated genotoxicity, should prove to be a valuable tool in genetic research. In this study, we demonstrate the utility of Scaffold/Matrix Attachment Region (S/MAR DNA vectors to model the restoration of a functional wild-type copy of the gene folliculin (FLCN implicated in the renal cancer Birt-Hogg-Dubé (BHD. Inactivation of FLCN has been shown to be involved in the development of sporadic renal neoplasia in BHD. S/MAR-modified BHD tumor cells (named UOK257-FS show restored stable FLCN expression and have normalized downstream TGFβ signals. We demonstrate that UOK257-FS cells show a reduced growth rate in vitro and suppression of xenograft tumor development in vivo, compared with the original FLCN-null UOK257 cell line. In addition, we demonstrate that mTOR signaling in serum-starved FLCN-restored cells is differentially regulated compared with the FLCN-deficient cell. The novel UOK257-FS cell line will be useful for studying the signaling pathways affected in BHD pathogenesis. Significantly, this study demonstrates the suitability of S/MAR vectors to successfully model the functional expression of a therapeutic gene in a cancer cell line and will aid the identification of novel cancer markers for diagnosis and therapy.

  12. Sebastian, Prof. Kizhakeyil Lukose

    Indian Academy of Sciences (India)

    Date of birth: 18 November 1950. Specialization: Theoretical Chemistry and Chemistry of Interfaces Address: Department of Chemistry, Indian Institute of Technology, Ahalia Integrated Campus, Kozhippara Post, Palakkad 678 557, Kerala Contact: Office: (04923) 22 6511. Residence: (0491) 257 2290. Mobile: 96329 28096

  13. Zur Verbreitung theologischer Streitschriften im 15. Jahrhundert. Eine antihussitische Sammelhandschrift aus der Erfurter Kartause

    Czech Academy of Sciences Publication Activity Database

    Soukup, Pavel

    2009-01-01

    Roč. 1, č. 1 (2009), s. 231-257 ISSN 1804-0977 Grant - others:Av ČR(CZ) M300090903 Institutional research plan: CEZ:AV0Z90090514 Keywords : anti-Hussite Polemics * medieval Manuscripts * textual transmission Subject RIV: AB - History

  14. Low temperature delayed recombination decay in complex oxide scintillating crystals

    Czech Academy of Sciences Publication Activity Database

    Mihóková, Eva; Jarý, Vítězslav; Schulman, L. S.; Nikl, Martin

    2014-01-01

    Roč. 61, č. 1 (2014), 257-261 ISSN 0018-9499 R&D Projects: GA MŠk LH12150; GA MŠk LH12185 Grant - others:AVČR(CZ) M100101212 Institutional support: RVO:68378271 Keywords : luminescence * oxides * scintillator * tunneling Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 1.283, year: 2014

  15. 78 FR 62007 - Alabama Power Company; Notice of Application Accepted for Filing, Soliciting Comments, Motions To...

    Science.gov (United States)

    2013-10-11

    ... Street North, Birmingham, AL 35203-8180, (205) 257-1000. i. FERC Contact: Mark Carter, (678) 245-3083, mark[email protected] . j. Deadline for filing comments, motions to intervene, and protests: November 4... Commission approval to authorize construction of marina facilities within the project boundary associated...

  16. 78 FR 30298 - Alabama Power Company; Notice of Application Accepted for Filing and Soliciting Comments, Motions...

    Science.gov (United States)

    2013-05-22

    ... Company, 600 18th Street North, Birmingham, AL, 35203-8180, (205) 257-1000. i. FERC Contact: Mark Carter, (678) 245-3083, mark[email protected] . j. Deadline for filing comments, motions to intervene, and... by the proposal. To mitigate for the construction of the seawall and bridge abutments, the permittee...

  17. 78 FR 30297 - Alabama Power Company; Notice of Application Accepted for Filing and Soliciting Comments, Motions...

    Science.gov (United States)

    2013-05-22

    ... Power Company, 600 18th Street North, Birmingham, AL, 35203-8180, (205) 257-1000. i. FERC Contact: Mark Carter, (678) 245-3083, mark[email protected] . j. Deadline for filing comments, motions to intervene, and... previously permitted the construction of 5 docks with associated concrete access pads and a playground inside...

  18. Formal and Informal Employment Growth in Manufacturing (India ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Agent(e) responsable du CRDI. Rodriguez, Mr. Edgard. Financement total. CAD$ 257,300. Pays. Asie du sud, Asie centrale, Extrême-Orient, Bangladesh, Inde. Chargé(e) de projet. Dr. Sandip Sarkar. Institution. Institute for Human Development. Pays d' institution. India. Extrants. Documents. Employment problem in India ...

  19. Croissance de l'emploi dans le secteur manufacturier (structuré et ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Agent(e) responsable du CRDI. Rodriguez, Mr. Edgard. Financement total. CAD$ 257,300. Pays. Asie du sud, Asie centrale, Extrême-Orient, Bangladesh, Inde. Chargé(e) de projet. Dr. Sandip Sarkar. Institution. Institute for Human Development. Pays d' institution. Inde. Extrants. Articles de revue. Income inequality in India ...

  20. Müllerian duct anomalies diagnosed by saline contrast sonohysterography

    DEFF Research Database (Denmark)

    Dreisler, Eva; Stampe Sørensen, Søren

    2014-01-01

    were eligible and accepted inclusion (429 pre- and 257 postmenopausal). Saline contrast sonohysterography (SCSH) was finally performed in 622 women (aged 20-74 years) (the procedure was impossible owing to cervical stenosis in 58, contraindicated in 2, other patient-related factors in 4). INTERVENTION...

  1. Namlouvání jako signifikantní znak proměn jedné podoby tradičních komunikací. (Poznámky k proměnám tradice ve výzkumné sondě mezi středoškolskou mládeží)

    Czech Academy of Sciences Publication Activity Database

    Navrátilová, Alexandra

    2008-01-01

    Roč. 56, č. 3 (2008), s. 257-276 ISSN 1335-1303 R&D Projects: GA AV ČR(CZ) IAA900580501 Institutional research plan: CEZ:AV0Z90580513 Keywords : courtship * secondary-school students * changes of tradition Subject RIV: AC - Archeology, Anthropology, Ethnology

  2. Proceedings – Mathematical Sciences | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    Home; Journals; Proceedings – Mathematical Sciences; Volume 115; Issue 3. Volume 115, Issue 3. August 2005, pages 241-369. pp 241-249. Some Properties of ... with some properties which are mathematically and statistically interesting. pp 251-257. Homeomorphisms and the Homology of Non-Orientable Surfaces.

  3. Proceedings – Mathematical Sciences | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    Home; Journals; Proceedings – Mathematical Sciences. Basudeb Datta. Articles written in Proceedings – Mathematical Sciences. Volume 112 Issue 2 May 2002 pp 257-281. Two-Dimensional Weak Pseudomanifolds on Eight Vertices · Basudeb Datta Nandini Nilakantan · More Details Abstract Fulltext PDF. We explicitly ...

  4. Fate in intermittent claudication

    DEFF Research Database (Denmark)

    Jelnes, Rolf; Gaardsting, O; Hougaard Jensen, K

    1986-01-01

    The fate of 257 consecutive patients (100 women) aged 36-85 years (mean 65) first seen with intermittent claudication in 1977 was analysed after a mean of 6.5 (SD 0.5) years. When first seen none of the patients complained of rest pain or had ulcers or gangrenous lesions on the feet. At follow up...

  5. Indirect searches for dark matter

    Indian Academy of Sciences (India)

    ... of almost-standard annihilating dark matter have brought along have been discussed. The main sources of uncertainties that affect this kind of searches are also listed. [Report number: Saclay T11/206, CERN-PH-TH/2011-257, extended version in arXiv:1202.1454], [Prepared for the Proceedings of Lepton–Photon 2011, ...

  6. Use of biocides for the control of fungal outbreaks in subterranean environments: The case of the Lascaux Cave in France

    Czech Academy of Sciences Publication Activity Database

    Martín-Sánchez, P.M.; Nováková, Alena; Bastian, F.; Alabouvette, C.; Saiz-Jimenez, C.

    2012-01-01

    Roč. 46, č. 7 (2012), s. 3762-3770 ISSN 0013-936X Grant - others:Spanish Ministry of Science and Innovation(ES) TCP CSD2007-00058 Institutional support: RVO:60077344 Keywords : fungal outbreaks * subterranean environments * Lascaux Cave Subject RIV: EH - Ecology, Behaviour Impact factor: 5.257, year: 2012

  7. Humor and College Adjustment: The Predictive Nature of Humor, Academic Achievement, Authoritative Parenting Styles on the Initial Adjustment of Male and Female First-Year College Students

    Science.gov (United States)

    Hickman, Gregory P.; Andrews, David W.

    2003-01-01

    A self-report questionnaire on academic achievement, birth order, and family structure; the Student Adaptation to College Questionnaire; the Parental Authority Questionnaire; and the Coping Humor Scale were administered to 257 first-year college students. Researchers examined the relationships among (a) authoritative parenting style, (b) family…

  8. The Predictive Nature of Humor, Authoritative Parenting Style, and Academic Achievement on Indices of Initial Adjustment and Commitment to College among College Freshmen

    Science.gov (United States)

    Hickman, Gregory P.; Crossland, Garnet L.

    2004-01-01

    Through the administration of self-report surveys, this study examined the relationships among a) parenting styles, b) family structure, c) academic achievement, d) birth order, e) gender, and f) humor on the initial personal-emotional, social, academic, and commitment to college adjustment among 257 first-quarter college freshmen. Multiple…

  9. Magnetoelasticity of UNi.sub.2./sub.Si.sub.2./sub..

    Czech Academy of Sciences Publication Activity Database

    Honda, F.; Oomi, G.; Andreev, Alexander V.; Sechovský, V.; Menovsky, A. A.

    259-261, - (1999), s. 256-257 ISSN 0921-4526 R&D Projects: GA AV ČR IAA1010614 Grant - others:GA UK(CZ) 40/97 Institutional research plan: CEZ:AV0Z1010914 Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 0.725, year: 1999

  10. The Semantic Gesture - an Invitation to a Journey from the Poetics to the Aesthetics of a Literary Work

    Czech Academy of Sciences Publication Activity Database

    Kubíček, Tomáš

    2007-01-01

    Roč. 4, č. 8 (2007), s. 244-257 ISSN 1214-7915 R&D Projects: GA ČR GA405/07/0077 Institutional research plan: CEZ:AV0Z90560517 Keywords : semantic gesture * structuralism * poetics * aesthetics * possible words Subject RIV: AJ - Letters, Mass-media, Audiovision

  11. Water Quality Management Studies, Alabama River, R. E. ’Bob’ Woodruff, William ’Bill’ Dannelly and Claiborne Lakes - August-December 1977.

    Science.gov (United States)

    1983-03-01

    249, 264, 277. BOKAGINACEAE (E) Heliotropium sp.: 48. VERBENAU1AE (E) Lippia lanceolata Michaux: 6, 10, 152. LAMIACEAE (E) Lycopus sp.: 54, 55, 57...257. CAMPANULACEAE (E) Sphenoclea zeylanica Caertn.: 9, 69, 92, 93. ASTERACEAE (E) Bidens sp.: 57, 58. (E) Eclipta alba (L.) Hassk.: 132, 142-146, 149

  12. Longitudinal Test of Self-Determination Theory's Motivation Mediation Model in a Naturally Occurring Classroom Context

    Science.gov (United States)

    Jang, Hyungshim; Kim, Eun Joo; Reeve, Johnmarshall

    2012-01-01

    This study provides the first longitudinally designed, classroom-based empirical test of self-determination theory's motivation mediation model. Measures of perceived autonomy support, motivation (autonomy need satisfaction), engagement, and achievement were collected from 500 (257 females, 243 males) 8th-grade students in Korea in a 3-wave…

  13. The Effects of Choice on Autonomous Motivation, Perceived Autonomy Support, and Physical Activity Levels in High School Physical Education

    Science.gov (United States)

    How, Yew Meng; Whipp, Peter R.; Dimmock, James A.; Jackson, Ben

    2013-01-01

    This study examined whether the provision of choice in physical education (PE) enhanced students' autonomous motivation, perceived autonomy support, and physical activity (PA) levels, relative to a "regular PE" control group. Students from eight intact high school PE classes ("N" = 257, M[subscript "age"] = 12.91)…

  14. To Ink or Not to Ink: The Meaning of Tattoos among College Students

    Science.gov (United States)

    Dickson, Lynda; Dukes, Richard L.; Smith, Hilary; Strapko, Noel

    2015-01-01

    We examine the process of getting a tattoo and its meaning among 195 tattooed and 257 non-tattooed undergraduates. Most tattooed respondents contemplate getting a tattoo for months, get a professional tattoo, can cover it easily, and like it. Respondents acquire first tattoos to represent important role transitions and as a form of identity and…

  15. Prevalence and drug resistance in bacteria of the urinary tract ...

    African Journals Online (AJOL)

    Objective: To obtain data on the prevalence of antibiotic resistance in bacteria isolated from patients with suspected urinary tract infection in Bulawayo province, Zimbabwe. Method: Over a period of one year, 257 urine samples were analyzed for bacteria by standard procedures. Antimicrobial susceptibility testing of isolated ...

  16. Impact of Calcium and Two Doses of Vitamin D on Bone Metabolism in the Elderly

    DEFF Research Database (Denmark)

    Rahme, Maya; Sharara, Sima Lynn; Baddoura, Rafic

    2017-01-01

    The optimal dose of vitamin D to optimize bone metabolism in the elderly is unclear. We tested the hypothesis that vitamin D, at a dose higher than recommended by the Institute of Medicine (IOM), has a beneficial effect on bone remodeling and mass. In this double-blind trial we randomized 257 ove...

  17. A tutorial survey of topics in wireless networking: Part II

    Indian Academy of Sciences (India)

    Kumar A, Kumar V 2005 Optimal association of stations and APs in an IEEE 802.11 WLAN. Proc. of the Nat. Conf. on Comm. Kumar A, Patil D 1997 Stability and Throughput analysis of CDMA-ALOHA with Finite number of users and code sharing. Telecomm. Systems (a Baltzer Science Journal) 8: 257–275. Kumar A, Altman ...

  18. Karpenkoite, Co.sub.3./sub.(V.sub.2./sub.O.sub.7./sub.)(OH).sub.2./sub..2H.sub.2./sub.O, a cobalt analogue of martyite from the Little Eva mine, Grand County, Utah, USA

    Czech Academy of Sciences Publication Activity Database

    Kasatkin, A.V.; Plášil, Jakub; Pekov, V.I.; Belakovskiy, D. I.; Nestola, F.; Čejka, J.; Vigasina, M.F.; Zorzi, F.; Thorne, B.

    2015-01-01

    Roč. 60, č. 4 (2015), s. 251-257 ISSN 1802-6222 R&D Projects: GA ČR GP13-31276P Institutional support: RVO:68378271 Keywords : karpenkoite * new mineral * cobalt divanadate * powder diffraction * Little Eva mine * Utah Subject RIV: DB - Geology ; Mineralogy Impact factor: 1.326, year: 2015

  19. Journal of Chemical Sciences | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    Author Affiliations. Romina A Frenzel1 Gustavo P Romanelli1 Mirta N Blanco1 Luis R Piz1. Centro de Investigación y Desarrollo en Ciencias Aplicadas ``Dr. Jorge J. Ronco” (CINDECA), CCT-LaPlata-CONICET, Facultad de Ciencias Exactas, Universidad Nacional de La Plata, 47 N° 257 (B1900AJK) La Plata, Argentina ...

  20. Temporal and spatial variations in particulate matter, particulate organic carbon and attenuation coefficient in Cochin Backwaters

    Digital Repository Service at National Institute of Oceanography (India)

    Devi, K.S.

    Nine stations over a stretch of 21 km of Periyar river estuary were sampled during January to December 1981. Particulate matter varied from 3-253 mg.1 super(1) at the surface and 24.8-257mg.1 super(1) at the bottom. Particulate organic carbon ranged...

  1. Biohydrology research after Landau 2013 conference

    Czech Academy of Sciences Publication Activity Database

    Lichner, Ľ.; Cerdà, A.; Rajkai, K.; Tesař, Miroslav

    2014-01-01

    Roč. 62, č. 4 (2014), s. 253-257 ISSN 0042-790X Institutional support: RVO:67985874 Keywords : biohydrology * hydrological research * biological and hydrological systems * hydrological processes Subject RIV: DA - Hydrology ; Limnology Impact factor: 1.486, year: 2014

  2. Distribution of elements among minerals of a single (muscovite-) biotite granite sample – an optimal approach and general implications

    Czech Academy of Sciences Publication Activity Database

    Janoušek, V.; Navrátil, Tomáš; Trubač, J.; Strnad, J.; Laufek, F.; Minařík, Luděk

    2014-01-01

    Roč. 65, č. 4 (2014), s. 257-271 ISSN 1335-0552 Institutional research plan: CEZ:AV0Z30130516 Institutional support: RVO:67985831 Keywords : modal analyses * trace-element residence * ICP-MS * Central Bohemian Plutonic Complex * Říčany granite Subject RIV: DD - Geochemistry Impact factor: 0.761, year: 2014

  3. Mitogenomic phylogenetics of the bank vole Clethrionomys glareolus, a model system for studying end-glacial colonization of Europe

    Czech Academy of Sciences Publication Activity Database

    Filipi, Karolína; Marková, Silvia; Searle, J. B.; Kotlík, Petr

    2015-01-01

    Roč. 82, PA (2015), s. 245-257 ISSN 1055-7903 R&D Projects: GA ČR GAP506/11/1872 Institutional support: RVO:67985904 Keywords : adaptation * glacial refugia * mitogenome * mtDNA * Myodes glareolus * Numt Subject RIV: EG - Zoology Impact factor: 3.792, year: 2015

  4. Journal of Genetics | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    Home; Journals; Journal of Genetics. Sabrina Scherillo. Articles written in Journal of Genetics. Volume 89 Issue 2 August 2010 pp 253-257 Research Note. Genetic fingerprint of microorganisms associated with the deterioration of an historical tuff monument in Italy · Bruna De Felice Vincenzo Pasquale Nicola Tancredi ...

  5. Role of vanadium and pyridine in heteropolycompounds for ...

    Indian Academy of Sciences (India)

    Calle 47 Nro 257, B1900AJK La Plata, Argentina. bFacultad de Ciencias ... amount of inorganic waste and is not environmentally attractive. .... a wavenumber resolution of 4cm. −1 . The solids were ground and mixed with BrK, previously dried in a stove, and pellets were formed. The measuring range was. 400–4000 cm. −1.

  6. EST Table: AV403752 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV403752 pg--0009 10/09/28 100 %/257 aa ref|YP_002411376.1| terminase large subunit (DNA packaging... protein A) from bacteriophage origin [Escherichia coli UMN026] emb|CAR11828.1| terminase large subunit (DNA packaging

  7. Extraction and Configuration of an Isolate from Chrysanthellum ...

    African Journals Online (AJOL)

    MBI

    2014-09-23

    Sep 23, 2014 ... ABSTRACT. Bioactivity guided column chromatography of the ethylacetate fraction of the plant chrysanthellum indicum led to the isolation of a white chrystaline compound which melted at a temperature range of (257-259°C) with decomposition 1H nmr, 13C nmr, DEPT and IR spectroscopic techniques ...

  8. Solute aggregation in dilute aqueous solutions of tetramethylurea

    Czech Academy of Sciences Publication Activity Database

    Almásy, L.; Len, A.; Székely, N. K.; Pleštil, Josef

    2007-01-01

    Roč. 257, č. 1 (2007), s. 114-119 ISSN 0378-3812 Institutional research plan: CEZ:AV0Z40500505 Keywords : non-ideal mixture * TMU * concentration fluctuation Subject RIV: CD - Macromolecular Chemistry Impact factor: 1.506, year: 2007

  9. 78 FR 29364 - Exelon Corporation, Exelon Wind 1, LLC, Exelon Wind 2, LLC, Exelon Wind 3, LLC, Exelon Wind 4...

    Science.gov (United States)

    2013-05-20

    ...-005, QF07-257-004] Exelon Corporation, Exelon Wind 1, LLC, Exelon Wind 2, LLC, Exelon Wind 3, LLC, Exelon Wind 4, LLC, Exelon Wind 5, LLC, Exelon Wind 6, LLC, Exelon Wind 7, LLC, Exelon Wind 8, LLC, Exelon Wind 9, LLC, Exelon Wind 10, LLC, Exelon Wind 11, LLC, High Plains Wind Power, LLC v. Xcel Energy...

  10. Factors influencing observed and self-reported functional ability in women with chronic widespread pain: A cross-sectional study

    DEFF Research Database (Denmark)

    Amris, Kirstine; Wæhrens, Eva Ejlersen; Stockmarr, Anders

    2014-01-01

    -sectional with systematic data collection in a clinical setting. Subjects: A total of 257 consecutively enrolled women with chronic widespread pain. Methods: Multidimensional assessment using self-report and observation-based assessment tools identified to cover ICF categories included in the brief ICF Core Set for chronic...

  11. Muzejní zlomek s opisem Evangelia sv. Matouše s homiliemi

    Czech Academy of Sciences Publication Activity Database

    Voleková, Kateřina

    2017-01-01

    Roč. 140, 1/2 (2017), s. 247-257 ISSN 0024-4457 R&D Projects: GA ČR GA15-06405S Institutional support: RVO:68378092 Keywords : Old Czech * Bible * translation * manuscript Subject RIV: AI - Linguistics OBOR OECD: Linguistics

  12. Jazykový purismus v Čechách a v Lužici v poslední třetině 19. a v první třetině 20. století

    Czech Academy of Sciences Publication Activity Database

    Brankatschk, Katja; Martínek, František; Futtera, Ladislav

    2017-01-01

    Roč. 100, č. 4 (2017), s. 243-257 ISSN 0027-8203 R&D Projects: GA ČR GA16-10866S Institutional support: RVO:68378017 Keywords : Czech * Sorbian * national revival * purism * standardisation Subject RIV: AI - Linguistics OBOR OECD: Specific languages

  13. Differences in students' school motivation : A latent class modelling approach

    NARCIS (Netherlands)

    Korpershoek, Hanke; Kuyper, Hans; van der Werf, Greetje

    In this study, we investigated the school motivation of 7,257 9th grade students in 80 secondary schools across the Netherlands. Using a multiple goal perspective, four motivation dimensions were included: performance, mastery, extrinsic, and social motivation. Our first aim was to identify distinct

  14. Assessment of surface water resources availability using catchment modelling and the results of tracer studies in the mesoscale Migina Catchment, Rwanda

    NARCIS (Netherlands)

    Munyaneza, O.; Mukubwa, A.; Maskey, S.; Uhlenbrook, S.; Wenninger, J.W.

    2014-01-01

    In the present study, we developed a catchment hydrological model which can be used to inform water resources planning and decision making for better management of the Migina Catchment (257.4 km2). The semi-distributed hydrological model HEC-HMS (Hydrologic Engineering Center – the Hydrologic

  15. 75 FR 80013 - Radio Broadcasting Services; Jewett, TX

    Science.gov (United States)

    2010-12-21

    ... Information Center, Portals II, 445 12th Street, SW., Room CY-A257, Washington, DC 20554. The complete text of... Printing, Inc., 445 12th Street, SW., Room CY-B402, Washington, DC 20554, (800) 378-3160, or via the...

  16. Nicola Michelassi y Salomé Vuelta García, Il teatro spagnolo a Firenze nel Seicento. Vol. I: Giacinto Andrea Cicognini, Giovan Battista Ricciardi, Pietro Susini, Mattias Maria Bartolommei

    Directory of Open Access Journals (Sweden)

    Diego Símini

    2015-01-01

    Full Text Available Reseña de Nicola Michelassi y Salomé Vuelta García, Il teatro spagnolo a Firenze nel Seicento. Vol. I: Giacinto Andrea Cicognini, Giovan Battista Ricciardi, Pietro Susini, Mattias Maria Bartolommei, Alinea (Secoli d’Oro, 67; Commedia Aurea Spagnola e Pubblico Italiano, VIII, Florencia, 2013, 257 pp. ISBN: 9788860557865.

  17. Sadhana | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    Home; Journals; Sadhana. G Anandalingam. Articles written in Sadhana. Volume 30 Issue 2-3 April-June 2005 pp 257-274. Pricing strategies for information goods · Siva Viswanathan G Anandalingam · More Details Abstract Fulltext PDF. Digital or information goods are becoming the norm across a wide variety of ...

  18. Functioning Before and After Total Hip or Knee Arthroplasty

    NARCIS (Netherlands)

    I.B. de Groot (Ingrid)

    2009-01-01

    textabstractOsteoarthritis (OA) of the hip or knee is a common locomotor disease characterized by degradation of articular cartilage. In the Netherlands, in the year 2000 about 257,400 persons above the age of 55 years had hip OA and about 335,700 persons had knee OA. Because the prevalence of OA

  19. Sadhana | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    Home; Journals; Sadhana. Siva Viswanathan. Articles written in Sadhana. Volume 30 Issue 2-3 April-June 2005 pp 257-274. Pricing strategies for information goods · Siva Viswanathan G Anandalingam · More Details Abstract Fulltext PDF. Digital or information goods are becoming the norm across a wide variety of ...

  20. Mizan Law Review - Vol 4, No 2 (2010)

    African Journals Online (AJOL)

    From Tenuous Legal Arguments to Securitization and Benefit Sharing: Hegemonic Obstinacy – The Stumbling Block against Resolution of the Nile Waters Question · EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT · DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. DZ Mekonnen, 232-257.

  1. Detection of ultra-high energy cosmic ray showers with a single-pixel fluorescence telescope

    Czech Academy of Sciences Publication Activity Database

    Fujii, T.; Malacari, M.; Bertaina, M.; Casolino, E.; Dawson, B.; Horváth, P.; Hrabovský, M.; Jiang, J.; Mandát, Dušan; Matalon, A.; Matthews, J.N.; Motloch, P.; Palatka, Miroslav; Pech, Miroslav; Privitera, P.; Schovánek, Petr; Takizawa, Y.; Thomas, S.B.; Trávníček, Petr; Yamazaki, K.

    2016-01-01

    Roč. 74, Feb (2016), s. 64-72 ISSN 0927-6505 R&D Projects: GA MŠk(CZ) LG13007 Institutional support: RVO:68378271 Keywords : ultra-high energy cosmic rays * fluorescence detector * extensive air shower Subject RIV: BF - Elementary Particles and High Energy Physics Impact factor: 3.257, year: 2016

  2. Maximum entropy analysis of cosmic ray composition

    Czech Academy of Sciences Publication Activity Database

    Nosek, D.; Ebr, Jan; Vícha, Jakub; Trávníček, Petr; Nosková, J.

    2016-01-01

    Roč. 76, Mar (2016), s. 9-18 ISSN 0927-6505 R&D Projects: GA ČR(CZ) GA14-17501S Institutional support: RVO:68378271 Keywords : ultra-high energy cosmic rays * extensive air showers * cosmic ray composition Subject RIV: BF - Elementary Particles and High Energy Physics Impact factor: 3.257, year: 2016

  3. Fabrication and stability of fiber bragg gratings for WDM applications using a 266 nm cw-laser

    DEFF Research Database (Denmark)

    Deyerl, Hans-Jürgen; Sørensen, Henrik Rokkjær; Jensen, Jesper Bo Damm

    2003-01-01

    Diode pumped continuous wave all solid state UV-lasers operating at 266 nm offer an interesting alternative to frequency doubled argon ion lasers. We compare photosensitivity, UV-writing of Bragg gratings and thermal decay at 244, 257 and 266 nm....

  4. Mechanistic Study of 17 alpha-Ethinylestradiol Biodegradation by Pleurotus ostreatus: Tracking of Extracelullar and Intracelullar Degradation Mechanisms

    Czech Academy of Sciences Publication Activity Database

    Křesinová, Zdena; Moeder, M.; Ezechiáš, Martin; Svobodová, Kateřina; Cajthaml, Tomáš

    2012-01-01

    Roč. 46, č. 24 (2012), s. 13377-13385 ISSN 0013-936X R&D Projects: GA TA ČR TA01020804; GA ČR GAP503/10/0408 Institutional support: RVO:61388971 Keywords : WHITE-ROT FUNGI * ENDOCRINE-DISRUPTING CHEMICALS * PERSONAL CARE PRODUCTS Subject RIV: EE - Microbiology, Virology Impact factor: 5.257, year: 2012

  5. Liposomal formulation of alpha-tocopheryl maleamide: In vitro and in vivo toxicological profile and anticancer effect against spontaneous breast carcinomas in mice

    Czech Academy of Sciences Publication Activity Database

    Turánek, J.; Wang, X. F.; Knötigová, P.; Koudelka, Š.; Dong, L. F.; Vrublová, E.; Mahdavian, E.; Procházka, L.; Sangsura, S.; Vacek, A.; Salvatore, B. A.; Neužil, Jiří

    2009-01-01

    Roč. 237, č. 3 (2009), s. 249-257 ISSN 0041-008X R&D Projects: GA AV ČR KAN200520703; GA AV ČR(CZ) IAA500520602 Institutional research plan: CEZ:AV0Z50520701 Keywords : Liposome * apoptosis * vitamin E analogues Subject RIV: FR - Pharmacology ; Medidal Chemistry Impact factor: 3.359, year: 2009

  6. Regioselective alcoholysis of silychristin acetates catalyzed by lipases

    Czech Academy of Sciences Publication Activity Database

    Vavříková, Eva; Gavezzotti, P.; Purchartová, Kateřina; Fuksová, Kateřina; Biedermann, David; Kuzma, Marek; Riva, S.; Křen, Vladimír

    2015-01-01

    Roč. 16, č. 6 (2015), s. 11983-11995 E-ISSN 1422-0067 R&D Projects: GA ČR(CZ) GA15-03037S; GA MŠk(CZ) LD14096; GA MŠk LH13097 Institutional support: RVO:61388971 Keywords : acetylation * alcoholysis * lipase Subject RIV: CC - Organic Chemistry Impact factor: 3.257, year: 2015

  7. Steroid implants and markers of bone turnover in steers | Knetter ...

    African Journals Online (AJOL)

    Thirty-two crossbred yearling steers were given one of four treatments to determine whether these markers of bone turnover could be detected and reflect steroid-induced bone maturity in the periphery: non-implanted controls; 25.7 mg estradiol-17β (E2); 120 mg trenbolone acetate (TBA); or 120 mg TBA and 24 mg E2 (T+E) ...

  8. Signature of the last ice age in the present subsurface temperatures in the Czech Republic and Slovenia

    Czech Academy of Sciences Publication Activity Database

    Šafanda, Jan; Rajver, D.

    2001-01-01

    Roč. 29, 3/4 (2001), s. 241-257 ISSN 0921-8181 R&D Projects: GA ČR GA205/97/0900 Institutional research plan: CEZ:AV0Z3012916 Keywords : glacial temperature contrast * interglacial temperature contrast * borehole temperatures * Central Europe Subject RIV: DC - Siesmology, Volcanology, Earth Structure Impact factor: 1.381, year: 2001

  9. Irregular Breakfast Eating and Associated Health Behaviors: A Pilot Study among College Students

    Science.gov (United States)

    Thiagarajah, Krisha; Torabi, Mohammad R.

    2009-01-01

    The purpose of this study was to examine prevalence of eating breakfast and associated health compromising behaviors. This study utilized a cross-sectional survey methodology. A purposive cluster sampling technique was utilized to collect data from a representative sample of college students in a Midwestern university in the U.S. A total of 1,257

  10. The seasonal distribution of airborne fungi in two hospitals in Istanbul

    African Journals Online (AJOL)

    Among the 257 micro fungi isolated from this hospital, the most common species were Alternaria alternata (25.8%), Cladosporium cladosporioides (21.9%), Penicillium glabrum (12.9%), Penicillium brevicompactum (7.4%) and Cladosporium herbarum (3.9%). In KYSH, the highest number of fungi was isolated in summer ...

  11. Md Maidul Islam

    Indian Academy of Sciences (India)

    Home; Journals; Journal of Chemical Sciences. Md Maidul Islam. Articles written in Journal of Chemical Sciences. Volume 122 Issue 2 March 2010 pp 247-257 Full Papers. DNA minor groove binding of small molecules: Experimental and computational evidence · Prateek Pandya Md Maidul Islam G Suresh Kumar B ...

  12. 40 CFR 63.1990 - What definitions apply to this subpart?

    Science.gov (United States)

    2010-07-01

    ... subpart A of this part, and this section that follows: Bioreactor means a MSW landfill or portion of a MSW... receive other types of RCRA Subtitle D wastes (see § 257.2 of this chapter) such as commercial solid waste...

  13. Assessing and Minimizing Adversarial Risk in a Nuclear Material Transportation Network

    Science.gov (United States)

    2013-09-01

    SCHOOL September 2013 Author: Bradford S. Foster Approved by: R. Kevin Wood Thesis Advisor Kyle Y. Lin Second Reader Robert F. Dell Chair, Department of...Boulder Milliken WELD LARIMER BOULDER JEFFERSON ADAMS DOUGLAS PARK ARAPAHOE DENVER ELBERT GILPIN CLEARHCREEK BROOMFIELD Æ·83 Æ·257 Æ·88 ¦̈§76 ¦̈§25

  14. Frequency versus Importance: Language Learning Strategy Use in the EFL Classroom

    Science.gov (United States)

    Agazade, Ali Sidki; Vefali, Gulsen Musayeva

    2014-01-01

    In recent decades, there has been a plethora of studies on language learning strategies (LLS hereafter). However, the research to date has mostly examined students' views on LLS, and there are few studies reflecting teachers' views. In contrast, this study surveyed 257 EFL students and 12 teachers to explore their views on the frequency and…

  15. Zmenšení dynamických účinků na předpjatých mostech

    Czech Academy of Sciences Publication Activity Database

    Frýba, Ladislav

    2005-01-01

    Roč. 14, č. 9 (2005), s. 257-260 ISSN 1210-4027 R&D Projects: GA MDS (CZ) 1F45D/013/120 Institutional research plan: CEZ:AV0Z20710524 Keywords : prestressed bridges * dynamics * prestressed strings Subject RIV: JM - Building Engineering

  16. Browse Title Index

    African Journals Online (AJOL)

    Items 201 - 250 of 257 ... Vol 30 (2001), The effects of unavailability of technical storage facilities to the marketing of fruits and vegetables for economic development in Morogoro .... Vol 42, No 2 (2014), Towards assessing managerial competencies and leadership styles required for successful game ranch management in the ...

  17. 78 FR 15669 - Marine Mammals: Alaska Harbor Seal Habitats

    Science.gov (United States)

    2013-03-12

    ... alone while the mother feeds and should not be disturbed. Need for Increased Harbor Seal Management in... was: Tracy Arm fjord, 257 visits; Disenchantment Bay, 125 visits; and College Fjord, 39 visits (Cruise... the five most heavily visited sites--Tracy Arm, Endicott Arm, College Fjord, and Disenchantment Bay...

  18. Implicit Racial Biases in Preschool Children and Adults from Asia and Africa

    Science.gov (United States)

    Qian, Miao K.; Heyman, Gail D.; Quinn, Paul C.; Messi, Francoise A.; Fu, Genyue; Lee, Kang

    2016-01-01

    This research used an Implicit Racial Bias Test to investigate implicit racial biases among 3- to 5-year-olds and adult participants in China (N = 213) and Cameroon (N = 257). In both cultures, participants displayed high levels of racial biases that remained stable between 3 and 5 years of age. Unlike adults, young children's implicit racial…

  19. Performance of commercial laying hen genotypes on free range and organic farms in Switzerland, France and The Netherlands

    NARCIS (Netherlands)

    Leenstra, F.R.; Maurer, V.; Bestman, M.W.P.; Sambeek van, F.; Zeltner, E.; Reuvekamp, B.F.J.; Galea, F.; Niekerk, van T.G.C.M.

    2012-01-01

    1. A total of 257 farmers with free ranging laying hens (organic and conventional) in Switzerland, France and The Netherlands with 273 flocks were interviewed to determine the relationships between the genotype of the hens, management conditions and performance. 2. Almost 20 different genotypes

  20. Fulltext PDF

    Indian Academy of Sciences (India)

    Synchronization enhancement via an oscillatory bath in a network of self-excited cells. B R Nana Nbendjo, H G Enjieu Kadji and Hilda A Cerdeira. 257–272 ... Distribution of level spacing ratios using one- plus two-body random matrix ensembles. N D Chavda. 309–316. Analysing correlations after the financial crisis of 2008 ...

  1. Stability of Scores on the Junior Eysenck Personality Inventory in an Outpatient Population.

    Science.gov (United States)

    Gabrys, Jan Bernard

    1980-01-01

    This paper reports a test-retest study of the Junior Eysenck Personality Inventory for 257 children, ages 7-16, receiving psychological services in a British Columbia public health facility. Findings support the test author's claims over a 30-day period of relative score stability on extraversion and neuroticism. (Author/SJL)

  2. The Effects of Stress on Judgement and Decision Making: An Annotated Bibliography.

    Science.gov (United States)

    1991-06-01

    matrix and the representative design of experiments. Psychological Bulletin, 100(2), 257-269. -26- LEVI, A., & TLWM, P. E. (1980). A cognitive...pattern is defensive avoidance [whereby the decision maker escapes the conflict by procrastinating , shifting responsibility to smone else, or

  3. Prediction of Improved Performance of Catalytic Hydrogenation Reactor by Periodic Modulation of the Feed Rate

    Czech Academy of Sciences Publication Activity Database

    Staněk, Vladimír; Hanika, Jiří; Jiřičný, Vladimír; Stavárek, Petr; Tukač, V.; Lederer, J.

    2009-01-01

    Roč. 23, č. 3 (2009), s. 251-257 ISSN 1451-9372 R&D Projects: GA MPO FT-TA/039 Institutional research plan: CEZ:AV0Z40720504 Keywords : trickle bed * feed modulation * catalytic reactor Subject RIV: CI - Industrial Chemistry, Chemical Engineering

  4. 77 FR 30904 - Connect America Fund; A National Broadband Plan for Our Future; Establishing Just and Reasonable...

    Science.gov (United States)

    2012-05-24

    ... advantage of the Covered Locations exception: The competitive ETC Dobson Communications, which was acquired... for competitive carriers serving remote areas of Alaska. We also clarify that the framework... available for public inspection during regular business hours in the FCC Reference Center, Room CY-A257, 445...

  5. Disablist Bullying in Northern Ireland and the Republic of Ireland: An Investigation of Student Teachers' Knowledge, Experience and Confidence

    Science.gov (United States)

    Purdy, Noel; Mc Guckin, Conor

    2014-01-01

    This study explored the knowledge, experience and confidence of student teachers from Northern Ireland and the Republic of Ireland in relation to disablist bullying. Adopting a mixed methodological approach of four focus groups (N = 18) and a pencil-and-paper questionnaire (N = 257), the study explored the students knowledge, experience and…

  6. Perceptions of Contextual Features Related to Implementation and Sustainability of School-Wide Positive Behavior Support

    Science.gov (United States)

    McIntosh, Kent; Predy, Larissa K.; Upreti, Gita; Hume, Amanda E.; Turri, Mary G.; Mathews, Susanna

    2014-01-01

    The purpose of this study was to assess the perceived importance of specific contextual variables for initial implementation and sustainability of School-Wide Positive Behavior Support (SWPBS). A large, national sample of 257 school team members completed the "School-Wide Universal Behavior Sustainability Index: School Teams", a…

  7. Anxiety and Depression in Breast Cancer Survivors of Different Sexual Orientations

    Science.gov (United States)

    Boehmer, Ulrike; Glickman, Mark; Winter, Michael

    2012-01-01

    Objective: We conducted a study comparing anxiety and depression by sexual orientation in long-term breast cancer survivors, testing the hypothesis that sexual minority women (e.g., lesbian and bisexual women) have greater levels of anxiety and depression. Method: From a state cancer registry, we recruited 257 heterosexual and 69 sexual minority…

  8. The Self-Esteem, Perceived Social Support and Hopelessness in Adolescents: The Structural Equation Modeling

    Science.gov (United States)

    Savi Cakar, Firdevs; Karatas, Zeynep

    2012-01-01

    In this study, a developed model to explain a causal relationship between adolescent's self-esteem, perceived social support and hopelessness is tested. The purpose of the study is to explore the relationship between self-esteem, perceived social support and hopelessness in adolescents. A total of 257 adolescents, including 143 female and 114…

  9. Cost-utility of quadrivalent versus trivalent influenza vaccine in Brazil – comparison of outcomes from different static model types

    Directory of Open Access Journals (Sweden)

    Laure-Anne Van Bellinghen

    2018-01-01

    Conclusion: All three models predicted a cost per quality-adjusted life year gained for quadrivalent versus trivalent influenza vaccine in the range of R$19,257 (FLORENCE to R$22,768 (FLORA with the best available data in Brazil (Appendix A.

  10. Growth responses of NaCl stressed rice (Oryza sativa L.) plants ...

    African Journals Online (AJOL)

    GREGORY

    2010-09-27

    Sep 27, 2010 ... Mirza RA, Mahmood K (1986). Comparative effect of sodium chloride and sodium bicarbonate on germination, growth and ion accumu- lation in Phaseolus aureus, Roxb, c.v. 6601. Biologia. 32: 257-268. Montgomery R (1961). Further studies of the phenol sulphuric acid reagent for carbohydrates, Biochem.

  11. Making Dutch pupils media conscious: preadolescents' self-assessment of possible media risks and the need for media education

    NARCIS (Netherlands)

    Küter-Luks, Theresa; Heuvelman, A.; Peters, O.

    2011-01-01

    Despite clear European and Dutch policies about media education, there is currently no media education curriculum in Dutch schools. A survey among preadolescents (n = 257) in six primary schools in the Netherlands included questions regarding media access, fears, risks, parental mediation of

  12. Browse Title Index

    African Journals Online (AJOL)

    Items 151 - 200 of 257 ... Vol 35 (2006), Partnering, poverty reduction and rural enterprise advancement, Abstract PDF. FS Lategan, GJ Raats. Vol 44, No 2 (2016), Perceptions of extension advisors on privatization and outsourcing as an option for development paradigm in Limpopo Province and the lessons for future, Abstract ...

  13. Posouzení vlivu simulovaného poškození listové plochy na výnos a kvalitu cukrovky

    Czech Academy of Sciences Publication Activity Database

    Cerkal, R.; Dvořák, J.; Kamler, Jiří; Hřivna, L.

    2006-01-01

    Roč. 122, 9-10 (2006), s. 257-261 ISSN 1210-3306 R&D Projects: GA MZe QF4192 Institutional research plan: CEZ:AV0Z60930519 Keywords : sugar beet Subject RIV: GF - Plant Pathology, Vermin, Weed, Plant Protection Impact factor: 0.078, year: 2004

  14. Bioprospecting for culturable actinobacteria with antimicrobial ...

    African Journals Online (AJOL)

    these results, 257 isolates were able to inhibit pigment production in C. violaceum without altering the growth of bacteria, which represents an enormous potential, representing an alternative to the use of antibiotics and their induced resistance [22]. In this area,. Actinobacteria are of interest due to their capacity to produce ...

  15. Article 2 - Lagos

    African Journals Online (AJOL)

    on commercial real estate investments in percentage against the change of inflation ... are into direct real estate investment should look more at office properties ..... Agency. 35(33.3%). Valuation. 30(28.6%). Development. 4(3.8%). Others. -. 105(100%). Size of property mgt portfolio. Small(1-10). 2(5.7%). Medium. (11-50).

  16. Drug: D04478 [KEGG MEDICUS

    Lifescience Database Archive (English)

    Full Text Available D04478 Drug Hydroxypropylcellulose (JP17); Hydroxypropyl cellulose (NF); Low substituted hydroxypropylcellu...lose (JP17); Lacrisert (TN) ... CAS: 9004-64-2 PubChem: 47206330 DrugBank: DB00840 NIKKAJI: J257.400D ...

  17. Internal Structure of DISCOVER: A Performance-based Assessment.

    Science.gov (United States)

    Sarouphim, Ketty M.

    2000-01-01

    A study involving 257 Navajo and Mexican-American elementary students investigated the internal structure of the DISCOVER assessment, a performance-based assessment grounded in Gardner's theory of multiple intelligence. Results showed low interrating correlations among the five assessment activities, indicating students gifted in one intelligence…

  18. Verification and Validation Data for Computational Unsteady Aerodynamics (Donnees de verification et de valadation pour l’aerodynamique instationnaire numerique)

    Science.gov (United States)

    2000-10-01

    by R.M. Bennett 10. Supersonic 2D Wing with Control Surfaces 257 by P. Naudin v 11E. RAE Tests on AGARD Tailplane 271 by I.W. Kaynes 12. NAL SST...Quai Marcel Dassault Glasgow, G12 8QQ, Scotland Cedex 300 M.J. de C. Henshaw92214 Saint Cloud British Aerospace (Operations) Ltd. P. Naudin Military

  19. Analysis of Principals' Managerial Competencies for Effective Management of School Resources in Secondary Schools in Anambra State, Nigeria

    Science.gov (United States)

    Victor, Akinfolarin Akinwale

    2017-01-01

    This study analyses principals' managerial competencies for effective management of school resources in secondary schools in Anambra State. The study was conducted in Anambra State. The study population comprised 257 principals in public secondary schools in the State. The study adopted a descriptive survey design. A 24 items researcher developed…

  20. Finding clues to the riddle of sex determination in zebrafish

    Indian Academy of Sciences (India)

    2016-02-11

    Feb 11, 2016 ... 2013). Bradley et al. identified 2 sex linked loci in ABXIN cross. (Bradley et al. 2011). One of the loci was on chromosome 5 encompassing the gene dmrt1. Two SNPs within dmrt1 gene were suggested ..... 22 R257–R262. Gilchrist RB, Ritter LJ and Armstrong DT 2004 Oocyte-somatic cell interactions during ...

  1. Predictors of Secondary Traumatic Stress among Children's Advocacy Center Forensic Interviewers

    Science.gov (United States)

    Bonach, Kathryn; Heckert, Alex

    2012-01-01

    This study examined various predictor variables that were hypothesized to impact secondary traumatic stress in forensic interviewers (n = 257) from children's advocacy centers across the United States. Data were examined to investigate the relationship between organizational satisfaction, organizational buffers, and job support with secondary…

  2. Development of Creative Behavior Observation Form: A Study on Validity and Reliability

    Science.gov (United States)

    Dere, Zeynep; Ömeroglu, Esra

    2018-01-01

    This study, Creative Behavior Observation Form was developed to assess creativity of the children. While the study group on the reliability and validity of Creative Behavior Observation Form was being developed, 257 children in total who were at the ages of 5-6 were used as samples with stratified sampling method. Content Validity Index (CVI) and…

  3. 76 FR 81004 - Culturally Significant Objects Imported for Exhibition Determinations: “Woman in Blue, Against...

    Science.gov (United States)

    2011-12-27

    ... DEPARTMENT OF STATE [Public Notice: 7739] Culturally Significant Objects Imported for Exhibition Determinations: ``Woman in Blue, Against Blue Water'' by Edvard Munch SUMMARY: Notice is hereby given of the..., Delegation of Authority No. 257 of April 15, 2003), I hereby determine that the object ``Woman in Blue...

  4. PER 2006 (1) Kotze - article

    African Journals Online (AJOL)

    Dr Tanya du Plessis

    Environmental governance in the 21st century in South Africa faces serious challenges in terms of improving ... 2 For a comprehensive discussion on fragmentation of the South African environmental law regime, see CEM Report ...... Holistic Governance 32. 98 Crowther (ed) Oxford Advanced Learner's Dictionary 219, 257.

  5. Institutionalizing Evaluation Training in Universities in South Asia ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Agent(e) responsable du CRDI. Wind, Tricia. Financement total. CAD$ 257,800. Pays. Asie du sud, Asie centrale, Extrême-Orient, Bangladesh, Inde, Pakistan. Chargé(e) de projet. Soma De Silva. Institution. Sri Lanka Evaluation Association. Pays d' institution. Sri Lanka. Site internet. http://www.sleva.lk. Contenus connexes ...

  6. Evaluation of the performance of three varieties of upland rice in ...

    African Journals Online (AJOL)

    The performances of three different varieties of improved upland rice (ITA 257; EX-CHINA; ITA 315) were evaluated in a 2 year study under Abakaliki environmental condition. The design of the experiment was a randomized complete Block Design with 3 replications. ITA 315 and EX-China, on the average, had greater ...

  7. Effects of slope position and fertilization on the performance of ...

    African Journals Online (AJOL)

    FARO 45 (ITA 257) early maturing upland variety of rice was used as the test crop at each slope level. The experiment was a 3 x 2 factorial combination of three slopes (upper, middle and hydromorphic fringe) and two fertilizations (without fertilizer and with fertilizer) in a Randomized Complete Block Design (RCBD), ...

  8. Strong overtones and combination bands in ultraviolet resonance Raman spectroscopy

    NARCIS (Netherlands)

    Efremov, E.V.; Ariese, F.; Mank, A.J.G.; Gooijer, C.

    2006-01-01

    Ultraviolet resonance Raman spectroscopy is carried out using a continuous wave frequency-doubled argon ion laser operated at 229, 244, and 257 nm in order to characterize the overtones and combination bands for several classes of organic compounds in liquid solutions. Contrary to what is generally

  9. Maybe it's not Python that sucks, maybe it's my code

    CERN Multimedia

    CERN. Geneva

    2015-01-01

    Did you know that in Python integers from -5 to 257 are preallocated? Reusing them 1000 times, instead of allocating memory for a bigger integer, saves a whopping 1 millisecond of code's execution time! Isn't that thrilling? Well, before you get that crazy, learn some basic performance tricks that you can start using today.

  10. Sex of calf and age of dam adjustment factors for birth and weaning ...

    African Journals Online (AJOL)

    Records on 2 257 Composite and 5 923 Tswana calves born between the period of 1988 and 2006 in Botswana were used to calculate additive correction factors for the effects of sex of calf and age of dam on birth weight and weaning weight. The mature age group in both breeds for the two growth characteristics was 5 ...

  11. 40 CFR 799.9537 - TSCA in vitro mammalian chromosome aberration test.

    Science.gov (United States)

    2010-07-01

    .... A report from ICPEMC Task Group 9. Mutation Research 257, 147-204 (1991). (5) Morita, T. et al.... (iii) Preparation of cultures—(A) Established cell lines and strains. Cells are propagated from stock... separately and reported but generally not included in the total aberration frequency. (ii) Concurrent...

  12. Comparison of the genome sequences and the phylogenetic ...

    Indian Academy of Sciences (India)

    Home; Journals; Journal of Biosciences; Volume 25; Issue 3. Comparison of the genome sequences and the phylogenetic analyses of the GP78 and the Vellore P20778 isolates of Japanese encephalitis virus from India. Sudhanshu Vrati. Articles Volume 25 Issue 3 September 2000 pp 257-262 ...

  13. Temperature retrieval from Rayleigh-Brillouin scattering profiles measured in air

    NARCIS (Netherlands)

    Witschas, B.; Ubachs, W.M.G.

    2014-01-01

    In order to investigate the performance of two different algorithms for retrieving temperature from Rayleigh-Brillouin (RB) line shapes, RB scattering measurements have been performed in air at a wavelength of 403 nm, for a temperature range from 257 K to 330 K, and atmospherically relevant

  14. Chronopotentiometric sensing of anterior gradient 2 protein

    Czech Academy of Sciences Publication Activity Database

    Vargová, Veronika; Hrstka, R.; Hernychová, L.; Coufalová, D.; Ostatná, Veronika

    2017-01-01

    Roč. 240, JUN2017 (2017), s. 250-257 ISSN 0013-4686 R&D Projects: GA ČR(CZ) GA13-00956S Institutional support: RVO:68081707 Keywords : catalyzed hydrogen evolution * mercury -electrodes * affinity tags Subject RIV: CG - Electrochemistry OBOR OECD: Electrochemistry (dry cells, batteries, fuel cells, corrosion metals, electrolysis) Impact factor: 4.798, year: 2016

  15. Download this PDF file

    African Journals Online (AJOL)

    2.57). Subject matter dreds ºf relevance and cºmpetence have been identified. There are several ... in production, processing and marketing of a particular crop or livestock. This system tended to emphasize more of competency in subject ...

  16. Effects of plant tannin extracts supplementation on animal performance and gastrointestinal parasites infestation in steers grazing winter wheat

    Science.gov (United States)

    Twenty-six stocker cattle (286.1 ± 25.7 kg) were used to quantify the effect of commercial plant tannin extracts (control vs. mimosa and chestnut tannins) on animal performance, gastrointestinal parasites control, and plasma metabolite changes in heifers grazing winter wheat forage (Triticum aestivu...

  17. New polymorphic microsatellite loci for rodents of the genus Mastomys using PCR multiplexing, and cross-species amplification in Myomys and Praomys

    Czech Academy of Sciences Publication Activity Database

    Loiseau, A.; Konečný, Adam; Galan, M.; Bryja, Josef; Cosson, J.-F.; Brouat, C.

    2007-01-01

    Roč. 7, č. 4 (2007), s. 684-687 ISSN 1471-8278 R&D Projects: GA AV ČR IAA6093404 Institutional research plan: CEZ:AV0Z60930519 Keywords : microsatellite * Rodentia Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 1.257, year: 2007

  18. Effect of main belt perturbers on asteroid-pair age estimation

    Czech Academy of Sciences Publication Activity Database

    Galád, Adrián

    2012-01-01

    Roč. 548, November (2012), A25/1-A25/7 ISSN 0004-6361 R&D Projects: GA ČR GAP209/12/0229 Institutional support: RVO:67985815 Keywords : minor planets * asteroids * celestial mechanics Subject RIV: BN - Astronomy, Celestial Mechanics, Astrophysics Impact factor: 5.084, year: 2012

  19. Prostate specific antigen: a prognostic marker of survival in good prognosis metastatic prostate cancer? (EORTC 30892)

    NARCIS (Netherlands)

    Collette, Laurence; de Reijke, Theo M.; Schröder, Fritz H.

    2003-01-01

    We study the value of PSA response and PSA progression as prognostic factors for survival in good prognosis metastatic prostate cancer. Data from 257 patients treated with Flutamide or Cyproterone acetate within the EORTC GU Group protocol 30892 have been used and analysis by Cox models. A PSA

  20. 76 FR 45491 - Creation of a Low Power Radio Service; Amendment of Service and Eligibility Rules for FM...

    Science.gov (United States)

    2011-07-29

    ... (``LCRA'') will impact future LPFM and translator station licensing. Section 5 of the Act requires the Commission to ensure that: Licenses are available for both LPFM and translator stations; licensing decisions... copying during normal business hours in the FCC Reference Center (Room CY-A257), 445 12th Street, SW...

  1. Program DEIMOS32 for gamma-ray spectra evalution

    Czech Academy of Sciences Publication Activity Database

    Frána, Jaroslav

    2003-01-01

    Roč. 257, č. 3 (2003), s. 583-587 ISSN 0236-5731. [International Conference Ko-users Workshop /3./. Bruges, 23.09.2001-28.09.2001] Institutional research plan: CEZ:AV0Z1048901 Keywords : gamma-ray spectra * software Subject RIV: BG - Nuclear, Atomic and Molecular Physics, Colliders Impact factor: 0.472, year: 2003

  2. Synovial fluid analysis

    Science.gov (United States)

    ... in the rheumatic diseases. In: Goldman L, Schafer AI, eds. Goldman-Cecil Medicine . 25th ed. Philadelphia, PA: Elsevier Saunders; 2016:chap 257. Review Date 4/18/2017 Updated by: C. Benjamin Ma, MD, Professor, Chief, Sports Medicine and Shoulder Service, UCSF Department of Orthopaedic ...

  3. ESR and TSL study of hole and electron traps in LuAG:Ce,Mg ceramic scintillator

    Czech Academy of Sciences Publication Activity Database

    Hu, C.; Liu, S.-P.; Fasoli, M.; Vedda, A.; Nikl, Martin; Feng, X. Q.; Pan, Y.B.

    2015-01-01

    Roč. 45, Jul (2015), s. 252-257 ISSN 0925-3467 R&D Projects: GA ČR GAP204/12/0805 Institutional support: RVO:68378271 Keywords : LuAG * scintillator * codoping * Ce3+ * O- center Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 2.183, year: 2015

  4. Nigerian Journal of Clinical Practice - Vol 16, No 2 (2013)

    African Journals Online (AJOL)

    Effects of user experience and method in the inflation of endotracheal tube pilot balloon on cuff pressure · EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. AB Ozer, I Demirel, G Gunduz, OL Erhan, 253-257. http://dx.doi.org/10.4103/1119-3077.110139 ...

  5. Experimental in Situ Transformation of Pb Smelter Fly Ash in Acidic Soils

    Czech Academy of Sciences Publication Activity Database

    Ettler, V.; Mihaljevič, M.; Šebek, O.; Matys Grygar, Tomáš; Klementová, Mariana

    2012-01-01

    Roč. 46, č. 19 (2012), s. 10539-10548 ISSN 0013-936X Institutional research plan: CEZ:AV0Z40320502 Keywords : pollution -control residues Subject RIV: CA - Inorganic Chemistry Impact factor: 5.257, year: 2012

  6. Advantages of breath testing for the early diagnosis of lung cancer

    Czech Academy of Sciences Publication Activity Database

    Smith, D.; Španěl, Patrik; Sule-Suso, J.

    2010-01-01

    Roč. 10, č. 3 (2010), s. 255-257 ISSN 1473-7159 Institutional research plan: CEZ:AV0Z40400503 Keywords : mass spectrometry * breath analysis * lung cancer Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 4.652, year: 2010

  7. Injuries associated with fractured tibial shaft | Ikeanyi | Journal of ...

    African Journals Online (AJOL)

    The commonest cause of the injuries was motorcycle accidents (25.7%) followed closely by motor vehicular accidents (25%). The most common associated injuries in order of frequency were: ipsilateral fibular fractures, ankle injuries, ipsilateral femoral fractures and pelvic fractures. Conclusion: Tibial shaft fractures are ...

  8. E-beam and UV induced fabrication of CeO2, Eu2O3 and their mixed oxides with UO2

    Czech Academy of Sciences Publication Activity Database

    Pavelková, T.; Vaněček, V.; Jakubec, Ivo; Čuba, V.

    2016-01-01

    Roč. 124, JUL (2016), s. 252-257 ISSN 0969-806X Institutional support: RVO:61388980 Keywords : E-beam * Nuclear fuels * Radiation synthesis * Cerium(IV) oxide * Europium(III) oxide * Uranium(IV) oxide Subject RIV: CA - Inorganic Chemistry Impact factor: 1.315, year: 2016

  9. Federal University

    African Journals Online (AJOL)

    USER

    2015-07-09

    Jul 9, 2015 ... Antarctica. Generally, 257 species of modern ungulates were recognized (Wilson and Reeder, 2005), five of which have become extinct due to human activities and other species are of critical conservation concern (Huffman, 2008). Modifications of the range to meet the requirement of wild life are called ...

  10. Statistical analysis and optimization of copper biosorption capability ...

    African Journals Online (AJOL)

    These three variables were further adopted by the three-level Box– Behnken design to correlate between the three variables and to estimate the optimal conditions required for Cu2+ biosorption. Although the maximum value for Cu2+ biosorption was 85%, the calculated optimum percentage was 72%, which was a 2.57-fold ...

  11. Monopole-antimonopole interaction potential

    Science.gov (United States)

    Saurabh, Ayush; Vachaspati, Tanmay

    2017-11-01

    We numerically study the interactions of twisted monopole-antimonopole pairs in the 't Hooft-Polyakov model for a range of values of the scalar to vector mass ratio. We also recover the sphaleron solution at maximum twist discovered by Taubes [Commun. Math. Phys. 86, 257 (1982), 10.1007/BF01206014] and map out its energy and size as functions of parameters.

  12. 78 FR 11227 - Notice of Determinations Regarding Eligibility To Apply for Worker Adjustment Assistance

    Science.gov (United States)

    2013-02-15

    ... Harley-Davidson Motor Kansas City, MO........ December 14, 2011. Company, Global Information Services. 82...,257H Harley-Davidson Carson City, NV........ December 14, 2011. Financial Services, Inc., Global... Staffing, Raleys Superior Cleaning. 82,291 Independent Record, Helena, MT December 26, 2011. Creative...

  13. Journal of Genetics | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    Home; Journals; Journal of Genetics; Volume 87; Issue 3. Issue front cover thumbnail. Volume 87, Issue 3. December 2008, pages 201-317 .... pp 257-259 Research Note. Double trisomy with 48, XXX+21 karyotype in a Down's syndrome child from Jammu and Kashmir, India · Wahied Khawar Balwan Parvinder Kumar T. R. ...

  14. Dynamický impaktní test – unikátní metoda analýzy ochranných vrstev

    Czech Academy of Sciences Publication Activity Database

    Fořt, Tomáš; Grossman, Jan; Sobota, Jaroslav; Daniel, Josef

    2017-01-01

    Roč. 62, č. 10 (2017), s. 257-260 ISSN 0447-6441 R&D Projects: GA MŠk(CZ) LO1212 Institutional support: RVO:68081731 Keywords : dynamical impact test * thin films * protective coatings * wear-resistance * fatigue tests Subject RIV: JK - Corrosion ; Surface Treatment of Materials OBOR OECD: Audio engineering, reliability analysis

  15. Spectra and gross features of vertical temperature and salinity profiles off the central west coast of India

    Digital Repository Service at National Institute of Oceanography (India)

    Varkey, M.J.; Nagarajan, R.

    difference filter and corrected for the filter-response followed an average slope of - 2.9 (range: - 2.57 to - 3.43 and std. dev.: - 0.3) and - 2.6 (range: - 2.05 to - 3.15 and std. dev.: - 0.36) with correlation coefficients - 0.96 and - 0.92 for temperature...

  16. Fulltext PDF

    Indian Academy of Sciences (India)

    Metal–insulator transition in Ni-doped Na0.75CoO2: Insights from infrared studies . . . . . . . . . . . . . . . . . . . .M Premila, A Bharathi, N Gayathri, P Yasodha,. Y Hariharan ... P K Sahu, A Ohnishi, M Isse, N Otuka and S C Phatak. 257. Determination of thorium and uranium contents in soil samples using. SSNTD's passive method .

  17. In vitro Evaluation of Trimethoprim and Sulfamethoxazole from Fixed ...

    African Journals Online (AJOL)

    trimethoprim (TMP) and sulfamethoxazole (SMX) from fixed-dose combination generic products using a flow-through cell technique. Methods: Absorbance measurement was achieved at 247.8 and 257.9 nm for trimethoprim and sulfamethoxazole, respectively. USP Apparatus 4 with 22.6 mm cells, laminar flow at 16 ml/min, ...

  18. Reconstruction of Acute Traumatic Tibial Fractures with the Ilizarov ...

    African Journals Online (AJOL)

    The average time for application of the apparatus to fracture healing was 4.3 months. One fracture required autogenous bone graft for union. One patient is undergoing callus transportation for bone replacement. The most common complication was pin tract infection seen in nine (25.7%) patients. Conclusion: We treated 35 ...

  19. Trematode diversity in freshwater fishes of the Globe I: ‘Old World’

    Czech Academy of Sciences Publication Activity Database

    Scholz, Tomáš; Besprozvannykh, V. V.; Boutorina, T.E.; Choudhury, A.; Cribb, T.H.; Ermolenko, A. V.; Faltýnková, Anna; Shedko, M.B.; Shimazu, T.; Smit, N.J.

    2016-01-01

    Roč. 93, č. 3 (2016), s. 257-269 ISSN 0165-5752 R&D Projects: GA ČR(CZ) GBP505/12/G112; GA ČR GA15-14198S Institutional support: RVO:60077344 Keywords : life cycle * Digenea * parasite communite Subject RIV: EG - Zoology Impact factor: 1.181, year: 2016

  20. Optimizing Cognitive Load for Learning from Computer-Based Science Simulations

    Science.gov (United States)

    Lee, Hyunjeong; Plass, Jan L.; Homer, Bruce D.

    2006-01-01

    How can cognitive load in visual displays of computer simulations be optimized? Middle-school chemistry students (N = 257) learned with a simulation of the ideal gas law. Visual complexity was manipulated by separating the display of the simulations in two screens (low complexity) or presenting all information on one screen (high complexity). The…

  1. Recurrent Novae in M31

    Czech Academy of Sciences Publication Activity Database

    Shafter, A.W.; Henze, M.; Rector, T. A.; Schweizer, F.; Hornoch, Kamil; Orio, M.; Pietsch, W.; Darnley, M.J.; Williams, S.C.; Bode, M.F.; Bryan, J.

    2015-01-01

    Roč. 216, č. 2 (2015), 34/1-34/35 ISSN 0067-0049 Institutional support: RVO:67985815 Keywords : individual (M31) galaxies * stellar content * cataclysmic variables Subject RIV: BN - Astronomy, Celestial Mechanics, Astrophysics Impact factor: 11.257, year: 2015

  2. Aksoy Nigar Yildirim Variational problem with complex co-efficient of ...

    Indian Academy of Sciences (India)

    user1

    Abbaspour Mohammad Hassan see Ghaffarzadeh Ghodrat. 329. Abhyankar Shreeram S. Rees valuations. 525. Agarwal A K. seeAnand S. 23. Aithal A R. On the extrema of Dirichlet's first eigen- value of a family of punctured regular polygons in two dimensional space forms. 257. Aksoy Nigar Yildirim. Variational problem ...

  3. Ontological Proofs of Existence and Non-Existence

    Czech Academy of Sciences Publication Activity Database

    Hájek, Petr

    2008-01-01

    Roč. 90, č. 2 (2008), s. 257-262 ISSN 0039-3215 R&D Projects: GA AV ČR IAA100300503 Institutional research plan: CEZ:AV0Z10300504 Keywords : ontological proofs * existence * non-existence * Gödel * Caramuel Subject RIV: BA - General Mathematics

  4. Effects of Boreal Timber Rafting on the Composition of Arctic Driftwood

    Czech Academy of Sciences Publication Activity Database

    Hellmann, L.; Kirdyanov, A. V.; Büntgen, Ulf

    2016-01-01

    Roč. 7, č. 11 (2016), č. článku 257. ISSN 1999-4907 Institutional support: RVO:67179843 Keywords : boreal rivers * Arctic driftwood * timber logging * industrial floating * Siberia Subject RIV: GK - Forestry Impact factor: 1.951, year: 2016

  5. Genetic relationships between three indigenous cattle breeds in ...

    African Journals Online (AJOL)

    Unknown

    1ARC Animal Improvement Institute, P/Bag X2, Irene, 0062, South Africa; 2Veterinary Faculty, Eduardo Montlana University,. C.P. 257, Maputo, Mozambique; 3German ... histories and thereby illuminate human migrations, identify breeds potentially useful in breeding programmes and aid in understanding domestication.

  6. Long-term effects of CO2 enrichment on bud phenology and shoot growth patterns of Norway spruce juvenile trees

    Czech Academy of Sciences Publication Activity Database

    Pokorný, Radek; Tomášková, Ivana; Drápelová, I.; Kulhavý, J.; Marek, Michal V.

    2010-01-01

    Roč. 56, č. 6 (2010), s. 251-257 ISSN 1212-4834 R&D Projects: GA AV ČR IAA600870701 Institutional research plan: CEZ:AV0Z60870520 Keywords : bud * elevated CO2 * Norway spruce Subject RIV: EH - Ecology, Behaviour

  7. On the calculation of resonances by means of analytic continuation in coupling constant

    Czech Academy of Sciences Publication Activity Database

    Horáček, J.; Paidarová, Ivana

    2010-01-01

    Roč. 257, č. 1 (2010), 012002 E-ISSN 1742-6596 R&D Projects: GA MŠk(CZ) LC06014; GA MŠk OC09079 Institutional research plan: CEZ:AV0Z40400503 Keywords : electron collisions * Dissociation * coupling constant Subject RIV: CF - Physical ; Theoretical Chemistry

  8. Gas barrier properties of nanocomposites based on in situ polymerized poly(n-butyl methacrylate) in the presence of surface modified montmorillonite

    Czech Academy of Sciences Publication Activity Database

    Herrera-Alonso, J. M.; Sedláková, Zdeňka; Marand, E.

    2010-01-01

    Roč. 349, 1-2 (2010), s. 251-257 ISSN 0376-7388 R&D Projects: GA AV ČR KAN100500651; GA MŠk ME09058 Institutional research plan: CEZ:AV0Z40500505 Keywords : barrier membranes * nanocomposites * montmorillonite Subject RIV: CD - Macromolecular Chemistry Impact factor: 3.673, year: 2010

  9. Reaching the superlinear convergence phase of the CG method

    Czech Academy of Sciences Publication Activity Database

    Axelsson, Owe; Karátson, J.

    2014-01-01

    Roč. 260, č. 260 (2014), s. 244-257 ISSN 0377-0427 R&D Projects: GA MŠk ED1.1.00/02.0070 Institutional support: RVO:68145535 Keywords : superlinear convergence * conjugate gradient method * eigenvalues Subject RIV: BA - General Mathematics Impact factor: 1.266, year: 2014 http://www.sciencedirect.com/science/article/pii/S0377042713005451

  10. Different responses of soybean cyst nematode resistance between ...

    Indian Academy of Sciences (India)

    2016-12-02

    Dec 2, 2016 ... SCN race 1 (HG types 2.5.7), while 7605 is highly susceptible. Chi-square test of frequency distribution of families' female index (FI) showed that resistance to SCN was significantly different between NJ(RN)P7 and JN(RN)P7 popula- tions. Three recessive genes conditioned the inheritance of resistance to ...

  11. Synthesis, crystal structure and DFT calculations of a new Hg (II) metal-organic polymer

    Czech Academy of Sciences Publication Activity Database

    Mirtamizdoust, B.; Roodsari, M.S.; Shaabani, B.; Dušek, Michal; Fejfarová, Karla

    2016-01-01

    Roč. 15, č. 3 (2016), s. 257-266 ISSN 1024-1221 Grant - others:AV ČR(CZ) Praemium Academiae Institutional support: RVO:68378271 Keywords : mercury (II) iodide * coordination polymer * square planar * tetrahedral geometry * density functional calculation Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 0.565, year: 2016

  12. Intrinsically passive control using sampled data system passivity

    NARCIS (Netherlands)

    Stramigioli, Stefano; Barbagli, F.; Prattichizzo, D.; Salisbury, K.

    In this chapter, which is a distilled version of [271], we present a novel way to approach the interconnection of a continuous and a discrete time physical system firstly presented in [270, 268, 257]. This is done in a way which preserves passivity of the coupled system independently of the sampling

  13. New Fellows and Honorary Fellow

    Indian Academy of Sciences (India)

    Fellow Profile. Elected: 1975 Section: General Biology. Maitra, Prof. Pabitra Kumar D.Phil. (Calcutta), FNA. Date of birth: 1 November 1932. Date of death: 4 September 2007. Specialization: Biochemistry, Molecular Biology and Genetics Last known address: CJ-257, Salt Lake, Kolkata 700 091. YouTube; Twitter; Facebook ...

  14. International Journal of Natural and Applied Sciences - Vol 7, No 3 ...

    African Journals Online (AJOL)

    Effects of spent engine oil pollution on arable soil of Nekede Mechanic Village Owerri, Nigeria · EMAIL FULL TEXT EMAIL FULL TEXT · DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. AC Udebuani, CI Okoli, H Nwigwe, PTE Ozoh, 257 – 260 ...

  15. Biochemical and Ultrastructural Effects of T-2 Toxin on Rat Hepatocytes in Vitro

    Science.gov (United States)

    1985-01-01

    indicatec: that, at a dose of p.01 p~glml, protein synthesis t", was inhibited within 1-h but recovered to near control leavels with or without the...Mechanisms of cell injury in the killing of cultured hepatocytes by bromobenzene. J. Biol. Chem. 257:6721-6728. 2. Clark , D.G., R. Rognstad, and J. Katz

  16. EST Table: FS871051 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available aa ref|NP_001139536.1| mortality factor 4-like [Bombyx mori] gb|ABJ99463.1| mrg15-like protein [Bombyx mori...FS871051 E_FL_fner_44F14_R_0 11/12/09 GO hit GO:0005634(nucleus) 10/09/28 100 %/257

  17. Cryoseston of the Pirin Mountains, Bulgaria

    Czech Academy of Sciences Publication Activity Database

    Cepák, Vladislav; Lukavský, Jaromír

    2013-01-01

    Roč. 72, č. 2 (2013), s. 257-268 ISSN 0365-0588 R&D Projects: GA TA ČR TE01020080; GA TA ČR TA03011027 Institutional research plan: CEZ:AV0Z60050516 Keywords : Chlainomonas * Pirin * Bulgaria Subject RIV: EI - Biotechnology ; Bionics Impact factor: 0.449, year: 2013

  18. Development of a radiochemical neutron activation analysis procedure for determination of rhenium in biological and environmental samples at ultratrace level

    Czech Academy of Sciences Publication Activity Database

    Kučera, Jan; Byrne, A. R.; Mizera, Jiří; Lučaníková, M.; Řanda, Zdeněk

    2006-01-01

    Roč. 269, č. 2 (2006), s. 251-257 ISSN 0236-5731 R&D Projects: GA ČR(CZ) GA203/04/0943 Institutional research plan: CEZ:AV0Z10480505 Keywords : radiochemical neutron activation analysis * rhenium * biological and environmental samples Subject RIV: CB - Analytical Chemistry, Separation Impact factor: 0.509, year: 2006

  19. Different levels of macadamia oil cake meal, and wood ash vs. feed ...

    African Journals Online (AJOL)

    3) as the main source of calcium; and the other wood ash, which contained 257 g Ca/kg. All diets contained a Ca level of ca. 10 g/kg. The chickens received the experimental diets from 2 to 15 weeks of age. After week 15, eight chickens per ...

  20. Role of diatom-attached choanoflagellates of the genus Salpingoeca as pelagic bacterivores

    Czech Academy of Sciences Publication Activity Database

    Šimek, Karel; Jezbera, Jan; Horňák, Karel; Vrba, Jaroslav; Seďa, Jaromír

    2004-01-01

    Roč. 36, č. 3 (2004), s. 257-269 ISSN 0948-3055 R&D Projects: GA ČR(CZ) GA206/02/0003 Keywords : reservoir * microbial food webs * protistan bacterivory Subject RIV: EE - Microbiology, Virology Impact factor: 2.255, year: 2004

  1. Dicty_cDB: Contig-U14141-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 41-1Q) /CSM_Contig/Contig-U14141-1Q.Seq.d NNNNNNNNNNAATCCNAAACCTGGNCCCCAATATTATCCCCNANCNACTT TNCCNNTATTTGAATCCCCNA...CNAGC AGNTAAANNATTAAANAAACAAGGNTGGAGNTNTNATAAAAAANATNTCN CCTGGNTTANAANACATGAAGNACCNAAANAAATNCCNAANGAATTTGAA ...tities = 257/263 (97%) Strand = Plus / Plus Query: 11 aatccnaaacctggnccccaatattatccccnancnactttnccnntatttgaa...tccccn 70 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Sbjct: 11 aatccna...aacctggnccccaatattatccccnancnactttnccnntatttgaatccccn 70 Query: 71 aangnttttganaaatttganatnganaccntgn

  2. Is PT -symmetric quantum theory false as a fundamental theory?

    Czech Academy of Sciences Publication Activity Database

    Znojil, Miloslav

    2016-01-01

    Roč. 56, č. 3 (2016), s. 254-257 ISSN 1210-2709 R&D Projects: GA ČR GA16-22945S Institutional support: RVO:61389005 Keywords : quantum mechanics * PT-symmetric representations of observables * masurement outcomes Subject RIV: BE - Theoretical Physics

  3. Genetic variation within clonal lineages of Phytophthora infestans revealed through genotyping-by-sequencing, and implications for late blight epidemiology

    Science.gov (United States)

    Genotyping-by-sequencing (GBS) was performed on 257 Phytophthora infestans isolates belonging to four clonal lineages to study within-lineage diversity. The four lineages used in the study included US-8 (n=28), US-11 (n=27), US-23 (n=166), and US-24 (n=36), with isolates originating from 23 of the U...

  4. Accommodation, Cafes and Restaurants. Industry Training Monograph No. 8.

    Science.gov (United States)

    Dumbrell, Tom

    Australia's accommodation, cafes, and restaurants industry represents more than half of the nation's total tourism and hospitality employment. It accounts for roughly 4.5% of all jobs in Australia (400,000 workers). Since 1987, the number of jobs in the sector has risen from about 257,000 to about 372,000. Approximately 57% of employees are…

  5. Eating attitudes, body image satisfaction and self-esteem of South ...

    African Journals Online (AJOL)

    BMI was positively associated with self-esteem (p = 0.01, r = 0.134) and negatively with dieting behaviour in White boys (p = 0.004, r = −0.257), and with lower EAT-26 bulimic and oral control scores in Black boys. In conclusion, the findings highlight ethnic differences and a need to better understand cultural differences that ...

  6. Teachers' Teaching Experience and Students' Learning Outcomes ...

    African Journals Online (AJOL)

    cce

    Items 1 - 6 ... E-mail:toade1957@yahoo.com. Abstract. This article examined teachers' teaching experience and students' learning outcomes in the secondary schools in Ondo State Nigeria. As a correlational survey, the study population comprised all the 257 secondary schools that presented students for the year 2003 senior ...

  7. Does Lactation Mitigate Triple Negative/Basal Breast Cancer Progression?

    Science.gov (United States)

    2012-09-01

    Research. Edited by Ip MM, Asch BB. N.Y.: Kluwer Academic/Plenum; 2000: 259-270. 29. Russell TD , Fischer A, Beeman NE, Freed EF, Neville MC, Schaack J...Odyssey PF-08-257-01- CSM to TRL and DoD Predoctoral Grants BC073482 to JO and BC100910 to HM.

  8. Bulletin of Materials Science | News

    Indian Academy of Sciences (India)

    pp 257-262 Electronic Supplementary Material. A comparative study regarding effects of interfacial ferroelectric Bi4Ti3O12 (BTO) layer on electrical characteristics of Au/-Si structures · M Yildirim M Gökçen · More Details Abstract Fulltext PDF. Present study focuses on the effects of interfacial ferroelectric BTO layer on the ...

  9. Browse Title Index

    African Journals Online (AJOL)

    Items 51 - 100 of 257 ... Vol 22, No 1 (2012), Awareness and Incidence of Plagiarism among Undergraduates in a Nigerian Private University, Abstract. Y T Babalola. Vol 12, No 2 (2002), Book Publishing Patterns in Uganda: Challenges and Prospects, Abstract. Stephen M. Mutula, Mabel M.T. Nakitto. Vol 15, No 1 (2005), Book ...

  10. Co-localisation of the Kir6.2/SUR1 channel complex with glucagon-like peptide-1 and glucose-dependent insulinotrophic polypeptide expression in human ileal cells and implications for glycaemic control in new onset type 1 diabetes

    DEFF Research Database (Denmark)

    Nielsen, Lotte B; Ploug, Kenneth B; Swift, Peter

    2007-01-01

    on glucose-sensing tissues in vivo that may affect the overall glycaemic control in children with new-onset type 1 diabetes. DESIGN AND METHODS: Western blot and immunohistochemical analyses were performed for expression and co-localisation studies. Meal-stimulated C-peptide test was carried out in 257...

  11. Influence of Teachers' Teaching Experience on Students' Learning ...

    African Journals Online (AJOL)

    This article examined teachers' teaching experience and students' learning outcomes in the secondary schools in Ondo State Nigeria. As a correlational survey, the study population comprised all the 257 secondary schools that presented students for the year 2003 senior secondary certificate (SSC) examinations in the ...

  12. Population pharmacokinetics of mycophenolic acid : a comparison between enteric-coated mycophenolate sodium and mycophenolate mofetil in renal transplant recipients

    NARCIS (Netherlands)

    de Winter, Brenda C. M.; van Gelder, Teun; Glander, Petra; Cattaneo, Dario; Tedesco-Silva, Helio; Neumann, Irmgard; Hilbrands, Luuk; van Hest, Reinier M.; Pescovitz, Mark D.; Budde, Klemens; Mathot, Ron A. A.

    2008-01-01

    The pharmacokinetics of mycophenolic acid (MPA) were compared in renal transplant patients receiving either mycophenolate mofetil (MMF) or enteric-coated mycophenolate sodium (EC-MPS). MPA concentration-time profiles were included from EC-MPS- (n = 208) and MMF-treated (n = 184) patients 4-257

  13. Contrasting petrogenesis of spatially related carbonatites from Samalpatti and Sevattur, Tamil Nadu, India

    Czech Academy of Sciences Publication Activity Database

    Ackerman, Lukáš; Magna, T.; Rapprich, V.; Upadhyay, D.; Krátký, O.; Čejková, B.; Erban, V.; Kochergina, Y. V.; Hrstka, Tomáš

    284/285, 1 July (2017), s. 257-275 ISSN 0024-4937 Institutional support: RVO:67985831 Keywords : carbonatite * geochemistry * Samalpatti * Sevattur * silicocarbonatite * Sr–Nd–Pb–C–O isotopic systematics Subject RIV: DB - Geology ; Mineralogy OBOR OECD: Geology Impact factor: 3.677, year: 2016

  14. Contribution de la microscopie électronique à balayage ...

    African Journals Online (AJOL)

    user

    [6] - M.A. WEBB and H.J. ARNOTT, A survey of calcium oxalate crystals and other mineral inclusions in seeds. Scan Electron Micros3 (1982) 1109-1131. [7] - H. ILARSLAN, R.G. PALMER, J. IMSANDE and H.T. HORNER, Calcium oxalate crystals in developing seeds of soybean. Annales of Botany. 88 (2001) 243-257.

  15. Bulletin of Materials Science | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    Home; Journals; Bulletin of Materials Science; Volume 25; Issue 3. Issue front cover thumbnail. Volume 25, Issue 3. June 2002, pages 175-257. pp 175-180 Nanomaterials. Synthesis and characterization of sol–gel derived ZnS : Mn nanocrystallites embedded in a silica matrix · B Bhattacharjee D Ganguli K Iakoubovskii A ...

  16. Biohydrogen production from household solid waste (HSW) at extreme-thermophilic temperature (70 degrees C) - Influence of pH and acetate concentration

    DEFF Research Database (Denmark)

    Liu, Dawei; Min, Booki; Angelidaki, Irini

    2008-01-01

    Hydrogen production from household solid waste (HSW) was performed via dark fermentation by using an extreme-thermophilic mixed culture, and the effect of pH and acetate on the biohydrogen production was investigated. The highest hydrogen production yield was 257 +/- 25 mL/gVS(added) at the optim...

  17. Histopathology of carp (Cyprinus carpio L.) larvae exposed to Cyanobacteria extract

    Czech Academy of Sciences Publication Activity Database

    Palíková, M.; Navrátil, S.; Tichý, F.; Štěrba, F.; Maršálek, Blahoslav; Bláha, L.

    2004-01-01

    Roč. 73, - (2004), s. 253-257 ISSN 0001-7213 R&D Projects: GA AV ČR KSK6005114; GA ČR GP524/01/P027 Institutional research plan: CEZ:AV0Z6005908 Keywords : microcystins * embryo-larval test * liver damage Subject RIV: EF - Botanics Impact factor: 0.449, year: 2004

  18. First study of the radiation-amplitude zero in W gamma production and limits on anomalous WW gamma couplings at s**(1/2) = 1.96 TeV

    Czech Academy of Sciences Publication Activity Database

    Abazov, V. M.; Abbott, B.; Abolins, M.; Kupčo, Alexander; Lokajíček, Miloš

    2008-01-01

    Roč. 100, č. 24 (2008), 241805/1-241805/7 ISSN 0031-9007 R&D Projects: GA MŠk 1P05LA257; GA MŠk LC527 Institutional research plan: CEZ:AV0Z10100502 Keywords : D0 * Tevatron Subject RIV: BF - Elementary Particles and High Energy Physics Impact factor: 7.180, year: 2008

  19. 78 FR 39691 - Closed Captioning of Internet Protocol-Delivered Video Programming: Implementation of the Twenty...

    Science.gov (United States)

    2013-07-02

    ... subscription service that delivers video and audio programming via satellite to a small parabolic ``dish... third party, such as cable systems or direct-to-home satellite systems, for transmission to viewers... Street SW., Room CY-A257, Washington, DC 20554. This document will also be available via ECFS at http...

  20. ORF Alignment: NC_000912 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_000912 gi|13507986 >1txoB 6 236 9 257 6e-28 ... gb|AAB96233.1| protein phoshatase ...iae ... M129] pir||S73911 protein phoshatase 2C homolog ptc1 - ... Mycoplasma pneumoniae (stra... ... ref|NP_109935.1| protein phoshatase 2C homolog; similar ... to Swiss-Prot Accession Number P3518

  1. Journal of Earth System Science | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    Home; Journals; Journal of Earth System Science; Volume 113; Issue 2. Volume 113, Issue 2. June 2004, pages 129-257. pp 129-138. The evaporation of the charged and uncharged water drops suspended in a wind tunnel · Rohini V Bhalwankar A B Sathe A K Kamra · More Details Abstract Fulltext PDF. A laboratory ...

  2. Steroid implants and markers of bone turnover in steers

    African Journals Online (AJOL)

    jannes

    and reflect steroid-induced bone maturity in the periphery: non-implanted controls; 25.7 mg estradiol-17β ... accelerated ageing effects of the widely used steroidal implants, trenbolone acetate (TBA) and estradiol-17β ..... Roles of IGF-I and the estrogen, androgen and IGF-I receptors in estradiol-17 beta- and trenbolone ...

  3. Involvement of carotenoids in the synthesis and assembly of protein subunits of photosynthetic reaction centers of Synechocystis sp. PCC 6803

    Czech Academy of Sciences Publication Activity Database

    Sozer, O.; Komenda, Josef; Ughy, B.; Domonkos, I.; Laczkó-Dobos, H.; Malec, P.; Gombos, Z.; Kis, M.

    2010-01-01

    Roč. 51, č. 5 (2010), s. 823-835 ISSN 0032-0781 R&D Projects: GA AV ČR IAA400200801 Institutional research plan: CEZ:AV0Z50200510 Keywords : Carotenoidless mutant * crtB * Membrane protein synthesis Subject RIV: EE - Microbiology, Virology Impact factor: 4.257, year: 2010

  4. South African Medical Journal - Vol 101, No 4 (2011)

    African Journals Online (AJOL)

    Loss to follow-up in a community clinic in South Africa – roles of gender, pregnancy and CD4 count · EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT · DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. B Wang, E Losina, R Stark, A Munro, RP Walensky, M Wilke, D Martin, Z Lu, KA Freedberg, R Wood, 253-257 ...

  5. P Chatterjee

    Indian Academy of Sciences (India)

    Home; Journals; Bulletin of Materials Science. P Chatterjee. Articles written in Bulletin of Materials Science. Volume 25 Issue 3 June 2002 pp 251-257 Experimental Techniques. Voigt modelling of size–strain analysis: Application to -Al2O3 prepared by combustion technique · K Santra P Chatterjee S P Sen Gupta.

  6. In vitro fermentation characteristics and acceptability by West African ...

    African Journals Online (AJOL)

    Proximate composition, acceptability using twenty four West African dwarf (WAD) goats and in vitro gas production of dry season forages were determined. Crude protein content ranged from 7.9% in Panicum maximum to 25.7% in Leucaena leucocephala. Crude fibre composition was generally high (range 56.8 - 74.1%) ...

  7. African-American Women Who Use Crack Cocaine: A Comparison of Mothers Who Live with and Have Been Separated from Their Children

    Science.gov (United States)

    Lam, W.K.K.; Wechsberg, W.; Zule, W.

    2004-01-01

    Objective:: This study examined factors that influenced caregiver status for African-American mothers who use crack cocaine but are not receiving drug treatment and participated in an HIV prevention study in North Carolina. Method:: Caregiver mothers who were living with at least one of their children at intake (n=257) were compared with…

  8. Détermination des doses optimales de fumures organo-minérales ...

    African Journals Online (AJOL)

    millet production in Niger, West Africa. Nutrient Cycling and Agroecosystem, 80,. 257–265. DOI: 10.1007/s10705-007-9141-. 3. Lompo F. 2009. Effets induits des modes de gestion de la fertilité sur les états du phosphore et la solubilisation des phosphates naturels dans deux sols acides du Burkina Faso. Thèse de doctorat.

  9. 77 FR 48827 - Changes To Implement the Supplemental Examination Provisions of the Leahy-Smith America Invents...

    Science.gov (United States)

    2012-08-14

    ...., 649 F.3d 1276 (Fed. Cir. 2011). Section 12 of the AIA also indicates that nothing in 35 U.S.C. 257... in a request for supplemental examination, including, for example, transcripts of audio or video... transcript of an audio or video recording, each of which may be considered an item of information. If the...

  10. Sub-Chronic Hepato-Toxicity Evaluation of the Aqueous- Ethanol ...

    African Journals Online (AJOL)

    Among the heavy metals, iron and aluminium were dominant, while cadmium, mercury and lead were detected at micro quantities. The levels of anti-nutrient phytate, oxalate, tannins, resins and cyanide were found to be 7.85, 2.57, 2.51, 0.40, and 0.04, percent respectively. The extract induced an inconsistent but significant ...

  11. Relationship between ZnT8Ab, the SLC30A8 gene and disease progression in children with newly diagnosed type 1 diabetes

    DEFF Research Database (Denmark)

    Nielsen, L. B.; Vaziri-Sani, F.; Porksen, S.

    2011-01-01

    of this genetic variant and the ZnT8Ab on the residual beta-cell function during disease progression the first year after disease diagnosis in children with newly diagnosed type 1 diabetes. This cohort consists of 257 children aged

  12. PAEDIATRIC UROLOGICAL TRAUMA AT NNEWI, SOUTH ...

    African Journals Online (AJOL)

    The patient group included neonates up to children aged 15 years. Apart from the biodata, the cause of the trauma, the organ(s) injured, the treatment given and its outcome were critically analyzed. Results: In the two years under review, 257 cases of paediatric trauma were managed. Out of these, urological trauma was ...

  13. A feruloyl esterase derived from a leachate metagenome library

    CSIR Research Space (South Africa)

    Rashamuse, K

    2012-01-01

    Full Text Available . and Lactobacilli. Appl. Microbiol. Biotechnol. 50, 257-260. 22. Bendten, J. D., Nielsen, H., von Heijnie, G. and Brunak, S. (2004) Improved prediction of signal peptide: SignalP 3. 0. J. Mol. Biol. 340, 783-795. 23. Altschul, S. F., Madden, T. S., Sch?ffer, A...

  14. Strong Similarities in Turkish and European Patients Diagnosed with APECED Syndrome

    Directory of Open Access Journals (Sweden)

    Metin Güçlü

    2015-09-01

    Full Text Available Purpose: Autoimmune polyendocrinopathy-candidiasis-ectodermal dystrophy (APECED is a rare autoimmune disease which is caused by mutations in the autoimmune regulator (AIRE gene, mapping to 21q22.3. We aimed to evaluate AIRE gene mutations in patients with APECED syndrome and in their relatives. Material and Method: In this study, we investigated two patients with APECED syndrome and their families in terms of the AIRE gene mutation. We performed mutation analysis by sequencing all the 14 exons and the intron-exon boundaries of the AIRE gene on the DNA extracted from the peripheral blood in 12 cases. Results: Mutation analysis of AIRE gene showed that patient 1 was homozygous for the pathogenic mutation c.769C>T (p.R257X; g.8473C>T which turns arginine coding codon 257 into a stop codon. Her father and all three sisters were heterozygous for this mutation, and no mutation was found in patient 2 and her family members. Discussion: However phenotypic manifestations of the disease vary largely, prompting the idea of other genetic and/or environmental factors contributing to clinical presentation of the disease. The R257X mutation in exon 6 has been discovered in 89% of the alleles of the Finnish patients with APECED, but is also the most frequent one in other ethnic groups. Although this mutation has been discovered in different ethnic groups, patients with R257X mutation have similar clinical findings. The significance of our cases arises from the fact that this mutation (R257X is demonstrated in our ethnical group and geographical area for the first time. Turk Jem 2015; 19: 89-92

  15. Real Options in Defense R and D: A Decision Tree Analysis Approach for Options to Defer, Abandon, and Expand

    Science.gov (United States)

    2016-12-01

    investments. As a result, real options thinking has been widely accepted as a strategic aid in capital investment decision making. As scholars agree...4.6 4.6 .. Canada 273.8 227.6 257.0 233.5 .. .. Chile .. 0.2 0.1 0.2 .. .. Czech Republic 36.4 31.5 29.4 27.5 26.3 25.7 Denmark 9.8 7.4 7.2 7.2...0.01 Belgium 0.18 0.18 0.17 0.16 0.15 .. Canada 3.23 2.99 3.41 3.14 .. .. Chile .. 0.03 0.02 0.02 0.03 0.02 Czech Republic 2.25

  16. Histopathologic Patterns of Breast Lesions in Northern Saudi Arabia

    Directory of Open Access Journals (Sweden)

    Hussain Gadelkarim Ahmed

    2017-10-01

    Full Text Available Objective: The aim of this study was to find out the prevalence rates of common types of breast cancer in Northern Saudi Arabia. Methodology: A retrospective cohort study was carried out over a five-year period in two referral hospitals. In this study 257 files were retrieved from departments of Surgery from different hospitals in Hail region, Kingdom of Saudi Arabia (KSA. Results: Of the 257 samples diagnosed using Fine Needle Aspiration Cytology (FNAC, histopathological diagnosis was confirmed for 158 patients. Of the 158 diagnosed samples, 46/158 (23.2% were ductal carcinoma, 7/158 (4.4% were lobular carcinoma, 3/158 (1.9% were mixed tumours, and 102/158 (64.6 were fibroadenoma. Conclusion: Fibroadenoma and ductal carcinoma are the prevalent breast lesions in Hail Region of Saudi Arabia.

  17. Proposal of an analytical methodology to evaluate asbestos content into bulk samples by means of Fourier transform infrared spectroscopy; Una proposta di metodica analitica per la determinazione del contenuto di amianto in campioni massivi tramite spettroscopia infrarossa in trasformata di Fourier

    Energy Technology Data Exchange (ETDEWEB)

    Cioffi, R. [Potenza Universita' della Basilicata, Potenza (Italy). Dipt. di Ingegneria e Fisica dell' Ambiente; De Stefano, L. [Area Ambiente Ricerca, Segrate, MI (Italy); Lavorgna, M.; Palumbo, M. [Naples Univ. Federico 2., Naples (Italy). Dipt. di Ingegneria dei Materiali e della Produzione

    2001-04-01

    The Italian act 257/92 imposes the identification and classification of asbestos containing materials in order to opportune programs of control and maintenance or of reclamation and disposal. In this work is presented a proposal of an analytical methodology to evaluate the content of asbestos in bulk samples by Fourier Transform Infrared (FT-IR) spectroscopy. The accuracy and the precision of the method have been verified on test mixtures with a known content of asbestos. [Italian] La legge 257/92 impone di individuare e classificare i materiali contenenti amianto per stabilire opportuni programmi di controllo e manutenzione o di bonifica e smaltimento. In questo lavoro e' presentata in dettaglio una proposta di metodica analitica per la determinazione del contenuto di amianto in campioni massivi tramite spettroscopia infrarossa in trasformata di Fourier (FT-IR). L'accuratezza e la precisione della metodica sono state verificate con miscele di prova a contenuto noto di amianto.

  18. Calibration Tests of Fuel Assembly Simulators of APR+ Reactor

    Energy Technology Data Exchange (ETDEWEB)

    Kim, Kih Wan; Chu, In Cheol; Euh, Dong Jin; Kwon, Tae Soon [KAERI, Daejeon (Korea, Republic of)

    2012-10-15

    A Reactor flow distribution is regarded to be major importance in improving the design margin of a flow distribution. The prediction of APR+ core fluid flow phenomena has been in demand, since 257 fuel assemblies are adapted in the APR+, unlike in the APR1400. The APR+ reactor flow test facility, the ACOP (APR+ Core Flow and Pressure Test Facility), was constructed to analyze the hydraulic characteristics. For the ACOP facility, the core simulator was designed with a scale analysis to simulate the real HIPER fuel assembly of an APR+. In this study, for all 257 core simulators, several calibration tests were conducted to verify their design performance before applying them to the ACOP facility. The inlet flow rate and the total pressure drop of the simulators were measured by varying flow rates to evaluate its compatibility. The discharge coefficients were also calculated from the experimental data to produce a statistical database for a further ACOP facility test.

  19. Cross flow tests of APR+ core simulator

    Energy Technology Data Exchange (ETDEWEB)

    Kim, Kih Wan; Chu, In Cheol; Choi, Hae Seob; Euh, Dong Jin; Kwon, Tae Soon [KAERI, Daejeon (Korea, Republic of)

    2012-10-15

    An accurate prediction of an APR+ core flow is in demand since the APR+ has 257 fuel assemblies, unlike in the APR1400. The APR+ reactor flow distribution test facility, which was named ACOP (APR+ Core Flow and Pressure Test Facility), was developed to conduct various hydraulic tests. The 257 core simulators were installed in the ACOP to measure the hydraulic characteristics at the inlet and outlet of the fuel assemblies. The simulator was designed with a linear reduced scale of 1/5 to preserve a geometrically similar flow without hindering the dynamic similarity. The cross flow characteristic of the simulator may be regarded as of major importance to evaluate the pressure distribution at the outlet of the fuel assembly. This paper shows a cross flow test for each core simulator which are arranged in a row. The results are also compared with those of the HIPER and core simulators obtained from the CFD code, and are carefully examined.

  20. Nuclear structure of the transactinides – investigated by decay spectroscopy

    Directory of Open Access Journals (Sweden)

    Heßberger Fritz Peter

    2016-01-01

    Full Text Available Superheavy elements owe their stability due to a subtle balance between the disruptive Coulomb force and the attractive nuclear forces. Thus they represent an ideal laboratory to study basic interactions. The essential tools are detailed investigations of radioactive decay properties and nuclear structure of superheavy nuclei. The results of those studies will deliver valuable input to improve theoretical models. To fulfill this demand conclusive data of high quality are necessary, which is presently not so easy to meet due to small production cross sections and technical limitations (beam intensities, detection probabilities. Possibilities and problems concerning extraction of decay properties and nuclear structure information on the basis of a low number of observed decay events will be discussed for three illustrative examples, 257Rf, 257Lr, and 288Fl.