WorldWideScience

Sample records for mendelevium 257

  1. 6 CFR 25.7 - Litigation management.

    Science.gov (United States)

    2010-01-01

    ... 6 Domestic Security 1 2010-01-01 2010-01-01 false Litigation management. 25.7 Section 25.7 Domestic Security DEPARTMENT OF HOMELAND SECURITY, OFFICE OF THE SECRETARY REGULATIONS TO SUPPORT ANTI-TERRORISM BY FOSTERING EFFECTIVE TECHNOLOGIES § 25.7 Litigation management. (a) Liability for all claims...

  2. 40 CFR 257.3-8 - Safety.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 24 2010-07-01 2010-07-01 false Safety. 257.3-8 Section 257.3-8... and Practices § 257.3-8 Safety. (a) Explosive gases. The concentration of explosive gases generated by... shall not pose a hazard to the safety of persons or property from fires. This may be accomplished...

  3. 4 CFR 25.7 - Gambling.

    Science.gov (United States)

    2010-01-01

    ... 4 Accounts 1 2010-01-01 2010-01-01 false Gambling. 25.7 Section 25.7 Accounts GOVERNMENT ACCOUNTABILITY OFFICE GENERAL PROCEDURES CONDUCT IN THE GOVERNMENT ACCOUNTABILITY OFFICE BUILDING AND ON ITS GROUNDS § 25.7 Gambling. Participating in games for money or other personal property or operating gambling...

  4. 32 CFR 257.3 - Definition.

    Science.gov (United States)

    2010-07-01

    ... 32 National Defense 2 2010-07-01 2010-07-01 false Definition. 257.3 Section 257.3 National Defense... SERVICE OF PROCESS § 257.3 Definition. Service of Process. When applied to the filing of a court action... delivery of a subpoena for any other reason whether or not the matter involves the United States. ...

  5. Chemical properties of mendelevium

    International Nuclear Information System (INIS)

    Hulet, E.K.

    1980-01-01

    The isotope 256 Md is nearly always employed for chemical studies of this element. This nuclide can be made by bombardment of fractions of a microgram of 254 Es with intense alpha-particle beams which will produce about 10 6 atoms of 256 Md with a half-life of 77 minutes. Even with the most intense ion beams and the largest available quantities of target isotope, about 10 6 atoms at a time is all the Md that can be produced for chemical studies. This lack of sufficient sample size coupled with the very short lifetimes of the few atoms produced has severly restricted the gathering and broadening of our knowledge concerning the properties of Md and the heavier elements. To illustrate, the literature contains a mere eleven references to the chemical studies of Md, and none of these deal with bulk properties associated with element found in solid phases. Some of these findings are: Md was found to be more volatile than other actinide metals which lead to the belief that it is divalent in the metallic state; separation of Md from the other actinides can be accomplished either by reduction of Md to the divalent state or by chromatographic separations with Md remaining in the tripositive state; extraction of Md with bis(2-ethylhexyl)phosphoric acid is much poorer than the extraction of the neighboring tripositive actinides; attempts to oxidize Md wih sodium bismuthate failed to show any evidence of Md 4+ ; standard reduction potential of Md 3+ was found to be close to -0.1 volt; Md 3+ can be reduced to Md(Hg) by sodium amalgams and by electrolysis; the electrochemical behavior of Md is very similar to that of Fm and can be summarized in the equation, Md 2+ + 2e - = Md(Hg), and E 0 = 1.5 V

  6. Chemical properties of mendelevium

    International Nuclear Information System (INIS)

    Hulet, E.K.

    1980-11-01

    Even with the most intense ion beams and the largest available quantities of target isotope, about 10 6 atoms at a time is all the Md that can be produced for chemical studies. This lack of sufficient sample size coupled with the very short lifetimes of the few atoms produced has severely restricted the gathering and the broadness of our knowledge concerning the properties of Md and the heavier elements. To illustrate, the literature contains a mere eleven references to the chemical studies of Md, and none of these deal with bulk properties associated with the element bound in solid phases. Some of these findings are: Md was found to be more volatile than other actinide metals which lead to the belief that it is divalent in the metallic state; separation of Md from the other actinides can be accomplished either by reduction of Md 3+ to the divalent state or by chromatographic separations with Md remaining in the tripositive state; extraction of Md 2+ with bis(2-ethylhexyl)phosphoric acid is much poorer than the extraction of the neighboring tripositive actinides; attempts to oxidize Md 3+ with sodium bismuthate failed to show any evidence for Md 4+ ; reduction potential of Md 3+ was found to be close to -0.1 volt; Md 3+ can be reduced to Md(Hg) by sodium amalgams and by electrolysis; the electrochemical behavior of Md is very similar to that of Fm and can be summarized in the equation, Md 2+ + 2e - = Md(Hg) and E 0 = -1.50 V.; and Md cannot be reduced to a monovalent ion with Sm 2+

  7. 27 CFR 40.257 - Processed tobacco.

    Science.gov (United States)

    2010-04-01

    ... 27 Alcohol, Tobacco Products and Firearms 2 2010-04-01 2010-04-01 false Processed tobacco. 40.257 Section 40.257 Alcohol, Tobacco Products and Firearms ALCOHOL AND TOBACCO TAX AND TRADE BUREAU, DEPARTMENT OF THE TREASURY (CONTINUED) TOBACCO MANUFACTURE OF TOBACCO PRODUCTS, CIGARETTE PAPERS AND TUBES, AND...

  8. 40 CFR 265.257 - Special requirements for incompatible wastes.

    Science.gov (United States)

    2010-07-01

    ..., STORAGE, AND DISPOSAL FACILITIES Waste Piles § 265.257 Special requirements for incompatible wastes. (a... 40 Protection of Environment 25 2010-07-01 2010-07-01 false Special requirements for incompatible wastes. 265.257 Section 265.257 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED...

  9. 40 CFR 264.257 - Special requirements for incompatible wastes.

    Science.gov (United States)

    2010-07-01

    ... DISPOSAL FACILITIES Waste Piles § 264.257 Special requirements for incompatible wastes. (a) Incompatible... 40 Protection of Environment 25 2010-07-01 2010-07-01 false Special requirements for incompatible wastes. 264.257 Section 264.257 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED...

  10. 29 CFR 25.7 - Fees; cost; expenses; decisions.

    Science.gov (United States)

    2010-07-01

    ... 29 Labor 1 2010-07-01 2010-07-01 true Fees; cost; expenses; decisions. 25.7 Section 25.7 Labor... ORDER 10988 § 25.7 Fees; cost; expenses; decisions. (a) Arbitrator's fees, per diem and travel expenses... entirely by the agency. (b) The standard fee for the services of an arbitrator should be $100 per day...

  11. 40 CFR 257.3-4 - Ground water.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 24 2010-07-01 2010-07-01 false Ground water. 257.3-4 Section 257.3-4... and Practices § 257.3-4 Ground water. (a) A facility or practice shall not contaminate an underground drinking water source beyond the solid waste boundary or beyond an alternative boundary specified in...

  12. 40 CFR 257.3-3 - Surface water.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 24 2010-07-01 2010-07-01 false Surface water. 257.3-3 Section 257.3-3... and Practices § 257.3-3 Surface water. (a) For purposes of section 4004(a) of the Act, a facility... Water Act, as amended. (b) For purposes of section 4004(a) of the Act, a facility shall not cause a...

  13. 43 CFR 2.57 - Accounting for disclosures.

    Science.gov (United States)

    2010-10-01

    ... 43 Public Lands: Interior 1 2010-10-01 2010-10-01 false Accounting for disclosures. 2.57 Section 2... INFORMATION ACT Privacy Act § 2.57 Accounting for disclosures. (a) Maintenance of an accounting. (1) Where a... the person or agency to whom the disclosure was made. (3) Accountings prepared under this section...

  14. 7 CFR 2.57 - Administrator, Food and Nutrition Service.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 1 2010-01-01 2010-01-01 false Administrator, Food and Nutrition Service. 2.57... for Food, Nutrition, and Consumer Services § 2.57 Administrator, Food and Nutrition Service. (a... delegations of authority are made by the Under Secretary for Food, Nutrition, and Consumer Services to the...

  15. 40 CFR 257.3-2 - Endangered species.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 24 2010-07-01 2010-07-01 false Endangered species. 257.3-2 Section... Disposal Facilities and Practices § 257.3-2 Endangered species. (a) Facilities or practices shall not cause or contribute to the taking of any endangered or threatened species of plants, fish, or wildlife. (b...

  16. 50 CFR 216.257 - Letters of Authorization.

    Science.gov (United States)

    2010-10-01

    ... ADMINISTRATION, DEPARTMENT OF COMMERCE MARINE MAMMALS REGULATIONS GOVERNING THE TAKING AND IMPORTING OF MARINE MAMMALS Taking Marine Mammals Incidental to Conducting Precision Strike Weapon Missions in the Gulf of Mexico § 216.257 Letters of Authorization. (a) A Letter of Authorization, unless suspended or revoked...

  17. SISAK liquid-liquid extraction experiments with preseparated 257Rf

    International Nuclear Information System (INIS)

    Omtvedt, Jon Petter; Alstad, J.; Breivik, H.; Dyve, J.E.; Eberhardt, K.; Folden III, C.M.; Ginter, T.; Gregorich, K.E.; Hult, E.A.; Johansson, M.; Kirbach, U.W.; Lee, D.M.; Mendel, M.; Nahler, A.; Ninov, V.; Omtvedt, L.A.; Patin, J.B.; Skarnemark, G.; Stavsetra, L.; Sudowe, R.; Wiehl, N.; Wierczinski, B.; Wilk, P.A.; Zielinski, P.M.; Kratz, J.V.; Trautmann, N.; Nitsche, H.; Hoffman, D.C.

    2002-01-01

    The SISAK liquid-liquid extraction system was used to extract 4.0-s 257Rf. The 257Rf was produced in the reaction 208Pb(50Ti, 1n)257Rf with 237-MeV beam energy on target, separated in the Berkeley Gas-filled Separator (BGS) and transferred to a gas jet using the Recoil Transfer Chamber (RTC). The activity delivered by the gas jet was dissolved in 6-M HNO3 and Rf was extracted into 0.25-M dibutyl-phosphoric acid in toluene. This was the first time a transactinide, i.e., an element with Z >= 104, was extracted and unequivocally identified by the SISAK system. Thus, this pilot experiment demonstrates that the fast liquid-liquid extraction system SISAK, in combination with liquidscintillation detectors, can be used for investigating the chemical properties of the transactinides. The extraction result is in accordance with the behaviour shown by the Rf group IV homologues Zr and Hf

  18. Photoelectron Emission Studies in CsBr at 257 nm

    International Nuclear Information System (INIS)

    Maldonado, Juan R.; Liu, Zhi; Sun, Yun; Pianetta, Piero A.; Pease, Fabian W.

    2006-01-01

    CsBr/Cr photocathodes were found [1,2] to meet the requirements of a multi-electron beam lithography system operating with a light energy of 4.8 eV (257nm). The fact that photoemission was observed with a light energy below the reported 7.3 eV band gap for CsBr was not understood. This paper presents experimental results on the presence of intra-band gap absorption sites (IBAS) in CsBr thin film photo electron emitters, and presents a model based on IBAS to explain the observed photoelectron emission behavior at energies below band gap. A fluorescence band centered at 330 nm with a FWHM of about 0.34 eV was observed in CsBr/Cr samples under 257 nm laser illumination which can be attributed to IBAS and agrees well with previously obtained synchrotron photoelectron spectra[1] from the valence band of CsBr films

  19. 42 CFR 447.257 - FFP: Conditions relating to institutional reimbursement.

    Science.gov (United States)

    2010-10-01

    ... 42 Public Health 4 2010-10-01 2010-10-01 false FFP: Conditions relating to institutional reimbursement. 447.257 Section 447.257 Public Health CENTERS FOR MEDICARE & MEDICAID SERVICES, DEPARTMENT OF...: Conditions relating to institutional reimbursement. FFP is not available for a State's expenditures for...

  20. 24 CFR 257.401 - Notice of false information from mortgagor-procedure.

    Science.gov (United States)

    2010-04-01

    ... 24 Housing and Urban Development 2 2010-04-01 2010-04-01 false Notice of false information from... HOUSING ACT AND OTHER AUTHORITIES HOPE FOR HOMEOWNERS PROGRAM Enforcement Mortgagor False Information § 257.401 Notice of false information from mortgagor-procedure. (a) If FHA finds that the mortgagor has...

  1. 24 CFR 983.257 - Owner termination of tenancy and eviction.

    Science.gov (United States)

    2010-04-01

    ... (iv) do not apply to the PBV program. (In the PBV program, “good cause” does not include a business or... URBAN DEVELOPMENT PROJECT-BASED VOUCHER (PBV) PROGRAM Occupancy § 983.257 Owner termination of tenancy... good cause as stated in paragraph (a) of this section; (3) Refuse to renew the lease without good cause...

  2. Loci and candidate genes conferring resistance to soybean cyst nematode HG type 2.5.7.

    Science.gov (United States)

    Zhao, Xue; Teng, Weili; Li, Yinghui; Liu, Dongyuan; Cao, Guanglu; Li, Dongmei; Qiu, Lijuan; Zheng, Hongkun; Han, Yingpeng; Li, Wenbin

    2017-06-14

    Soybean (Glycine max L. Merr.) cyst nematode (SCN, Heterodera glycines I,) is a major pest of soybean worldwide. The most effective strategy to control this pest involves the use of resistant cultivars. The aim of the present study was to investigate the genome-wide genetic architecture of resistance to SCN HG Type 2.5.7 (race 1) in landrace and elite cultivated soybeans. A total of 200 diverse soybean accessions were screened for resistance to SCN HG Type 2.5.7 and genotyped through sequencing using the Specific Locus Amplified Fragment Sequencing (SLAF-seq) approach with a 6.14-fold average sequencing depth. A total of 33,194 SNPs were identified with minor allele frequencies (MAF) over 4%, covering 97% of all the genotypes. Genome-wide association mapping (GWAS) revealed thirteen SNPs associated with resistance to SCN HG Type 2.5.7. These SNPs were distributed on five chromosomes (Chr), including Chr7, 8, 14, 15 and 18. Four SNPs were novel resistance loci and nine SNPs were located near known QTL. A total of 30 genes were identified as candidate genes underlying SCN resistance. A total of sixteen novel soybean accessions were identified with significant resistance to HG Type 2.5.7. The beneficial alleles and candidate genes identified by GWAS might be valuable for improving marker-assisted breeding efficiency and exploring the molecular mechanisms underlying SCN resistance.

  3. Magnetic and structural properties of mechanically alloyed Tb0.257-xNdxFe0.743 alloys, with x = 0 and 0.257

    International Nuclear Information System (INIS)

    Rojas Martinez, Y.; Bustos Rodriguez, H.; Oyola Lozano, D.; Perez Alcazar, G. A.; Paz, J. C.

    2007-01-01

    The alloys between a transition metal and a rare earth present magnetic and magneto optical properties of exceptional interest for the production of magnetic devices for information storage. In this work we report the magnetic and structural properties, obtained by Moessbauer spectrometry (MS) and X-ray diffraction (XRD), of Tb 0.257-x Nd x Fe 0.743 alloys with x = 0 and 0.257 prepared by mechanical alloying during 12, 24 and 48 h, to study the influence of the milling time in their magnetic and structural properties. The X-rays results show for all the samples that the α and an amorphous phase are always present. The first decreases and the second increases with the increase of the milling time. Moessbauer results show that the amorphous phase in samples with Nd is ferromagnetic and appears as a hyperfine field distribution and a broad doublet, and that as the milling time increases the paramagnetic contribution increases. For samples with Tb the amorphous phase is paramagnetic and appears as a broad doublet which increases with the milling time and for 48 h milling it appears an additional broad singlet.

  4. Structure of the conserved hypothetical protein MAL13P1.257 from Plasmodium falciparum

    International Nuclear Information System (INIS)

    Holmes, Margaret A.; Buckner, Frederick S.; Van Voorhis, Wesley C.; Mehlin, Christopher; Boni, Erica; Earnest, Thomas N.; DeTitta, George; Luft, Joseph; Lauricella, Angela; Anderson, Lori; Kalyuzhniy, Oleksandr; Zucker, Frank; Schoenfeld, Lori W.; Hol, Wim G. J.; Merritt, Ethan A.

    2006-01-01

    The crystal structure of a conserved hypothetical protein, MAL13P1.257 from P. falciparum, has been determined at 2.17 Å resolution. The structure represents a new protein fold and is the first structural representative for Pfam sequence family PF05907. The structure of a conserved hypothetical protein, PlasmoDB sequence MAL13P1.257 from Plasmodium falciparum, Pfam sequence family PF05907, has been determined as part of the structural genomics effort of the Structural Genomics of Pathogenic Protozoa consortium. The structure was determined by multiple-wavelength anomalous dispersion at 2.17 Å resolution. The structure is almost entirely β-sheet; it consists of 15 β-strands and one short 3 10 -helix and represents a new protein fold. The packing of the two monomers in the asymmetric unit indicates that the biological unit may be a dimer.

  5. 2-(5,7-Dimethyl-3-methylsulfanyl-1-benzofuran-2-ylacetic acid

    Directory of Open Access Journals (Sweden)

    Hong Dae Choi

    2008-08-01

    Full Text Available The title compound, C13H14O3S, was prepared by alkaline hydrolysis of ethyl 2-(5,7-dimethyl-3-methylsulfanyl-1-benzofuran-2-ylacetate. In the crystal structure, the carboxyl groups are involved in intermolecular O—H...O hydrogen bonds, which link the molecules into centrosymmetric dimers. These dimers are further packed into stacks along the a axis by weak C—H...π interactions.

  6. SISAK liquid-liquid extraction experiments with preseparated {sup 257}Rf

    Energy Technology Data Exchange (ETDEWEB)

    Omtvedt, Jon Petter; Alstad, J.; Breivik, H. [University of Oslo, Department of Chemistry, Oslo (NO)] (and others)

    2002-06-01

    The SISAK liquid-liquid extraction system was used to extract 4.0-s {sup 257}Rf. The {sup 257}Rf was produced in the reaction {sup 208}Pb({sup 50}Ti, 1n){sup 257}Rf with 237-MeV beam energy on target, separated in the Berkeley Gas-filled Separator (BGS) and transferred to a gas jet using the Recoil Transfer Chamber (RTC). The activity delivered by the gas jet was dissolved in 6-M HNO{sub 3} and Rf was extracted into 0.25-M dibutyl-phosphoric acid in toluene. This was the first time a transactinide, i.e., an element with Z{>=}104, was extracted and unequivocally identified by the SISAK system. Thus, this pilot experiment demonstrates that the fast liquid-liquid extraction system SISAK, in combination with liquid-scintillation detectors, can be used for investigating the chemical properties of the transactinides. The extraction result is in accordance with the behaviour shown by the Rf group IV homologues Zr and Hf. (author)

  7. Studies of neutron-deficient mendelevium isotopes at SHIP

    Energy Technology Data Exchange (ETDEWEB)

    Antalic, S.; Saro, S. [Comenius University, Department of Nuclear Physics and Biophysics, Bratislava (Slovakia); Hessberger, F.P.; Ackermann, D.; Heinz, S.; Kindler, B.; Kojouharov, I.; Lommel, B.; Mann, R. [GSI Helmholtzzentrum fuer Schwerionenforschung GmbH, Darmstadt (Germany); Hofmann, S. [GSI Helmholtzzentrum fuer Schwerionenforschung GmbH, Darmstadt (Germany); Goethe-Universitaet, Institut fuer Kernphysik, Frankfurt am Main (Germany); Kuusiniemi, P. [University of Oulu, Centre for Underground Physics in Pyhaesalmi (CUPP), Oulu (Finland); Leino, M. [University of Jyvaeskylae, Department of Physics, Jyvaeskylae (Finland)

    2010-01-15

    The radioactive decay of the isotopes {sup 247}Md, {sup 246}Md and their daughter products was investigated by means of {alpha}-{alpha} and {alpha}-{gamma} coincidence spectroscopy. The isotopes were produced using the fusion reaction {sup 40}Ar + {sup 209}Bi. Decay schemes are suggested for {sup 247}Md and {sup 243}Es. A new isomeric state in {sup 246}Md with a half-life of (4.4{+-}0.8) s was observed. Previous data of electron-capture delayed fission of {sup 246}Md and {sup 242}Es were confirmed. The probability for this decay branch in {sup 246}Md was measured to be P{sub ECDF}>0.10. The probability for electron-capture delayed fission in the case of {sup 242}Es was determined to be P{sub ECDF}=0.013{sup +0.012} {sub -0.007}. (orig.)

  8. 40 CFR 257.5 - Disposal standards for owners/operators of non-municipal non-hazardous waste disposal units that...

    Science.gov (United States)

    2010-07-01

    ... compliance with §§ 257.7 through 257.30 prior to the receipt of CESQG hazardous waste. (b) Definitions.... Waste management unit boundary means a vertical surface located at the hydraulically downgradient limit.../operators of non-municipal non-hazardous waste disposal units that receive Conditionally Exempt Small...

  9. 47 CFR 25.257 - Special requirements for operations in the band 29.1-29.25 GHz between NGSO MSS and LMDS.

    Science.gov (United States)

    2010-10-01

    ... 47 Telecommunication 2 2010-10-01 2010-10-01 false Special requirements for operations in the band 29.1-29.25 GHz between NGSO MSS and LMDS. 25.257 Section 25.257 Telecommunication FEDERAL COMMUNICATIONS COMMISSION (CONTINUED) COMMON CARRIER SERVICES SATELLITE COMMUNICATIONS Technical Standards § 25...

  10. 24 CFR 257.203 - Calculation of up-front and annual mortgage insurance premiums for H4H program mortgages.

    Science.gov (United States)

    2010-04-01

    ... mortgage insurance premiums for H4H program mortgages. 257.203 Section 257.203 Housing and Urban... mortgage insurance premiums for H4H program mortgages. (a) Applicable premiums. Any mortgage presented for... LOAN INSURANCE PROGRAMS UNDER NATIONAL HOUSING ACT AND OTHER AUTHORITIES HOPE FOR HOMEOWNERS PROGRAM...

  11. Kidney transplant graft outcomes in 379 257 recipients on 3 continents.

    Science.gov (United States)

    Merion, Robert M; Goodrich, Nathan P; Johnson, Rachel J; McDonald, Stephen P; Russ, Graeme R; Gillespie, Brenda W; Collett, David

    2018-03-24

    Kidney transplant outcomes that vary by program or geopolitical unit may result from variability in practice patterns or health care delivery systems. In this collaborative study, we compared kidney graft outcomes among 4 countries (United States, United Kingdom, Australia, and New Zealand) on 3 continents. We analyzed transplant and follow-up registry data from 1988-2014 for 379 257 recipients of first kidney-only transplants using Cox regression. Compared to the United States, 1-year adjusted graft failure risk was significantly higher in the United Kingdom (hazard ratio [HR] 1.22, 95% confidence interval [CI] 1.18-1.26, P < .001) and New Zealand (hazard ratio [HR] 1.29, 95% confidence interval [CI] 1.14-1.46, P < .001), but lower in Australia (HR 0.90, 95% CI 0.84-0.96, P = .001). In contrast, long-term adjusted graft failure risk (conditional on 1-year function) was significantly higher in the United States compared to Australia, New Zealand, and the United Kingdom (HR 0.74, 0.75, and 0.74, respectively; each P < .001). Thus long-term kidney graft outcomes are approximately 25% worse in the United States than in 3 other countries with well-developed kidney transplant systems. Case mix differences and residual confounding from unmeasured factors were found to be unlikely explanations. These findings suggest that identification of potentially modifiable country-specific differences in care delivery and/or practice patterns should be sought. © 2018 The American Society of Transplantation and the American Society of Transplant Surgeons.

  12. Fission of 255,256Es, 255-257Fm, and 258Md at moderate excitation energies

    NARCIS (Netherlands)

    Britt, H.C.; Hoffman, D.C.; Plicht, J. van der; Wilhelmy, J.; Cheifetz, E.; Dupzyk, R.J.; Lougheed, R.W.

    1984-01-01

    The fission of 255,256Es, 255-257Fm, and 258Md has been studied in the excitation energy range from threshold to 25 MeV. A target of 254Es was used in the direct reaction studies; (d,pf), (t,pf), (3He,df), (3He,pf), and in the compound induced fission reactions formed with p, d, t, and α particle

  13. Half-lives of long-lived isotopes of transactinium elements from 228Th to 257Fm

    International Nuclear Information System (INIS)

    Surin, V.M.; Fomushkin, Eh.F.

    1983-09-01

    The experimental measurements and critical evaluation results of the long-lived isotope half-decay periods of transactinium elements (from 228 Th to 257 Fm) are given on July 1981 to be published in open literature and related to the natural radioactive decay. From the massif of the known half-decay periods the most reliable data were selected, received or evaluated and recommended for practical use; the calculations of isotope specific activities were performed on this data. (author)

  14. Magnetic and structural properties of mechanically alloyed Tb{sub 0.257-x}Nd{sub x}Fe{sub 0.743} alloys, with x = 0 and 0.257

    Energy Technology Data Exchange (ETDEWEB)

    Rojas Martinez, Y., E-mail: yarojas@ut.edu.co; Bustos Rodriguez, H.; Oyola Lozano, D. [University of Tolima, Department of Physics (Colombia); Perez Alcazar, G. A.; Paz, J. C. [University of Valle, Department of Physics (Colombia)

    2007-02-15

    The alloys between a transition metal and a rare earth present magnetic and magneto optical properties of exceptional interest for the production of magnetic devices for information storage. In this work we report the magnetic and structural properties, obtained by Moessbauer spectrometry (MS) and X-ray diffraction (XRD), of Tb{sub 0.257-x}Nd{sub x}Fe{sub 0.743} alloys with x = 0 and 0.257 prepared by mechanical alloying during 12, 24 and 48 h, to study the influence of the milling time in their magnetic and structural properties. The X-rays results show for all the samples that the {alpha} and an amorphous phase are always present. The first decreases and the second increases with the increase of the milling time. Moessbauer results show that the amorphous phase in samples with Nd is ferromagnetic and appears as a hyperfine field distribution and a broad doublet, and that as the milling time increases the paramagnetic contribution increases. For samples with Tb the amorphous phase is paramagnetic and appears as a broad doublet which increases with the milling time and for 48 h milling it appears an additional broad singlet.

  15. Mitochondrial DNA polymerase editing mutation, PolgD257A, disturbs stem-progenitor cell cycling in the small intestine and restricts excess fat absorption.

    Science.gov (United States)

    Fox, Raymond G; Magness, Scott; Kujoth, Gregory C; Prolla, Tomas A; Maeda, Nobuyo

    2012-05-01

    Changes in intestinal absorption of nutrients are important aspects of the aging process. To address this issue, we investigated the impact of accelerated mitochondrial DNA mutations on the stem/progenitor cells in the crypts of Lieberkühn in mice homozygous for a mitochondrial DNA polymerase gamma mutation, Polg(D257A), that exhibit accelerated aging phenotype. As early as 3-7 mo of age, the small intestine was significantly enlarged in the PolgD257A mice. The crypts of the PolgD257A mice contained 20% more cells than those of their wild-type littermates and exhibited a 10-fold increase in cellular apoptosis primarily in the stem/progenitor cell zones. Actively dividing cells were proportionally increased, yet a significantly smaller proportion of cells was in the S phase of the cell cycle. Stem cell-derived organoids from PolgD257A mice failed to develop fully in culture and exhibited fewer crypt units, indicating an impact of the mutation on the intestinal epithelial stem/progenitor cell maintenance. In addition, epithelial cell migration along the crypt-villus axis was slowed and less organized, and the ATP content in the villi was significantly reduced. On a high-fat, high-carbohydrate diet, PolgD257A mice showed significantly restricted absorption of excess lipids accompanied by an increase in fecal steatocrits. We conclude that the PolgD257A mutation causes cell cycle dysregulation in the crypts leading to the age-associated changes in the morphology of the small intestine and contributes to the restricted absorption of dietary lipids.

  16. 257__Omar_Tatsewarki

    African Journals Online (AJOL)

    User

    IRRIGATED FLUVISOLS ALONG RIVER TATSEWARKI, KANO, NIGERIA ... concentrations of heavy metals in wastewater irrigated Fluvisols and in the ..... Effects of. Wastewater Discharge on Heavy Metals. Pollution in Fadama Soils in Kano ...

  17. Mitochondrial DNA polymerase editing mutation, PolgD257A, reduces the diabetic phenotype of Akita male mice by suppressing appetite.

    Science.gov (United States)

    Fox, Raymond; Kim, Hyung-Suk; Reddick, Robert L; Kujoth, Gregory C; Prolla, Tomas A; Tsutsumi, Shuichi; Wada, Youichiro; Smithies, Oliver; Maeda, Nobuyo

    2011-05-24

    Diabetes and the development of its complications have been associated with mitochondrial DNA (mtDNA) dysfunction, but causal relationships remain undetermined. With the objective of testing whether increased mtDNA mutations exacerbate the diabetic phenotype, we have compared mice heterozygous for the Akita diabetogenic mutation (Akita) with mice homozygous for the D257A mutation in mitochondrial DNA polymerase gamma (Polg) or with mice having both mutations (Polg-Akita). The Polg-D257A protein is defective in proofreading and increases mtDNA mutations. At 3 mo of age, the Polg-Akita and Akita male mice were equally hyperglycemic. Unexpectedly, as the Polg-Akita males aged to 9 mo, their diabetic symptoms decreased. Thus, their hyperglycemia, hyperphagia and urine output declined significantly. The decrease in their food intake was accompanied by increased plasma leptin and decreased plasma ghrelin, while hypothalamic expression of the orexic gene, neuropeptide Y, was lower and expression of the anorexic gene, proopiomelanocortin, was higher. Testis function progressively worsened with age in the double mutants, and plasma testosterone levels in 9-mo-old Polg-Akita males were significantly reduced compared with Akita males. The hyperglycemia and hyperphagia returned in aged Polg-Akita males after testosterone administration. Hyperglycemia-associated distal tubular damage in the kidney also returned, and Polg-D257A-associated proximal tubular damage was enhanced. The mild diabetes of female Akita mice was not affected by the Polg-D257A mutation. We conclude that reduced diabetic symptoms of aging Polg-Akita males results from appetite suppression triggered by decreased testosterone associated with damage to the Leydig cells of the testis.

  18. Characteristic of metallic state preperties of mendelevium and other actinoids by thermochcomatography

    International Nuclear Information System (INIS)

    Hubener, S.; Zvara, I.

    1982-01-01

    The adsorption of the heavy actinoids Cf, Es, Fm, and Md on polycrystalline titanium and molybdenum has been studied by thermochromatography in comparison with several well-known metallic elements, in trace amounts. The data lead us to suggest that Es, Fm, and Md are divalent in the metallic state and, moreover, that the position of their f energy levels relativg to the Fermi-energy is lower than in the cases of Cf and Yb. A correlation was found between the experimental enthalpies of adsorption of the heavy actinoids and their predicted enthalpies of sublimation

  19. A Missense Mutation of G257A at Exon 3 in PEX7 CDS Was Responsible for the Incidence of Rhizomelic Chondrodysplasia Punctata Type 1

    Directory of Open Access Journals (Sweden)

    Marziyeh Alamatsaz

    2018-02-01

    Full Text Available Background Rhizomelic chondrodysplasia punctata (RCDP type 1 is among of the rare autosomal recessive peroxisome biogenesis disorders caused by mutations in the PEX7 gene. RCDP patients with the classic form of RCDP1 do not live more than 10- year. Materials and Methods In the present study, a two-year-old girl with skeletal abnormalities and dysmorphic facial appearance is reported to be suffered from RCDP. The patient's parents were second cousins and healthy and there was no similar case in the parents’ family. PEX7 gene was sequenced in the patient and her parents. Results A homozygous mutation, G257A, was identified PEX7 in the genome of patient while the parents were compound heterozygous. Conclusion Taken together, clinical presentation and peroxisome profile of the patient suggested a missense mutation led to formation of a pathogenic PEX7, responsible for incidence of RCDP.

  20. Achieving a Net Zero Energy Retrofit – in a humid, temperate climate – lessons from the University of Hawai’i at M&#257noa

    Energy Technology Data Exchange (ETDEWEB)

    Regnier, Cindy [Lawrence Berkeley National Lab. (LBNL), Berkeley, CA (United States); Harding, Ari [Lawrence Berkeley National Lab. (LBNL), Berkeley, CA (United States); Robinson, Alastair [Lawrence Berkeley National Lab. (LBNL), Berkeley, CA (United States)

    2015-07-01

    The University of Hawai’i at M&#257noa (UHM) partnered with the US Department of Energy (DOE) and the Hawai`i Clean Energy Initiative to develop and implement solutions to retrofit exiting buildings to reduce energy consumption by at least 30% as part of DOE’s Commercial Building Partnerships (CBP) Program1. Kuykendall Hall, located on the UHM campus in Honolulu, was the focus of a CBP analysis and design collaboration among the University of Hawai’i, their consultants, and Lawrence Berkeley National Laboratory (LBNL). Kuykendall Hall consists of two 1960s-era wings – a four-story wing containing classrooms, and a seven-story tower containing offices – with a total floor area of approximately 76,000 square feet (ft²).

  1. Propiedades estructurales y magnéticas de aleaciones Gd0.257 -xTbxFe0.743 obtenidas por aleamiento mecánico

    Directory of Open Access Journals (Sweden)

    Mauricio Galvis-Patiño

    2017-01-01

    Full Text Available En el presente trabajo se reporta el estudio de las propiedades estructurales y magnéticas de la composición en forma de polvo de Gd0.257-xTbxFe0.743 con x=0,  0.1285,  0.257,preparados por Aleamiento Mecánico (AM en atmosfera de argón durante 72 horas mediante un molino planetario de alta energía ;la caracterización estructural se realizó por medio de Difractometría de rayos X(DRX, para la caracterización magnética se utilizó la espectroscopía Mössbauer, los ciclos de histéresis se llevaron a cabo a través de  PPMS (Physical Property Measurement System, Sistema de Medidas de Propiedades Físicas. La fase de α-Fe se presenta en los tres difractogramas mediante un pico característico cuya  intensidad disminuye al reemplazar el Tb por el Gd, presentándose la menor en x= 0 así mismo se observa un aumento de su ancho atribuible a la presencia de átomos de Gd en lugares propios del Fe. Los espectros Mössbauer (EM fueron ajustados con sextetos, dobletes, singletes y distribuciones de campo hiperfino lo que señala que el orden magnético se ve alterado al sustituir el Tb por el Gd en la composición. Las propiedades magnéticas extrínsecas de la composición en estudio, la caracterizan como materiales magnéticamente semiduros.

  2. Role of Ser-257 in the sliding mechanism of NADP(H) in the reaction catalyzed by the Aspergillus fumigatus flavin-dependent ornithine N5-monooxygenase SidA.

    Science.gov (United States)

    Shirey, Carolyn; Badieyan, Somayesadat; Sobrado, Pablo

    2013-11-08

    SidA (siderophore A) is a flavin-dependent N-hydroxylating monooxygenase that is essential for virulence in Aspergillus fumigatus. SidA catalyzes the NADPH- and oxygen-dependent formation of N(5)-hydroxyornithine. In this reaction, NADPH reduces the flavin, and the resulting NADP(+) is the last product to be released. The presence of NADP(+) is essential for activity, as it is required for stabilization of the C4a-hydroperoxyflavin, which is the hydroxylating species. As part of our efforts to determine the molecular details of the role of NADP(H) in catalysis, we targeted Ser-257 for site-directed mutagenesis and performed extensive characterization of the S257A enzyme. Using a combination of steady-state and stopped-flow kinetic experiments, substrate analogs, and primary kinetic isotope effects, we show that the interaction between Ser-257 and NADP(H) is essential for stabilization of the C4a-hydroperoxyflavin. Molecular dynamics simulation results suggest that Ser-257 functions as a pivot point, allowing the nicotinamide of NADP(+) to slide into position for stabilization of the C4a-hydroperoxyflavin.

  3. Hepatocellular Carcinoma in the Pediatric Population: A Population Based Clinical Outcomes Study Involving 257 Patients from the Surveillance, Epidemiology, and End Result (SEER Database (1973–2011

    Directory of Open Access Journals (Sweden)

    Christine S. M. Lau

    2015-01-01

    Full Text Available Introduction. Hepatocellular carcinoma (HCC is a rare pediatric cancer accounting for 0.5% of all pediatric malignancies. This study examines a large cohort of HCC patients in an effort to define the factors impacting clinical outcomes in pediatric HCC patients compared to adults. Methods. Demographic and clinical data on 63,771 HCC patients (257 pediatric patients ≤ 19 and 63,514 adult patients age ≥ 20 were abstracted from the SEER database (1973–2011. Results. HCC was more common among males (59.5% pediatric and 75.1% adults and Caucasians (50.4% and 50.5%, p 4 cm in size (79.6% versus 62.0%, p=0.02. Pediatric HCC patients undergoing surgery (13.107 versus 8.324 years, p4 cm in Caucasian males. Children with HCC achieve significantly longer mean overall survival compared to adults with HCC, primarily attributable to the more favorable fibrolamellar histologic variant, and more aggressive surgical intervention, which significantly improves survival.

  4. Observation of a Neutral Structure near the DD[over ¯]^{*} Mass Threshold in e^{+}e^{-}→(DD[over ¯]^{*})^{0}π^{0} at sqrt[s]=4.226 and 4.257 GeV.

    Science.gov (United States)

    Ablikim, M; Achasov, M N; Ai, X C; Albayrak, O; Albrecht, M; Ambrose, D J; Amoroso, A; An, F F; An, Q; Bai, J Z; Ferroli, R Baldini; Ban, Y; Bennett, D W; Bennett, J V; Bertani, M; Bettoni, D; Bian, J M; Bianchi, F; Boger, E; Boyko, I; Briere, R A; Cai, H; Cai, X; Cakir, O; Calcaterra, A; Cao, G F; Cetin, S A; Chang, J F; Chelkov, G; Chen, G; Chen, H S; Chen, H Y; Chen, J C; Chen, M L; Chen, S Chen; Chen, S J; Chen, X; Chen, X R; Chen, Y B; Cheng, H P; Chu, X K; Cibinetto, G; Dai, H L; Dai, J P; Dbeyssi, A; Dedovich, D; Deng, Z Y; Denig, A; Denysenko, I; Destefanis, M; De Mori, F; Ding, Y; Dong, C; Dong, J; Dong, L Y; Dong, M Y; Du, S X; Duan, P F; Fan, J Z; Fang, J; Fang, S S; Fang, X; Fang, Y; Fava, L; Feldbauer, F; Felici, G; Feng, C Q; Fioravanti, E; Fritsch, M; Fu, C D; Gao, Q; Gao, X L; Gao, X Y; Gao, Y; Gao, Z; Garzia, I; Goetzen, K; Gong, W X; Gradl, W; Greco, M; Gu, M H; Gu, Y T; Guan, Y H; Guo, A Q; Guo, L B; Guo, R P; Guo, Y; Guo, Y P; Haddadi, Z; Hafner, A; Han, S; Hao, X Q; Harris, F A; He, K L; He, X Q; Held, T; Heng, Y K; Hou, Z L; Hu, C; Hu, H M; Hu, J F; Hu, T; Hu, Y; Huang, G M; Huang, G S; Huang, J S; Huang, X T; Huang, Y; Hussain, T; Ji, Q; Ji, Q P; Ji, X B; Ji, X L; Jiang, L W; Jiang, X S; Jiang, X Y; Jiao, J B; Jiao, Z; Jin, D P; Jin, S; Johansson, T; Julin, A; Kalantar-Nayestanaki, N; Kang, X L; Kang, X S; Kavatsyuk, M; Ke, B C; Kiese, P; Kliemt, R; Kloss, B; Kolcu, O B; Kopf, B; Kornicer, M; Kühn, W; Kupsc, A; Lange, J S; Lara, M; Larin, P; Leng, C; Li, C; Li, Cheng; Li, D M; Li, F; Li, F Y; Li, G; Li, H B; Li, H J; Li, J C; Li, Jin; Li, K; Li, K; Li, Lei; Li, P R; Li, T; Li, W D; Li, W G; Li, X L; Li, X M; Li, X N; Li, X Q; Li, Z B; Liang, H; Liang, J J; Liang, Y F; Liang, Y T; Liao, G R; Lin, D X; Liu, B J; Liu, C X; Liu, D; Liu, F H; Liu, Fang; Liu, Feng; Liu, H B; Liu, H H; Liu, H H; Liu, H M; Liu, J; Liu, J B; Liu, J P; Liu, J Y; Liu, K; Liu, K Y; Liu, L D; Liu, P L; Liu, Q; Liu, S B; Liu, X; Liu, Y B; Liu, Z A; Liu, Zhiqing; Loehner, H; Lou, X C; Lu, H J; Lu, J G; Lu, Y; Lu, Y P; Luo, C L; Luo, M X; Luo, T; Luo, X L; Lyu, X R; Ma, F C; Ma, H L; Ma, L L; Ma, M M; Ma, Q M; Ma, T; Ma, X N; Ma, X Y; Maas, F E; Maggiora, M; Mao, Y J; Mao, Z P; Marcello, S; Messchendorp, J G; Min, J; Mitchell, R E; Mo, X H; Mo, Y J; Morales, C Morales; Moriya, K; Muchnoi, N Yu; Muramatsu, H; Nefedov, Y; Nerling, F; Nikolaev, I B; Ning, Z; Nisar, S; Niu, S L; Niu, X Y; Olsen, S L; Ouyang, Q; Pacetti, S; Pan, Y; Patteri, P; Pelizaeus, M; Peng, H P; Peters, K; Pettersson, J; Ping, J L; Ping, R G; Poling, R; Prasad, V; Qi, M; Qian, S; Qiao, C F; Qin, L Q; Qin, N; Qin, X S; Qin, Z H; Qiu, J F; Rashid, K H; Redmer, C F; Ripka, M; Rong, G; Rosner, Ch; Ruan, X D; Sarantsev, A; Savrié, M; Schoenning, K; Schumann, S; Shan, W; Shao, M; Shen, C P; Shen, P X; Shen, X Y; Sheng, H Y; Shi, M; Song, W M; Song, X Y; Sosio, S; Spataro, S; Sun, G X; Sun, J F; Sun, S S; Sun, X H; Sun, Y J; Sun, Y Z; Sun, Z J; Sun, Z T; Tang, C J; Tang, X; Tapan, I; Thorndike, E H; Tiemens, M; Ullrich, M; Uman, I; Varner, G S; Wang, B; Wang, D; Wang, D Y; Wang, K; Wang, L L; Wang, L S; Wang, M; Wang, P; Wang, P L; Wang, S G; Wang, W; Wang, W P; Wang, X F; Wang, Y D; Wang, Y F; Wang, Y Q; Wang, Z; Wang, Z G; Wang, Z H; Wang, Z Y; Wang, Z Y; Weber, T; Wei, D H; Wei, J B; Weidenkaff, P; Wen, S P; Wiedner, U; Wolke, M; Wu, L H; Wu, L J; Wu, Z; Xia, L; Xia, L G; Xia, Y; Xiao, D; Xiao, H; Xiao, Z J; Xie, Y G; Xiu, Q L; Xu, G F; Xu, J J; Xu, L; Xu, Q J; Xu, X P; Yan, L; Yan, W B; Yan, W C; Yan, Y H; Yang, H J; Yang, H X; Yang, L; Yang, Y; Yang, Y X; Ye, M; Ye, M H; Yin, J H; Yu, B X; Yu, C X; Yu, J S; Yuan, C Z; Yuan, W L; Yuan, Y; Yuncu, A; Zafar, A A; Zallo, A; Zeng, Y; Zeng, Z; Zhang, B X; Zhang, B Y; Zhang, C; Zhang, C C; Zhang, D H; Zhang, H H; Zhang, H Y; Zhang, J; Zhang, J J; Zhang, J L; Zhang, J Q; Zhang, J W; Zhang, J Y; Zhang, J Z; Zhang, K; Zhang, L; Zhang, X Y; Zhang, Y; Zhang, Y N; Zhang, Y H; Zhang, Y T; Zhang, Yu; Zhang, Z H; Zhang, Z P; Zhang, Z Y; Zhao, G; Zhao, J W; Zhao, J Y; Zhao, J Z; Zhao, Lei; Zhao, Ling; Zhao, M G; Zhao, Q; Zhao, Q W; Zhao, S J; Zhao, T C; Zhao, Y B; Zhao, Z G; Zhemchugov, A; Zheng, B; Zheng, J P; Zheng, W J; Zheng, Y H; Zhong, B; Zhou, L; Zhou, X; Zhou, X K; Zhou, X R; Zhou, X Y; Zhu, K; Zhu, K J; Zhu, S; Zhu, S H; Zhu, X L; Zhu, Y C; Zhu, Y S; Zhu, Z A; Zhuang, J; Zotti, L; Zou, B S; Zou, J H

    2015-11-27

    A neutral structure in the DD[over ¯]^{*} system around the DD[over ¯]^{*} mass threshold is observed with a statistical significance greater than 10σ in the processes e^{+}e^{-}→D^{+}D^{*-}π^{0}+c.c. and e^{+}e^{-}→D^{0}D[over ¯]^{*0}π^{0}+c.c. at sqrt[s]=4.226 and 4.257 GeV in the BESIII experiment. The structure is denoted as Z_{c}(3885)^{0}. Assuming the presence of a resonance, its pole mass and width are determined to be [3885.7_{-5.7}^{+4.3}(stat)±8.4(syst)]  MeV/c^{2} and [35_{-12}^{+11}(stat)±15(syst)]  MeV, respectively. The Born cross sections are measured to be σ[e^{+}e^{-}→Z_{c}(3885)^{0}π^{0},Z_{c}(3885)^{0}→DD[over ¯]^{*}]=[77±13(stat)±17(syst)]  pb at 4.226 GeV and [47±9(stat)±10(syst)]  pb at 4.257 GeV. The ratio of decay rates B[Z_{c}(3885)^{0}→D^{+}D^{*-}+c.c.]/B[Z_{c}(3885)^{0}→D^{0}D[over ¯]^{*0}+c.c.] is determined to be 0.96±0.18(stat)±0.12(syst), consistent with no isospin violation in the process, Z_{c}(3885)^{0}→DD[over ¯]^{*}.

  5. GSK3 beta forms a tetrameric complex with endogenous PS1-CTF/NTF and beta-catenin. Effects of the D257/D385A and FAD-linked mutations.

    Science.gov (United States)

    Tesco, G; Tanzi, R E

    2000-01-01

    We have previously shown that the endogenous C-terminal fragment of presenilin 1 co-immunoprecipitates with endogenous beta-catenin. Since PS1 has been suggested to be involved in beta-catenin stabilization, we further investigated whether GSK3 beta, responsible for beta-catenin phosphorylation and degradation, is part of the PS1/beta-catenin complex. In naïve H4 and CHO cells, PS1 co-immunoprecipitated with both endogenous beta-catenin and GSK3 beta. In addition, GSK3 beta endogenously binds to the PS1-CTF/NTF complex and beta-catenin in naïve CHO cells. GSK3 beta also co-immunoprecipitated with PS1 full length in CHO cell lines overexpressing PS1 wild type. Given that it has been recently shown that PS1 mutations of aspartate 257 or 385 result in prevention of PS1 endoproteolysis and inhibition of gamma-secretase activity, we also tested whether PS1 endoproteolysis is required for beta-catenin/GSK3 beta/PS1 binding and whether PS1 FAD-linked mutations affect GSK3 beta recruitment in the PS1/beta-catenin complex. GSK3 beta was detected in PS1 immunoprecipitates from H4 cell lines overexpressing PS1 wild type, delta E10, A286E, L246V and in CHO cell lines overexpressing aspartate or M146L mutations. The latter data show that the absence of PS1 endoproteolysis (D257A/D385A and delta E10) or the presence of PS1-FAD mutations does not interfere with beta-catenin/GSK3 beta/PS1 complex formation.

  6. Publications | Page 257 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Any -, Central Asia, Europe, Far East Asia, Middle East, North and Central America ... Utilization of trade agreements in Sri Lanka : perceptions of exporters vs. statistical ... in diverse cropping patterns, lifestyles and social and cultural relations. ... Research assessed the level of access to sexual and reproductive health ...

  7. 40 CFR 257.9 - Wetlands.

    Science.gov (United States)

    2010-07-01

    ... not locate such units in wetlands, unless the owner or operator can make the following demonstrations... actions (e.g., restoration of existing degraded wetlands or creation of man-made wetlands); and (5) Sufficient information is available to make a reasonable determination with respect to these demonstrations...

  8. Publications | Page 257 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    A public talk with Globe and Mail journalist Doug Saunders. A third of humanity is on the move—usually from farms ... This study looks at backward linkages to the manufacturing sector in the oil and gas value chain in Angola as a potential driver of industrial development. The study employs a sub-sectoral approach rather ...

  9. 17 CFR 257.2 - Schedule.

    Science.gov (United States)

    2010-04-01

    ... records (See Item 18). 4. Organization Documents: (a) Title, franchises, and licenses: (1) Certificates of... (prepared for internal administrative or operating purposes) of estimated future income, receipts and...

  10. 25 CFR 700.257 - Definitions.

    Science.gov (United States)

    2010-04-01

    ....C. 552a. (b) Individual. As used in this subpart, “individual” means a citizen of the United States... the Commission including, but not limited to, education, financial transactions, medical history, and... photograph. (e) System of records. As used in this subpart, “System of records” means a group of any records...

  11. 262 257 Profitability Analysis of Three Met

    African Journals Online (AJOL)

    2008-12-02

    Dec 2, 2008 ... marketing in Maiduguri Metropolitan Area in Borno State of Nigeria. ... emphasis on “convenience” foods such as Suya. (Igene ... of the businesses of the people of the State. .... are old in the business and, therefore, managed.

  12. 7 CFR 1944.257 - Service coordinator.

    Science.gov (United States)

    2010-01-01

    ... professional relationships with all agencies and service providers in the community, and develop a directory of...) Maintain necessary case files on each program participant, containing such information and kept in such...) Assist the grant recipient in building informal support networks with neighbors, friends and family; and...

  13. 40 CFR 257.21 - Applicability.

    Science.gov (United States)

    2010-07-01

    ...) Site-specific field collected measurements, sampling, and analysis of physical, chemical, and... there is no potential for migration of hazardous constituents from that unit to the uppermost aquifer...; and (5) Resource value of the underlying aquifer, including: (i) Current and future uses; (ii...

  14. 40 CFR 257.3-6 - Disease.

    Science.gov (United States)

    2010-07-01

    ... septic tank pumpings (Interim Final). A facility or practice involving disposal of sewage sludge or septic tank pumpings shall not exist or occur unless in compliance with paragraphs (b) (1), (2) or (3) of... trenching or burial operation.) (2) Septic tank pumpings that are applied to the land surface or...

  15. 17 CFR 257.1 - General instructions.

    Science.gov (United States)

    2010-04-01

    ... conflict with other legal retention requirements. Optional destruction of records relevant to pending or... statements including the transactions to which such records relate. (j) Use of technical accounting terms. For purposes of the schedules, traditional accounting terms such as ledgers, journals, registers and...

  16. 40 CFR 25.7 - Advisory groups.

    Science.gov (United States)

    2010-07-01

    ... agencies involved in activities supported by EPA financial assistance under any of the three Acts. (b) Role... should monitor the progress of the project and become familiar with issues relevant to project...

  17. Publications | Page 257 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    TTI reports on its first two years of programming. During its first two years, the Think Tank Initiative has supported 52 institutions in ... the way we acquire, disseminate, and transform knowledge. And, as a result, knowledge production is becoming closer and more directly linked to economic competitiveness. This evolution.

  18. 14 CFR 257.5 - Notice requirement.

    Science.gov (United States)

    2010-01-01

    ... that the corporate name of the transporting carrier and any other name under which that service is held... communication in the United States with a prospective consumer and in any telephone calls placed from the United... and shall identify the transporting carrier by its corporate name and any other name under which that...

  19. 40 CFR 257.3-7 - Air.

    Science.gov (United States)

    2010-07-01

    ... Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) SOLID WASTES CRITERIA FOR CLASSIFICATION OF SOLID WASTE DISPOSAL FACILITIES AND PRACTICES Classification of Solid Waste Disposal Facilities... residential, commercial, institutional or industrial solid waste. This requirement does not apply to...

  20. 42 CFR 441.257 - Informed consent.

    Science.gov (United States)

    2010-10-01

    ... otherwise entitled. (ii) A description of available alternative methods of family planning and birth control... section was effectively communicated to any individual who is blind, deaf, or otherwise handicapped; (3...

  1. 40 CFR 257.2 - Definitions.

    Science.gov (United States)

    2010-07-01

    ... grease removed from a grease trap at a restaurant. Facility means all contiguous land and structures... manure spreading operations) for agricultural purposes or for treatment and disposal. Landfill means an... industrial, commercial, mining, and agricultural operations, and from community activities, but does not...

  2. Correction: β-Amyrin synthase from Euphorbia tirucalli L. functional analyses of the highly conserved aromatic residues Phe413, Tyr259 and Trp257 disclose the importance of the appropriate steric bulk, and cation-π and CH-π interactions for the efficient catalytic action of the polyolefin cyclization cascade.

    Science.gov (United States)

    Ito, Ryousuke; Nakada, Chika; Hoshino, Tsutomu

    2017-01-18

    Correction for 'β-Amyrin synthase from Euphorbia tirucalli L. functional analyses of the highly conserved aromatic residues Phe413, Tyr259 and Trp257 disclose the importance of the appropriate steric bulk, and cation-π and CH-π interactions for the efficient catalytic action of the polyolefin cyclization cascade' by Ryousuke Ito et al., Org. Biomol. Chem., 2017, 15, 177-188.

  3. 40 CFR Appendix II to Part 257 - Appendix II to Part 257

    Science.gov (United States)

    2010-07-01

    ... will be a minimum of five turnings of the windrow. Heat drying: Dewatered sludge cake is dried by... are only add-on in nature. Beta ray irradiation: Sludge is irradiated with beta rays from an...

  4. 40 CFR 257.27 - Selection of remedy.

    Science.gov (United States)

    2010-07-01

    ... currently available, but which may offer significant advantages over already available technologies in terms...; (6) Resource value of the aquifer including: (i) Current and future uses; (ii) Proximity and... and those substances are present in concentrations such that cleanup of the release from the unit...

  5. 40 CFR 180.257 - Chloroneb; tolerances for residues.

    Science.gov (United States)

    2010-07-01

    ..., sugar, tops 0.2 Cowpea, forage 2.0 Cowpea, hay 2.0 Cattle, fat 0.2 Cattle, meat 0.2 Cattle, meat byproducts 0.2 Cotton, gin byproducts 1.0 Cotton, undelinted seed 0.2 Goat, fat 0.2 Goat, meat 0.2 Goat, meat byproducts 0.2 Hog, fat 0.2 Hog, meat 0.2 Hog, meat byproducts 0.2 Horse, fat 0.2 Horse, meat 0.2 Horse, meat...

  6. 14 CFR 257.4 - Unfair and deceptive practice.

    Science.gov (United States)

    2010-01-01

    ... violation of 49 U.S.C. 41712 unless, in conjunction with such holding out or sale, carriers and ticket... Unfair and deceptive practice. The holding out or sale of scheduled passenger air transportation...

  7. 27 CFR 24.257 - Labeling wine containers.

    Science.gov (United States)

    2010-04-01

    ... container of beverage wine prior to removal for consumption or sale. The minimum type size for information... wines under 7 percent alcohol is under the jurisdiction of the Food and Drug Administration. (iv) The..., 5662) (Approved by the Office of Management and Budget under control number 1512-0503) [T.D. ATF-299...

  8. All projects related to | Page 257 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Research on the links between tobacco farming and health problems among men, women, and children in Bangladesh will examine the health and ... was a London-based news agency that bought news features from developing world correspondents and distributed them to news media organizations around the world.

  9. Dicty_cDB: SHA257 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available vp*thvqiqpvv*tlqsmlmiiihvl*mlvpnqqvshipq*m*mittnvqlmhvpkkvv* lilqstlmitmpvqlilvhhqxvfptpqsivmikxpvqlihvqiqlv...v*ilqxxvtiiih vlxilamt*lvvxilqsmlmiixhvpsmpvlnqqvxlipqsmxmiitnvqlixvpkkvv* lilhsilmitm

  10. Nigeria: Power and Democracy in Africa. Headline Series No. 257.

    Science.gov (United States)

    Herskovits, Jean

    This booklet traces the emergence of a democratic government in Nigeria through military dictatorship to the writing of a constitution fashioned on the American model. Chapters include: (1) "Prologue"; (2) "Nigeria Defined"; (3) "Tragedy and Recovery: The First Republic and the Federal Military Government"; (4)…

  11. 38 CFR 21.257 - Self-employment.

    Science.gov (United States)

    2010-07-01

    .... (Authority: 38 U.S.C. 3104, 3116, 3117) (f) Feasibility analysis of a proposed self-employment business plan. VA will conduct a comprehensive review and analysis of the feasibility of a proposed business plan... amended; (6) The location of the site for the proposed business and the cost of the site, if any; and (7...

  12. 14 CFR 257.6 - Effective and compliance dates.

    Science.gov (United States)

    2010-01-01

    ... the selling carrier is not the transporting carrier and (ii) Of the transporting carrier's identity... transportation involving a code-share arrangement of the transporting carrier's corporate name and any other name...

  13. Dicty_cDB: AFG257 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available h*kc*s*nsrqrryptrsxkinfrw*tirxwsyxl* lqhskgihsplgsqikrxxanxcknldw*nyhlgsrrf*qh*kc*sqnpgqrrxxxxspx infrw*tirr...rystrstkinlcw*tirrwsxsf*lqhskgihspfssxik rxyanxcknxhw*nhhlxg*r*x*h*kc*s*nsrqrryptrsxkinfrw*tirxwsyxl* lqhskgihsplgsqikrxxanx

  14. 24 CFR 92.257 - Faith-based activities.

    Science.gov (United States)

    2010-04-01

    ... organization retains its authority over its internal governance, and it may retain religious terms in its..., practice, and expression of its religious beliefs, provided that it does not use direct HOME funds to...

  15. 24 CFR 203.257 - Creation of the contract.

    Science.gov (United States)

    2010-04-01

    ... issuance of a Mortgage Insurance Certificate, from the date of the endorsement of the credit instrument, or... SINGLE FAMILY MORTGAGE INSURANCE Contract Rights and Obligations Endorsement and Contract of Insurance...

  16. 40 CFR 257.1 - Scope and purpose.

    Science.gov (United States)

    2010-07-01

    ... disposal of solid waste by underground well injection subject to the regulations (40 CFR part 146) for the Underground Injection Control Program (UICP) under the Safe Drinking Water Act, as amended, 42 U.S.C. 3007 et... intended for return to the mine site. (3) The criteria do not apply to the land application of domestic...

  17. 3-(2-Fluorophenylsulfinyl-2,5,7-trimethyl-1-benzofuran

    Directory of Open Access Journals (Sweden)

    Hong Dae Choi

    2013-06-01

    Full Text Available In the title compound, C17H15FO2S, the benzofuran ring system, being essentially planar, with an r.m.s. deviation from the least-squares plane of 0.009 (2 Å, makes a dihedral angle of 79.02 (5° with the plane of the 2-fluorophenyl group. In the crystal, molecules are linked by pairs of weak C—H...O hydrogen bonds into centrosymmetric dimers.

  18. Nwidu et al., Afr J Tradit Complement Altern Med. (2014) 11(2):257 ...

    African Journals Online (AJOL)

    cadewumi

    ... semi-preparative HPLC, and the structures established by NMR (Nwidu et al., 2012b). ... fingerprint of the ESE, preliminary phyto-chemical screening, elemental and ..... Prostaglandins and serotonin: Non-peptide diarrheagenic hormones.

  19. Standardized UXO Technology Demonstration Site, Blind Grid Scoring Record No. 257

    National Research Council Canada - National Science Library

    Overbay, Larry, Jr; Robitaille, George; Boutin, Matthew; Fling, Rick; McClung, Christina

    2005-01-01

    ...) utilizing the APG Standardized UXO Technology Demonstration Site Blind Grid. The scoring record was coordinated by Larry Overbay and the Standardized UXO Technology Demonstration Site Scoring Committee...

  20. 40 CFR Appendix I to Part 257 - Maximum Contaminant Levels (MCLs)

    Science.gov (United States)

    2010-07-01

    ... Drinking Water Act Chemical CAS No. MCL -(mg/l) Arsenic 7440-38-2 0.05 Barium 7440-39-3 1.0 Benzene 71-343... 0.004 Lead 7439-92-1 0.05 Mercury 7439-97-6 0.002 Methoxychlor 72-43-5 0.1 Nitrate 10.0 Selenium...

  1. : tous les projets | Page 257 | CRDI - Centre de recherches pour le ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Sujet: URBAN AREAS, DRUG TRAFFIC, CONFLICTS, VIOLENCE, EMERGENCY RELIEF. Région: Brazil, South America, Colombia, Haiti, North and Central America, Mexico. Programme: Gouvernance et justice. Financement total : CA$ 505,000.00. Action humanitaire dans les autres situations de violence. Projet.

  2. Buli. Mater. Sci., Vol. 20, No. 2, April 1997, pp. 247-257. (C

    Indian Academy of Sciences (India)

    Synthesis of spodumene and spodumene-zirconia composite ... were prepared using aqueous sol-gel method employing lithium formate, aluminium formate, ... synthesis and the processing of spodumene using different precursor compounds.

  3. SU-E-J-257: Image Artifacts Caused by Implanted Calypso Beacons in MRI Studies

    International Nuclear Information System (INIS)

    Amro, H; Chetty, I; Gordon, J; Wen, N

    2014-01-01

    Purpose: The presence of Calypso Beacon-transponders in patients can cause artifacts during MRI imaging studies. This could be a problem for post-treatment follow up of cancer patients using MRI studies to evaluate metastasis and for functional imaging studies.This work assesses (1) the volume immediately surrounding the transponders that will not be visualized by the MRI due to the beacons, and (2) the dependence of the non-visualized volume on beacon orientation, and scanning techniques. Methods: Two phantoms were used in this study (1) water filled box, (2) and a 2300 cc block of pork meat. Calypso beacons were implanted in the phantoms both in parallel and perpendicular orientations with respect to the MR scanner magnetic field. MR image series of the phantom were obtained with on a 1.0T high field open MR-SIM with multiple pulse sequences, for example, T1-weighted fast field echo and T2-weighted turbo spin echo. Results: On average, a no-signal region with 2 cm radius and 3 cm length was measured. Image artifacts are more significant when beacons are placed parallel to scanner magnetic field; the no-signal area around the beacon was about 0.5 cm larger in orthogonal orientation. The no-signal region surrounding the beacons slightly varies in dimension for the different pulse sequences. Conclusion: The use of Calypso beacons can prohibit the use of MRI studies in post-treatment assessments, especially in the immediate region surrounding the implanted beacon. A characterization of the MR scanner by identifying the no-signal regions due to implanted beacons is essential. This may render the use of Calypso beacons useful for some cases and give the treating physician a chance to identify those patients prior to beacon implantation

  4. 24 CFR 257.120 - Appreciation sharing or up-front payment

    Science.gov (United States)

    2010-04-01

    ... the Act, the amount of the appreciation in value of a property securing an H4H program mortgage that... appreciation may be established to the satisfaction of FHA: (1) In the case of— (i) A sale of the property to...'s interest in appreciation. Upon sale or disposition of a property securing an H4H program mortgage...

  5. 257 Etude du cycle sexuel et l'inversion sexuelle de Pagellus bellottii

    African Journals Online (AJOL)

    User

    Résumé. Pagellus bellottii appartient à la famille des Sparidae. Il est hermaphrodite protérogyne et est fréquent dans les débarquements au Sénégal. Le but de ce travail est d'étudier la biologie de ce poisson qui présente un intérêt économique car il est consommé localement mais aussi exporté vers les pays de l'union.

  6. Data supporting Boyes et al., Neurotoxicology 53, 257-270, 2016

    Data.gov (United States)

    U.S. Environmental Protection Agency — Visual evoked potential data from rats exposed to toluene Electroretinogram data from rats exposed to toluene Counts of rod and m-cone photoreceptor cells in retinas...

  7. TASK 2.5.7 FIELD EXPERIMENTS TO EVALUATE COOL-COLORED ROOFING

    Energy Technology Data Exchange (ETDEWEB)

    Miller, William A [ORNL; Cherry, Nigel J [ORNL; Allen, Richard Lowell [ORNL; Childs, Phillip W [ORNL; Atchley, Jerald Allen [ORNL; Ronnen, Levinson [Lawrence Berkeley National Laboratory (LBNL); Akbari, Hashem [Lawrence Berkeley National Laboratory (LBNL); Berhahl, Paul [Lawrence Berkeley National Laboratory (LBNL)

    2010-03-01

    Aesthetically pleasing dark roofs can be formulated to reflect like a highly reflective white roof in the near infrared portion of the solar spectrum. New paint pigments increase the near infrared reflectance of exterior finishes by minimizing the absorption of near-infrared radiation (NIR). The boost in the NIR reflectance drops the surface temperatures of roofs and walls, which in turn reduces cooling-energy use and provides savings for the homeowner and relief for the utilities. In moderate and hot climates, a roof surface with high solar reflectance and high thermal emittance was shown by Akbari et al. (2004) and by Parker and Sherwin (1998) to reduce the exterior temperature and produce savings in comfort cooling. The new cool color pigments can potentially reduce emissions of carbon dioxide, which in turn reduces metropolitan heat buildup and urban smog. The pigments can also help conserve water resources otherwise used to clean and process fuel consumed by fossil-fuel driven power plants. Cool roofs also result in a lower ambient temperature that further decreases the need for air conditioning, retards smog formation, and improves thermal comfort. Parker, Sonne and Sherwin (2002) demonstrated that white barrel and white flat tiles reduced cooling energy consumption by 22% of the base load used by an adjacent and identical home having direct nailed dark shingles. Part of the savings was due to the reflectance of the white tiles; however, another part was due to the mass of the tile and to the venting occurring within the double batten installation. With, Cherry and Haig (2009) have studied the influence of the thermal mass and batten space ventilation and have found that, referenced to an asphalt shingle system, it can be equivalent to an additional 28 points of solar reflectivity. The double batten arrangement has wooden counter battens laid vertically (soffit-to-ridge) against the roof deck, and then the conventional battens are laid horizontally across the counter battens, providing a nailing surface for the concrete tile. This double batten construction forms an inclined air channel running from the soffit to the ridge. The bottom surface of the channel is formed by the roof decking and is relatively flat and smooth. The top surface is created by the underside of the roofing tiles, and is designed to be an air permeable covering to alleviate the underside air pressure and minimize wind uplift on the tiles. The resulting air flows also have a cooling influence which further complicates prediction of the heat penetrating through the deck because an accurate measure of the airflow is required to predict the heat transfer. Measured temperatures and heat flows at the roof surface, within the attic and at the ceiling of the houses are discussed as well as the power usage to help gauge the benefit of cool-pigmented reflective roof products fitted with and without ventilation above the roof deck. Ventilation occurring above the deck is an inherent feature for tile roof assemblies, and is formed by an air space between the exterior face of the roof sheathing and the underside of the tile. The greater the tile s profile the greater is the effect of the ventilation which herein is termed above-sheathing ventilation (ASV). However, because of the complexity of the thermally induced flow, little credit is allowed by state and federal building codes. ASHRAE (2005) provides empirical data for the effective thermal resistance of plane air spaces. A -in. (0.0191-m) plane air space inclined at 45 with the horizontal has an RUS-0.85 (RSI-0.15) . Our intent is to help further deploy cool color pigments in roofs by conducting field experiments to evaluate the new cool-colored roofing materials in the hot climate of Southern California. The collected data will be used to showcase and market the performance of new cool-roof products and also to help formulate and validate computer codes capable of calculating the heat transfer occurring within the attic and the whole building. Field measures and computer predictions showed that the demonstration home without a NIR-reflective tile coating and without above-sheathing ventilation had the greatest roof deck heat flow and subsequently the highest electrical usage. The house with both NIR paint pigments on the tile and with ASV had the least deck heat flows and therefore caused the home to consume the least amount of energy. The relative performance of the reflective coating and the ventilation individually is less obvious, but it is clear that the combination of a reflective tile with ASV is the preferred solution for the best energy saving.

  8. SU-E-J-257: Image Artifacts Caused by Implanted Calypso Beacons in MRI Studies

    Energy Technology Data Exchange (ETDEWEB)

    Amro, H; Chetty, I; Gordon, J; Wen, N [Henry Ford Health System, Detroit, MI (United States)

    2014-06-01

    Purpose: The presence of Calypso Beacon-transponders in patients can cause artifacts during MRI imaging studies. This could be a problem for post-treatment follow up of cancer patients using MRI studies to evaluate metastasis and for functional imaging studies.This work assesses (1) the volume immediately surrounding the transponders that will not be visualized by the MRI due to the beacons, and (2) the dependence of the non-visualized volume on beacon orientation, and scanning techniques. Methods: Two phantoms were used in this study (1) water filled box, (2) and a 2300 cc block of pork meat. Calypso beacons were implanted in the phantoms both in parallel and perpendicular orientations with respect to the MR scanner magnetic field. MR image series of the phantom were obtained with on a 1.0T high field open MR-SIM with multiple pulse sequences, for example, T1-weighted fast field echo and T2-weighted turbo spin echo. Results: On average, a no-signal region with 2 cm radius and 3 cm length was measured. Image artifacts are more significant when beacons are placed parallel to scanner magnetic field; the no-signal area around the beacon was about 0.5 cm larger in orthogonal orientation. The no-signal region surrounding the beacons slightly varies in dimension for the different pulse sequences. Conclusion: The use of Calypso beacons can prohibit the use of MRI studies in post-treatment assessments, especially in the immediate region surrounding the implanted beacon. A characterization of the MR scanner by identifying the no-signal regions due to implanted beacons is essential. This may render the use of Calypso beacons useful for some cases and give the treating physician a chance to identify those patients prior to beacon implantation.

  9. 40 CFR 257.23 - Ground-water sampling and analysis requirements.

    Science.gov (United States)

    2010-07-01

    ...: (1) Sample collection; (2) Sample preservation and shipment; (3) Analytical procedures; (4) Chain of... theory test, then the data should be transformed or a distribution-free theory test should be used. If... chart and its associated parameter values shall be protective of human health and the environment. The...

  10. 47 CFR 15.257 - Operation within the band 92-95 GHz.

    Science.gov (United States)

    2010-10-01

    ... bandwidth of at least 10 MHz, or uses an equivalent measurement method. (3) The average emission limits... section are subject to the radiofrequency radiation exposure requirements specified in 47 CFR 1.1307(b), 2...

  11. 40 CFR 257.28 - Implementation of the corrective action program.

    Science.gov (United States)

    2010-07-01

    ... constituents as a result of an accident or failure of a container or handling system; and (vii) Other situations that may pose threats to human health and the environment. (b) An owner or operator may determine... alternative measures prior to implementing the alternative measures has been placed in the operating record...

  12. The 257 MeV 19/2/sup -/ two-phonon octupole state in /sup 147/Gd

    CERN Document Server

    Kleinheinz, P; Kortelahti, M; Piiparinen, M; Styczen, J

    1981-01-01

    The half-life of the (vf/sub 7/2/*3/sup -/*3/sup -/)/sub 19/2-/ two- phonon octupole states at 2.572 MeV in /sup 147/Gd was measured as T /sub 1/2/=0.37(8) ns, which gives a transition strength of 52(15) WU for the 1525 keV E3 transition to the 0.997 MeV (vf/sub 7/2/*3/sup -/) /sub 13/2+/ one transition to the 0.997 MeV ( nu f/sub 7/2/*3/sup -/) /sub 13/2+/ one phonon excitation. The nu i/sub 13/2/ admixture in the 13/2/sup +/ one-phonon state, as well as the dominant pi h/sub 11/2/d /sub 5//sup -1/2/ component of the /sup 146/Gd 3/sup -/ state give rise to large anharmonicities for the two-phonon excitation. An estimate of the energy shifts based on empirical coupling matrix elements gives 2.66 MeV excitation for the 19/2/sup -/ two-phonon state, in good agreement with the observed energy of that state. (9 refs).

  13. Magnetic properties of PrMn2-xFexGe2-57Fe Moessbauer spectroscopy

    International Nuclear Information System (INIS)

    Wang, J L; Campbell, S J; Cadogan, J M; Tegus, O; Studer, A J; Hofmann, M

    2006-01-01

    We have investigated the magnetic behaviour of PrMn 2-x Fe x Ge 2 compounds with x = 0.4, 0.6 and 0.8 over the temperature range 4.2-350 K using ac magnetic susceptibility, dc magnetization and 57 Fe Moessbauer effect spectroscopy, as well as neutron diffraction for the PrMn 1.2 Fe 0.8 Ge 2 compound. Replacement of Mn with Fe leads to contraction of the unit cell and a shortening of the Mn-Mn spacing, resulting in modification of the magnetic structure. PrMn 1.6 Fe 0.4 Ge 2 is an intralayer antiferromagnet at room temperature and ferromagnetic below T C inter ∼230 K with additional ferromagnetic ordering of the Pr sublattice detected below T C Pr ∼30 K. Re-entrant ferromagnetism has been observed in PrMn 1.4 Fe 0.6 Ge 2 with four magnetic transitions (T N intra ∼333 K, T C inter ∼168 K, T N inter ∼152 K and T C Pr ∼40 K). Moreover, it was found that T C inter and T C Pr increase with applied field while T N inter decreases. PrMn 1.2 Fe 0.8 Ge 2 is antiferromagnetic with T N intra ∼242 K and T N inter ∼154 K. The magnetic transition temperatures for all compounds are also marked by changes in the 57 Fe magnetic hyperfine field and the electric quadrupole interaction parameters. The 57 Fe transferred hyperfine field at 4.5 K in PrMn 1.6 Fe 0.4 Ge 2 and PrMn 1.4 Fe 0.6 Ge 2 is reduced (below the ordering temperature of the Pr sublattice) compared with that at 80 K (above T C Pr ), indicating that the transferred hyperfine field from Pr acts in the opposite direction to that from the Mn atoms. The neutron data for PrMn 1.2 Fe 0.8 Ge 2 demonstrate that an anisotropic thermal expansion occurs within the interplanar antiferromagnetic range

  14. 40 CFR 257.3-5 - Application to land used for the production of food-chain crops (interim final).

    Science.gov (United States)

    2010-07-01

    ... Analysis, Agronomy Monograph No. 9.” C. A. Black, ed., American Society of Agronomy, Madison, Wisconsin. pp..., and analyzing by the electrometric method. (“Methods of Soil Analysis, Agronomy Monograph No. 9,” C.A. Black, ed., American Society of Agronomy, Madison, Wisconsin, pp. 914-926, 1965.) [44 FR 53460, Sept. 13...

  15. Retraction: Aydin, B. Statistical Convergent Topological Sequence Entropy Maps of the Circle. Entropy 2004, 6, 257–261

    Directory of Open Access Journals (Sweden)

    Kevin H. Knuth

    2014-02-01

    Full Text Available The editors were made aware that a paper published in Entropy in 2004 [1] may have plagiarized an earlier paper by Roman Hric published in 2000 [2]. After checking with specialized plagiarism software, we found that this claim is indeed correct and almost the entire paper is a verbatim copy of the earlier one. After confirmation of this fact, the editors of Entropy have decided to retract the paper immediately. [...

  16. National disability-adjusted life years (DALYs) for 257 diseases and injuries in Ethiopia, 1990-2015: findings from the global burden of disease study 2015.

    Science.gov (United States)

    Misganaw, Awoke; Melaku, Yohannes Adama; Tessema, Gizachew Assefa; Deribew, Amare; Deribe, Kebede; Abera, Semaw Ferede; Dessalegn, Muluken; Lakew, Yihunie; Bekele, Tolesa; Haregu, Tilahun N; Amare, Azmeraw T; Gedefaw, Molla; Mohammed, Mesoud; Yirsaw, Biruck Desalegn; Damtew, Solomon Abrha; Achoki, Tom; Blore, Jed; Krohn, Kristopher J; Assefa, Yibeltal; Kifle, Mahlet; Naghavi, Mohsen

    2017-01-01

    Disability-adjusted life years (DALYs) provide a summary measure of health and can be a critical input to guide health systems, investments, and priority-setting in Ethiopia. We aimed to determine the leading causes of premature mortality and disability using DALYs and describe the relative burden of disease and injuries in Ethiopia. We used results from the Global Burden of Diseases, Injuries, and Risk Factors Study 2015 (GBD 2015) for non-fatal disease burden, cause-specific mortality, and all-cause mortality to derive age-standardized DALYs by sex for Ethiopia for each year. We calculated DALYs by summing years of life lost due to premature mortality (YLLs) and years lived with disability (YLDs) for each age group and sex. Causes of death by age, sex, and year were measured mainly using Causes of Death Ensemble modeling. To estimate YLDs, a Bayesian meta-regression method was used. We reported DALY rates per 100,000 for communicable, maternal, neonatal, and nutritional (CMNN) disorders, non-communicable diseases, and injuries, with 95% uncertainty intervals (UI) for Ethiopia. Non-communicable diseases caused 23,118.1 (95% UI, 17,124.4-30,579.6), CMNN disorders resulted in 20,200.7 (95% UI, 16,532.2-24,917.9), and injuries caused 3781 (95% UI, 2642.9-5500.6) age-standardized DALYs per 100,000 in Ethiopia in 2015. Lower respiratory infections, diarrheal diseases, and tuberculosis were the top three leading causes of DALYs in 2015, accounting for 2998 (95% UI, 2173.7-4029), 2592.5 (95% UI, 1850.7-3495.1), and 2562.9 (95% UI, 1466.1-4220.7) DALYs per 100,000, respectively. Ischemic heart disease and cerebrovascular disease were the fourth and fifth leading causes of age-standardized DALYs, with rates of 2535.7 (95% UI, 1603.7-3843.2) and 2159.9 (95% UI, 1369.7-3216.3) per 100,000, respectively. The following causes showed a reduction of 60% or more over the last 25 years: lower respiratory infections, diarrheal diseases, tuberculosis, neonatal encephalopathy, preterm birth complications, meningitis, malaria, protein-energy malnutrition, iron-deficiency anemia, measles, war and legal intervention, and maternal hemorrhage. Ethiopia has been successful in reducing age-standardized DALYs related to most communicable, maternal, neonatal, and nutritional deficiency diseases in the last 25 years, causing a major ranking shift to types of non-communicable disease. Lower respiratory infections, diarrheal disease, and tuberculosis continue to be leading causes of premature death, despite major declines in burden. Non-communicable diseases also showed reductions as premature mortality declined; however, disability outcomes for these causes did not show declines. Recently developed non-communicable disease strategies may need to be amended to focus on cardiovascular diseases, cancer, diabetes, and major depressive disorders. Increasing trends of disabilities due to neonatal encephalopathy, preterm birth complications, and neonatal disorders should be emphasized in the national newborn survival strategy. Generating quality data should be a priority through the development of new initiatives such as vital events registration, surveillance programs, and surveys to address gaps in data. Measuring disease burden at subnational regional state levels and identifying variations with urban and rural population health should be conducted to support health policy in Ethiopia.

  17. SU-E-J-257: A PCA Model to Predict Adaptive Changes for Head&neck Patients Based On Extraction of Geometric Features From Daily CBCT Datasets

    Energy Technology Data Exchange (ETDEWEB)

    Chetvertkov, M [Wayne State University, Detroit, MI (United States); Henry Ford Health System, Detroit, MI (United States); Siddiqui, F; Chetty, I; Kim, J; Kumarasiri, A; Liu, C; Gordon, J [Henry Ford Health System, Detroit, MI (United States)

    2015-06-15

    Purpose: Using daily cone beam CTs (CBCTs) to develop principal component analysis (PCA) models of anatomical changes in head and neck (H&N) patients and to assess the possibility of using these prospectively in adaptive radiation therapy (ART). Methods: Planning CT (pCT) images of 4 H&N patients were deformed to model several different systematic changes in patient anatomy during the course of the radiation therapy (RT). A Pinnacle plugin was used to linearly interpolate the systematic change in patient for the 35 fraction RT course and to generate a set of 35 synthetic CBCTs. Each synthetic CBCT represents the systematic change in patient anatomy for each fraction. Deformation vector fields (DVFs) were acquired between the pCT and synthetic CBCTs with random fraction-to-fraction changes were superimposed on the DVFs. A patient-specific PCA model was built using these DVFs containing systematic plus random changes. It was hypothesized that resulting eigenDVFs (EDVFs) with largest eigenvalues represent the major anatomical deformations during the course of treatment. Results: For all 4 patients, the PCA model provided different results depending on the type and size of systematic change in patient’s body. PCA was more successful in capturing the systematic changes early in the treatment course when these were of a larger scale with respect to the random fraction-to-fraction changes in patient’s anatomy. For smaller scale systematic changes, random changes in patient could completely “hide” the systematic change. Conclusion: The leading EDVF from the patientspecific PCA models could tentatively be identified as a major systematic change during treatment if the systematic change is large enough with respect to random fraction-to-fraction changes. Otherwise, leading EDVF could not represent systematic changes reliably. This work is expected to facilitate development of population-based PCA models that can be used to prospectively identify significant anatomical changes early in treatment. This work is supported in part by a grant from Varian Medical Systems, Palo Alto, CA.

  18. Organizational Issues, Structure, and Processes of Care in 257 ICUs in Latin America: A Study From the Latin America Intensive Care Network.

    Science.gov (United States)

    Estenssoro, Elisa; Alegría, Leyla; Murias, Gastón; Friedman, Gilberto; Castro, Ricardo; Nin Vaeza, Nicolas; Loudet, Cecilia; Bruhn, Alejandro; Jibaja, Manuel; Ospina-Tascon, Gustavo; Ríos, Fernando; Machado, Flavia R; Biasi Cavalcanti, Alexandre; Dubin, Arnaldo; Hurtado, F Javier; Briva, Arturo; Romero, Carlos; Bugedo, Guillermo; Bakker, Jan; Cecconi, Maurizio; Azevedo, Luciano; Hernandez, Glenn

    2017-08-01

    Latin America bears an important burden of critical care disease, yet the information about it is scarce. Our objective was to describe structure, organization, processes of care, and research activities in Latin-American ICUs. Web-based survey submitted to ICU directors. ICUs located in nine Latin-American countries. Individual ICUs. None. Two hundred fifty-seven of 498 (52%) of submitted surveys responded: 51% from Brazil, 17% Chile, 13% Argentina, 6% Ecuador, 5% Uruguay, 3% Colombia, and 5% between Mexico, Peru, and Paraguay. Seventy-nine percent of participating hospitals had less than 500 beds; most were public (59%) and academic (66%). ICUs were mainly medical-surgical (75%); number of beds was evenly distributed in the entire cohort; 77% had 24/7 intensivists; 46% had a physician-to-patient ratio between 1:4 and 7; and 69% had a nurse-to-patient ratio of 1 ≥ 2.1. The 24/7 presence of other specialists was deficient. Protocols in use averaged 9 ± 3. Brazil (vs the rest) had larger hospitals and ICUs and more quality, surveillance, and prevention committees, but fewer 24/7 intensivists and poorer nurse-to-patient ratio. Although standard monitoring, laboratory, and imaging practices were almost universal, more complex measurements and treatments and portable equipment were scarce after standard working hours, and in public hospitals. Mortality was 17.8%, without differences between countries. This multinational study shows major concerns in the delivery of critical care across Latin America, particularly in human resources. Technology was suboptimal, especially in public hospitals. A 24/7 availability of supporting specialists and of key procedures was inadequate. Mortality was high in comparison to high-income countries.

  19. Comparison of reactions for the production of 258,257Db: 208Pb(51V,xn) and 209Bi(50Ti,xn)

    Energy Technology Data Exchange (ETDEWEB)

    Gates, Jacklyn M.; Nelson, Sarah L.; Gregorich, Kenneth E.; Dragojevic, Irena; Dullmann, Christoph E.; Ellison, Paul A.; Folden III, Charles M.; Garcia, Mitch A.; Stavsetra, Liv; Sudowe, Ralf; Hoffman, Darleane C.; Nitsche, Heino

    2008-09-29

    Excitation functions for the 1n and 2n exit channels of the 208Pb(51V,xn)259-xDb reaction were measured. A maximum cross section of the 1n exit channel of 2070+1100/-760 pb was measured at an excitation energy of 16.0 +- 1.8 MeV. For the 2n exit channel, a maximum cross section of 1660+450/-370 pb was measured at 22.0 +- 1.8 MeV excitation energy. The 1n excitation function for the 209Bi(50Ti,n)258Db reaction was remeasured, resulting in a cross section of 5480+1750/-1370 pb at an excitation energy of 16.0 +- 1.6 MeV, in agreement with previous values [F. P. Hebberger, et al., Eur. Phys. J. A 12, 57 (2001)]. Differences in cross section maxima are discussed in terms of the fusion probability below the barrier.

  20. Ovarian cancer and oral contraceptives: collaborative reanalysis of data from 45 epidemiological studies including 23,257 women with ovarian cancer and 87,303 controls

    DEFF Research Database (Denmark)

    Cancer, Collaborative Group on Epidemiological Studies of Ovarian; Beral, V.; Doll, R.

    2008-01-01

    was estimated, stratifying by study, age, parity, and hysterectomy. FINDINGS: Overall 7308 (31%) cases and 32,717 (37%) controls had ever used oral contraceptives, for average durations among users of 4.4 and 5.0 years, respectively. The median year of cancer diagnosis was 1993, when cases were aged an average...... reductions, although typical oestrogen doses in the 1960s were more than double those in the 1980s. The incidence of mucinous tumours (12% of the total) seemed little affected by oral contraceptives, but otherwise the proportional risk reduction did not vary much between different histological types. In high-income...... countries, 10 years use of oral contraceptives was estimated to reduce ovarian cancer incidence before age 75 from 1.2 to 0.8 per 100 users and mortality from 0.7 to 0.5 per 100; for every 5000 woman-years of use, about two ovarian cancers and one death from the disease before age 75 are prevented...

  1. SU-E-J-257: A PCA Model to Predict Adaptive Changes for Head&neck Patients Based On Extraction of Geometric Features From Daily CBCT Datasets

    International Nuclear Information System (INIS)

    Chetvertkov, M; Siddiqui, F; Chetty, I; Kim, J; Kumarasiri, A; Liu, C; Gordon, J

    2015-01-01

    Purpose: Using daily cone beam CTs (CBCTs) to develop principal component analysis (PCA) models of anatomical changes in head and neck (H&N) patients and to assess the possibility of using these prospectively in adaptive radiation therapy (ART). Methods: Planning CT (pCT) images of 4 H&N patients were deformed to model several different systematic changes in patient anatomy during the course of the radiation therapy (RT). A Pinnacle plugin was used to linearly interpolate the systematic change in patient for the 35 fraction RT course and to generate a set of 35 synthetic CBCTs. Each synthetic CBCT represents the systematic change in patient anatomy for each fraction. Deformation vector fields (DVFs) were acquired between the pCT and synthetic CBCTs with random fraction-to-fraction changes were superimposed on the DVFs. A patient-specific PCA model was built using these DVFs containing systematic plus random changes. It was hypothesized that resulting eigenDVFs (EDVFs) with largest eigenvalues represent the major anatomical deformations during the course of treatment. Results: For all 4 patients, the PCA model provided different results depending on the type and size of systematic change in patient’s body. PCA was more successful in capturing the systematic changes early in the treatment course when these were of a larger scale with respect to the random fraction-to-fraction changes in patient’s anatomy. For smaller scale systematic changes, random changes in patient could completely “hide” the systematic change. Conclusion: The leading EDVF from the patientspecific PCA models could tentatively be identified as a major systematic change during treatment if the systematic change is large enough with respect to random fraction-to-fraction changes. Otherwise, leading EDVF could not represent systematic changes reliably. This work is expected to facilitate development of population-based PCA models that can be used to prospectively identify significant anatomical changes early in treatment. This work is supported in part by a grant from Varian Medical Systems, Palo Alto, CA

  2. Actinides

    International Nuclear Information System (INIS)

    Martinot, L.; Fuger, J.

    1985-01-01

    The oxidation behavior of the actinides is explained on the basis of their electronic structure. The actinide elements, actinium, thorium, protactinium, uranium, neptunium, plutonium, americium, curium, berkelium, californium, einsteinium, fermium, mendelevium, nobelium, and laurencium are included. For all except the last three elements, the points of discussion are oxidation states, Gibbs energies and potentials, and potential diagram for the element in acid solution; and thermodynamic properties of these same elements are tabulated. References are cited following discussion of each element with a total of 97 references being cited. 13 tables

  3. The Heart of the Matter: Methodological Challenges in Developing a Contemporary 257-269 Reading Programme for Monolingual Lexicography, from the Perspective of the Dictionary Unit for South African English

    Directory of Open Access Journals (Sweden)

    Leela Pienaar

    2011-10-01

    Full Text Available

    Abstract: This article argues the importance of the reading programme as the pivotal issue inthe lexicographic process. It is essentially a practical article which outlines strategies for developingand implementing a reading programme for monolingual lexicography. The arguments are informedby theory, together with an examination of the data-collection procedures followed by theDictionary Unit for South African English (DSAE and a survey of current practice in major Englishdictionary units around the world, namely the Oxford English Dictionary, the Canadian OxfordDictionary, the Australian National Dictionary Centre and the New Zealand Dictionary Centre.The reading programme for the DSAE is first defined and contextualized within its mission statement.The article then explores the challenges inherent in sampling contemporary written and spokenEnglish in the South African multilingual context. It is intended to inform the DSAE's intakepolicy, in terms of the following critical issues:

    — the definition of South African English,

    — the monitoring and selection of print, oral and electronic sources,

    — the excerpting of citations and relevant bibliographic information, and

    — the recruiting and training of readers.

    These interlinked aspects of the reading programme have crucial implications for the quality andauthority of the monolingual dictionary on historical principles.

    Keywords: READING PROGRAMME, MONOLINGUAL DICTIONARY, HISTORICAL PRINCIPLES, CONTEMPORARY, INTAKE, CITATIONS, STRATEGIES

    Opsomming: Die kern van die saak: Metodologiese uitdagings by die ontwikkelingvan 'n eietydse leesprogram vir eentalige leksikografie, uit dieperspektief van die Dictionary Unit for South African English. Hierdie artikelbepleit die belangrikheid van die leesprogram as die kernsaak in die leksikografiese proses. Dit ishoofsaaklik 'n praktiese artikel wat stategieë vir die ontwikkeling en implementering van 'n leesprogramvir eentalige leksikografie skets. Die argumente word ondersteun deur teorie, saam met 'nondersoek na die dataversamelingsprosedures wat deur die Dictionary Unit for South AfricanEnglish (DSAE gevolg word en 'n oorsig van die huidige praktyk by belangrike Engelse woordeboekeenhedeoor die hele wêreld, naamlik die Oxford English Dictionary, die Canadian OxfordDictionary, die Australian National Dictionary Centre en die New Zealand Dictionary Centre. Dieleesprogram van die DSAE word eers omskryf en geplaas binne sy missiestelling. Die artikelondersoek dan die uitdagings verbonde aan die toetsing van eietydse geskrewe en gesproke Engelsbinne die Suid-Afrikaanse veeltalige konteks. Dit is bedoel om die DSAE se opnamebeleid te beligbetreffende die volgende kritieke sake:

    — die omskrywing van Suid-Afrikaanse Engels,

    — die kontrole en keuse van gedrukte, gesproke en elektroniese bronne

    ,— die ekserpering van sitate en tersaaklike bibliografiese inligting, en

    — die werwing en opleiding van lesers.

    Hierdie verbandhoudende aspekte van die leesprogram het beslissende implikasies vir die gehalteen gesaghebbendheid van die eentalige woordeboek volgens historiese beginsels.

    Sleutelwoorde: LEESPROGRAM, EENTALIGE WOORDEBOEK, HISTORIESE BEGINSELS, EIETYDS, OPNAME, SITATE, STRATEGIE?

  4. Nr 257 - Opinion presented on the behalf of the Commission of sustainable development and land planning on the finance bill for 2013 (nr 235), Volumes 1-10, ecology, sustainable development and planning, regional policies, research and higher education

    International Nuclear Information System (INIS)

    Krabal, Jacques; Sermier, Jean-Marie; Gaillard, Genevieve; Baupin, Denis; Pauvros, Remi; Benisti, Jacques Alain; Fromantin, Jean-Christophe; Calmette, Alain; Plisson, Philippe; Ginesy, Charles-Ange

    2012-01-01

    This huge document comprises ten volumes which present and discuss public programs (objectives, strategies, plans, and actions), public finances, economic activity data and evolutions, debates by commissions, and amendments on different issues. A first set of issues deals with ecology, sustainable development and planning: protection of the environment and risk prevention (volume 1), and then with sustainable development policies (vol. 2), landscapes, water, biodiversity, and geographic and cartographic information (vol. 3), ecological transition (vol. 4), road, railway and water transports (vol. 5), air transports (vol. 6), maritime affairs (vol. 7). The next volume addresses regional policies (vol. 8). The last parts concern research and higher education: research in the field of sustainable development (vol. 9) and in the fields of environments and resources (vol. 10)

  5. Chemistry of the heaviest elements--one atom at a time

    International Nuclear Information System (INIS)

    Hoffman, Darleane C.; Lee, Diana M.

    2000-01-01

    In keeping with the goal of the Viewpoint series of the Journal of Chemical Education, this article gives a 75-year perspective of the chemistry of the heaviest elements, including a 50-year retrospective view of past developments, a summary of current research achievements and applications, and some predictions about exciting, new developments that might be envisioned within the next 25 years. A historical perspective of the importance of chemical separations in the discoveries of the transuranium elements from neptunium (Z=93) through mendelevium (Z=101) is given. The development of techniques for studying the chemical properties of mendelevium and still heavier elements on the basis of measuring the radioactive decay of a single atom (''atom-at-a-time'' chemistry) and combining the results of many separate experiments is reviewed. The influence of relativistic effects (expected to increase as Z 2 ) on chemical properties is discussed. The results from recent atom-at-a-time studies of the chemistry of the heaviest elements through seaborgium (Z=106) are summarized and show that their properties cannot be readily predicted based on simple extrapolation from the properties of their lighter homologues in the periodic table. The prospects for extending chemical studies to still heavier elements than seaborgium are considered and appear promising

  6. The discovery of 260Md and the decay properties of 258Fm, 258m,gMd and 259Md

    International Nuclear Information System (INIS)

    Lougheed, R.W.; Hulet, E.K.; Dougan, R.J.; Wild, J.F.; Dupzyk, R.J.; Henderson, C.M.; Moody, K.J.; Hahn, R.L.; Suemmerer, K.; Bethune, G.

    1986-01-01

    We have discovered a new neutron-rich isotope, 260 Md, from 18 O and 22 Ne bombardments of 254 Es. We observed a spontaneous-fission (SF) activity with a half-life of 32 days in electromagnetically separated fractions with mass number 260 from these bombardments and we measured the mass and kinetic energy distributions of this SF activity. The mass distribution was symmetric with the principal energy peak at a total kinetic energy (TKE) of 234 MeV, similar to previous observations for heavy fermium isotopes. Surprisingly, we also observed a smaller symmetric component with a TKE of 195 MeV. We interpret these two peaks in the TKE distribution as arising from two types of fission in the same nucleus, or bimodal fission. The observed fission activity may be either from the SF decay of 260 Md or from 260 Fm which would arise from electron-capture (EC) decay of 260 Md. We have eliminated the possible β - decay of 260 Md by measuring β - -SF time correlations for the decay of 260 Md and we plan to determine whether 260 Md decays by EC by measuring time correlations between fermium X-rays and SF events. We also measured various properties of the heavy fermium and mendelevium isotopes and obtained 1. more accurate cross-sections for the neutron-rich mendelevium isotopes which we use to predict the production rates of yet undiscovered nuclides, 2. improved half-life measurements for 258m,g Md and 259 Md, 3. confirmation of the EC decay of 258m Md by measurement of the fermium X-rays preceding the SF decay of 258 Fm and 4. very substantially improved mass and TKE distributions for the SF decay of 258 Fm and 259 Md. (orig.)

  7. ORF Alignment: NC_003063 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available ... Length = 231 ... Query: 198 LDAALRGAEITQKRATELQAKDVGTVAASDNAQVALDQARANVVAGEAAISSAKANVELL 257 ... LDA...ALRGAEITQKRATELQAKDVGTVAASDNAQVALDQARANVVAGEAAISSAKANVELL Sbjct: 9 ... LDAALRGAEITQKRATELQAKDVGTVAASDNAQVALDQARANVVAGEAAISSAKANVEL

  8. ORF Alignment: NC_003450 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available ... Length = 257 ... Query: 9 ... IRTRHFREAKVNGQKVSVLTSYDALSARIFDEAGVDMLLVGDSAANVVLGRD...TTLSITLD 68 ... IRTRHFREAKVNGQKVSVLTSYDALSARIFDEAGVDMLLVGDSAANVVLGRDTTLSITLD Sbjct: 1 ... IRTRHFREAKVNGQKVSVLTSYDALSARIFD

  9. ORF Alignment: NC_004668 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available s V583] ... Length = 72 ... Query: 257 AEREKYEANRKELIANISHDLKTPITSIIGYVEGLMDGVANTEEKKQRYLTVIHEKSLGL 316 ... ... AEREKYEANRKELIANISHDLKTPITSIIGYVEGLMDGVANTEEKKQRYLTVIHEKSLGL Sbjct: 1 ... AEREKYEANRKELIANISHDLKTPITSIIGYVEGLMDGVANTEEKKQRYLTVIHEKSLGL 60 ...

  10. Optical simulations for the S3 project - Super separator spectrometer - gamma-electron coincidence spectroscopy of a transfermium nucleus: the 251Md101

    International Nuclear Information System (INIS)

    Dechery, Fabien

    2012-01-01

    In analogy with the atomic closed shells giving rise to the stability and high ionisation energies of noble gases, nuclear physics also has its magic numbers of protons and neutrons which enhance nuclear structure stability. Knowledge of the structure of doubly-magic nuclei, both proton and neutron numbers, is crucial to parameterize theoretical models. The discovery of the next and ultimate magic numbers will provide a strong constraint on the many predictions. These two numbers are like the centre coordinates of an area of enhanced stability of the nuclear chart, well known as 'island of stability'. These superheavy nuclei only exist due to pure quantum shell effects. My thesis work deals with two distinct, but complementary, aspects of fundamental physics with the common goal of studying these extreme mass nuclei structure. The first part corresponds to the development of a next generation instrument for nuclear physics to allow synthesis and spectroscopy studies of superheavy nuclei: the Super Separator Spectrometer S 3 . This project will be installed at SPIRAL2 (GANIL) and has been approved by the French Research National Agency (ANR) within the EQUIPEX framework. It has been designed to take advantage of the high intensity heavy ion beam from the LINAC, giving access to a wide range of physical programs. The second part corresponds to the preparation, realisation and analysis of an experiment on 251-Mendelevium in which the very first prompt gamma-electron coincidence spectroscopy was performed for a transfermium nuclei. (author) [fr

  11. Transuranium elements: Past, present, and future

    International Nuclear Information System (INIS)

    Seaborg, G.T.

    1995-01-01

    In this illustrative Account the authors shall concentrate on four of these elements, chosen for their current interest or pivotal role. The story of plutonium is one of the most dramatic in the history of science, and today, plutonium is at the focus of an extraordinary dilemma. Mendelevium (element 101) has played a pivotal role in blazing the trail for the discovery of the heaviest elements on the basis of open-quotes one atom at a timeclose quotes production. Seaborgium (element 106) was recently named in my honor by the discoverers and may be the last element, at least for some time, for which it will be possible to determine many chemical properties. And element 110 represents recent evidence, after a lapse of 10 years, for the discovery of a chemical element. Recent (1994) recommendations of the IUPAC Commission on the Nomenclature of Inorganic Chemistry for the renaming of elements 104-108 have met with widespread rejection. The author is using the names proposed by the acknowledged discoverers (elements 106-109) or, in the case of the disputed elements 104 and 105, the most logical names. 21 refs., 5 figs

  12. The Use of the Delphi and Other Consensus Group Methods in Medical Education Research: A Review.

    Science.gov (United States)

    Humphrey-Murto, Susan; Varpio, Lara; Wood, Timothy J; Gonsalves, Carol; Ufholz, Lee-Anne; Mascioli, Kelly; Wang, Carol; Foth, Thomas

    2017-10-01

    Consensus group methods, such as the Delphi method and nominal group technique (NGT), are used to synthesize expert opinions when evidence is lacking. Despite their extensive use, these methods are inconsistently applied. Their use in medical education research has not been well studied. The authors set out to describe the use of consensus methods in medical education research and to assess the reporting quality of these methods and results. Using scoping review methods, the authors searched the Medline, Embase, PsycInfo, PubMed, Scopus, and ERIC databases for 2009-2016. Full-text articles that focused on medical education and the keywords Delphi, RAND, NGT, or other consensus group methods were included. A standardized extraction form was used to collect article demographic data and features reflecting methodological rigor. Of the articles reviewed, 257 met the inclusion criteria. The Modified Delphi (105/257; 40.8%), Delphi (91/257; 35.4%), and NGT (23/257; 8.9%) methods were most often used. The most common study purpose was curriculum development or reform (68/257; 26.5%), assessment tool development (55/257; 21.4%), and defining competencies (43/257; 16.7%). The reporting quality varied, with 70.0% (180/257) of articles reporting a literature review, 27.2% (70/257) reporting what background information was provided to participants, 66.1% (170/257) describing the number of participants, 40.1% (103/257) reporting if private decisions were collected, 37.7% (97/257) reporting if formal feedback of group ratings was shared, and 43.2% (111/257) defining consensus a priori. Consensus methods are poorly standardized and inconsistently used in medical education research. Improved criteria for reporting are needed.

  13. Actinide production in the reaction of heavy ions with curium-248

    International Nuclear Information System (INIS)

    Moody, K.J.

    1983-07-01

    Chemical experiments were performed to examine the usefulness of heavy ion transfer reactions in producing new, neutron-rich actinide nuclides. A general quasi-elastic to deep-inelastic mechanism is proposed, and the utility of this method as opposed to other methods (e.g. complete fusion) is discussed. The relative merits of various techniques of actinide target synthesis are discussed. A description is given of a target system designed to remove the large amounts of heat generated by the passage of a heavy ion beam through matter, thereby maximizing the beam intensity which can be safely used in an experiment. Also described is a general separation scheme for the actinide elements from protactinium (Z=91) to mendelevium (Z=101), and fast specific procedures for plutonium, americium and berkelium. The cross sections for the production of several nuclides from the bombardment of 248 Cm with 18 O, 86 Kr and 136 Xe projectiles at several energies near and below the Coulomb barrier were determined. The results are compared with yields from 48 Ca and 238 U bombardments of 248 Cm. Simple extrapolation of the product yields into unknown regions of charge and mass indicates that the use of heavy ion transfer reactions to produce new, neutron-rich above-target species is limited. The substantial production of neutron-rich below-target species, however, indicates that with very heavy ions like 136 Xe and 238 U the new species 248 Am, 249 Am and 247 Pu should be produced with large cross sections from a 248 Cm target. A preliminary, unsuccessful attempt to isolate 247 Pu is outlined. The failure is probably due to the half life of the decay, which is calculated to be less than 3 minutes. The absolute gamma ray intensities from 251 Bk decay, necessary for calculating the 251 Bk cross section, are also determined

  14. Application of alpha spectrometry to the discovery of new elements by heavy-ion-beam bombardment

    International Nuclear Information System (INIS)

    Nitschke, J.M.

    1983-05-01

    Starting with polonium in 1898, α-spectrometry has played a decisive role in the discovery of new, heavy elements. For even-even nuclei, α-spectra have proved simple to interpret and exhibit systematic trends that allow extrapolation to unknown isotopes. The early discovery of the natural α-decay series led to the very powerful method of genetically linking the decay of new elements to the well-established α-emission of daughter and granddaughter nuclei. This technique has been used for all recent discoveries of new elements including Z = 109. Up to mendelevium (Z = 101), thin samples suitable for α-spectrometry were prepared by chemical methods. With the advent of heavy-ion accelerators new sample preparation methods emerged. These were based on the large momentum transfer associated with heavy-ion reactions, which produced energetic target recoils that, when ejected from the target, could be thermalized in He gas. Subsequent electrical deposition or a He-jet technique yielded samples that were not only thin enough for α-spectroscopy, but also for α- and #betta#-recoil experiments. Many variations of these methods have been developed and are discussed. For the synthesis of element 106 an aerosol-based recoil transport technique was devised. In the most recent experiments, α-spectrometry has been coupled with the magnetic analysis of the recoils. The time from production to analysis of an isotope has thereby been reduced to 10 - 6 s; while it was 10 - 1 to 10 0 s for He-jets and 10 1 to 10 3 s for rapid chemical separations. Experiments are now in progress to synthesize super heavy elements (SHE) and to analyze them with these latest techniques. Again, α-spectrometry will play a major role since the expected signature for the decay of a SHE is a sequence of α-decays followed by spontaneous fission

  15. Human recombinant antibodies against Plasmodium falciparum merozoite surface protein 3 cloned from peripheral blood leukocytes of individuals with immunity to malaria demonstrate antiparasitic properties

    DEFF Research Database (Denmark)

    Lundquist, Rasmus; Nielsen, Leif Kofoed; Jafarshad, Ali

    2006-01-01

    against MSP-3 residues 194 to 257 (MSP-3(194-257)) on the molecular level. mRNA from peripheral blood leukocytes from clinically immune individuals was used as a source of Fab (fragment antibody) genes. A Fab-phage display library was made, and three distinct antibodies designated RAM1, RAM2, and RAM3...

  16. Radionuclides for nuclear medicine: a nuclear physicists' view

    Czech Academy of Sciences Publication Activity Database

    Cantone, M.; Haddad, F.; Harissopoulos, S.; Jensen, M.; Jokinen, A.; Koster, U.; Lebeda, Ondřej; Ponsard, B.; Ratzinger, U.; Stora, T.; Tarkanyi, F.; Van Duppen, P.

    2013-01-01

    Roč. 40, 2 Supplement (2013), S257-S257 ISSN 1619-7070. [Annual Congress of the European Association of Nuclear Medicine (EANM). 19.10.2013-23.10.2013, Lyon] Institutional support: RVO:61389005 Keywords : nuclear physics for medicine * EANM * medical radionuclides Subject RIV: BG - Nuclear, Atomic and Molecular Physics, Colliders

  17. The Eating Disorders Inventory among Asian American College Women.

    Science.gov (United States)

    Tsai, Grace; Gray, James

    2000-01-01

    Assesses the prevalence rate of bulimic disorders among 257 female Asian Americans from 18 to 30 years old. Finds that only two of the 257 women met the classification for bulimia nervosa. Contends that the findings illustrate the need for future research among culturally different populations. (CMK)

  18. OVA-specific CD8(+)T cells do not express granzyme B during anterior chamber associated immune deviation

    NARCIS (Netherlands)

    Ren, Y.; Yang, P.; Li, B.; Gao, Y.; Zhou, H.; Huang, X.; Zhu, L.; Kijlstra, A.

    2006-01-01

    To examine antigen (Ag)-specific CTL response during anterior chamber associated immune deviation (ACAID). Methods OVA or OVA257-264 peptide was injected into the anterior chamber (AC) of C57BL/6 mice. There were 16 mice in each ACAID group induced with OVA or OVA257-264 peptide. The mice were

  19. Age and growth of Labeo gonius (Cyprinidae) in Kali river, Uttar Pradesh, India

    Digital Repository Service at National Institute of Oceanography (India)

    Chatterji, A.

    stream_size 4 stream_content_type text/plain stream_name Asian_Fish_Sci_5_257.pdf.txt stream_source_info Asian_Fish_Sci_5_257.pdf.txt Content-Encoding ISO-8859-1 Content-Type text/plain; charset=ISO-8859-1 ...

  20. Browse Title Index

    African Journals Online (AJOL)

    Items 251 - 257 of 257 ... ... technology in accessing maternal and child health information in Nigeria, Abstract. Oluwaseun I. Obasola, Iyabo M. Mabawonku. Vol 17, No 1 (2007), Workplace, Biographical and Motivation Factors Affecting Organisational Commitment of Records Officers in Nigerian Federal Universities, Abstract.

  1. Search Results | Page 26 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    2015-04-07

    Results 251 - 257 of 257 ... Putting open data into policy : lessons from leaders around the world. Open data as a policy area is not more than five years old. Published date. April 7, 2015. Journal articles. DEVELOPMENT AID CULTURAL CHANGE SOCIAL MOVEMENTS DEVELOPMENT STRATEGY ORGANIZATIONAL ...

  2. Život i djelo Dmitrija Ivanoviča Mendeljejeva - povodom 100. obljetnice smrti

    Directory of Open Access Journals (Sweden)

    Vaščić, V.

    2007-04-01

    Full Text Available The life and activities of D. I. Mendeleyev are presented primarily in view of his role in the progress of chemistry. Born in Tobolsk in 1834 to a numerous and poor family, burdened by the family's bad luck and his ill health, he graduated natural sciences in 1855 at St. Petersburg and was awarded a gold medal for exceptional success. In 1855/56 he was teacher at a secondary school in Odessa. He obtained his MSc degree in 1856 in St. Petersburg where he was appointed lecturer in 1857. He was guest scientist 1859-1861 at the University in Heidelberg where he investigated the behavior of gases under various pressures and temperatures and discovered the criticaltemperature of liquefaction. He achieved his PhD degree in 1865 in St. Petersburg with a thesis on ethanol/water mixtures. Therein he had proven the existence of alcohol hydrates. His work later enabled the elaboration of modern conceptions on solvate formation in solutions. In 1865 he was elected professor at the University in St. Petersburg where he worked until 1890 when he was forced to retire. Preparing his textbook "Fundamentals of Chemistry" in 1869, he discovered that properties of chemical elements depend periodically on atomic weights. This enabled the elaboration of a periodic system as the base for classification in chemistry, as well as for further research and development of chemical science and technology. The international scientific community accepted Mendeleyev's system with distrust and it was generally acknowledged not before three "prophecies" of Mendeleyev were realized by the discovery of gallium (1875, scandium (1879 and germanium (1886. Later, in verification of his predictions, other elements - including transuranics - were discovered. Hence, in honor of the creator of the periodic system, the element of atomic number 101 was named mendelevium (1955. Mendeleyev was reactivated in 1892 as director of the Central Bureau for Measures and Weights where he worked until

  3. Formins: Linking Cytoskeleton and Endomembranes in Plant Cells

    Czech Academy of Sciences Publication Activity Database

    Cvrčková, F.; Oulehlová, Denisa; Žárský, Viktor

    2015-01-01

    Roč. 16, č. 1 (2015), s. 1-18 E-ISSN 1422-0067 Institutional support: RVO:61389030 Keywords : formin * actin * microtubules Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 3.257, year: 2015

  4. Search Results | Page 8 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Results 71 - 80 of 257 ... Integrated "farm to fork approach" to improving food and nutrition security in the Caribbean by linking agricultural ... Findings showed market-based barriers to technology adoption by farmers: ... Creating global citizens?

  5. TAX REFORMS AND INVESTMENT IN NIGERIA: AN EMPIRICAL ...

    African Journals Online (AJOL)

    GRACE

    Tax generated revenues are used to finance public utilities, perform social responsibilities and grease the ..... Capital Theory and Investment Behaviours, The American Review,. 53:247-257. ... ESUT Journal of Accounting, 5(2). December ...

  6. Search Results | Page 2 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Results 11 - 20 of 257 ... Harnessing big data to meet the Sustainable Development Goals ... official statistics, and facilitate development in sectors such as health, ... promoting gender equality is central to global development policy and practice.

  7. A review of the peri-operative management of paediatric burns ...

    African Journals Online (AJOL)

    adversely affect surgical and anaesthetic outcomes were identified. Results. There were 257 males and .... morphine, this allowed for a higher turnover of patient numbers. Table 3 displays the total .... psychological effects. Premedication was.

  8. Search Results | Page 16 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Results 151 - 160 of 257 ... Multi-donor Research Platform on Social Protection, Financial Inclusion and ... Child Support, Poverty and Gender Equality in the Caribbean - Phase II ... Sector within Urban Policies in Latin America and the Caribbean.

  9. The Conference from the Prague Perspective

    Czech Academy of Sciences Publication Activity Database

    Hrubec, Marek

    2017-01-01

    Roč. 43, č. 3 (2017), s. 256-257 ISSN 0191-4537 Institutional support: RVO:67985955 Keywords : Critical Theory * Conference Philosophy and Social Science * Prague Subject RIV: AA - Philosophy ; Religion

  10. 75 FR 25890 - Self-Regulatory Organizations; Notice of Filing and Immediate Effectiveness of Proposed Rule...

    Science.gov (United States)

    2010-05-10

    ... MNKD MannKind Corp... 255 TM Toyota Motor Corp. 171 MDVN Medivation Inc.. 257 HK Petrohawk Energy Corp... Kinross Gold Corp. 213 MRVL Marvell 273 EP El Paso Corp. Technology Group Ltd. 215 XLP Consumer Staples...

  11. 75 FR 26299 - Self-Regulatory Organizations; Notice of Filing and Immediate Effectiveness of Proposed Rule...

    Science.gov (United States)

    2010-05-11

    ... AMED Amedisys Inc. 255 TM Toyota Motor Corp. 257 HK Petrohawk Energy Corp. 258 ENER Energy Conversion... Kinross Gold Corp. 273 EP El Paso Corp. 274 SEED Origin Agritech Ltd. 275 WIN Windstream Corp. 279 DHI DR...

  12. 75 FR 26312 - Self-Regulatory Organizations; NYSE Amex LLC; Notice of Filing and Immediate Effectiveness of...

    Science.gov (United States)

    2010-05-11

    ... MannKind Corp. 255 TM Toyota Motor Corp. 171 MDVN Medivation Inc. 257 HK Petrohawk Energy Corp. 176... Gold Corp. 213 MRVL Marvell Technology 273 EP El Paso Corp. Group Ltd. 215 XLP Consumer Staples 274...

  13. a comparative study of student academic performance in on-campus

    African Journals Online (AJOL)

    User

    demic performance (Cumulative Weighted Average Scores) between distance and on-campus students. ... one of the several programmes that is offered ... and women in the two courses in health care ..... cation for Business 77 (5):257-263.

  14. LEVELS OF CHLORPYRIFOS AND ITS DEGRADATION PRODUCT 3,5,6-TRICHLORO-2-PYRIDINOL IN THE HOMES, DAY CARE CENTERS, AND URINE OF 130 NORTH CAROLINA PRESCHOOL CHILDREN

    Science.gov (United States)

    This study examined the aggregate exposures of 257 preschool children to pollutants commonly found in their everyday environments. A primary objective was to identify important sources and routes that contribute to the children's exposures in these environments. Participants w...

  15. Traženje zajedničkoga kulturnog identiteta na početku 20. Stoljeća: Josef Vajs I pokret za obnovu glagoljaškoga pjevanja u hrvatskoj I češkoj

    Czech Academy of Sciences Publication Activity Database

    Slavický, Tomáš

    2013-01-01

    Roč. 44, č. 2 (2013), s. 257-270 ISSN 0587-5455 Institutional support: RVO:68378076 Keywords : Josef Vajs * Glagolitic singing * Glagolitic liturgy Subject RIV: AL - Art, Architecture, Cultural Heritage

  16. Agro-Science Journal of Tropical Agriculture, Food, Environment ...

    African Journals Online (AJOL)

    PC USER

    Agro-Science Journal of Tropical Agriculture, Food, Environment and Extension. Volume 14 ... 3Department of Home Science, Nutrition and Dietetics, University of Nigeria, Nsukka,. Nigeria ..... work was found to be 25.7%. This value is higher.

  17. Search Results | Page 5 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    2013-04-01

    Results 41 - 50 of 257 ... Innovation and productivity in services : an impact evaluation of Colciencias funding programs in Colombia. Published date. April 1, 2013. Papers. CHILE SERVICES Innovation ...

  18. Prevalence and immediate outcomes of hypoxic Ischaemic ...

    African Journals Online (AJOL)

    research and Publications via the Office of the Head,. Department Of Paediatrics and ... thank the nurses of neonatal ward for their assistance during data collection. ... Birth asphyxia: A review. East Asian Medical Journal 1985; 72:252 – 257. 2.

  19. Search Results | Page 13 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Results 121 - 130 of 257 ... The Caribbean is a diverse group of countries, both culturally and ... unemployment and an underdeveloped formal (private) sector. ... has reduced poverty and increased labour market opportunities in Latin America.

  20. Search Results | Page 17 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Results 161 - 170 of 257 ... This project will focus on understanding governance issues related to ... adopting information and communication technologies (ICTs) in the process of ... Nurses are the largest single group of health professionals who ...

  1. Radioactive waste management and advanced nuclear fuel cycle technologies

    International Nuclear Information System (INIS)

    2007-01-01

    In 2007 ENEA's Department of Nuclear Fusion and Fission, and Related Technologies acted according to national policy and the role assigned to ENEA FPN by Law 257/2003 regarding radioactive waste management and advanced nuclear fuel cycle technologies

  2. Morphology of the Local Supercluster

    International Nuclear Information System (INIS)

    Tully, R.B.

    1983-01-01

    The intent of this brief note is to summarize some of the fundamental properties of the region, rich in galaxies, in which we live. A more complete account can be found in Astrophys. J., 257, p. 389, 1982. (Auth.)

  3. Isolating dividing neural and brain tumour cells for gene expression profiling

    Czech Academy of Sciences Publication Activity Database

    Endaya, B.; Cavanagh, B.; Alowaidi, F.; Walker, T.; de Pennington, N.; Ng, J.-M.; Lam, P.Y.P.; Mackay-Sim, A.; Neužil, Jiří; Meedeniya, A.C.B.

    2016-01-01

    Roč. 257, JAN 15 2016 (2016), s. 121-133 ISSN 0165-0270 Institutional support: RVO:86652036 Keywords : Cell division * Click chemistry * FACS Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 2.554, year: 2016

  4. Antiperspirants/Deodorants and Breast Cancer

    Science.gov (United States)

    ... measurements and mechanisms of toxicological actions on breast biology. Journal of Inorganic Biochemistry 2013; 128:257-261. [PubMed Abstract] Willhite CC, Karyakina NA, Yokel RA, et al. Systematic review of potential health risks posed by pharmaceutical, ...

  5. Search Results | Page 25 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Results 241 - 250 of 257 ... ... poor, combined with less education and limited access to healthcare services. ... Overall maternal and child health indicators are among the worst in ... Influencing eating behaviors in early childhood can have a huge ...

  6. Search Results | Page 14 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Results 131 - 140 of 257 ... Filter by region .... Resilient Cities Initiative on Climate Change in Latin America and the Caribbean. This joint initiative between IDRC and the Climate and Development Knowledge Network will help strengthen ...

  7. Search Results | Page 20 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Results 191 - 200 of 257 ... Involving urban communities in controlling dengue fever in Latin America ... For most countries, raising the minimum wage has long been considered a way ... Evaluating vocational training program for women in Brazil.

  8. Effects of an inorganic insecticide (boric acid) against Blattella ...

    African Journals Online (AJOL)

    ufuoma

    2013-05-01

    May 1, 2013 ... Data on ovarian .... The overall data suggested an interference of boric acid with the ... solutions as baits for management of German cockroaches .... Comp. Biochem. Physiol. 135C:257-267. Tine S, Aribi N, Soltani N (2011).

  9. The undefined function differs from the pointwise undefined function

    OpenAIRE

    Dosch, Walter (Prof.)

    1993-01-01

    The undefined function differs from the pointwise undefined function. - In: Joint Conference on Declarative Programming : Proceedings / Maria I. Sessa ... (eds.). - Salerno : Univ. degli Studi, 1995. - S. 257-268

  10. Insect hormones: more than 50-years after the discovery of insect juvenile hormobne analogues (JHA, juvenoids)

    Czech Academy of Sciences Publication Activity Database

    Sláma, Karel

    2013-01-01

    Roč. 6, č. 4 (2013), s. 257-333 ISSN 1874-9828 Institutional support: RVO:60077344 Keywords : juvenile hormone (JH) * activation neurohormone (AH) pseudojuvenile effects * terpenoid juvenoids Subject RIV: ED - Physiology

  11. Pregnancy Outcome among Patients with Sickle Cell Disease in Jos

    African Journals Online (AJOL)

    Zamzar

    The antenatal complications included anaemia (62.9%), vaso-oclusive. (bone pain) ... Conclusion: Pregnancy in sickle cell disease patients is associated with high maternal and perinatal morbidity .... and malaria (25.7%) were other common.

  12. Search Results | Page 6 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Results 51 - 60 of 257 ... Linking communities of practice with value chain development in ... Recognizing that value chains involve complex social and economic relationships, there ... development dynamics that lead to economic growth, poverty ...

  13. Polyethylene flame retarded with expandable graphite and a novel intumescent additive

    CSIR Research Space (South Africa)

    Focke, WW

    2014-07-01

    Full Text Available A novel intumescent additive was synthesized by neutralizing 3,5-diaminobenzoic acid hydrochloride salt with ammonium dihydrogen phosphate. This compound, which melts at 257 C, decomposes concurrently to release carbon dioxide gas. The flame...

  14. AcEST: DK960686 [AcEST

    Lifescience Database Archive (English)

    Full Text Available NVISWNAMLAAYTYCGCNDGVLELFDQMLFQ 196 V TAL+ + +L +A VF+ ++V+SWNA++A C + V + +M + Sbjct: 192 VFMTALI----RSRKLAEALEVFEACRGKDVVSWNAVMAG...D S Sbjct: 199 RSRKLAEALEVFEACRGKDVVSWNAVMAGLVQFCCGEVPGF-WRRMCCEGVKPDNFAFSG 257 Q

  15. Search Results | Page 11 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Results 101 - 110 of 257 ... This grant will help the Norman Paterson School of International ... Understanding Southern Influence in Cyberspace Security and ... Beyond Social Protection: Labour Markets, Entrepreneurship, and Gender Equality.

  16. CYP/PON genetic variations as determinant of organophosphate ...

    Indian Academy of Sciences (India)

    GURPREET KAUR

    ticular disease and others do not (Rose et al. 2005). ..... Polycystic ovary syndrome,. Dadachanji et al. ..... early microvascular complications in type 1 diabetes. Diabetic ..... 257–261. Shenhar-Tsarfaty S., Waiskopf N., Ofek K., Shopin L., Usher.

  17. Structure-guided modification of Rhizomucor miehei lipase for production of structured lipids.

    Directory of Open Access Journals (Sweden)

    Jun-Hui Zhang

    Full Text Available To improve the performance of yeast surface-displayed Rhizomucor miehei lipase (RML in the production of human milk fat substitute (HMFS, we mutated amino acids in the lipase substrate-binding pocket based on protein hydrophobicity, to improve esterification activity. Five mutants: Asn87Ile, Asn87Ile/Asp91Val, His108Leu/Lys109Ile, Asp256Ile/His257Leu, and His108Leu/Lys109Ile/Asp256Ile/His257Leu were obtained and their hydrolytic and esterification activities were assayed. Using Discovery Studio 3.1 to build models and calculate the binding energy between lipase and substrates, compared to wild-type, the mutant Asp256Ile/His257Leu was found to have significantly lower energy when oleic acid (3.97 KJ/mol decrease and tripalmitin (7.55 KJ/mol decrease were substrates. This result was in accordance with the esterification activity of Asp256Ile/His257Leu (2.37-fold of wild-type. The four mutants were also evaluated for the production of HMFS in organic solvent and in a solvent-free system. Asp256Ile/His257Leu had an oleic acid incorporation of 28.27% for catalyzing tripalmitin and oleic acid, and 53.18% for the reaction of palm oil with oleic acid. The efficiency of Asp256Ile/His257Leu was 1.82-fold and 1.65-fold that of the wild-type enzyme for the two reactions. The oleic acid incorporation of Asp256Ile/His257Leu was similar to commercial Lipozyme RM IM for palm oil acidolysis with oleic acid. Yeast surface-displayed RML mutant Asp256Ile/His257Leu is a potential, economically feasible catalyst for the production of structured lipids.

  18. Structure-guided modification of Rhizomucor miehei lipase for production of structured lipids.

    Science.gov (United States)

    Zhang, Jun-Hui; Jiang, Yu-Yan; Lin, Ying; Sun, Yu-Fei; Zheng, Sui-Ping; Han, Shuang-Yan

    2013-01-01

    To improve the performance of yeast surface-displayed Rhizomucor miehei lipase (RML) in the production of human milk fat substitute (HMFS), we mutated amino acids in the lipase substrate-binding pocket based on protein hydrophobicity, to improve esterification activity. Five mutants: Asn87Ile, Asn87Ile/Asp91Val, His108Leu/Lys109Ile, Asp256Ile/His257Leu, and His108Leu/Lys109Ile/Asp256Ile/His257Leu were obtained and their hydrolytic and esterification activities were assayed. Using Discovery Studio 3.1 to build models and calculate the binding energy between lipase and substrates, compared to wild-type, the mutant Asp256Ile/His257Leu was found to have significantly lower energy when oleic acid (3.97 KJ/mol decrease) and tripalmitin (7.55 KJ/mol decrease) were substrates. This result was in accordance with the esterification activity of Asp256Ile/His257Leu (2.37-fold of wild-type). The four mutants were also evaluated for the production of HMFS in organic solvent and in a solvent-free system. Asp256Ile/His257Leu had an oleic acid incorporation of 28.27% for catalyzing tripalmitin and oleic acid, and 53.18% for the reaction of palm oil with oleic acid. The efficiency of Asp256Ile/His257Leu was 1.82-fold and 1.65-fold that of the wild-type enzyme for the two reactions. The oleic acid incorporation of Asp256Ile/His257Leu was similar to commercial Lipozyme RM IM for palm oil acidolysis with oleic acid. Yeast surface-displayed RML mutant Asp256Ile/His257Leu is a potential, economically feasible catalyst for the production of structured lipids.

  19. Within centre evaluation of hypercalcaemia discriminant

    DEFF Research Database (Denmark)

    Nielsen, Bo Friis; Conradsen, Knut

    1996-01-01

    Diagnostic hypercalcaemia discriminant functions, discriminating between clinically significant and non-significant hypercalcaemia, were tested 5 years after their development in order to evaluate the impact of time on their diagnostic capacity. Two populations, consisting of 257 and 129 patients......). The discriminant functions correctly classified 81 and 80% of the women, respectively (NS) and respectively 75% and 64% of the men (NS) in the first and second recorded populations.......Diagnostic hypercalcaemia discriminant functions, discriminating between clinically significant and non-significant hypercalcaemia, were tested 5 years after their development in order to evaluate the impact of time on their diagnostic capacity. Two populations, consisting of 257 and 129 patients...

  20. Fabrication and stability of fiber bragg gratings for WDM applications using a 266 nm cw-laser

    DEFF Research Database (Denmark)

    Deyerl, Hans-Jürgen; Sørensen, Henrik Rokkjær; Jensen, Jesper Bo Damm

    2003-01-01

    Diode pumped continuous wave all solid state UV-lasers operating at 266 nm offer an interesting alternative to frequency doubled argon ion lasers. We compare photosensitivity, UV-writing of Bragg gratings and thermal decay at 244, 257 and 266 nm.......Diode pumped continuous wave all solid state UV-lasers operating at 266 nm offer an interesting alternative to frequency doubled argon ion lasers. We compare photosensitivity, UV-writing of Bragg gratings and thermal decay at 244, 257 and 266 nm....

  1. Outcome, Cost, and Oversight of Iraq Reconstruction Contract W914NS-04-D-0006

    Science.gov (United States)

    2008-01-28

    Minerals HQs Building $7,928,993 2% 03 Modernize Maternity & Pediatric Hospital – Ibn Al Baladi $8,814,353 3% 04 Ministry of Health – Healthcare...Ministerial buildings 8,257,981 8,258,377 Completed Terminated for Convenience 3 Renovate Ibn Al Baladi Hospital 9,585,023 9,365,516 4 Design and...7,331,585 237,490 688,906 8,257,981 8,258,377 8,258,377 3 Renovate Ibn Al Baladi Hospital 8,251,610 320,820 1,012,593 9,585,023 9,585,023

  2. Statistical Inference on Memory Structure of Processes and Its Applications to Information Theory

    Science.gov (United States)

    2016-05-12

    8217x’!will!correspond!with!the!stringoid! matrices! ! E4=C4*log(P4)! Ea4=matrix(E4[1:256])! Es4=matrix(E4[257:496])! ! EL4 =matrix(cbind(A4,E4),length...E4))! ELa4=matrix( EL4 [1:256,1:5],length(Ea4))! ELs4=matrix( EL4 [257:496,1:5],length(Es4))! ! Ea4a=matrix(rep(0,60))! for(i!in!1:256)! for(j!in!1:60

  3. Ontological Proofs of Existence and Non-Existence

    Czech Academy of Sciences Publication Activity Database

    Hájek, Petr

    2008-01-01

    Roč. 90, č. 2 (2008), s. 257-262 ISSN 0039-3215 R&D Projects: GA AV ČR IAA100300503 Institutional research plan: CEZ:AV0Z10300504 Keywords : ontological proofs * existence * non-existence * Gödel * Caramuel Subject RIV: BA - General Mathematics

  4. Impact of Calcium and Two Doses of Vitamin D on Bone Metabolism in the Elderly

    DEFF Research Database (Denmark)

    Rahme, Maya; Sharara, Sima Lynn; Baddoura, Rafic

    2017-01-01

    The optimal dose of vitamin D to optimize bone metabolism in the elderly is unclear. We tested the hypothesis that vitamin D, at a dose higher than recommended by the Institute of Medicine (IOM), has a beneficial effect on bone remodeling and mass. In this double-blind trial we randomized 257 ove...

  5. Theoretical modeling of influence of the structural disorder on the charge carrier mobility in triphenylene stacks

    Czech Academy of Sciences Publication Activity Database

    Mikolajczyk, M.; Toman, Petr; Bartkowiak, W.

    2010-01-01

    Roč. 485, 1-3 (2010), s. 253-257 ISSN 0009-2614 R&D Projects: GA MŠk MEB050815; GA AV ČR IAA401770601 Institutional research plan: CEZ:AV0Z40500505 Keywords : triphenylene * charge carrier mobility * tight-binding approximation Subject RIV: CD - Macromolecular Chemistry Impact factor: 2.282, year: 2010

  6. Determining the Relationship between the Use of Fixed Appliances ...

    African Journals Online (AJOL)

    Mike Saghiri

    2011-10-07

    Oct 7, 2011 ... Periodontal disease is one of the major problem and concern ... Gingival bleeding. Gingival recession. Gingival hyperplasia. No. Yes. No ... had no history of smoking. .... 15.3 years (minimum 11.6 and maximum 25.7). In all.

  7. Recurrent Novae in M31

    Czech Academy of Sciences Publication Activity Database

    Shafter, A.W.; Henze, M.; Rector, T. A.; Schweizer, F.; Hornoch, Kamil; Orio, M.; Pietsch, W.; Darnley, M.J.; Williams, S.C.; Bode, M.F.; Bryan, J.

    2015-01-01

    Roč. 216, č. 2 (2015), 34/1-34/35 ISSN 0067-0049 Institutional support: RVO:67985815 Keywords : individual (M31) galaxies * stellar content * cataclysmic variables Subject RIV: BN - Astronomy, Celestial Mechanics, Astrophysics Impact factor: 11.257, year: 2015

  8. Browse Title Index

    African Journals Online (AJOL)

    Items 1 - 50 of 257 ... Vol 42, No 2 (2014), A comparative analysis of two land reform models: The Mashishimale Farm Management Model and the Nkumbuleni Strategic ... Vol 43, No 2 (2015), Adapted SERVQUAL for evaluating the provision of information as an agricultural extension service in South Africa, Abstract PDF.

  9. Use of the industrial yeast Candida utilis for cadmium sorption

    Czech Academy of Sciences Publication Activity Database

    Kujan, Petr; Prell, Aleš; Šafář, Hynek; Sobotka, Miroslav; Řezanka, Tomáš; Holler, Pavel

    2006-01-01

    Roč. 51, č. 4 (2006), s. 257-260 ISSN 0015-5632 Institutional research plan: CEZ:AV0Z50200510 Keywords : candida utilis * cadmium * yeast Subject RIV: EE - Microbiology, Virology Impact factor: 0.963, year: 2006

  10. Work and Rest Patterns and Psychomotor Vigilance Performance of Crewmemebers of the USS Jason Dunham: A Comparison of the 3/9 and 6/6 Watchstanding Schedules

    Science.gov (United States)

    2014-12-31

    4, 257–271. Albertsen, K., Rafnsdóttir, G. L., Grimsmo, A., Tómasson, K., & Kauppinen, K. (2008). Workhours and worklife balance . Scandinavian...consequences on balancing work and home life. Scientific evidence suggests that shift work has a negative influence on children’s well-being and on

  11. QTL list: sex1.2 [PGDBj Registered plant list, Marker list, QTL list, Plant DB link and Genome analysis methods[Archive

    Lifescience Database Archive (English)

    Full Text Available QT64750 Cucumis sativus Cucurbitaceae sex1.2 Number of female nodes on mainstem gynoecious (F) trait (sex...1.1), determinate (de) trait (sex1.2) ... LG_01 ... 25.7 7.3 ... 10.1007/s00122-003-1277-1 12827247

  12. EST Table: AV403752 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV403752 pg--0009 10/09/28 100 %/257 aa ref|YP_002411376.1| terminase large subunit (DNA packaging... protein A) from bacteriophage origin [Escherichia coli UMN026] emb|CAR11828.1| terminase large subunit (DNA packaging

  13. Microbial colonization of silicone voice prostheses used in laryngectomized patients

    NARCIS (Netherlands)

    Eerenstein, S. E.; Grolman, W.; Schouwenburg, P. F.

    1999-01-01

    The aim of this study was to identify the microbial colonization of dysfunctioning voice prostheses in laryngectomized patients and determine the influence of patient radiation therapy on prosthesis life span. In a 40-month period, 257 outpatient voice prosthesis replacements were carried out in a

  14. Scoping Report: AI-Driven Wargame Replicator

    Science.gov (United States)

    2010-12-01

    Connectionist Learning with Adaptive Rule Induction On-line (CLARION) CLARION, with its root in neural networks, is a hybrid architecture that incorporates...www.dsto.defence.gov.au/publications/2655/DSTO-TN-0534.pdf. [257] Stokes, A.E. and Kite, K. (2000). Op grasping a nettle and becoming emotional. In Peter A

  15. Muzejní zlomek s opisem Evangelia sv. Matouše s homiliemi

    Czech Academy of Sciences Publication Activity Database

    Voleková, Kateřina

    2017-01-01

    Roč. 140, 1/2 (2017), s. 247-257 ISSN 0024-4457 R&D Projects: GA ČR GA15-06405S Institutional support: RVO:68378092 Keywords : Old Czech * Bible * translation * manuscript Subject RIV: AI - Linguistics OBOR OECD: Linguistics

  16. Development of a radiochemical neutron activation analysis procedure for determination of rhenium in biological and environmental samples at ultratrace level

    Czech Academy of Sciences Publication Activity Database

    Kučera, Jan; Byrne, A. R.; Mizera, Jiří; Lučaníková, M.; Řanda, Zdeněk

    2006-01-01

    Roč. 269, č. 2 (2006), s. 251-257 ISSN 0236-5731 R&D Projects: GA ČR(CZ) GA203/04/0943 Institutional research plan: CEZ:AV0Z10480505 Keywords : radiochemical neutron activation analysis * rhenium * biological and environmental samples Subject RIV: CB - Analytical Chemistry, Separation Impact factor: 0.509, year: 2006

  17. Low temperature delayed recombination decay in complex oxide scintillating crystals

    Czech Academy of Sciences Publication Activity Database

    Mihóková, Eva; Jarý, Vítězslav; Schulman, L. S.; Nikl, Martin

    2014-01-01

    Roč. 61, č. 1 (2014), 257-261 ISSN 0018-9499 R&D Projects: GA MŠk LH12150; GA MŠk LH12185 Grant - others:AVČR(CZ) M100101212 Institutional support: RVO:68378271 Keywords : luminescence * oxides * scintillator * tunneling Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 1.283, year: 2014

  18. 78 FR 11227 - Notice of Determinations Regarding Eligibility To Apply for Worker Adjustment Assistance

    Science.gov (United States)

    2013-02-15

    ... 11, 2011. 82,239 Hewlett Packard Santa Monica, CA....... December 10, 2011. Enterprise Services, LLC, Technical/ Enterprise Services Division, SAIT Services. 82,250 YP Western Directory Anaheim, CA December 12, 2011. LLC, Anaheim California Div., Publishing Operation, YP Western Holding YP Advertising. 82,257...

  19. Use of biocides for the control of fungal outbreaks in subterranean environments: The case of the Lascaux Cave in France

    Czech Academy of Sciences Publication Activity Database

    Martín-Sánchez, P.M.; Nováková, Alena; Bastian, F.; Alabouvette, C.; Saiz-Jimenez, C.

    2012-01-01

    Roč. 46, č. 7 (2012), s. 3762-3770 ISSN 0013-936X Grant - others:Spanish Ministry of Science and Innovation (ES) TCP CSD2007-00058 Institutional support: RVO:60077344 Keywords : fungal outbreaks * subterranean environments * Lascaux Cave Subject RIV: EH - Ecology, Behaviour Impact factor: 5.257, year: 2012

  20. Surface refinement and electronic properties of graphene layers grown on copper substrate: An XPS, UPS and EELS study

    Czech Academy of Sciences Publication Activity Database

    Siokou, A.; Ravani, F.; Karakalos, S.; Frank, Otakar; Kalbáč, Martin; Galiotis, C.

    2011-01-01

    Roč. 257, č. 23 (2011), s. 9785-9790 ISSN 0169-4332 R&D Projects: GA MŠk LC510; GA AV ČR IAA400400911 Institutional research plan: CEZ:AV0Z40400503 Keywords : graphene * XPS * EELS Subject RIV: CG - Electrochemistry Impact factor: 2.103, year: 2011

  1. Report of the NIH Panel to Define Principles of Therapy of HIV Infection and Guidelines for the Use of Antiretroviral Agents in HIV-Infected Adults and Adolescents. Vol. 47/No. RR-5.

    Science.gov (United States)

    1998-04-25

    1991;5:1-14. 85. Kinloch-de Loes S, de Saussure P, Saurat JH, Stalder H, Hirschel B, Perrin LH. Symptomatic primary infection due to human imm...epidemiologic features of primary HIV infection. Ann Intern Med 1996;125:257-64. 17. Kinloch-de Loes S, de Saussure P, Saurat J, Stalder H, Hirschel B, Perrin

  2. Radiation stability tests of the SMELS materials in the LVR-15 experimental reactor at Řež

    Czech Academy of Sciences Publication Activity Database

    Kučera, Jan; Eguskiza, M.; De Corte, F.; Rabouch, P.

    2003-01-01

    Roč. 257, č. 3 (2003), s. 677-682 ISSN 0236-5731 R&D Projects: GA ČR GA202/03/0891 Institutional research plan: CEZ:AV0Z1048901 Keywords : standardization * neutron activation analysis Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 0.472, year: 2003

  3. Iranian Sanctions: An Actor-Centric Analysis

    Science.gov (United States)

    2012-03-01

    cultivated to counterbalance other actors in the system who opposed Khamenei’s ascension, based on his weak religious credentials.42 These security...trumped up religious infraction.256 The bonyads are the Iranian economy’s dominating revenue generating entity outside the oil sector,257 mushrooming in

  4. Solvent extraction of strontium into nitrobenzene using hydrogen dicarbollylcobaltate in the presence of 12-crown-4

    Czech Academy of Sciences Publication Activity Database

    Vaňura, P.; Makrlík, E.; Vobecký, Miloslav

    2003-01-01

    Roč. 257, č. 2 (2003), s. 437-440 ISSN 0236-5731 R&D Projects: GA MŠk LN00B084 Institutional research plan: CEZ:AV0Z4031919; CEZ:MSM 230000009 Keywords : strontium * extraction Subject RIV: CB - Analytical Chemistry, Separation Impact factor: 0.472, year: 2003

  5. 21 CFR 184.1660 - Propyl gallate.

    Science.gov (United States)

    2010-04-01

    ... alcohol. (b) The ingredient meets the specifications of the “Food Chemicals Codex,” 3d Ed. (1981), pp. 257... 21 Food and Drugs 3 2010-04-01 2009-04-01 true Propyl gallate. 184.1660 Section 184.1660 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES (CONTINUED) FOOD FOR HUMAN...

  6. Advantages of breath testing for the early diagnosis of lung cancer

    Czech Academy of Sciences Publication Activity Database

    Smith, D.; Španěl, Patrik; Sule-Suso, J.

    2010-01-01

    Roč. 10, č. 3 (2010), s. 255-257 ISSN 1473-7159 Institutional research plan: CEZ:AV0Z40400503 Keywords : mass spectrometry * breath analysis * lung cancer Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 4.652, year: 2010

  7. The financial feasibility of producing fish and vegetables through aquaponics

    NARCIS (Netherlands)

    Bosma, Roel H.; Lacambra, Lysette; Landstra, Ynze; Perini, Chiara; Poulie, Joline; Schwaner, Marie J.; Yin, Yi

    2017-01-01

    Aquaponics, producing fish and vegetables in a closed-loop water system, reduces fertilizer use and water discharge, and is therefore promoted as a sustainable venture. A recent global study found that the majority of 257 surveyed aquaponics farms made losses, but the reasons have been poorly

  8. Gabonese French Dictionaries: Survey and Perspectives*

    African Journals Online (AJOL)

    Gabonese French Dictionaries: Survey and Perspectives. 257 ... be regarded, according to Gouws (2007: 314), as externally motivated products. .... Fair attention is given to different style or normative levels, i.e. .... differs enough from standard French to be regarded as a new emerging lan- ..... Tous les leaders des par-.

  9. Sadhana | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    Home; Journals; Sadhana. G Anandalingam. Articles written in Sadhana. Volume 30 Issue 2-3 April-June 2005 pp 257-274. Pricing strategies for information goods · Siva Viswanathan G Anandalingam · More Details Abstract Fulltext PDF. Digital or information goods are becoming the norm across a wide variety of ...

  10. 24 CFR 4001.102 - Cross-reference.

    Science.gov (United States)

    2010-04-01

    ... section 203 of the National Housing Act (12 U.S.C. 1709) apply to mortgages on one-family dwellings to be insured under section 257 of the National Housing Act (12 U.S.C. 1701z-22), except the following... contract regarding use of dwelling for transient or hotel purposes; 203.17(d) Maturity; 203.18 Maximum...

  11. 76 FR 72715 - Agency Information Collection Activities: Cargo Manifest/Declaration, Stow Plan, Container Status...

    Science.gov (United States)

    2011-11-25

    ... information (a total capital/startup costs and operations and maintenance costs). The comments that are... of total annual responses was lowered from 11,300,000 to 8,100,000. Vessel Stow Plan: the number of... 74 to 60, and the number of total responses was raised from 72,121,193 to 257,100,000. Type of Review...

  12. Crystal structure of the 14-3-3zeta:serotonin N-acetyltransferase complex. A role for scaffolding in enzyme regulation

    Czech Academy of Sciences Publication Activity Database

    Obšil, Tomáš; Ghirlando, R.; Klein, D. C.; Ganguly, S.; Dyda, F.

    2001-01-01

    Roč. 105, č. 2 (2001), s. 257-267 ISSN 0092-8674 Institutional research plan: CEZ:AV0Z5011922 Keywords : 14-3-3 * AANAT * crystal structure Subject RIV: BO - Biophysics Impact factor: 29.210, year: 2001

  13. The politics of fiscal federalism in Nigeria | Duru | Lwati: A Journal of ...

    African Journals Online (AJOL)

    257. Full Text: EMAIL FULL TEXT EMAIL FULL TEXT · DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT · http://dx.doi.org/10.4314/lwati.v4i1.36834 · AJOL African Journals Online. HOW TO USE AJOL... for Researchers · for Librarians ...

  14. Low-temperature time-resolved spectroscopic study of the major light-harvesting complex of Amphidinium carterae

    Czech Academy of Sciences Publication Activity Database

    Šlouf, V.; Fuciman, M.; Johanning, S.; Hofmann, E.; Frank, H.A.; Polívka, Tomáš

    2013-01-01

    Roč. 117, 1-3 (2013), s. 257-265 ISSN 0166-8595 R&D Projects: GA ČR(CZ) GAP205/11/1164 Institutional support: RVO:60077344 Keywords : Dinoflagellates * Energy transfer * Light- harvesting * Carotenoid Subject RIV: BO - Biophysics Impact factor: 3.185, year: 2013

  15. Development of Creative Behavior Observation Form: A Study on Validity and Reliability

    Science.gov (United States)

    Dere, Zeynep; Ömeroglu, Esra

    2018-01-01

    This study, Creative Behavior Observation Form was developed to assess creativity of the children. While the study group on the reliability and validity of Creative Behavior Observation Form was being developed, 257 children in total who were at the ages of 5-6 were used as samples with stratified sampling method. Content Validity Index (CVI) and…

  16. Predictors of Secondary Traumatic Stress among Children's Advocacy Center Forensic Interviewers

    Science.gov (United States)

    Bonach, Kathryn; Heckert, Alex

    2012-01-01

    This study examined various predictor variables that were hypothesized to impact secondary traumatic stress in forensic interviewers (n = 257) from children's advocacy centers across the United States. Data were examined to investigate the relationship between organizational satisfaction, organizational buffers, and job support with secondary…

  17. Maximum entropy analysis of cosmic ray composition

    Czech Academy of Sciences Publication Activity Database

    Nosek, D.; Ebr, Jan; Vícha, Jakub; Trávníček, Petr; Nosková, J.

    2016-01-01

    Roč. 76, Mar (2016), s. 9-18 ISSN 0927-6505 R&D Projects: GA ČR(CZ) GA14-17501S Institutional support: RVO:68378271 Keywords : ultra-high energy cosmic rays * extensive air showers * cosmic ray composition Subject RIV: BF - Elementary Particles and High Energy Physics Impact factor: 3.257, year: 2016

  18. Additional file 2

    Indian Academy of Sciences (India)

    Administrator

    41, Fatty acid degradation, KEGG PATHWAY, oas00071, 13, 43, 0.10466, 0.90655 ...... 257, Hepatitis C, KEGG PATHWAY, oas05160, 20, 132, 0.86387, 0.96769 ... 264, Vitamin digestion and absorption, KEGG PATHWAY, oas04977, 2, 22 ...

  19. Influence of Teachers' Teaching Experience on Students' Learning ...

    African Journals Online (AJOL)

    This article examined teachers' teaching experience and students' learning outcomes in the secondary schools in Ondo State Nigeria. As a correlational survey, the study population comprised all the 257 secondary schools that presented students for the year 2003 senior secondary certificate (SSC) examinations in the ...

  20. Accommodation, Cafes and Restaurants. Industry Training Monograph No. 8.

    Science.gov (United States)

    Dumbrell, Tom

    Australia's accommodation, cafes, and restaurants industry represents more than half of the nation's total tourism and hospitality employment. It accounts for roughly 4.5% of all jobs in Australia (400,000 workers). Since 1987, the number of jobs in the sector has risen from about 257,000 to about 372,000. Approximately 57% of employees are…

  1. Biohydrology research after Landau 2013 conference

    Czech Academy of Sciences Publication Activity Database

    Lichner, Ľ.; Cerdà, A.; Rajkai, K.; Tesař, Miroslav

    2014-01-01

    Roč. 62, č. 4 (2014), s. 253-257 ISSN 0042-790X Institutional support: RVO:67985874 Keywords : biohydrology * hydrological research * biological and hydrological systems * hydrological processes Subject RIV: DA - Hydrology ; Limnology Impact factor: 1.486, year: 2014

  2. 10 CFR 25.27 - Reopening of cases in which requests for access authorizations are canceled.

    Science.gov (United States)

    2010-01-01

    ... authorizations are canceled. 25.27 Section 25.27 Energy NUCLEAR REGULATORY COMMISSION ACCESS AUTHORIZATION Access Authorizations § 25.27 Reopening of cases in which requests for access authorizations are canceled. (a) In... cases were previously canceled, new fingerprint cards (FD-257) in duplicate and a new Security...

  3. Cost-utility of quadrivalent versus trivalent influenza vaccine in Brazil – comparison of outcomes from different static model types

    Directory of Open Access Journals (Sweden)

    Laure-Anne Van Bellinghen

    2018-01-01

    Conclusion: All three models predicted a cost per quality-adjusted life year gained for quadrivalent versus trivalent influenza vaccine in the range of R$19,257 (FLORENCE to R$22,768 (FLORA with the best available data in Brazil (Appendix A.

  4. Search Results | Page 21 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Results 201 - 210 of 257 ... Farm to fork—improving eating habits and nutrition education in the Caribbean ... The high and growing incidence of obesity among young children and adolescents is ... Garbage separation: a livelihood option for poor men and women ... Improving food security in Latin America and the Caribbean ...

  5. Karpenkoite, Co.sub.3./sub.(V.sub.2./sub.O.sub.7./sub.)(OH).sub.2./sub..2H.sub.2./sub.O, a cobalt analogue of martyite from the Little Eva mine, Grand County, Utah, USA

    Czech Academy of Sciences Publication Activity Database

    Kasatkin, A.V.; Plášil, Jakub; Pekov, V.I.; Belakovskiy, D. I.; Nestola, F.; Čejka, J.; Vigasina, M.F.; Zorzi, F.; Thorne, B.

    2015-01-01

    Roč. 60, č. 4 (2015), s. 251-257 ISSN 1802-6222 R&D Projects: GA ČR GP13-31276P Institutional support: RVO:68378271 Keywords : karpenkoite * new mineral * cobalt divanadate * powder diffraction * Little Eva mine * Utah Subject RIV: DB - Geology ; Mineralogy Impact factor: 1.326, year: 2015

  6. Search Results | Page 19 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Results 181 - 190 of 257 ... The IDRC-supported “Labour markets for inclusive growth” project, coordinated by the Centre for Distributive Labor and Social Studies (CEDLAS) at Universidad Nacional de La Plata in Argentina, is generating rigorous and policy-relevant evidence on how labour markets and social protection work ...

  7. Elemental characterization of the new Czech meteorite "Morávka" by neutron and photon activation analysis

    Czech Academy of Sciences Publication Activity Database

    Řanda, Zdeněk; Kučera, Jan; Soukal, Ladislav

    2003-01-01

    Roč. 257, č. 2 (2003), s. 275-283 ISSN 0236-5731 Institutional research plan: CEZ:AV0Z1048901 Keywords : Czech meteorite * photon activation analysis Subject RIV: DD - Geochemistry Impact factor: 0.472, year: 2003

  8. Monopole-antimonopole interaction potential

    Science.gov (United States)

    Saurabh, Ayush; Vachaspati, Tanmay

    2017-11-01

    We numerically study the interactions of twisted monopole-antimonopole pairs in the 't Hooft-Polyakov model for a range of values of the scalar to vector mass ratio. We also recover the sphaleron solution at maximum twist discovered by Taubes [Commun. Math. Phys. 86, 257 (1982), 10.1007/BF01206014] and map out its energy and size as functions of parameters.

  9. An annotated checklist of the vascular flora of Washington County Mississippi

    Science.gov (United States)

    Field explorations have yielded 257 species new to Washington County, Mississippi and Calandrinia ciliata (Ruiz & Pav.) DC. and Ruellia nudiflora (Engelm. & Gray) Urban new to the state. An annotated list of 796 taxa for Washington County is provided and excludes 62 species that were reported from ...

  10. Application of polyaniline dispersions by means of screen printing

    Czech Academy of Sciences Publication Activity Database

    Držková, M.; Peřinka, N.; Hajná, Milena; Kaplanová, M.; Stejskal, Jaroslav

    2013-01-01

    Roč. 19, č. 2013 (2013), s. 257-268 ISSN 1211-5541 R&D Projects: GA TA ČR TE01020022 Institutional support: RVO:61389013 Keywords : polyaniline * colloids * screen printing Subject RIV: JA - Electronics ; Optoelectronics, Electrical Engineering

  11. Interaction of polyunsaturated fatty acids and sodium butyrate during apoptosis in HT-29 human colon adenocarcinoma cells

    Czech Academy of Sciences Publication Activity Database

    Hofmanová, Jiřina; Vaculová, Alena; Lojek, Antonín; Kozubík, Alois

    2005-01-01

    Roč. 44, č. 1 (2005), s. 40-51 ISSN 1436-6207 R&D Projects: GA ČR(CZ) GA525/01/0419 Institutional research plan: CEZ:AV0Z50040507 Keywords : colon cancer * diet * butyrate Subject RIV: BO - Biophysics Impact factor: 2.257, year: 2005

  12. Social Support from Parents and Friends for Chinese Adolescents in Singapore

    Science.gov (United States)

    Cheung, Hoi Shan; Sim, Tick Ngee

    2017-01-01

    This study tested the situational hypothesis, by examining the perceived availability of three types of social support (emotional, informational, and instrumental) from parents and friends, with respect to occupational and interpersonal relationships issues. Participants were 257 Chinese Singaporean adolescents (120 males, 137 females) between…

  13. Transvesical prostatectomy in the management of benign prostatic ...

    African Journals Online (AJOL)

    2014-06-02

    Jun 2, 2014 ... only occurred in 76 patients (25.7%); acute urinary retention was seen in 106 patients (35.7%). Chronic ... prostatic hyperplasia (BPH) is a common problem in the ... of the drugs, open prostatectomy or transurethral resection .... Storage LUTS. 37 ... there was paucity of data about prostatectomy specimen.

  14. Occurrence of Exercise Dependence in a College-Aged Population

    Science.gov (United States)

    Garman, J. F.; Hayduk, D.M.; Crider, D. A.; Hodel, M. M.

    2004-01-01

    Students (n = 257) were evaluated for scope and commitment to physical activity by use of self-reported data that assessed amount of activity per week and the obligatory or pathological nature of their activity patterns. Exhibiting atypical activity patterns, 21.8% of the students in the sample exercised 360 or more minutes per week and…

  15. Measurement of the differential cross-section for the production of an isolated photon with associated jet in p anti-p collisions at s**(1/2) = 1.96 TeV

    Czech Academy of Sciences Publication Activity Database

    Abazov, V. M.; Abbott, B.; Abolins, M.; Kupčo, Alexander; Lokajíček, Miloš

    2008-01-01

    Roč. 666, č. 5 (2008), s. 435-445 ISSN 0370-2693 R&D Projects: GA MŠk LA08047; GA MŠk 1P05LA257 Institutional research plan: CEZ:AV0Z10100502 Keywords : D0 * Tevatron, * photon Subject RIV: BF - Elementary Particles and High Energy Physics Impact factor: 4.034, year: 2008

  16. ESR and TSL study of hole and electron traps in LuAG:Ce,Mg ceramic scintillator

    Czech Academy of Sciences Publication Activity Database

    Hu, C.; Liu, S.-P.; Fasoli, M.; Vedda, A.; Nikl, Martin; Feng, X. Q.; Pan, Y.B.

    2015-01-01

    Roč. 45, Jul (2015), s. 252-257 ISSN 0925-3467 R&D Projects: GA ČR GAP204/12/0805 Institutional support: RVO:68378271 Keywords : LuAG * scintillator * codoping * Ce3+ * O- center Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 2.183, year: 2015

  17. obesity and systemic hypertension in accra communities

    African Journals Online (AJOL)

    SUMMARY. Thc stildy was carried out to deterninine the preva-. Icncc of obesity associated with systemic hypcr- tcnsion in four comn~unities in Accra. A total of. 598 persons, of \\\\ll~om 257 were Inale and 341 fe- male agcd 15ycar and above werc examined. Their blood prcssurc, weight, and height were measuretl; and liom ...

  18. New Fellows and Honorary Fellow

    Indian Academy of Sciences (India)

    Fellow Profile. Elected: 1975 Section: General Biology. Maitra, Prof. Pabitra Kumar D.Phil. (Calcutta), FNA. Date of birth: 1 November 1932. Date of death: 4 September 2007. Specialization: Biochemistry, Molecular Biology and Genetics Last known address: CJ-257, Salt Lake, Kolkata 700 091. YouTube; Twitter; Facebook ...

  19. Comparison of intraspinal and intrathecal implantation of induced pluripotent stem cell-derived neural precursors for the treatment of spinal cord injury in rats

    Czech Academy of Sciences Publication Activity Database

    Amemori, Takashi; Růžička, Jiří; Romanyuk, Nataliya; Jhanwar-Uniyal, M.; Syková, Eva; Jendelová, Pavla

    2015-01-01

    Roč. 6, Dec (2015), s. 257 ISSN 1757-6512 R&D Projects: GA MŠk(CZ) LH12024 Institutional support: RVO:68378041 Keywords : spinal cord injury * human induced pluripotent stem cells * cell therapy * cell application route Subject RIV: FH - Neurology Impact factor: 4.504, year: 2015

  20. Resonance – Journal of Science Education | News

    Indian Academy of Sciences (India)

    More Details Fulltext PDF. pp 257-258. Author Index · More Details Fulltext PDF. pp 259-264. Subject Index · More Details Fulltext PDF. pp 265-266. Index · More Details Fulltext PDF. pp 267-267 Flowering Trees. Prima Vera · More Details Fulltext PDF. pp 268-268 Featured Scientist. C. V. Raman · More Details Fulltext PDF ...

  1. Study of Laminar Flame 2-D Scalar Values at Various Fuel to Air Ratios Using an Imaging Fourier-Transform Spectrometer and 2-D CFD Analysis

    Science.gov (United States)

    2013-03-01

    Role of flow visualization in the development of UNICORN , Journal of Visualization 2000, Vol. 2, 257-272. [10] Gross, K. C.; Tremblay, P.; Bradley...NASA- Glenn’s Chemical Equilibrium with Applications (CEA) program. UNICORN CFD predictions were in excellent agreement with CEA calculations at...49 Appendix A – UNICORN CFD Inputs and Instruction .....................................................50 Appendix B – NASA-Glenn

  2. Program DEIMOS32 for gamma-ray spectra evalution

    Czech Academy of Sciences Publication Activity Database

    Frána, Jaroslav

    2003-01-01

    Roč. 257, č. 3 (2003), s. 583-587 ISSN 0236-5731. [International Conference Ko-users Workshop /3./. Bruges, 23.09.2001-28.09.2001] Institutional research plan: CEZ:AV0Z1048901 Keywords : gamma-ray spectra * software Subject RIV: BG - Nuclear, Atomic and Molecular Physics, Colliders Impact factor: 0.472, year: 2003

  3. Surabhi Potnis

    Indian Academy of Sciences (India)

    Home; Journals; Resonance – Journal of Science Education. Surabhi Potnis. Articles written in Resonance – Journal of Science Education. Volume 22 Issue 3 March 2017 pp 257-268 General Article. From Carbon to Buckypaper · Surabhi Potnis · More Details Abstract Fulltext PDF. This article aims to highlight the amazing ...

  4. Jazykový purismus v Čechách a v Lužici v poslední třetině 19. a v první třetině 20. století

    Czech Academy of Sciences Publication Activity Database

    Brankatschk, Katja; Martínek, František; Futtera, Ladislav

    2017-01-01

    Roč. 100, č. 4 (2017), s. 243-257 ISSN 0027-8203 R&D Projects: GA ČR GA16-10866S Institutional support: RVO:68378017 Keywords : Czech * Sorbian * national revival * purism * standardisation Subject RIV: AI - Linguistics OBOR OECD: Specific languages

  5. Teachers' Teaching Experience and Students' Learning Outcomes in Secondary Schools in Ondo State, Nigeria

    Science.gov (United States)

    Adeyemi, T. O.

    2008-01-01

    This article examined teachers' teaching experience and students' learning outcomes in the secondary schools in Ondo State Nigeria. As a correlational survey, the study population comprised all the 257 secondary schools in the State. This population was made up of 147 rural schools and 110 urban schools. It was also made up of 12 single sex…

  6. Issues of Anger in the Workplace: Do Gender and Gender Role Matter?

    Science.gov (United States)

    Gianakos, Irene

    2002-01-01

    To examine the influence of gender and gender role on anger experiences in the workplace, 257 adult students completed narratives describing their anger-provoking issues and anger expression. Analyses revealed that gender did not influence the types of issues cited or workers' anger expressions. (Contains 39 references and an appendix.) (GCP)

  7. High-E.sub.T./sub. isolated-photon plus jets production in pp collisions at √s = 8 TeV with the ATLAS detector

    Czech Academy of Sciences Publication Activity Database

    Aaboud, M.; Aad, G.; Abbott, B.; Chudoba, Jiří; Havránek, Miroslav; Hejbal, Jiří; Hladík, Ondřej; Jakoubek, Tomáš; Kepka, Oldřich; Kupčo, Alexander; Kůs, Vlastimil; Lokajíček, Miloš; Lysák, Roman; Marčišovský, Michal; Mikeštíková, Marcela; Němeček, Stanislav; Penc, Ondřej; Šícho, Petr; Staroba, Pavel; Svatoš, Michal; Taševský, Marek; Vrba, Václav

    2017-01-01

    Roč. 918, May (2017), s. 257-316 ISSN 0550-3213 Institutional support: RVO:68378271 Keywords : ATLAS * CERN LHC Coll * experimental results * 8000 GeV-cms Subject RIV: BF - Elementary Particles and High Energy Physics OBOR OECD: Particles and field physics Impact factor: 3.678, year: 2016

  8. Magnetoelasticity of UNi.sub.2./sub.Si.sub.2./sub..

    Czech Academy of Sciences Publication Activity Database

    Honda, F.; Oomi, G.; Andreev, Alexander V.; Sechovský, V.; Menovsky, A. A.

    259-261, - (1999), s. 256-257 ISSN 0921-4526 R&D Projects: GA AV ČR IAA1010614 Grant - others:GA UK(CZ) 40/97 Institutional research plan: CEZ:AV0Z1010914 Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 0.725, year: 1999

  9. The pig as an experimental model for clinical craniofacial research

    Czech Academy of Sciences Publication Activity Database

    Štembírek, Jan; Kyllar, M.; Putnová, I.; Stehlík, L.; Buchtová, Marcela

    2012-01-01

    Roč. 46, č. 4 (2012), s. 269-279 ISSN 0023-6772 R&D Projects: GA ČR(CZ) GP304/08/P289 Institutional research plan: CEZ:AV0Z50450515 Keywords : platelet rich plasma * streptococcus suis serotype 2 * implant surface coatings Subject RIV: EG - Zoology Impact factor: 1.257, year: 2012

  10. Candidate gene linkage approach to identify DNA variants that predispose to preterm birth

    DEFF Research Database (Denmark)

    Bream, Elise N A; Leppellere, Cara R; Cooper, Margaret E

    2013-01-01

    Background:The aim of this study was to identify genetic variants contributing to preterm birth (PTB) using a linkage candidate gene approach.Methods:We studied 99 single-nucleotide polymorphisms (SNPs) for 33 genes in 257 families with PTBs segregating. Nonparametric and parametric analyses were...... through the infant and/or the mother in the etiology of PTB....

  11. Pramana – Journal of Physics | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    From P T -symmetric quantum mechanics to conformal field theory · Patrick Dorey Clare Dunning ... pp 251-257. Statistical features of quantum evolution · Sudhir R ... Sturm–Schrödinger equations: Formula for metric · Miloslav Znojil Hendrik B ...

  12. Synthesis of Highly Symmetrical Triptycene Tetra- and Hexacarboxylates

    Czech Academy of Sciences Publication Activity Database

    Rybáčková, Markéta; Bělohradský, Martin; Holý, Petr; Pohl, Radek; Dekoj, Václav; Závada, Jiří

    -, č. 10 (2007), s. 1554-1558 ISSN 0039-7881 R&D Projects: GA ČR GA203/03/0087 Institutional research plan: CEZ:AV0Z40550506 Keywords : carboxylic acids * Diels - Alder reaction s * oxidations * triptycenes * arynes Subject RIV: CC - Organic Chemistry Impact factor: 2.257, year: 2007

  13. Eating attitudes, body image satisfaction and self-esteem of South ...

    African Journals Online (AJOL)

    BMI was positively associated with self-esteem (p = 0.01, r = 0.134) and negatively with dieting behaviour in White boys (p = 0.004, r = −0.257), and with lower EAT-26 bulimic and oral control scores in Black boys. In conclusion, the findings highlight ethnic differences and a need to better understand cultural differences that ...

  14. The Self-Esteem, Perceived Social Support and Hopelessness in Adolescents: The Structural Equation Modeling

    Science.gov (United States)

    Savi Cakar, Firdevs; Karatas, Zeynep

    2012-01-01

    In this study, a developed model to explain a causal relationship between adolescent's self-esteem, perceived social support and hopelessness is tested. The purpose of the study is to explore the relationship between self-esteem, perceived social support and hopelessness in adolescents. A total of 257 adolescents, including 143 female and 114…

  15. Data of evolutionary structure change: 1AJ8B-1IOMA [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1AJ8B-1IOMA 1AJ8 1IOM B A LAKGLEDVYIDQTNICYIDGKEGKLYYRGYSVEELAELS...>GLY CA 362 ASP CA 307 LYS CA 257 1IOM... A 1IOMA EKLARLVAEKHGHS ARG CA 182 1IOM A 1IOM... 2.0784668922424316 2 1IOM

  16. Posouzení vlivu simulovaného poškození listové plochy na výnos a kvalitu cukrovky

    Czech Academy of Sciences Publication Activity Database

    Cerkal, R.; Dvořák, J.; Kamler, Jiří; Hřivna, L.

    2006-01-01

    Roč. 122, 9-10 (2006), s. 257-261 ISSN 1210-3306 R&D Projects: GA MZe QF4192 Institutional research plan: CEZ:AV0Z60930519 Keywords : sugar beet Subject RIV: GF - Plant Pathology, Vermin, Weed, Plant Protection Impact factor: 0.078, year: 2004

  17. Download this PDF file

    African Journals Online (AJOL)

    GEORGE

    Department of Urban and Regional Planning, Abia State Polytechnic Aba, Nigeria. Received 16 ... Squatter development in Southern Aba Region of Nigeria ... respondents was determined from the study population of 125,257 using the Taro Yamane model for .... networks or near industrial areas and market places, and.

  18. Outwards pointing hysteresis operators and asymptotic behaviour of evolution equations

    Czech Academy of Sciences Publication Activity Database

    Klein, O.; Krejčí, Pavel

    2003-01-01

    Roč. 4, č. 5 (2003), s. 755-785 ISSN 1468-1218 Keywords : hysteresis operators * Prandtl-Ishlinskii operator * asymptotic behaviour Subject RIV: BA - General Mathematics Impact factor: 0.257, year: 2003 http://www.wias-berlin.de/preprint/748/wias_preprints_748.pdf

  19. Formal and Informal Employment Growth in Manufacturing (India ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Agent(e) responsable du CRDI. Rodriguez, Mr. Edgard. Financement total. CAD$ 257,300. Pays. Asie du sud, Asie centrale, Extrême-Orient, Bangladesh, Inde. Chargé(e) de projet. Dr. Sandip Sarkar. Institution. Institute for Human Development. Pays d' institution. India. Extrants. Documents. Employment problem in India ...

  20. Reconstruction of Acute Traumatic Tibial Fractures with the Ilizarov ...

    African Journals Online (AJOL)

    The average time for application of the apparatus to fracture healing was 4.3 months. One fracture required autogenous bone graft for union. One patient is undergoing callus transportation for bone replacement. The most common complication was pin tract infection seen in nine (25.7%) patients. Conclusion: We treated 35 ...

  1. Pages 550 - 559.pmd

    African Journals Online (AJOL)

    Administrator

    2 Department of Population Studies, University of Botswana, Private Bag 00705, Gaborone, Botswana ... Methods: The study used cross-sectional data from the Botswana AIDS Impact Survey III on 1,257 men aged 15 years ... is unknown and are having sex with circumcised men. ...... Global HIV prevention working group.

  2. Proceedings – Mathematical Sciences | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    Home; Journals; Proceedings – Mathematical Sciences; Volume 115; Issue 3. Volume 115, Issue 3. August 2005, pages 241-369. pp 241-249. Some Properties of ... with some properties which are mathematically and statistically interesting. pp 251-257. Homeomorphisms and the Homology of Non-Orientable Surfaces.

  3. Proceedings – Mathematical Sciences | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    Home; Journals; Proceedings – Mathematical Sciences. Basudeb Datta. Articles written in Proceedings – Mathematical Sciences. Volume 112 Issue 2 May 2002 pp 257-281. Two-Dimensional Weak Pseudomanifolds on Eight Vertices · Basudeb Datta Nandini Nilakantan · More Details Abstract Fulltext PDF. We explicitly ...

  4. Reliability and Validity of a Prototype Fluid Intake Monitor

    National Research Council Canada - National Science Library

    Tharion, William J; Karis, Anthony J; Hoyt, Reed W

    2009-01-01

    .... There was no difference in mean sip volume measured using the FIM vs. the scale (25.7 + 10.7 ml vs. 25.6 + 8.7 ml, respectively). Field Test Results: of 31 trials, 4 trials under-measured water consumption in excess of 15...

  5. KAPPA: A Package for Synthesis of Optically Thin Spectra for the Non-Maxwellian kappa-distributions Based on the Chianti Database

    Czech Academy of Sciences Publication Activity Database

    Dzifčáková, Elena; Dudík, Jaroslav; Kotrč, Pavel; Fárník, František; Zemanová, Alena

    2015-01-01

    Roč. 217, č. 1 (2015), 14/1-14/14 ISSN 0067-0049 R&D Projects: GA ČR GAP209/12/1652 Institutional support: RVO:67985815 Keywords : numerical method * radiation mechanisms * coronae Subject RIV: BN - Astronomy, Celestial Mechanics, Astrophysics Impact factor: 11.257, year: 2015

  6. Jiří George Kukla a velká klimatologie globálních změn

    Czech Academy of Sciences Publication Activity Database

    Cílek, Václav

    2003-01-01

    Roč. 58, č. 9 (2003), s. 257-258 ISSN 1210-258X Institutional research plan: CEZ:AV0Z3013912 Keywords : J. G. Kukla * climatology * ice age Subject RIV: DB - Geology ; Mineralogy http://www.casopis.ochranaprirody.cz/res/ data /004/000514.pdf

  7. Kreslení strukturních vzorců

    Czech Academy of Sciences Publication Activity Database

    Řápková, R.; Holý, P.; Vyskočil, V.; Podešva, Jiří; Drašar, P.

    2018-01-01

    Roč. 112, č. 4 (2018), s. 257-261 ISSN 0009-2770 Institutional support: RVO:61389013 Keywords : chemical structures * recommendations, graphical Subject RIV: CD - Macromolecular Chemistry OBOR OECD: Polymer science Impact factor: 0.387, year: 2016 http://www.chemicke-listy.cz/ojs3/index.php/chemicke-listy/article/ view /3071

  8. Genetic variation within clonal lineages of Phytophthora infestans revealed through genotyping-by-sequencing, and implications for late blight epidemiology

    Science.gov (United States)

    Genotyping-by-sequencing (GBS) was performed on 257 Phytophthora infestans isolates belonging to four clonal lineages to study within-lineage diversity. The four lineages used in the study included US-8 (n=28), US-11 (n=27), US-23 (n=166), and US-24 (n=36), with isolates originating from 23 of the U...

  9. Unit Ministry Team Religious Support to Casualties on the Airland Battlefield

    Science.gov (United States)

    1987-10-28

    Dysentery, Mod 248 Gastrits, Acute 249 Peptic Ulcer, Severe 250 Peptic Ulcer, Mod 251 Regional Ileitis 252 Regional Ileitis, Mod 253 Helminthiasis ...Severe 254 Helminthiasis , Mod 255 Migraine, acute 256 Varicosities, Severe 257 Varicosities, Mod 258 Essential Hypertension 2,)9 Ischemic Heart

  10. Humor and College Adjustment: The Predictive Nature of Humor, Academic Achievement, Authoritative Parenting Styles on the Initial Adjustment of Male and Female First-Year College Students

    Science.gov (United States)

    Hickman, Gregory P.; Andrews, David W.

    2003-01-01

    A self-report questionnaire on academic achievement, birth order, and family structure; the Student Adaptation to College Questionnaire; the Parental Authority Questionnaire; and the Coping Humor Scale were administered to 257 first-year college students. Researchers examined the relationships among (a) authoritative parenting style, (b) family…

  11. 47 CFR 90.238 - Telemetry operations.

    Science.gov (United States)

    2010-10-01

    ... MHz band (as available in the Public Safety Pool for bio-medical telemetry operations). (i) For... with § 90.257 and subject to the rules governing the use of that band). (b) 154.45625, 154.46375, 154...-470 MHz band, telemetry operations will be authorized on a secondary basis with a transmitter output...

  12. Gebed en die vorming van Christelike identiteit in Openbaring

    African Journals Online (AJOL)

    31 Jul 2015 ... 111.3 – Johns 2003). Deur die ... David Aune (2006:107) merk tereg op dat ... Stevenson 1995:257–272). ... sien Stevenson (2001:234). 6. ...... McKinnon, J., 1987, Music in early chrisfian worship, Cambridge University Press,.

  13. Mitogenomic phylogenetics of the bank vole Clethrionomys glareolus, a model system for studying end-glacial colonization of Europe

    Czech Academy of Sciences Publication Activity Database

    Filipi, Karolína; Marková, Silvia; Searle, J. B.; Kotlík, Petr

    2015-01-01

    Roč. 82, PA (2015), s. 245-257 ISSN 1055-7903 R&D Projects: GA ČR GAP506/11/1872 Institutional support: RVO:67985904 Keywords : adaptation * glacial refugia * mitogenome * mtDNA * Myodes glareolus * Numt Subject RIV: EG - Zoology Impact factor: 3.792, year: 2015

  14. The Effects of Hydrodynamic Stretch on the Flame Propagation Enhancement of Ethylene by Addition of Ozone

    Science.gov (United States)

    2015-07-13

    dimensional simulations were performed using the unsteady ignition and combustion with reactions ( UNICORN ) model [28,33–36]. UNICORN only requires the inflow...Katta VR. 1998 Role of flow visualization in the development of UNICORN . J. Vis. 2, 257–272. (doi:10.1007/BF03181442) 34. Katta VR, Goss LP, Roquemore WM

  15. Asmare * Moges Abey **

    African Journals Online (AJOL)

    dell

    little or no significant behavioral change. This research is further aimed to bridge this gap. Concerning .... Posters. No. 63. 10. 4. 5. 82. 53.9. As it can be seen in table 4, the most widely used .... words only 25.7% of the respondents take in to ...

  16. Effect of nifedipine, imipramine and sertraline on the antidepressant ...

    African Journals Online (AJOL)

    DR ORIAFOH

    2012-06-28

    Jun 28, 2012 ... Ann. Nuclear Med. 11(3): 213-218. Kozisek ME, Middlemas D, Bylund DB (2008). The differential regulation of BDNF and TrkB levels in juvenile rats after four days of escitalopram and desipramine treatment. Neuropharmacol. 54(2):. 251-257. Kreydiyyeh SI (2000). Cyclic AMP and furosemide stimulate the ...

  17. Differences in the Morale of Older, Rural Widows and Widowers.

    Science.gov (United States)

    Scott, Jean Pearson; Kivett, Vira R.

    1985-01-01

    Examined effect of sex differences on morale of 257 older rural widows and widowers. Sex of respondent was not found to affect morale; however, perceived financial status and self-rated health had significant direct effects. Widows and widowers reporting higher morale had higher perceived financial status and rated their health as good.…

  18. University Students' Views of a Public Service Graduation Requirement

    Science.gov (United States)

    Moely, Barbara E.; Ilustre, Vincent

    2011-01-01

    As New Orleans began to rebuild after Hurricane Katrina, Tulane University also began its recovery process. A new initiative in the recovery was the establishment of a public service graduation requirement for undergraduate students. Attitudes toward the requirement were assessed for 290 first-year and 257 advanced students in fall 2006. The…

  19. Transfer to hospital in planned home births

    DEFF Research Database (Denmark)

    Blix, Ellen; Kumle, Merethe; Kjærgaard, Hanne

    2014-01-01

    was chosen. RESULTS: Fifteen studies were eligible for inclusion, containing data from 215,257 women. The total proportion of transfer from home to hospital varied from 9.9% to 31.9% across the studies. The most common indication for transfer was labour dystocia, occurring in 5.1% to 9.8% of all women...

  20. Levels of Satisfaction with Leisure Time in Foreign Students

    Science.gov (United States)

    Akdeniz, Hakan; Simsek, Sinem Didem; Kavi, Onur; Uzuner, Muhammet Eyup; Sekban, Gulsah

    2018-01-01

    The aim of this study was to investigate levels of satisfaction with leisure time in foreign students of Kocaeli University. In the collection of the data, the Leisure Satisfaction Scale (LSS) and demographic status questionnaire were used; 257 male and 103 female students participated. In the LSS scores for the separate domains, participants…

  1. Skill/Knowledge Commonalities in Selected Electronics Specialties.

    Science.gov (United States)

    1986-10-01

    Maintenance Specialist 241 19 30750 Telecomunications Systems Control Specialist 498 35 30950A Missile Det and Warning Radar Specialistc 18 30 309506... Telecomunications Systems Control Specialist 59 ( 5) 125 (10) 259 (21) :. aNumbers in parenthesis are percentage of total possible (1,257). bBased on principles

  2. Download this PDF file

    African Journals Online (AJOL)

    Uwaifoh

    2012-04-30

    Apr 30, 2012 ... ... by their reduced palatability, diet-induced anorexia, or systemic toxicity as reported by .... papaya (L.) in renal and DOCA-induced hypertension in the rat. ... International Journal of Crude Drug Research, 28(4): 257-266.

  3. EST Table: FS871051 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available aa ref|NP_001139536.1| mortality factor 4-like [Bombyx mori] gb|ABJ99463.1| mrg15-like protein [Bombyx mori...FS871051 E_FL_fner_44F14_R_0 11/12/09 GO hit GO:0005634(nucleus) 10/09/28 100 %/257

  4. 40 CFR 51.121 - Findings and requirements for submission of State implementation plan revisions relating to...

    Science.gov (United States)

    2010-07-01

    ... Carolina, Ohio, Pennsylvania, Rhode Island, South Carolina, Tennessee, Virginia, West Virginia, and the...,406 New Jersey 96,876 New York 240,322 North Carolina 165,306 Ohio 249,541 Pennsylvania 257,928 Rhode..., Russell, St. Clair, Shelby, Sumter, Talladega, Tallapoosa, Tuscaloosa, Walker, and Winston. (C) [Reserved...

  5. 75 FR 78029 - Endangered and Threatened Wildlife and Plants; 12-Month Finding on a Petition To List the North...

    Science.gov (United States)

    2010-12-14

    ... Pearson 1972, pp. 254-257). Litters are born from mid-February through March, containing one to five kits... several reasons. Wolverines tend to live in remote and inhospitable places away from human populations... human population density and the lack of suitable habitat suggests that wolverines did not exist in this...

  6. Differences in Students' School Motivation: A Latent Class Modelling Approach

    Science.gov (United States)

    Korpershoek, Hanke; Kuyper, Hans; van der Werf, Greetje

    2015-01-01

    In this study, we investigated the school motivation of 7,257 9th grade students in 80 secondary schools across the Netherlands. Using a multiple goal perspective, four motivation dimensions were included: performance, mastery, extrinsic, and social motivation. Our first aim was to identify distinct motivation profiles within our sample, using the…

  7. Anxiety and Depression in Breast Cancer Survivors of Different Sexual Orientations

    Science.gov (United States)

    Boehmer, Ulrike; Glickman, Mark; Winter, Michael

    2012-01-01

    Objective: We conducted a study comparing anxiety and depression by sexual orientation in long-term breast cancer survivors, testing the hypothesis that sexual minority women (e.g., lesbian and bisexual women) have greater levels of anxiety and depression. Method: From a state cancer registry, we recruited 257 heterosexual and 69 sexual minority…

  8. Mesoporous molecular sieves as advanced supports for olefin metathesis catalysts

    Czech Academy of Sciences Publication Activity Database

    Balcar, Hynek; Čejka, Jiří

    2013-01-01

    Roč. 257, 21-22 (2013), s. 3107-3124 ISSN 0010-8545 R&D Projects: GA AV ČR IAA400400805; GA ČR GBP106/12/G015 Institutional support: RVO:61388955 Keywords : Olefin metathesis * mesoporous molecular sieves * Heterogeneous catalysts Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 12.098, year: 2013

  9. Ruth Benedictová v Československu (léto 1948)

    Czech Academy of Sciences Publication Activity Database

    Kubáčková, Patricie

    2015-01-01

    Roč. 102, č. 3 (2015), s. 257-279 ISSN 0009-0794 Institutional support: RVO:68378092 Keywords : Ruth Benedict * UNESCO seminary in Poděbrady in 1948 * method of the research of national character at a distance Subject RIV: AI - Linguistics

  10. Bivariate and Multivariate Associations between Trait Listening Goals and Trait Communicator Preferences

    Science.gov (United States)

    Keaton, Shaughan A.; Keteyian, Robert V.; Bodie, Graham D.

    2014-01-01

    This article provides validity evidence for a measure of listening goals by showing theoretically consistent relationships with an existing communication preference questionnaire. Participants (N = 257) were administered trait measures for listening goals and communicator preferences. The four listening goals--relational, task-oriented,…

  11. Search Results | Page 9 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Results 81 - 90 of 257 ... Home; West Indies ... Middle East 261 Apply Middle East filter · United Kingdom 108 Apply .... and monitors the progress made by different countries over time, as well as ... This supplement contains working papers distributed prior to the ... related to small-scale fisheries and coastal management in th.

  12. The Predictive Nature of Humor, Authoritative Parenting Style, and Academic Achievement on Indices of Initial Adjustment and Commitment to College among College Freshmen

    Science.gov (United States)

    Hickman, Gregory P.; Crossland, Garnet L.

    2004-01-01

    Through the administration of self-report surveys, this study examined the relationships among a) parenting styles, b) family structure, c) academic achievement, d) birth order, e) gender, and f) humor on the initial personal-emotional, social, academic, and commitment to college adjustment among 257 first-quarter college freshmen. Multiple…

  13. A Randomized Trial of a Multifaceted Intervention to Reduce Falls among Community-Dwelling Adults

    Science.gov (United States)

    Fox, Patrick J.; Vazquez, Laurie; Tonner, Chris; Stevens, Judy A.; Fineman, Norman; Ross, Leslie K.

    2010-01-01

    Using a randomized controlled trial, we tested the efficacy of a fall prevention intervention to reduce falls among adults in a community-based health promotion program. Adults aged 65 and older within two counties were recruited (control n = 257; intervention n = 286). After 12 months, there was a significant decrease in the number of falls in…

  14. Geomorphological research of large-scale slope instability at Machu Picchu, Peru

    Czech Academy of Sciences Publication Activity Database

    Vilímek, V.; Zvelebil, J.; Klimeš, Jan; Patzelt, Z.; Astete, F.V.; Kachlík, F.; Hartvich, Filip

    2007-01-01

    Roč. 89, č. 3-4 (2007), s. 241-257 ISSN 0169-555X Institutional research plan: CEZ:AV0Z30460519 Keywords : natural hazard * Machu Picchu * landslides Subject RIV: DB - Geology ; Mineralogy Impact factor: 1.854, year: 2007 www.elsevier.com/locate/geomorphology

  15. Energy transfer processes in Ca.sub.3./sub.Tb.sub.2-x./sub.Eu.sub.x./sub.Si.sub.3./sub.O.sub.12./sub. (x = 0–2)

    Czech Academy of Sciences Publication Activity Database

    Carrasco, I.; Bartosiewicz, Karol; Nikl, Martin; Piccinelli, F.; Bettinelli, M.

    2015-01-01

    Roč. 48, Oct (2015), s. 252-257 ISSN 0925-3467 EU Projects: European Commission(XE) 316906 - LUMINET Institutional support: RVO:68378271 Keywords : phosphors * silico-carnotite * luminescence * energy transfer Subject RIV: BH - Optics, Masers, Lasers Impact factor: 2.183, year: 2015

  16. Germination, growth and physiological responses of Senegalia ...

    African Journals Online (AJOL)

    For plants growth and physiological responses, seedlings were individually cultivated in plastic bags (25×12 cm) containing non-sterile soil and watered with four salt solutions (0, 86, 171 and 257 mM NaCl). Four months after the plants' cultivation, the results showed that for all species, the salinity reduced significantly the ...

  17. Search Results | Page 4 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Results 31 - 40 of 257 ... ... and social development filter · RESEARCH NETWORKS 9 Apply ... While many private companies have made strides in building ... This presentation defines open data, and shares examples of potential social and economic benefits. ... and diversity on small holder farms to school feeding programs.

  18. Search Results | Page 7 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Results 61 - 70 of 257 ... Extraterritorial investments, environmental crisis, and collective action in ... The second cohort of the Open Data Leaders Network convened at the ... This presentation defines open data, and shares examples of potential social and economic benefits. ... Capacity building Evaluation COMMUNICATION ...

  19. Journal of Chemical Sciences | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    Author Affiliations. Romina A Frenzel1 Gustavo P Romanelli1 Mirta N Blanco1 Luis R Piz1. Centro de Investigación y Desarrollo en Ciencias Aplicadas ``Dr. Jorge J. Ronco” (CINDECA), CCT-LaPlata-CONICET, Facultad de Ciencias Exactas, Universidad Nacional de La Plata, 47 N° 257 (B1900AJK) La Plata, Argentina ...

  20. Note on the distribution of Garveia franciscana (Torrey, 1902) and Cordylophora caspia (Pallas, 1771) in the Netherlands

    NARCIS (Netherlands)

    Vervoort, W.

    1964-01-01

    INTRODUCTION In 1956 Kinne (1956, p. 257) published the description of a new athecate hydroid, Perigonimus megas, discovered by him in the Nordostseekanal, a canal connecting the North Sea with the Baltic. Kinne's new species resembles a well known and widely distributed fresh- and brackish-water

  1. Determination of total sulfur in agricultural samples by high-resolution continuum source flame molecular absorption spectrometry.

    Science.gov (United States)

    Virgilio, Alex; Raposo, Jorge L; Cardoso, Arnaldo A; Nóbrega, Joaquim A; Gomes Neto, José A

    2011-03-23

    The usefulness of molecular absorption was investigated for the determination of total sulfur (S) in agricultural samples by high-resolution continuum source flame molecular absorption spectrometry. The lines for CS at 257.595, 257.958, and 258.056 nm and for SH at 323.658, 324.064, and 327.990 nm were evaluated. Figures of merit, such as linear dynamic range, sensitivity, linear correlation, characteristic concentration, limit of detection, and precision, were established. For selected CS lines, wavelength-integrated absorbance equivalent to 3 pixels, analytical curves in the 100-2500 mg L(-1) (257.595 nm), 250-2000 mg L(-1) (257.958 nm), and 250-5000 mg L(-1) (258.056 nm) ranges with a linear correlation coefficient better than 0.9980 were obtained. Results were in agreement at a 95% confidence level (paired t test) with those obtained by gravimetry. Recoveries of S in fungicide and fertilizer samples were within the 84-109% range, and the relative standard deviation (n=12) was typically <5%.

  2. Why Did This Happen to Me? Cognitive Schema Disruption and Posttraumatic Stress Disorder in Victims of Sexual Trauma

    Science.gov (United States)

    Wright, Caroline Vaile; Collinsworth, Linda L.; Fitzgerald, Louise F.

    2010-01-01

    Many trauma researchers have proposed cognitive schemas as a heuristic device to understand the elusive process of integrating traumatic events. We examined the schemas of a sample (N = 257) of female participants classified by exposure to sexual trauma, nonsexual trauma, and no trauma experience. Cognitive schema was assessed with the Traumatic…

  3. Effect of prolonged exposure to sublethal concentrations of DDT and DDE on protein expression in human pancreatic beta cells

    Czech Academy of Sciences Publication Activity Database

    Pavlíková, N.; Smetana, P.; Halada, Petr; Kovář, J.

    2015-01-01

    Roč. 142, OCT 2015 (2015), s. 257-263 ISSN 0013-9351 Grant - others:OPPK(CZ) CZ.2.16/3.1.00/24023 Source of funding: O - operačné programy Keywords : Diabetes * DDT/E * Alpha-enolase Subject RIV: CE - Biochemistry Impact factor: 3.088, year: 2015

  4. GMES Sentinel-1 Analysis of Marine Applications Potential (AMAP)

    Science.gov (United States)

    2008-10-01

    Synthetic Aperture Radar (EUSAR 2008), 2 to 5 June 2008, Friedrichshafen, Germany. Vol. 1, 179-182. VDE Verlag, Berlin, ISBN 978-3-8007-3084-1...European Conference on Synthetic Aperture Radar (EUSAR 2008), on CD-ROM. 2 to 5 June 2008, Friedrichshafen, Germany. Vol. 2, 257-260. VDE Verlag

  5. Does Burnout Begin with Student-Teaching? Analyzing Efficacy, Burnout, and Support during the Student-Teaching Semester

    Science.gov (United States)

    Fives, Helenrose; Hamman, Doug; Olivarez, Arturo

    2007-01-01

    The burnout process may begin as early as the student-teaching experience [Gold, Y., 1985. Does teacher burnout begin with student teaching? "Education", 105, 254-257]. Data from 49 student-teachers in the southwest United States were gathered twice during their student-teaching practicum. Data assessing teacher efficacy, teacher…

  6. HlyA knock out yields a safer Escherichia coli A0 34/86 variant with unaffected colonization capacity in piglets

    Czech Academy of Sciences Publication Activity Database

    Sheshko, Valeria; Hejnová, Jana; Řeháková, Z.; Šinkora, J.; Faldyna, M.; Alexa, P.; Felsberg, Jürgen; Němcová, R.; Bomba, A.; Šebo, Peter

    2006-01-01

    Roč. 48, - (2006), s. 257-266 ISSN 0928-8244 R&D Projects: GA ČR GA523/03/0186 EU Projects: European Commission(XE) 503240 - MUVAPRED Institutional research plan: CEZ:AV0Z50200510 Keywords : escherichia coli * haemolysin * colonization Subject RIV: EE - Microbiology, Virology Impact factor: 2.281, year: 2006

  7. Functioning Before and After Total Hip or Knee Arthroplasty

    NARCIS (Netherlands)

    I.B. de Groot (Ingrid)

    2009-01-01

    textabstractOsteoarthritis (OA) of the hip or knee is a common locomotor disease characterized by degradation of articular cartilage. In the Netherlands, in the year 2000 about 257,400 persons above the age of 55 years had hip OA and about 335,700 persons had knee OA. Because the prevalence of OA

  8. Prediction of Improved Performance of Catalytic Hydrogenation Reactor by Periodic Modulation of the Feed Rate

    Czech Academy of Sciences Publication Activity Database

    Staněk, Vladimír; Hanika, Jiří; Jiřičný, Vladimír; Stavárek, Petr; Tukač, V.; Lederer, J.

    2009-01-01

    Roč. 23, č. 3 (2009), s. 251-257 ISSN 1451-9372 R&D Projects: GA MPO FT-TA/039 Institutional research plan: CEZ:AV0Z40720504 Keywords : trickle bed * feed modulation * catalytic reactor Subject RIV: CI - Industrial Chemistry, Chemical Engineering

  9. 77 FR 25088 - Extension of the Commission's Rules Regarding Outage Reporting to Interconnected Voice Over...

    Science.gov (United States)

    2012-04-27

    ...: Gregory Intoccia, Special Counsel, Cybersecurity and Communications Reliability Division, Public Safety... public inspection during regular business hours in the FCC Reference Center, Room CY-A257, 445 12th Street SW., Washington, DC 20554, or online at http://transition.fcc.gov/Daily_Releases/Daily_Business...

  10. Towards a genetic architecture of cryptic genetic variation and ...

    Indian Academy of Sciences (India)

    Unknown

    reprinted in this issue as a J. Genet. classic, pages 227–257). IAN DWORKIN* ... In this commentary, I will discuss the context of this work examining the genetic ... mental buffering where development was channelled in one of several ...

  11. Nutritive evaluation of Telfairia occidentalis leaf protein concentrate ...

    African Journals Online (AJOL)

    STORAGESEVER

    2008-08-04

    Aug 4, 2008 ... The details determination of amino acids is as described elsewhere ... photometry (Jenway Ltd, Dunmond, Essex, UK) while phosphorus .... Zinc. 79.6. 21.5. 25.7. Magnesium. 18.1. 2.33. 0.8. Anti-nutrients (mg 100mg-1 DM).

  12. Pukupuku arunachalensis sp. nov. (Coleoptera, Scarabaeidae, Rutelinae) from Arunachal Pradesh, India

    Czech Academy of Sciences Publication Activity Database

    Gupta, D.; Chandra, K.; Bezděk, Aleš

    2017-01-01

    Roč. 2017, č. 257 (2017), s. 1-11 ISSN 2118-9773 Institutional support: RVO:60077344 Keywords : new species * taxonomy * Northeast India Subject RIV: EG - Zoology OBOR OECD: Zoology Impact factor: 0.649, year: 2016 http://www.europeanjournaloftaxonomy.eu/index.php/ejt/issue/view/264

  13. Isoflurane as a solvent for electrochemistry. Electrooxidation study of icosahedral carborane anions in four different solvents

    Czech Academy of Sciences Publication Activity Database

    Wahab, Abdul; Kvapilová, Hana; Klíma, Jiří; Michl, Josef; Ludvík, Jiří

    2013-01-01

    Roč. 689, JAN 2013 (2013), s. 257-261 ISSN 1572-6657 R&D Projects: GA MŠk ME09002; GA ČR GC203/09/J058 Institutional support: RVO:61388955 ; RVO:61388963 Keywords : isoflurane * relative permitivity * icosahedral carborane anions Subject RIV: CG - Electrochemistry Impact factor: 2.871, year: 2013

  14. E-beam and UV induced fabrication of CeO2, Eu2O3 and their mixed oxides with UO2

    Czech Academy of Sciences Publication Activity Database

    Pavelková, T.; Vaněček, V.; Jakubec, Ivo; Čuba, V.

    2016-01-01

    Roč. 124, JUL (2016), s. 252-257 ISSN 0969-806X Institutional support: RVO:61388980 Keywords : E-beam * Nuclear fuels * Radiation synthesis * Cerium(IV) oxide * Europium(III) oxide * Uranium (IV) oxide Subject RIV: CA - Inorganic Chemistry Impact factor: 1.315, year: 2016

  15. 24 CFR 4001.403 - Prohibitions on interested parties in insured mortgage transaction.

    Science.gov (United States)

    2010-04-01

    ... 24 Housing and Urban Development 5 2010-04-01 2010-04-01 false Prohibitions on interested parties... under section 257 of the Act shall not improperly influence or attempt to improperly influence through..., inducement, intimidation, nonpayment for services rendered, or bribery, the development, reporting, result or...

  16. 78 FR 2571 - Special Access for Price Cap Local Exchange Carriers; AT&T Corporation Petition for Rulemaking To...

    Science.gov (United States)

    2013-01-11

    ...., observed sales and purchases). This allows for an analysis that controls for factors that may vary widely... those factors that affect providers' decisions to expand existing networks, e.g., the non-price factors... Street SW., Room CY-A257, Washington, DC 20554. The complete text may be purchased from Best Copy and...

  17. 78 FR 67053 - Special Access for Price Cap Local Exchange Carriers; AT&T Corporation Petition for Rulemaking To...

    Science.gov (United States)

    2013-11-08

    ... characteristics of the purchased service; and (4) other factors that influence the pricing decisions of special..., 445 12th Street SW., Room CY-A257, Washington, DC 20554. The complete text may be purchased from Best... competition and pricing decisions. Under each category, most of which would be collected from Providers, the...

  18. Download this PDF file

    African Journals Online (AJOL)

    FRANK

    Barro, F.I., Mbodji, S., Ndiaye, A. L., Madougou, S., Zerbo, I., Zougmore, F. and Sissoko, G., 2004. European. Photovoltaic Solar Energy Conference and Exhibition, Poster 1AV2.57. Basu, P.K. and Singh, S.N., 1994. Solar Energy Materials and Solar Cells, 33: 317-329. Betser, Y., Ritter, D., Bahir, G., Cohen, S. and Sperling, ...

  19. Contrasting petrogenesis of spatially related carbonatites from Samalpatti and Sevattur, Tamil Nadu, India

    Czech Academy of Sciences Publication Activity Database

    Ackerman, Lukáš; Magna, T.; Rapprich, V.; Upadhyay, D.; Krátký, O.; Čejková, B.; Erban, V.; Kochergina, Y. V.; Hrstka, Tomáš

    284/285, 1 July (2017), s. 257-275 ISSN 0024-4937 Institutional support: RVO:67985831 Keywords : carbonatite * geochemistry * Samalpatti * Sevattur * silicocarbonatite * Sr–Nd–Pb–C–O isotopic systematics Subject RIV: DB - Geology ; Mineralogy OBOR OECD: Geology Impact factor: 3.677, year: 2016

  20. Histopathology of carp (Cyprinus carpio L.) larvae exposed to Cyanobacteria extract

    Czech Academy of Sciences Publication Activity Database

    Palíková, M.; Navrátil, S.; Tichý, F.; Štěrba, F.; Maršálek, Blahoslav; Bláha, L.

    2004-01-01

    Roč. 73, - (2004), s. 253-257 ISSN 0001-7213 R&D Projects: GA AV ČR KSK6005114; GA ČR GP524/01/P027 Institutional research plan: CEZ:AV0Z6005908 Keywords : microcystins * embryo-larval test * liver damage Subject RIV: EF - Botanics Impact factor: 0.449, year: 2004

  1. Effectiveness of a worksite mindfulness-related multi-component health promotion intervention on work engagement and mental health: Results of a randomized controlled trial

    NARCIS (Netherlands)

    Berkel, J. van; Boot, C.R.L.; Proper, K.I.; Bongers, P.M.; Beek, A.J. van der

    2014-01-01

    Objectives: The aim of the present study was to evaluate the effectiveness of a worksite mindfulness-related multicomponent health promotion intervention on work engagement, mental health, need for recovery and mindfulness. Methods: In a randomized controlled trial design, 257 workers of two

  2. Effectiveness of a Worksite Mindfulness-Related Multi-Component Health Promotion Intervention on Work Engagement and Mental Health: Results of a Randomized Controlled Trial

    NARCIS (Netherlands)

    van Berkel, J.; Boot, C.R.L.; Proper, K.I.; Bongers, P.M.; van der Beek, A.J.

    2014-01-01

    Objectives: The aim of the present study was to evaluate the effectiveness of a worksite mindfulness-related multicomponent health promotion intervention on work engagement, mental health, need for recovery and mindfulness. Methods: In a randomized controlled trial design, 257 workers of two

  3. The Relations between the Organizational Happiness and the Organizational Socialization Perceptions of Teachers: The Sample of Physical Education and Sport

    Science.gov (United States)

    Tosten, Rasim; Avci, Yunus Emre; Sahin, Erhan

    2018-01-01

    The main purpose of this research is to examine the relationship between levels of organizational happiness and organizational socialization of physical education and sport teachers. The research is quantitative and correlational model. The population of the research is composed of 257 physical education and sports teachers working in Siirt…

  4. Responses to Children's Media Use in Families with and without Siblings: A Family Development Perspective

    Science.gov (United States)

    Davies, John J.; Gentile, Douglas A.

    2012-01-01

    Drawing on family development theory, this study provides insight into how family stages with and without siblings are related to media habits and effects. Two national samples (N = 527 and N = 1,257) present a cross-sectional snapshot of media uses in families across three stages of family life: families with preschoolers (2-6 years), with…

  5. Detection of ultra-high energy cosmic ray showers with a single-pixel fluorescence telescope

    Czech Academy of Sciences Publication Activity Database

    Fujii, T.; Malacari, M.; Bertaina, M.; Casolino, E.; Dawson, B.; Horváth, P.; Hrabovský, M.; Jiang, J.; Mandát, Dušan; Matalon, A.; Matthews, J.N.; Motloch, P.; Palatka, Miroslav; Pech, Miroslav; Privitera, P.; Schovánek, Petr; Takizawa, Y.; Thomas, S.B.; Trávníček, Petr; Yamazaki, K.

    2016-01-01

    Roč. 74, Feb (2016), s. 64-72 ISSN 0927-6505 R&D Projects: GA MŠk(CZ) LG13007 Institutional support: RVO:68378271 Keywords : ultra-high energy cosmic rays * fluorescence detector * extensive air shower Subject RIV: BF - Elementary Particles and High Energy Physics Impact factor: 3.257, year: 2016

  6. Exploring exercise behavior, intention and habit strength relationships

    NARCIS (Netherlands)

    de Bruijn, G.J.; Rhodes, R.E.

    2011-01-01

    The purpose of this study was to explore the relevance of integrating exercise habit strength within the framework of the theory of planned behavior. Data were obtained from 538 undergraduate students [mean age=21.19 (SD=2.57); 28.4% males] using validated questionnaires and analyzed using

  7. Liposomal formulation of alpha-tocopheryl maleamide: In vitro and in vivo toxicological profile and anticancer effect against spontaneous breast carcinomas in mice

    Czech Academy of Sciences Publication Activity Database

    Turánek, J.; Wang, X. F.; Knötigová, P.; Koudelka, Š.; Dong, L. F.; Vrublová, E.; Mahdavian, E.; Procházka, L.; Sangsura, S.; Vacek, A.; Salvatore, B. A.; Neužil, Jiří

    2009-01-01

    Roč. 237, č. 3 (2009), s. 249-257 ISSN 0041-008X R&D Projects: GA AV ČR KAN200520703; GA AV ČR(CZ) IAA500520602 Institutional research plan: CEZ:AV0Z50520701 Keywords : Liposome * apoptosis * vitamin E analogues Subject RIV: FR - Pharmacology ; Medidal Chemistry Impact factor: 3.359, year: 2009

  8. 78 FR 38227 - Connect America Fund

    Science.gov (United States)

    2013-06-26

    ... and reviewed publicly available data sources to ensure that the particular locations it plans to serve... for public inspection during regular business hours in the FCC Reference Center, Room CY-A257, 445... make broadband-capable networks available to as many unserved locations as possible in those areas. In...

  9. Medical Students' Satisfaction and Academic Performance with Problem-Based Learning in Practice-Based Exercises for Epidemiology and Health Demographics

    Science.gov (United States)

    Jiménez-Mejías, E.; Amezcua-Prieto, C.; Martínez-Ruiz, V.; Olvera-Porcel, M. C.; Jiménez-Moleón, J. J.; Lardelli Claret, P.

    2015-01-01

    The aim of this study was to evaluate the effect of problem-based learning (PBL) on university students' satisfaction with and academic performance in a course on epidemiology and social and demographic health. The participants in this interventional study were 529 students (272 in the intervention group and 257 in the control group) enrolled in a…

  10. International Journal of Natural and Applied Sciences - Vol 7, No 3 ...

    African Journals Online (AJOL)

    Effects of spent engine oil pollution on arable soil of Nekede Mechanic Village Owerri, Nigeria · EMAIL FULL TEXT EMAIL FULL TEXT · DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. AC Udebuani, CI Okoli, H Nwigwe, PTE Ozoh, 257 – 260 ...

  11. Effects of nutrient and water level changes on the composition and size structure of zooplankton communities in shallow lakes under different climatic conditions: a pan-European mesocosm experiment

    Czech Academy of Sciences Publication Activity Database

    Tavşanoglu, Ü.N.; Šorf, Michal; Stefanidis, K.; Brucet, S.; Turkan, S.; Agasild, H.; Baho, D.L.; Scharfenberger, U.; Hejzlar, Josef; Papastergiadou, E.; Adrian, R.; Angeler, D.G.; Zingel, P.; Çakiroglu, A.I.; Ozen, A.; Drakare, S.; Sondergaard, M.; Jeppesen, E.; Beklioglu, M.

    2017-01-01

    Roč. 51, č. 2 (2017), s. 257-273 ISSN 1386-2588 EU Projects: European Commission(XE) 244121 - REFRESH Institutional support: RVO:60077344 Keywords : climate change * water level change * zooplankton * size structure * mesocosms Subject RIV: EH - Ecology, Behaviour OBOR OECD: Ecology Impact factor: 1.500, year: 2016

  12. High-temperature oxidation of silicide-aluminide layer on the TiAl6V4 alloy prepared by liquid-phase siliconizing

    Czech Academy of Sciences Publication Activity Database

    Kubatík, Tomáš František

    2016-01-01

    Roč. 50, č. 2 (2016), s. 257-261 ISSN 1580-2949 Institutional support: RVO:61389021 Keywords : TiAl6V4 * silicides * high-temperature oxidation * liquid-phase silicon izing Subject RIV: JG - Metallurgy Impact factor: 0.436, year: 2016

  13. ORF Alignment: NC_000912 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_000912 gi|13507986 >1txoB 6 236 9 257 6e-28 ... gb|AAB96233.1| protein phoshatase ...iae ... M129] pir||S73911 protein phoshatase 2C homolog ptc1 - ... Mycoplasma pneumoniae (stra... ... ref|NP_109935.1| protein phoshatase 2C homolog; similar ... to Swiss-Prot Accession Number P3518

  14. Acridizinium-Substituted Dendrimers As a New Potential Rewritable Optical Data Storage Material for Blu-ray

    DEFF Research Database (Denmark)

    Lohse, Brian; Vestberg, Robert; Ivanov, Mario T.

    2008-01-01

    A second-generation (acridizinium)12-dendrimer based on a poly(2,2-bis(hydroxymethylpropionic acid)) [bis-MPA] scaffold which can undergo photoinduced (4n + 4n) cycloaddition reactions on exposure to blue-violet light at 405 nm, and be reversed upon irradiation at 257 nm, has been synthesized...

  15. Mechanistic Study of 17 alpha-Ethinylestradiol Biodegradation by Pleurotus ostreatus: Tracking of Extracelullar and Intracelullar Degradation Mechanisms

    Czech Academy of Sciences Publication Activity Database

    Křesinová, Zdena; Moeder, M.; Ezechiáš, Martin; Svobodová, Kateřina; Cajthaml, Tomáš

    2012-01-01

    Roč. 46, č. 24 (2012), s. 13377-13385 ISSN 0013-936X R&D Projects: GA TA ČR TA01020804; GA ČR GAP503/10/0408 Institutional support: RVO:61388971 Keywords : WHITE-ROT FUNGI * ENDOCRINE-DISRUPTING CHEMICALS * PERSONAL CARE PRODUCTS Subject RIV: EE - Microbiology, Virology Impact factor: 5.257, year: 2012

  16. Molecular Studies of HTLV-1 Infection in Newly Recognized High Risk Population

    Science.gov (United States)

    1993-07-10

    members. Members of this community continued to marry close relatives for over the next 150 years. Markers of consanguinity are high among Mashadi...Caribbean region, and relationship to adult T cell leukemia/lymphoma. Int J Cancer 1982;30:257-264. 51. Hattori T, Uchiyama T, Topibana K, Takatsuki K

  17. 77 FR 468 - Revision of the Commission's Program Carriage Rules

    Science.gov (United States)

    2012-01-05

    ... the following methods: Federal eRulemaking Portal: http://www.regulations.gov . Follow the... business hours in the FCC Reference Center, Portals II, 445 12th Street SW., Room CY-A257, Washington, DC... (``NCTA''), Media Access Project, and Public Knowledge filed a joint request to extend the reply comment...

  18. Estimating the community-level impact of the riparian alien species Mimulus guttatus by using a replicated BACI field experiment

    Czech Academy of Sciences Publication Activity Database

    Hejda, Martin; Pyšek, Petr

    2008-01-01

    Roč. 7, - (2008), s. 250-257 ISSN 1619-0033 R&D Projects: GA ČR(CZ) GA206/05/0323 Grant - others:ALARM(XE) GOCE-CT-2003-506675 Institutional research plan: CEZ:AV0Z60050516 Keywords : plant invasions * impact * species diversity Subject RIV: EF - Botanics

  19. Long-term effects of CO2 enrichment on bud phenology and shoot growth patterns of Norway spruce juvenile trees

    Czech Academy of Sciences Publication Activity Database

    Pokorný, Radek; Tomášková, Ivana; Drápelová, I.; Kulhavý, J.; Marek, Michal V.

    2010-01-01

    Roč. 56, č. 6 (2010), s. 251-257 ISSN 1212-4834 R&D Projects: GA AV ČR IAA600870701 Institutional research plan: CEZ:AV0Z60870520 Keywords : bud * elevated CO2 * Norway spruce Subject RIV: EH - Ecology, Behaviour

  20. Optimizing Cognitive Load for Learning from Computer-Based Science Simulations

    Science.gov (United States)

    Lee, Hyunjeong; Plass, Jan L.; Homer, Bruce D.

    2006-01-01

    How can cognitive load in visual displays of computer simulations be optimized? Middle-school chemistry students (N = 257) learned with a simulation of the ideal gas law. Visual complexity was manipulated by separating the display of the simulations in two screens (low complexity) or presenting all information on one screen (high complexity). The…

  1. Differences in pathogenicity among strains of the same or different avian leukosis virus subgroups

    Czech Academy of Sciences Publication Activity Database

    Průková, Dana; Vernerová, Z.; Pilčík, Tomáš; Stepanets, Volodymyr; Indrová, Marie; Geryk, Josef; Plachý, Jiří; Hejnar, Jiří; Svoboda, Jan

    2007-01-01

    Roč. 36, č. 1 (2007), s. 15-27 ISSN 0307-9457 R&D Projects: GA ČR GA523/04/0489 Institutional research plan: CEZ:AV0Z50520514 Keywords : chicken * wasting disease * ALV Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 1.257, year: 2007

  2. Cryoseston of the Pirin Mountains, Bulgaria

    Czech Academy of Sciences Publication Activity Database

    Cepák, Vladislav; Lukavský, Jaromír

    2013-01-01

    Roč. 72, č. 2 (2013), s. 257-268 ISSN 0365-0588 R&D Projects: GA TA ČR TE01020080; GA TA ČR TA03011027 Institutional research plan: CEZ:AV0Z60050516 Keywords : Chlainomonas * Pirin * Bulgaria Subject RIV: EI - Biotechnology ; Bionics Impact factor: 0.449, year: 2013

  3. A multiplex set of microsatellite markers for the scarlet rosefinch (Carpodacus erythrinus)

    Czech Academy of Sciences Publication Activity Database

    Poláková, Radka; Vyskočilová, Martina; Martin, J.-F.; Mays Jr., H. L.; Hill, G. E.; Bryja, Josef; Albrecht, Tomáš

    2007-01-01

    Roč. 7, č. 6 (2007), s. 1375-1378 ISSN 1471-8278 R&D Projects: GA ČR GA206/06/0851 Grant - others:NSF(US) DEB-0077804 Institutional research plan: CEZ:AV0Z60930519 Keywords : Carpodacus * cross-amplification * heterozygosity * microsatellites Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 1.257, year: 2007

  4. Search Results | Page 12 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Results 111 - 120 of 257 ... The human ecological footprint exceeds what the planet can ... people in Latin America (28% of its population) live in poverty. ... This project seeks to empower women as social scientists to increase their visibility and ...

  5. 78 FR 5750 - Data Specifications for Collecting Study Area Boundaries

    Science.gov (United States)

    2013-01-28

    ... regular business hours in the FCC Reference Center, Room CY-A257, 445 12th Street SW., Washington, DC... reforms adopted as part of the USF/ICC Transformation Order, 76 FR 73830, November 29, 2011. In the USF/ICC Transformation Order, the Commission comprehensively reformed universal service funding for high...

  6. 78 FR 26269 - Connect America Fund; High-Cost Universal Service Support

    Science.gov (United States)

    2013-05-06

    ... regular business hours in the FCC Reference Center, Room CY-A257, 445 12th Street SW., Washington, DC...-807A1.pdf . I. Introduction 1. In the USF/ICC Transformation Order, 76 FR 73830, November 29, 2011, the... business, will be placed in individual census blocks, and a network topology will be constructed to serve...

  7. 78 FR 29063 - Survey of Urban Rates for Fixed Voice and Fixed Broadband Residential Services

    Science.gov (United States)

    2013-05-17

    ... the USF/ICC Transformation Order. DATES: Effective May 17, 2013. This Order contains information... public inspection during regular business hours in the FCC Reference Center, Room CY-A257, 445 12th... released the USF/ICC Transformation Order and FNPRM, 76 FR 73830, November 29, 2011, which comprehensively...

  8. 77 FR 1637 - Connect America Fund; Developing an Unified Intercarrier Compensation Regime; Lifeline and Link Up

    Science.gov (United States)

    2012-01-11

    ... public inspection during regular business hours in the FCC Reference Center, Room CY-A257, 445 12th... of the USF/ICC Transformation Order, 76 FR 73830, November 18, 2011. 2. In the USF/ICC Transformation... the USF/ICC Transformation Order, as well as such carriers that had previously obtained ETC...

  9. 76 FR 30605 - Assessment and Collection of Regulatory Fees For Fiscal Year 2011

    Science.gov (United States)

    2011-05-26

    ..., 1999). The Small Business Act contains a definition of ``small-business concern,'' which the RFA incorporates into its own definition of ``small business.'' See 15 U.S.C. 632(a) (``Small Business Act''); 5 U... during normal business hours in the FCC Reference Center, 445 Twelfth Street, SW., Room CY-A257, Portals...

  10. 78 FR 33654 - Reassessment of Exposure to Radiofrequency Electromagnetic Fields Limits and Policies

    Science.gov (United States)

    2013-06-04

    ... available for inspection and copying during normal business hours in the FCC Reference Center (Room CY-A257... and supported statements. I. Notice of Proposed Rulemaking (Further NPRM) A. Definition of Terms... definitions for ``power'' in its RF-exposure related rules, it is proposing explicit and consistent power...

  11. Preparation of Mn-Zn ferrite nanoparticles and their silica-coated clusters: magnetic properties and transverse relaxivity

    Czech Academy of Sciences Publication Activity Database

    Kaman, Ondřej; Kuličková, Jarmila; Herynek, Vít; Koktan, Jakub; Maryško, Miroslav; Dědourková, T.; Knížek, Karel; Jirák, Zdeněk

    2017-01-01

    Roč. 427, Apr (2017), s. 251-257 ISSN 0304-8853 Institutional support: RVO:68378271 ; RVO:68378041 Keywords : magnetic nanoparticles * Mn-Zn ferrite * hydrothermal synthesis * magnetic resonance imaging * transverse relaxivity Subject RIV: BM - Solid Matter Physics ; Magnetism OBOR OECD: Condensed matter physics (including formerly solid state physics, supercond.) Impact factor: 2.630, year: 2016

  12. Effects of melatonin on ischemia and reperfusion injury of the rat heart

    Czech Academy of Sciences Publication Activity Database

    Szárszoi, Ondrej; Asemu, Girma; Vaněček, Jiří; Ošťádal, Bohuslav; Kolář, František

    2001-01-01

    Roč. 15, č. 3 (2001), s. 251-257 ISSN 0920-3206 R&D Projects: GA ČR GA306/98/0470; GA MŠk LN00A069 Institutional research plan: CEZ:AV0Z5011922 Keywords : melatonin * heart * ischemia Subject RIV: ED - Physiology Impact factor: 1.009, year: 2001

  13. Simulation of Seed Digestion by Birds: How Does It Reflect the Real Passage Through a Pigeon's Gut?

    Czech Academy of Sciences Publication Activity Database

    Vazačová, Kristýna; Münzbergová, Zuzana

    2013-01-01

    Roč. 48, č. 2 (2013), s. 257-269 ISSN 1211-9520 R&D Projects: GA ČR GAP505/10/0593 Institutional support: RVO:67985939 Keywords : Canary Islands * endozoochory * scarification Subject RIV: EF - Botanics Impact factor: 1.612, year: 2013

  14. 75 FR 39940 - Notice of Debarment; Schools and Libraries Universal Service Support Mechanism

    Science.gov (United States)

    2010-07-13

    ... business hours at the FCC Reference Information Center, Portal II, 445 12th Street, SW., Room CY-A257... regular business hours at the contractor, Best Copy and Printing, Inc., Portal II, 445 12th Street, SW... civil judgment for attempt or commission of criminal fraud, theft, embezzlement, forgery, bribery...

  15. IL-1β level in Sudanese patients with atherosclerotic coronary heart ...

    African Journals Online (AJOL)

    McRoy

    studies investigating inflammatory cytokines in atherosclerotic patients with coronary heart disease (CHD).[2,5-7]. However, systemic level of IL-1β may still be unreliable marker for atherosclerosis. This is because systemic level of IL-1β could not faithfully reflect the local inflammatory process near the atheromatous lesions.

  16. Making Dutch pupils media conscious: preadolescents' self-assessment of possible media risks and the need for media education

    NARCIS (Netherlands)

    Küter-Luks, Theresa; Heuvelman, A.; Peters, O.

    2011-01-01

    Despite clear European and Dutch policies about media education, there is currently no media education curriculum in Dutch schools. A survey among preadolescents (n = 257) in six primary schools in the Netherlands included questions regarding media access, fears, risks, parental mediation of

  17. Making Dutch Pupils Media Conscious: Preadolescents' Self-Assessment of Possible Media Risks and the Need for Media Education

    Science.gov (United States)

    Kuter-Luks, Theresa; Heuvelman, Ard; Peters, Oscar

    2011-01-01

    Despite clear European and Dutch policies about media education, there is currently no media education curriculum in Dutch schools. A survey among preadolescents (n = 257) in six primary schools in the Netherlands included questions regarding media access, fears, risks, parental mediation of television and the internet, and the need for media…

  18. Aksoy Nigar Yildirim Variational problem with complex co-efficient of ...

    Indian Academy of Sciences (India)

    user1

    Abbaspour Mohammad Hassan see Ghaffarzadeh Ghodrat. 329. Abhyankar Shreeram S. Rees valuations. 525. Agarwal A K. seeAnand S. 23. Aithal A R. On the extrema of Dirichlet's first eigen- value of a family of punctured regular polygons in two dimensional space forms. 257. Aksoy Nigar Yildirim. Variational problem ...

  19. Search Results | Page 3 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Results 21 - 30 of 257 ... Scaling open data for development in Latin America. Latin America is the most unequal region in the world and faces complex development challenges. ... Digital marketplace platforms like AirBnB and Uber, sometimes ...

  20. 75 FR 46885 - Satellite Television Extension and Localism Act of 2010 and Satellite Home Viewer Extension and...

    Science.gov (United States)

    2010-08-04

    ... some point in the future and a prediction from the updated model indicates that the location can..., to ``develop and prescribe by rule a point-to-point predictive model for reliably and presumptively... business hours in the FCC Reference Center (Room CY-A257), 445 12th Street, SW., Washington, DC 20554. The...

  1. Cell Growth Arrest Mediated by STAT Proteins in Breast Cancer Cells

    Science.gov (United States)

    1998-07-01

    Wei, S., Matsusaka, T., Yoshida, K., Sudo, T., Naruto , M., and Kishimoto, T. (1994) Cellll{\\), 63-71 34. David, M., and Larner, A. C. e. a. (1992...T., Naruto , M., and Kishimoto, T. (1994) Cell 77, 63-71 34. David, M., and Lamer, A. C. (1992) Science 257, 813-815 35. Sadowski, H. B., and Gilman

  2. Magnetic phase transitions in ferrimagnetic DyFe.sub.5./sub.Al.sub.7./sub. near the compensation point

    Czech Academy of Sciences Publication Activity Database

    Mushnikov, N. V.; Rozenfeld, E.V.; Gorbunov, Denis; Andreev, Alexander V.

    2014-01-01

    Roč. 115, č. 3 (2014), s. 257-267 ISSN 0031-918X R&D Projects: GA ČR GAP204/12/0150 Institutional support: RVO:68378271 Keywords : rare- earth intermetallic compounds * ferrimagnetism * compensation temperature * magnetic anisotropy * magnetic phase transition Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 0.761, year: 2014

  3. QTL list: ldr1.3 [PGDBj Registered plant list, Marker list, QTL list, Plant DB link and Genome analysis methods[Archive

    Lifescience Database Archive (English)

    Full Text Available QT64344 Cucumis sativus Cucurbitaceae ldr1.3 Mean length:diameter ratio over three... harvests little-leaf (ll) trait (ldr1.3) 1,6 ... LG_01 ... 25.7 4.6 ... 10.1007/s00122-003-1277-1 12827247

  4. Assessing the Quantitative Relationships between Preschool Children's Exposures to Bisphenol A by Route and Urinary Biomonitoring

    Science.gov (United States)

    Limited published information exists on young children’s exposures to bisphenol A (BPA) in the United States using urinary biomonitoring. In a previous project, we quantified the aggregate exposures of 257 preschool children to BPA in environmental and personal media over 48-h pe...

  5. Vocalisations of the silvery mole-rat: comparasion of vocal repertoires in subterrane an rodents with different socials systems

    Czech Academy of Sciences Publication Activity Database

    Knotková, E.; Veitl, S.; Šumbera, R.; Sedláček, František; Burda, H.

    2009-01-01

    Roč. 18, č. 3 (2009), s. 241-257 ISSN 0952-4622 Institutional research plan: CEZ:AV0Z60870520 Keywords : silvery mole-rat * bathyergidae * vocal communication Subject RIV: EG - Zoology Impact factor: 1.050, year: 2009

  6. Empathy without borders? Cross-cultural heart and mind-reading in ...

    African Journals Online (AJOL)

    Background: This cross-cultural study was designed to examine cultural differences in empathy levels of first-year medical students. Methods: A total of 257 students from the academic year 2010/11, 131 at Jimma University, Ethiopia, and 126 at the Ludwig Maximilian University, Munich, Germany, completed the Balanced ...

  7. On the Eulerian formulation of a stress induced platelet activation function

    Czech Academy of Sciences Publication Activity Database

    Bodnár, Tomáš

    2014-01-01

    Roč. 257, November (2014), s. 91-95 ISSN 0025-5564 Institutional support: RVO:61388998 Keywords : blood flow * platelet * stress * activation Subject RIV: BK - Fluid Dynamics Impact factor: 1.303, year: 2014 http://www.sciencedirect.com/science/article/pii/S0025556414001163

  8. Frequency Rates and Correlates of Contrapower Harassment in Higher Education

    Science.gov (United States)

    DeSouza, Eros R.

    2011-01-01

    The current study investigated incivility, sexual harassment, and racial-ethnic harassment simultaneously when the targets were faculty members and the perpetrators were students (i.e., academic contrapower harassment; ACH). The sample constituted 257 faculty members (90% were White and 53% were women) from a medium-sized state university in the…

  9. Journal of Genetics | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    These results suggest that sexual preference may be influenced in a significant proportion of homosexual men by a biological/genetic factor that also controls direction of hair-whorl rotation. pp 257-263 Research Article. Cloning of a novel gene, Cymg1, related to family 2 cystatins and expressed at specific stages of mouse ...

  10. Annual Review of Progress in Applied Computational Electromagnetics (6th), Held in Monterey, California on March 19-22, 1990

    Science.gov (United States)

    1990-01-01

    enhanced by using variable length, width and color. " Contour maps, color or grayscale maps, and hedgehog charts for scalar quantities on any surface. All...a com- munications guardian transputer, and a communications spine . Users currently have a choice of Occam, C, or Fortran. 257 3.2 Five Processor

  11. Performance of commercial laying hen genotypes on free range and organic farms in Switzerland, France and The Netherlands

    NARCIS (Netherlands)

    Leenstra, F.R.; Maurer, V.; Bestman, M.W.P.; Sambeek van, F.; Zeltner, E.; Reuvekamp, B.F.J.; Galea, F.; Niekerk, van T.G.C.M.

    2012-01-01

    1. A total of 257 farmers with free ranging laying hens (organic and conventional) in Switzerland, France and The Netherlands with 273 flocks were interviewed to determine the relationships between the genotype of the hens, management conditions and performance. 2. Almost 20 different genotypes

  12. Complexity in behavioural organization and strongylid infection among wild chimpanzees

    Czech Academy of Sciences Publication Activity Database

    Burgunder, J.; Pafčo, B.; Petrželková, Klára Judita; Modrý, David; Hashimoto, C.; MacIntosh, A. J. J.

    2017-01-01

    Roč. 129, July (2017), s. 257-268 ISSN 0003-3472 Institutional support: RVO:60077344 Keywords : behavioural complexity * chimpanzees * fractal analysis * health monitoring * Pan troglodytes schweinfurthii * strongylid infection Subject RIV: EG - Zoology OBOR OECD: Zoology Impact factor: 2.869, year: 2016

  13. Complexity in behavioural organization and strongylid infection among wild chimpanzees

    Czech Academy of Sciences Publication Activity Database

    Burgunder, J.; Pafčo, B.; Petrželková, Klára Judita; Modrý, D.; Hashimoto, C.; MacIntosh, A. J. J.

    2017-01-01

    Roč. 129, July (2017), s. 257-268 ISSN 0003-3472 Institutional support: RVO:68081766 Keywords : behavioural complexity * chimpanzees * fractal analysis * health monitoring * Pan troglodytes schweinfurthii * strongylid infection Subject RIV: EG - Zoology OBOR OECD: Zoology Impact factor: 2.869, year: 2016

  14. Journal of Genetics | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    pp 223-226 Commentary on J. Genet. Classic. Towards a genetic architecture of cryptic genetic variation and genetic assimilation: the contribution of K. G. Bateman · Ian Dworkin · More Details Fulltext PDF. pp 227-257 J. Genet. Classic. The Genetic Assimilation of Four Venation Phenocopies (Published on 1959 J. Genet.

  15. 7 CFR 1726.27 - Contractor's bonds.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 11 2010-01-01 2010-01-01 false Contractor's bonds. 1726.27 Section 1726.27... AGRICULTURE ELECTRIC SYSTEM CONSTRUCTION POLICIES AND PROCEDURES General § 1726.27 Contractor's bonds. (a) RUS Form 168b, Contractor's Bond, shall be used when a contractor's bond is required by RUS Forms 200, 257...

  16. The religious lives of students at a South African university

    African Journals Online (AJOL)

    2016-04-08

    Apr 8, 2016 ... homosexual people (Altemeyer & Hunsberger 1992). Other .... Furthermore, results show that this scale represents a reliable measure ... services on the radio or television, taking part in religious or rituals and fasting ...... African Americans', Journal of Psychology and Theology 33(4), 251–257. Van Breda ...

  17. Strong overtones and combination bands in ultraviolet resonance Raman spectroscopy

    NARCIS (Netherlands)

    Efremov, E.V.; Ariese, F.; Mank, A.J.G.; Gooijer, C.

    2006-01-01

    Ultraviolet resonance Raman spectroscopy is carried out using a continuous wave frequency-doubled argon ion laser operated at 229, 244, and 257 nm in order to characterize the overtones and combination bands for several classes of organic compounds in liquid solutions. Contrary to what is generally

  18. Search Results | Page 24 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Results 231 - 240 of 257 ... Even where quota systems are in place, there has been slow progress in increasing women''s leadership in formal politics, suggesting that a range of ... Results show the power of agroecological practices to improve livelihoods and food security, limited by situations where most agroecological ...

  19. Different responses of soybean cyst nematode resistance between ...

    Indian Academy of Sciences (India)

    2016-12-02

    Dec 2, 2016 ... 3Crop Research Institute, Shandong Academy of Agricultural Sciences, Jinan, Shandong 250100, People's Republic of ... SCN race 1 (HG types 2.5.7), while 7605 is highly susceptible. ... nomical and environmental friendly method to control ..... analysis and qualitative mapping of a major partial-resistance.

  20. Temporal and spatial variations in particulate matter, particulate organic carbon and attenuation coefficient in Cochin Backwaters

    Digital Repository Service at National Institute of Oceanography (India)

    Devi, K.S.

    Nine stations over a stretch of 21 km of Periyar river estuary were sampled during January to December 1981. Particulate matter varied from 3-253 mg.1 super(1) at the surface and 24.8-257mg.1 super(1) at the bottom. Particulate organic carbon ranged...

  1. Prevalence of Sexual Activity and Outcome among Female ...

    African Journals Online (AJOL)

    Sexual activity among 534 Nigerian female secondary school students was studied using self-administered questionnaire. Prevalence of sexual intercourse was 25.7%. There was no significant difference between the junior (48.2%) and senior (51.8%) students (p > 0.05). Seventeen (12.4%) students had initiated sexual ...

  2. Thermal stability of alumina thin films containing γ-Al.sub.2./sub.O.sub.3./sub. phase prepared by reactive magnetron sputtering

    Czech Academy of Sciences Publication Activity Database

    Musil, Jindřich; Blažek, J.; Zeman, P.; Prokšová, Š.; Šašek, M.; Čerstvý, R.

    2010-01-01

    Roč. 257, č. 3 (2010), s. 1058-1062 ISSN 0169-4332 Institutional research plan: CEZ:AV0Z10100520 Keywords : Al 2 O 3 (alumina) * annealing * thermal stability * nanocrystalline material * sputtering Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 1.795, year: 2010

  3. Nicola Michelassi y Salomé Vuelta García, Il teatro spagnolo a Firenze nel Seicento. Vol. I: Giacinto Andrea Cicognini, Giovan Battista Ricciardi, Pietro Susini, Mattias Maria Bartolommei

    Directory of Open Access Journals (Sweden)

    Diego Símini

    2015-01-01

    Full Text Available Reseña de Nicola Michelassi y Salomé Vuelta García, Il teatro spagnolo a Firenze nel Seicento. Vol. I: Giacinto Andrea Cicognini, Giovan Battista Ricciardi, Pietro Susini, Mattias Maria Bartolommei, Alinea (Secoli d’Oro, 67; Commedia Aurea Spagnola e Pubblico Italiano, VIII, Florencia, 2013, 257 pp. ISBN: 9788860557865.

  4. Voltammetry on Mercury and Carbon Electrodes as a Tool for Studies of Metallothionein Interactions with Metal Ions

    Czech Academy of Sciences Publication Activity Database

    Šestáková, Ivana; Mader, P.

    2000-01-01

    Roč. 46, č. 2 (2000), s. 257-267 ISSN 0145-5680 R&D Projects: GA ČR GV204/97/K084 Institutional research plan: CEZ:AV0Z4040901; CEZ:A54/98:Z4-040-9-ii Subject RIV: CG - Electrochemistry Impact factor: 1.449, year: 2000

  5. Comité Scientifique de la Revue des Sciences et de la Technologie ...

    African Journals Online (AJOL)

    MICROSIM

    Ecological Indicators,1, 261 – 270. [11] Wekbeker G. & Cory G., 1988. Robo nucleotide reductase activity and growth of glutathione depleted mouse leukemia 1210 cells in vitro. Cancer letters, 40, 257 – 264. [12] Bradford M., 1976. A rapid and sensitive method for the quantification of microgram quantities of protein utilizing ...

  6. Komentované fytocenologické snímky z České republiky. 1.

    Czech Academy of Sciences Publication Activity Database

    Dřevojan, P.; Novák, P.; Sádlo, Jiří

    2016-01-01

    Roč. 52, č. 2 (2016), s. 257-267 ISSN 1211-5258 R&D Projects: GA ČR GB14-36079G Institutional support: RVO:67985939 Keywords : plant communities * plant ecology * syntaxonomy Subject RIV: EF - Botanics

  7. Differences in students' school motivation : A latent class modelling approach

    NARCIS (Netherlands)

    Korpershoek, Hanke; Kuyper, Hans; van der Werf, Greetje

    In this study, we investigated the school motivation of 7,257 9th grade students in 80 secondary schools across the Netherlands. Using a multiple goal perspective, four motivation dimensions were included: performance, mastery, extrinsic, and social motivation. Our first aim was to identify distinct

  8. Synthesis, crystal structure and DFT calculations of a new Hg (II) metal-organic polymer

    Czech Academy of Sciences Publication Activity Database

    Mirtamizdoust, B.; Roodsari, M.S.; Shaabani, B.; Dušek, Michal; Fejfarová, Karla

    2016-01-01

    Roč. 15, č. 3 (2016), s. 257-266 ISSN 1024-1221 Grant - others:AV ČR(CZ) Praemium Academiae Institutional support: RVO:68378271 Keywords : mercury (II) iodide * coordination polymer * square planar * tetrahedral geometry * density functional calculation Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 0.565, year: 2016

  9. Chronopotentiometric sensing of anterior gradient 2 protein

    Czech Academy of Sciences Publication Activity Database

    Vargová, Veronika; Hrstka, R.; Hernychová, L.; Coufalová, D.; Ostatná, Veronika

    2017-01-01

    Roč. 240, JUN2017 (2017), s. 250-257 ISSN 0013-4686 R&D Projects: GA ČR(CZ) GA13-00956S Institutional support: RVO:68081707 Keywords : catalyzed hydrogen evolution * mercury -electrodes * affinity tags Subject RIV: CG - Electrochemistry OBOR OECD: Electrochemistry (dry cells, batteries, fuel cells, corrosion metals, electrolysis) Impact factor: 4.798, year: 2016

  10. Is PT -symmetric quantum theory false as a fundamental theory?

    Czech Academy of Sciences Publication Activity Database

    Znojil, Miloslav

    2016-01-01

    Roč. 56, č. 3 (2016), s. 254-257 ISSN 1210-2709 R&D Projects: GA ČR GA16-22945S Institutional support: RVO:61389005 Keywords : quantum mechanics * PT-symmetric representations of observables * masurement outcomes Subject RIV: BE - Theoretical Physics

  11. Surgical decompression for traumatic spinal cord injury in a tertiary ...

    African Journals Online (AJOL)

    The spectrum of injuries included cervical 27 (77.1%), thoracic 7 (20.0%), and lumbar vertebrae 1 (2.9%). The outcome as measured by Frankel's grade at 6 months after surgery showed improvement in 9 (25.7%) patients following intervention. All patients who presented with Frankel's Grade C and D improved to Grade E ...

  12. Journal of Chemical Sciences | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    pp 257-266 Full Papers ... complexes of rhodium - Synthesis, structure and, spectral and electrochemical properties ... pp 267-273 Full Papers ... pp 275-281 Full Papers ... Yuliang Che Hua Yang Hongxiao Jin Chunxin Lu Ziyang Liu ... Excited state dynamics of 9,9'-bianthryl in room temperature ionic liquids as revealed by ...

  13. The Impact of Stressors on Military Performance

    Science.gov (United States)

    2013-12-01

    mechanical (vibration, eyewear , interface with other equipment); physiological (fatigue, sleep deprivation, hypoxia, medical condition...and vibration in Canadian forces armoured vehicles. Industrial Health, 45, 318-327. Nakishima, A., & Cheung, B. (2006). The effects of vibration...environments. International Journal of Industrial Ergonomics, 9, 245-257. Rash, C. E., Hiatt, K. L., Wildzunas, R., Caldwell, J. L., Caldwell, J. A

  14. To Ink or Not to Ink: The Meaning of Tattoos among College Students

    Science.gov (United States)

    Dickson, Lynda; Dukes, Richard L.; Smith, Hilary; Strapko, Noel

    2015-01-01

    We examine the process of getting a tattoo and its meaning among 195 tattooed and 257 non-tattooed undergraduates. Most tattooed respondents contemplate getting a tattoo for months, get a professional tattoo, can cover it easily, and like it. Respondents acquire first tattoos to represent important role transitions and as a form of identity and…

  15. Prevalence and drug resistance in bacteria of the urinary tract ...

    African Journals Online (AJOL)

    Objective: To obtain data on the prevalence of antibiotic resistance in bacteria isolated from patients with suspected urinary tract infection in Bulawayo province, Zimbabwe. Method: Over a period of one year, 257 urine samples were analyzed for bacteria by standard procedures. Antimicrobial susceptibility testing of isolated ...

  16. ORF Alignment: NC_006395 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_006395 gi|55376890 >1v7zA 5 250 13 257 5e-37 ... ref|YP_134741.1| creatinine amido...hydrolase [Haloarcula marismortui ATCC 43049] ... gb|AAV45035.1| creatinine amidohydrolase [Haloarcul

  17. 40 CFR 421.266 - Pretreatment standards for new sources.

    Science.gov (United States)

    2010-07-01

    ... Subcategory Pollutant or pollutant property Maximum for any 1 day Maximum for monthly average mg/troy ounce of... day Maximum for monthly average mg/troy ounce of precious metals, in the granulated raw material... average mg/troy ounce of gold produced by cyanide stripping Copper 4.736 2.257 Cyanide (total) 0.740 0.296...

  18. 40 CFR 421.263 - Effluent limitations guidelines representing the degree of effluent reduction attainable by the...

    Science.gov (United States)

    2010-07-01

    ... for any 1 day Maximum for monthly average mg/troy ounce of precious metals, including silver.../troy ounce of precious metals in the granulated raw material Copper 0.819 0.390 Cyanide (total) 0.128 0... Maximum for monthly average mg/troy ounce of gold produced by cyanide stripping Copper 4.736 2.257 Cyanide...

  19. Factors influencing observed and self-reported functional ability in women with chronic widespread pain: A cross-sectional study

    DEFF Research Database (Denmark)

    Amris, Kirstine; Wæhrens, Eva Ejlersen; Stockmarr, Anders

    2014-01-01

    -sectional with systematic data collection in a clinical setting. Subjects: A total of 257 consecutively enrolled women with chronic widespread pain. Methods: Multidimensional assessment using self-report and observation-based assessment tools identified to cover ICF categories included in the brief ICF Core Set for chronic...

  20. New methodology for capillary electrophoresis with ESI-MS detection: Electrophoretic focusing on inverse electromigration dispersion gradient. High-sensitivity analysis of sulfonamides in waters

    Czech Academy of Sciences Publication Activity Database

    Malá, Zdeňka; Gebauer, Petr; Boček, Petr

    2016-01-01

    Roč. 935, SEP (2016), s. 249-257 ISSN 0003-2670 R&D Projects: GA ČR(CZ) GA16-09135S Institutional support: RVO:68081715 Keywords : electrophoretic focusing * CE-ESI-MS * capillary electrophoresis Subject RIV: CB - Analytical Chemistry, Separation Impact factor: 4.950, year: 2016

  1. Search Results | Page 23 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Results 221 - 230 of 257 ... ... Economic and social development filter · RESEARCH NETWORKS 9 Apply ... Impact of maternal and child health private expenditure on ... Food security radio programme and videos : overview (annex 32 of final technical report) ... of growth media, and adoption of water management strategies, ...

  2. Two-year oscillation cycle in abundance of soybean aphid in Indiana

    Czech Academy of Sciences Publication Activity Database

    Rhainds, M.; Yoo, H. J. S.; Kindlmann, Pavel; Voegtlin, D.; Castillo, D.; Rutledge, C.; Sadof, C.; Yaninek, S.; O'Neil, R. J.

    2010-01-01

    Roč. 12, č. 3 (2010), s. 251-257 ISSN 1461-9555 Institutional research plan: CEZ:AV0Z60870520 Keywords : Aphididae * Aphis glycines * autumn migration * Hemiptera * heteroecy * Rhamnus * seesaw effect * soybean aphid Subject RIV: EH - Ecology, Behaviour Impact factor: 1.484, year: 2010

  3. An Afterschool Program for Economically Disadvantaged Youth: Perceptions of Parents, Staff, and Students

    Science.gov (United States)

    Hall, Katrina W.; Williams, Lunetta M.; Daniel, Larry G.

    2010-01-01

    The present study investigated perceived effects of an afterschool program located in 6 Title 1 schools on students' achievement, self-esteem, and attitudes. Data sources comprised surveys (n = 257), 5 focus groups (n= 23), and an individual interview with the program director (n = 1). Survey data indicated overall satisfaction with the program.…

  4. Photoacoustic Detection of Terahertz Radiation for Chemical Sensing and Imaging Applications

    Science.gov (United States)

    2013-03-01

    ISSN 2229-5518 [39] Jingle Liu, Benjamin Clough, and X. C. Zhang, “Enhancement of photoacoustic emission through terahertz-field driven electron...materials,” Journal of Electroceramics, vol. 2: p. 257-272, 2009. [47] Jingle Liu, Benjamin Clough, and X. C. Zhang, “Enhancement of photoacoustic

  5. 76 FR 58040 - Certain Coaxial Cable Connectors and Components Thereof and Products Containing Same; Notice of...

    Science.gov (United States)

    2011-09-19

    ...://edis.usitc.gov . Hearing-impaired persons are advised that information on this matter can be obtained... Industry, Co., Ltd. and Gem Electronics, Inc. (``the active respondents''), remained active. On October 13... found infringement of the `257 patent by the defaulting respondents and no infringement by the active...

  6. Das Luthertum in Böhmen und seine (Nicht)Reflexion bei den Nuntien am Kaiserhof

    Czech Academy of Sciences Publication Activity Database

    Černušák, Tomáš

    2018-01-01

    Roč. 18, č. 2 (2018), s. 257-267 ISSN 1805-790X Keywords : Nuncius * Papacy * Bohemian lands * Lutheranism Subject RIV: AB - History OBOR OECD: History (history of science and technology to be 6.3, history of specific sciences to be under the respective headings)

  7. 76 FR 72144 - Standardized and Enhanced Disclosure Requirements for Television Broadcast Licensee Public...

    Science.gov (United States)

    2011-11-22

    ... be convenient--during regular business hours. Making the information available online will provide 24... in an online public file to be hosted on the Commission's Web site. DATES: Comments for this... business hours in the FCC Reference Center, Federal Communications Commission, 445 12th Street SW., CY-A257...

  8. Gamma-secretase activity of presenilin 1 regulates acetylcholine muscarinic receptor-mediated signal transduction

    DEFF Research Database (Denmark)

    Popescu, Bogdan O; Cedazo-Minguez, Angel; Benedikz, Eirikur

    2004-01-01

    , we studied the effect of two other FAD PS1 mutants (M146V and L250S) and two dominant negative PS1 mutants (D257A and D385N) on basal and carbachol-stimulated phosphoinositide (PI) hydrolysis and intracellular calcium concentrations ([Ca2+]i) in SH-SY5Y neuroblastoma cells. We found a significant...

  9. Counterinsurgency in the Philippines. Problems and Prospects

    Science.gov (United States)

    1989-10-01

    funds and the farmer-producers in the rural areas are practically begging for start-up funds with which to finance a backyard poultry farm, a cottage...257-70. Burton, Sandra. "Aquino’s Philippines: The Center Holds." Foreign Affairs 65:3 (America and the World 1986): 524-37. Butcher , Scott. U.S

  10. Reaching the superlinear convergence phase of the CG method

    Czech Academy of Sciences Publication Activity Database

    Axelsson, Owe; Karátson, J.

    2014-01-01

    Roč. 260, č. 260 (2014), s. 244-257 ISSN 0377-0427 R&D Projects: GA MŠk ED1.1.00/02.0070 Institutional support: RVO:68145535 Keywords : superlinear convergence * conjugate gradient method * eigenvalues Subject RIV: BA - General Mathematics Impact factor: 1.266, year: 2014 http://www.sciencedirect.com/science/article/pii/S0377042713005451

  11. Zmenšení dynamických účinků na předpjatých mostech

    Czech Academy of Sciences Publication Activity Database

    Frýba, Ladislav

    2005-01-01

    Roč. 14, č. 9 (2005), s. 257-260 ISSN 1210-4027 R&D Projects: GA MDS (CZ) 1F45D/013/120 Institutional research plan: CEZ:AV0Z20710524 Keywords : prestressed bridges * dynamics * prestressed strings Subject RIV: JM - Building Engineering

  12. Apoteóza Sokola, armády a nového člověka: rané recepce Janáčkovy Sinfonietty

    Czech Academy of Sciences Publication Activity Database

    Zapletal, Miloš

    2016-01-01

    Roč. 53, 2/3 (2016), s. 257-287 ISSN 0018-7003 Institutional support: RVO:68378076 Keywords : Leoš Janáček * Sinfonietta * reception of music * Janáček reception * reception studies Subject RIV: AL - Art, Architecture, Cultural Heritage

  13. Gastrointestinal helminths of resident wildlife at the Federal ...

    African Journals Online (AJOL)

    ADEYEYE

    2014-08-12

    Aug 12, 2014 ... 2012) In Nigeria there is still a lacuna of data on the diseases and parasites ... management of zoological exhibits (Hotez et al.,. 2008; Thompson et al., ..... Coimbatore, Zoo's Print Journal, 15(5): 257-. 258. Wenz A, Heymenn ...

  14. Clean Hands Count

    Medline Plus

    Full Text Available ... Gorin 243,451 views 2:57 Hand Hygiene Dance - Duration: 3:15. mohd hafiz 34,146 views ... Language: English Location: United States Restricted Mode: Off History Help Loading... Loading... Loading... About Press Copyright Creators ...

  15. Disorder-induced broadening of transverse acoustic phonons in SixGe1-x mixed crystals

    Czech Academy of Sciences Publication Activity Database

    Beraud, A.; Kulda, Jiří; Yonenaga, I.; Foret, M.; Salce, B.; Courtens, E.

    2004-01-01

    Roč. 350, č. 1 (2004), s. 254-257 ISSN 0921-4526 R&D Projects: GA AV ČR KSK1010104 Keywords : disordered crystals * acoustic branches Subject RIV: BG - Nuclear, Atomic and Molecular Physics, Colliders Impact factor: 0.679, year: 2004

  16. Journal of Earth System Science | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    Home; Journals; Journal of Earth System Science; Volume 113; Issue 2. Volume 113, Issue 2. June 2004, pages 129-257. pp 129-138. The evaporation of the charged and uncharged water drops suspended in a wind tunnel · Rohini V Bhalwankar A B Sathe A K Kamra · More Details Abstract Fulltext PDF. A laboratory ...

  17. Temporal and spatial variations in hydrographic conditions of Mandovi estuary

    Digital Repository Service at National Institute of Oceanography (India)

    Varma, K.K.; Rao, L.V.G.; Cherian, T.

    Nine stations over a stretch of 21 km of Periyar river estuary were sampled during January to December 1981. Particulate matter varied from 3-253 mg.1 super(1) at the surface and 24.8-257mg.1 super(1) at the bottom. Particulate organic carbon ranged...

  18. Browse Title Index

    African Journals Online (AJOL)

    Items 151 - 200 of 257 ... ... of extension advisors on privatization and outsourcing as an option for ... Vol 28 (1999), Small-scale farming and extension in South Africa's ... Vol 37 (2008), Socio-economic determinants of farmers\\' adoption of ...

  19. P Chatterjee

    Indian Academy of Sciences (India)

    Home; Journals; Bulletin of Materials Science. P Chatterjee. Articles written in Bulletin of Materials Science. Volume 25 Issue 3 June 2002 pp 251-257 Experimental Techniques. Voigt modelling of size–strain analysis: Application to -Al2O3 prepared by combustion technique · K Santra P Chatterjee S P Sen Gupta.

  20. Author Impact Metrics in Communication Sciences and Disorder Research

    Science.gov (United States)

    Stuart, Andrew; Faucette, Sarah P.; Thomas, William Joseph

    2017-01-01

    Purpose: The purpose was to examine author-level impact metrics for faculty in the communication sciences and disorder research field across a variety of databases. Method: Author-level impact metrics were collected for faculty from 257 accredited universities in the United States and Canada. Three databases (i.e., Google Scholar, ResearchGate,…

  1. Uniformed Services Worldwide Legal Assistance & Reserve Components Office Directory. Revised.

    Science.gov (United States)

    1999-11-01

    257-1829 Commander (dl) 14th Coast Guard District Prince Kalanianaole Federal Building 300 Ala Moana Blvd, 9th Floor Honolulu, Hawaii 96850-4982...a),aarons.org Practice Area: 351 - Criminal Law - Defense, 400 - General Practice Bars Admitted: NM County of Practice: Santa Fe, Rio Arriba , Los

  2. Nuclear structure investigations of neutron deficient nuclei in the region Z=103 to 105

    International Nuclear Information System (INIS)

    Hessberger, F. P.; Hofmann, S.; Armbruster, P.; Muenzenberg, G.; Stodel, Ch.; Ackermann, D.; Lavrentev, A. Yu.; Popeko, A. G.; Yeremin, A. V.; Saro, S.; Leino, M.

    1999-01-01

    The isotopes 257,255 Rf, 257,256 Db, 253,252 Lr have been produced in bombardments of 207,208 Pb and 209 Bi target nuclei with 50 Ti and identified by their α-decay. New or improved decay data could be obtained. Analysis of the fine structure of the α-decay pattern of 257 Rf allowed the construction of a first tentative level scheme for the daughter nucleus 253 No and also the identification of a low lying high spin isomeric state, while from α-γ- coincidence measurements for 255 Rf a first tentative level scheme of the daughter nucleus 251 No was derived. For 257 Db we found that two nuclear levels decay by α-emission and populate also different levels in the daughter nucleus 253 Lr. The levels are produced by the reaction process. In bombardments of 209 Bi with 50 Ti at E CN *=26.4 MeV and 30.8 MeV the previously unknown isotopes 256 Db and 252 Lr were identified

  3. Search Results | Page 913 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Results 9121 - 9130 of 9601 ... ... RESEARCH NETWORKS (257) Apply RESEARCH NETWORKS filter .... Intellectual property rights in regional trade agreements of ... Research findings and recommendations emanating from the case study of ... Regional cooperation for improvement of trade procedures : the case of Japan.

  4. Search Results | Page 18 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Results 171 - 180 of 257 ... ... Safe and Inclusive Cities 1 Apply Safe and Inclusive Cities filter · Technology ... Regional Dialogue on the Information Society Network (Latin ... engaged in international cooperation for development but don't have ... The study's author, Stacie Travers, also carried out four case studies on Canadian ...

  5. Involvement of carotenoids in the synthesis and assembly of protein subunits of photosynthetic reaction centers of Synechocystis sp. PCC 6803

    Czech Academy of Sciences Publication Activity Database

    Sozer, O.; Komenda, Josef; Ughy, B.; Domonkos, I.; Laczkó-Dobos, H.; Malec, P.; Gombos, Z.; Kis, M.

    2010-01-01

    Roč. 51, č. 5 (2010), s. 823-835 ISSN 0032-0781 R&D Projects: GA AV ČR IAA400200801 Institutional research plan: CEZ:AV0Z50200510 Keywords : Carotenoidless mutant * crtB * Membrane protein synthesis Subject RIV: EE - Microbiology, Virology Impact factor: 4.257, year: 2010

  6. Regioselective alcoholysis of silychristin acetates catalyzed by lipases

    Czech Academy of Sciences Publication Activity Database

    Vavříková, Eva; Gavezzotti, P.; Purchartová, Kateřina; Fuksová, Kateřina; Biedermann, David; Kuzma, Marek; Riva, S.; Křen, Vladimír

    2015-01-01

    Roč. 16, č. 6 (2015), s. 11983-11995 E-ISSN 1422-0067 R&D Projects: GA ČR(CZ) GA15-03037S; GA MŠk(CZ) LD14096; GA MŠk LH13097 Institutional support: RVO:61388971 Keywords : acetylation * alcoholysis * lipase Subject RIV: CC - Organic Chemistry Impact factor: 3.257, year: 2015

  7. Der spätgotische Turmwächter des Altstädter Turms der Karlsbrücke. Neue Fragen einer einzigartigen Statue

    Czech Academy of Sciences Publication Activity Database

    Hlobil, Ivo

    2013-01-01

    Roč. 61, č. 3 (2013), s. 257-267 ISSN 0049-5123 R&D Projects: GA ČR GA13-39192S Institutional support: RVO:68378033 Keywords : Watchman * Late Gothic sculpture * Charles Bridge * Prague Subject RIV: AL - Art, Architecture, Cultural Heritage http://www.umeni-art.cz/cz/default.aspx

  8. Social Appraisal of Adult ADHD: Stigma and Influences of the Beholder's Big Five Personality Traits

    Science.gov (United States)

    Canu, Will H.; Newman, Matthew L.; Morrow, Tara L.; Pope, Daniel L. W.

    2008-01-01

    Objective: This study investigates social stigma associated with a diagnosis of ADHD in adulthood and whether Big Five personality traits predict appraisals of affected individuals. Method: A sample of 257 undergraduates rate the desirability of targets with ADHD, minor medical problems, and with no appreciable weakness, across several social…

  9. Ultraviolet laser-induced fluorescence detection strategies in capillary electrophoresis: determination of naphthalene sulphonates in river water.

    NARCIS (Netherlands)

    Kok, S.J.; Isberg, I.C.K.; Gooijer, C.; Brinkman, U.A.T.; Velthorst, N.H.

    1998-01-01

    Various UV-laser-induced fluorescence detection strategies for capillary electrophoresis (CE) are compared, i.e. two UV-laser systems (a pulsed laser providing up to 25 mW of tunable emission, applied at 280, 290 and 325 nm, and a continuous wave (cw) laser providing up to 100 mW of 257 nm emission)

  10. Plasmid-encoded diacetyl (acetoin) reductase in Leuconostoc pseudomesenteroides

    DEFF Research Database (Denmark)

    Rattray, Fergal P; Myling-Petersen, Dorte; Larsen, Dianna

    2003-01-01

    A plasmid-borne diacetyl (acetoin) reductase (butA) from Leuconostoc pseudomesenteroides CHCC2114 was sequenced and cloned. Nucleotide sequence analysis revealed an open reading frame encoding a protein of 257 amino acids which had high identity at the amino acid level to diacetyl (acetoin...

  11. Statistical analysis and optimization of copper biosorption capability ...

    African Journals Online (AJOL)

    These three variables were further adopted by the three-level Box– Behnken design to correlate between the three variables and to estimate the optimal conditions required for Cu2+ biosorption. Although the maximum value for Cu2+ biosorption was 85%, the calculated optimum percentage was 72%, which was a 2.57-fold ...

  12. 78 FR 29364 - Exelon Corporation, Exelon Wind 1, LLC, Exelon Wind 2, LLC, Exelon Wind 3, LLC, Exelon Wind 4...

    Science.gov (United States)

    2013-05-20

    ...-005, QF07-55-005, QF07-56-005, QF07-257-004] Exelon Corporation, Exelon Wind 1, LLC, Exelon Wind 2, LLC, Exelon Wind 3, LLC, Exelon Wind 4, LLC, Exelon Wind 5, LLC, Exelon Wind 6, LLC, Exelon Wind 7, LLC, Exelon Wind 8, LLC, Exelon Wind 9, LLC, Exelon Wind 10, LLC, Exelon Wind 11, LLC, High Plains...

  13. Theoretical studies of the active-site structure, spectroscopic and thermodynamic properties, and reaction mechanism of multicopper oxidases

    Czech Academy of Sciences Publication Activity Database

    Rulíšek, Lubomír; Ryde, U.

    2013-01-01

    Roč. 257, č. 2 (2013), s. 445-458 ISSN 0010-8545 Institutional support: RVO:61388963 Keywords : multi-copper oxidases * QM/MM calculations * multireference calculations * the oretical spectroscopy Subject RIV: CA - Inorganic Chemistry Impact factor: 12.098, year: 2013

  14. Adsorption of copper, cadmium and silver from aqueous solutions onto natural carbonaceous materials

    Czech Academy of Sciences Publication Activity Database

    Hanzlík, P.; Jehlička, J.; Weishauptová, Zuzana; Šebek, O.

    2004-01-01

    Roč. 50, č. 6 (2004), s. 257-264 ISSN 1214-1178 R&D Projects: GA AV ČR IAA3111306 Institutional research plan: CEZ:AV0Z3046908 Keywords : activated carbon * metal-cations * removal Subject RIV: DD - Geochemistry Impact factor: 0.170, year: 2004

  15. Distribution of elements among minerals of a single (muscovite-) biotite granite sample – an optimal approach and general implications

    Czech Academy of Sciences Publication Activity Database

    Janoušek, V.; Navrátil, Tomáš; Trubač, J.; Strnad, J.; Laufek, F.; Minařík, Luděk

    2014-01-01

    Roč. 65, č. 4 (2014), s. 257-271 ISSN 1335-0552 Institutional research plan: CEZ:AV0Z30130516 Institutional support: RVO:67985831 Keywords : modal analyses * trace-element residence * ICP -MS * Central Bohemian Plutonic Complex * Říčany granite Subject RIV: DD - Geochemistry Impact factor: 0.761, year: 2014

  16. Electrospinning of reactive mesogens

    NARCIS (Netherlands)

    Yao, J.; Picot, O.T.; Hughes-Brittain, N.F.; Bastiaansen, C.W.M.; Peijs, T.

    2016-01-01

    The reinforcement potential of reactive liquid crystals or reactive mesogens (RMs) in electrospun fibers was investigated through the blending of two types of RMs (RM257 and RM82) with two types of thermoplastics; polyamide 6 (PA6) and poly(methyl methacrylate) (PMMA). Polymer/RM blends were

  17. 76 FR 81004 - Culturally Significant Objects Imported for Exhibition Determinations: “Woman in Blue, Against...

    Science.gov (United States)

    2011-12-27

    ... DEPARTMENT OF STATE [Public Notice: 7739] Culturally Significant Objects Imported for Exhibition Determinations: ``Woman in Blue, Against Blue Water'' by Edvard Munch SUMMARY: Notice is hereby given of the..., Delegation of Authority No. 257 of April 15, 2003), I hereby determine that the object ``Woman in Blue...

  18. Search Results | Page 10 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Results 91 - 100 of 257 ... Enhanced Preservation of Fruits Using Nanotechnology (CIFSRF Phase 2). Poor handling of fruit results in post-harvest losses of nearly 40% in tropical ... New research aims to help control malaria in one watershed in northern Peru. Malaria is widespread in Peru's arid North Coast because of the ...

  19. Quality Control for Ordnance

    Science.gov (United States)

    1957-01-01

    R. H. Morgan, "Screen Intensification Systems and Their Lirnita- tions," Amtvican J w n u l of Roenlgenology and Radizcm Therapy , Vol. LXII, No...443. (1 10) Kurt Matthaes, " Magneto -Inductive Testing of Stcel," Zeitschrgt filr Melnll- kunde, Vol. 39, September, 1948, p]). 257- 272. (1 11

  20. Drug: D04478 [KEGG MEDICUS

    Lifescience Database Archive (English)

    Full Text Available D04478 Drug Hydroxypropylcellulose (JP17); Hydroxypropyl cellulose (NF); Low substituted hydroxypropylcellu...lose (JP17); Lacrisert (TN) ... CAS: 9004-64-2 PubChem: 47206330 DrugBank: DB00840 NIKKAJI: J257.400D ...

  1. Gas barrier properties of nanocomposites based on in situ polymerized poly(n-butyl methacrylate) in the presence of surface modified montmorillonite

    Czech Academy of Sciences Publication Activity Database

    Herrera-Alonso, J. M.; Sedláková, Zdeňka; Marand, E.

    2010-01-01

    Roč. 349, 1-2 (2010), s. 251-257 ISSN 0376-7388 R&D Projects: GA AV ČR KAN100500651; GA MŠk ME09058 Institutional research plan: CEZ:AV0Z40500505 Keywords : barrier membranes * nanocomposites * montmorillonite Subject RIV: CD - Macromolecular Chemistry Impact factor: 3.673, year: 2010

  2. Search Results | Page 15 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Results 141 - 150 of 257 ... In the Caribbean islands, climate change is affecting freshwater availability and other ecosystem services in complex ways. ... IDRC's Democratic Governance, Women's Rights and Gender Equality initiative is supporting a body of comparative research on whether and how democratic processes ...

  3. Experimental in Situ Transformation of Pb Smelter Fly Ash in Acidic Soils

    Czech Academy of Sciences Publication Activity Database

    Ettler, V.; Mihaljevič, M.; Šebek, O.; Matys Grygar, Tomáš; Klementová, Mariana

    2012-01-01

    Roč. 46, č. 19 (2012), s. 10539-10548 ISSN 0013-936X Institutional research plan: CEZ:AV0Z40320502 Keywords : pollution -control residues Subject RIV: CA - Inorganic Chemistry Impact factor: 5.257, year: 2012

  4. Effects of Boreal Timber Rafting on the Composition of Arctic Driftwood

    Czech Academy of Sciences Publication Activity Database

    Hellmann, L.; Kirdyanov, A. V.; Büntgen, Ulf

    2016-01-01

    Roč. 7, č. 11 (2016), č. článku 257. ISSN 1999-4907 Institutional support: RVO:67179843 Keywords : boreal rivers * Arctic driftwood * timber logging * industrial floating * Siberia Subject RIV: GK - Forestry Impact factor: 1.951, year: 2016

  5. Effect of different treatments of copper surface on its total hemispherical absorptivity bellow 77 K

    Czech Academy of Sciences Publication Activity Database

    Musilová, Věra; Králík, Tomáš; Hanzelka, Pavel; Srnka, Aleš

    2007-01-01

    Roč. 47, č. 4 (2007), s. 257-261 ISSN 0011-2275 R&D Projects: GA AV ČR IBS2065109 Institutional research plan: CEZ:AV0Z20650511 Keywords : metals * structural materials * heat transfer * radiant properties * cryostats Subject RIV: JA - Electronics ; Optoelectronics, Electrical Engineering Impact factor: 0.981, year: 2007

  6. Knihy kuchyňských účtů z let 1705-1706 z fondu Šternberk-Manderscheid jako pramen k dějinám aristokratických dvorů. Několik předběžných poznámek

    Czech Academy of Sciences Publication Activity Database

    Franc, Martin

    2002-01-01

    Roč. 52, č. 1 (2002), s. 257-277 ISSN 0036-5246 R&D Projects: GA MŠk LN00A041 Institutional research plan: CEZ:AV0Z8063914 Keywords : Sternberg-Manderscheid Archive * court management Subject RIV: AB - History

  7. Maybe it's not Python that sucks, maybe it's my code

    CERN Multimedia

    CERN. Geneva

    2015-01-01

    Did you know that in Python integers from -5 to 257 are preallocated? Reusing them 1000 times, instead of allocating memory for a bigger integer, saves a whopping 1 millisecond of code's execution time! Isn't that thrilling? Well, before you get that crazy, learn some basic performance tricks that you can start using today.

  8. Analysis of Principals' Managerial Competencies for Effective Management of School Resources in Secondary Schools in Anambra State, Nigeria

    Science.gov (United States)

    Victor, Akinfolarin Akinwale

    2017-01-01

    This study analyses principals' managerial competencies for effective management of school resources in secondary schools in Anambra State. The study was conducted in Anambra State. The study population comprised 257 principals in public secondary schools in the State. The study adopted a descriptive survey design. A 24 items researcher developed…

  9. Trematode diversity in freshwater fishes of the Globe I: ‘Old World’

    Czech Academy of Sciences Publication Activity Database

    Scholz, Tomáš; Besprozvannykh, V. V.; Boutorina, T.E.; Choudhury, A.; Cribb, T.H.; Ermolenko, A. V.; Faltýnková, Anna; Shedko, M.B.; Shimazu, T.; Smit, N.J.

    2016-01-01

    Roč. 93, č. 3 (2016), s. 257-269 ISSN 0165-5752 R&D Projects: GA ČR(CZ) GBP505/12/G112; GA ČR GA15-14198S Institutional support: RVO:60077344 Keywords : life cycle * Digenea * parasite communite Subject RIV: EG - Zoology Impact factor: 1.181, year: 2016

  10. Dynamický impaktní test – unikátní metoda analýzy ochranných vrstev

    Czech Academy of Sciences Publication Activity Database

    Fořt, Tomáš; Grossman, Jan; Sobota, Jaroslav; Daniel, Josef

    2017-01-01

    Roč. 62, č. 10 (2017), s. 257-260 ISSN 0447-6441 R&D Projects: GA MŠk(CZ) LO1212 Institutional support: RVO:68081731 Keywords : dynamical impact test * thin films * protective coatings * wear-resistance * fatigue tests Subject RIV: JK - Corrosion ; Surface Treatment of Materials OBOR OECD: Audio engineering, reliability analysis

  11. Browse Title Index

    African Journals Online (AJOL)

    Items 201 - 250 of 257 ... Vol 30 (2001), The effects of unavailability of technical storage facilities to the marketing of fruits and vegetables for economic development in Morogoro .... Vol 42, No 2 (2014), Towards assessing managerial competencies and leadership styles required for successful game ranch management in the ...

  12. Implicit Racial Biases in Preschool Children and Adults from Asia and Africa

    Science.gov (United States)

    Qian, Miao K.; Heyman, Gail D.; Quinn, Paul C.; Messi, Francoise A.; Fu, Genyue; Lee, Kang

    2016-01-01

    This research used an Implicit Racial Bias Test to investigate implicit racial biases among 3- to 5-year-olds and adult participants in China (N = 213) and Cameroon (N = 257). In both cultures, participants displayed high levels of racial biases that remained stable between 3 and 5 years of age. Unlike adults, young children's implicit racial…

  13. Predicting Alcohol, Cigarette, and Marijuana Use from Preferential Music Consumption

    Science.gov (United States)

    Oberle, Crystal D.; Garcia, Javier A.

    2015-01-01

    This study investigated whether use of alcohol, cigarettes, and marijuana may be predicted from preferential consumption of particular music genres. Undergraduates (257 women and 78 men) completed a questionnaire assessing these variables. Partial correlation analyses, controlling for sensation-seeking tendencies and behaviors, revealed that…

  14. Probabilistic precipitation nowcasting based on an extrapolation of radar reflectivity and an ensemble approach

    Czech Academy of Sciences Publication Activity Database

    Sokol, Zbyněk; Mejsnar, Jan; Pop, Lukáš; Bližňák, Vojtěch

    2017-01-01

    Roč. 194, 15 September (2017), s. 245-257 ISSN 0169-8095 Institutional support: RVO:68378289 Keywords : scale-dependence * forecast * predictability * images * model * rainfall * weather * analogs * motion Subject RIV: DG - Athmosphere Sciences, Meteorology OBOR OECD: Meteorology and atmospheric sciences Impact factor: 3.778, year: 2016 http://www.sciencedirect.com/science/article/pii/S0169809516305142

  15. Applying the Diagnosis Antisocial Personality to Imprisoned Offenders: Looking for Hay in a Haystack.

    Science.gov (United States)

    Stevens, Gail Flint

    1993-01-01

    Assessed differences between inmates (n=381) diagnosed antisocial personality and inmates (n=257) with other diagnoses. Found that inmates diagnosed antisocial personality did not differ from other diagnosed inmates in terms of background characteristics, except race, but did differ in terms of criminal histories. Findings suggest that standards…

  16. I psychologové mají svou olympiádu. Úspěch české psychologie na mezinárodním fóru

    Czech Academy of Sciences Publication Activity Database

    Klicperová-Baker, Martina

    (2016) ISSN 2336-257X R&D Projects: GA MŠk LG15038 Institutional support: RVO:68081740 Keywords : psychologists * Czech psychology * international forum Subject RIV: AN - Psychology http://veda-a-technika.eurozpravy.cz/veda/165538-i-psychologove-maji-svou-olympiadu-uspech-ceske-psychologie-na-mezinarodnim-foru/

  17. Browse Title Index

    African Journals Online (AJOL)

    Items 51 - 100 of 257 ... Vol 22, No 1 (2012), Awareness and Incidence of Plagiarism among Undergraduates in a Nigerian Private University, Abstract. Y T Babalola. Vol 12, No 2 (2002), Book Publishing Patterns in Uganda: Challenges and Prospects, Abstract. Stephen M. Mutula, Mabel M.T. Nakitto. Vol 15, No 1 (2005), Book ...

  18. Wartime Construction Project Outcomes as a Function of Contract Type

    Science.gov (United States)

    2016-07-01

    contract types has been well established. The theory of contractual incentives promulgated by Sherer (1964) established expected contractor...behaviors using a max- imization problem. The theory focuses on expected contractor behaviors in incentive contracts (cf. Federal Acquisition Regulation...Scherer, F. M. (1964). The theory of contractual incentives for cost reduction. Quarterly Journal of Economics, 78, 257–280. Tawazuh Commercial and

  19. K B Shaik

    Indian Academy of Sciences (India)

    Home; Journals; Resonance – Journal of Science Education. K B Shaik. Articles written in Resonance – Journal of Science Education. Volume 15 Issue 3 March 2010 pp 257-267 Classroom. Chaos from Jerk Circuit · K B Shaik M K Mandal · More Details Fulltext PDF ...

  20. 78 FR 64404 - Next Generation 911; Text-to-911; Next Generation 911 Applications

    Science.gov (United States)

    2013-10-29

    ... business hours in the FCC's Reference Information Center at Portals II, CY-A257, 445 12th Street SW... provider. CTIA claims that in current network architecture for Short Message Service (SMS) texting, only... consumer. Changes to this architecture, T-Mobile argues, are ``simply not feasible.'' T-Mobile opines that...

  1. 77 FR 62167 - World Trade Center Health Program; Addition of Certain Types of Cancer to the List of WTC-Related...

    Science.gov (United States)

    2012-10-12

    ... stricken. Digestive System [ssquf] The ICD-9 heading code 154.8 should have been included for ``malignant... digestive system,'' and ``ill-defined sites within the digestive system'' should be 159.0, 159.8, and 159.9... DEPARTMENT OF HEALTH AND HUMAN SERVICES 42 CFR Part 88 [Docket No. CDC-2012-0007; NIOSH-257] RIN...

  2. Increased prevalence of coronary artery disease risk markers in patients with chronic hepatitis C

    DEFF Research Database (Denmark)

    Roed, Torsten; Kristoffersen, Ulrik Sloth; Knudsen, Andreas

    2014-01-01

    % confidence interval [CI] 0.9-2.7) and smoked more (53% versus 38%, PR 1.4; 95% CI 0.9-2.1). The two groups had similar body mass index (mean 25.0 versus 25.7 kg/m(2)), whereas those with chronic hepatitis C had less dyslipidemia (including significantly lower low-density lipoprotein and cholesterol...

  3. Redescription of the Holotype of Culex (Culex) Peus Speiser and Taxonomy of Culex (Culex) Stigmatosoma Dyar and Thriambus Dyar (Diptera: Culicidae)

    Science.gov (United States)

    1988-10-12

    Ver- teneuil, Brussels. 257 pp. + 5 pls. Forattini, 0. P. 1965. Entomologia Medica. 2” Vol- ume_ Editora da Universidade de Sao Paulo. 506 PP...Publica, Boletines T&r& cos, Serie A: Entomologia Medica y Parasitologia No. 1. 66 pp. Matheson, R. 1944. Handbook of the Mosquitoes of North America

  4. Angle dependent laser nanopatterning of poly(ethylene terephthalate) surfaces

    Czech Academy of Sciences Publication Activity Database

    Slepička, P.; Chaloupka, A.; Sajdl, P.; Heitz, J.; Hnatowicz, Vladimír; Svorcik, V.

    2011-01-01

    Roč. 257, č. 14 (2011), s. 6021-6025 ISSN 0169-4332 R&D Projects: GA ČR GA106/09/0125 Institutional research plan: CEZ:AV0Z10480505 Keywords : POLYMER SURFACES * THIN-FILM * RADIATION Subject RIV: BO - Biophysics Impact factor: 2.103, year: 2011

  5. Neither hippurate-negative Brachyspira pilosicoli nor Brachyspira pilosicoli type strain caused diarrhoea in early-weaned pigs by experimental infection

    DEFF Research Database (Denmark)

    Fossi, M.; Ahlsten, K.; Pohjanvirta, T.

    2005-01-01

    Fossi M, Ahlsten K, Pohjanvirta T, Anttila M, Kokkonen T, Jensen TK, Boye M, Sukura A, Pelkola K, Pelkonen S: Neither hippurate-negative Brachyspira pilosicoli nor Brachyspira pilosicoli type strain caused diarrhoea in early-weaned pigs by experimental infection. Acta vet. scand. 2005, 46, 257...

  6. The impact of mechanism on the management and outcome of penetrating colonic trauma.

    Science.gov (United States)

    Oosthuizen, G V; Kong, V Y; Estherhuizen, T; Bruce, J L; Laing, G L; Odendaal, J J; Clarke, D L

    2018-02-01

    Introduction In light of continuing controversy surrounding the management of penetrating colonic injuries, we set out to compare the outcome of penetrating colonic trauma according to whether the mechanism of injury was a stab wound or a gunshot wound. Methods Our trauma registry was interrogated for the 5-year period from January 2012 to December 2016. All patients over the age of 18 years with penetrating trauma (stab or gunshot) and with intraoperatively proven colonic injury were reviewed. Details of the colonic and concurrent abdominal injuries were recorded, together with the operative management strategy. In-hospital morbidities were divided into colon-related and non-colon related morbidities. The length of hospital stay and mortality were recorded. Direct comparison was made between patients with stab wounds and gunshot wounds to the colon. Results During the 5-year study period, 257 patients sustained a colonic injury secondary to penetrating trauma; 95% (244/257) were male and the mean age was 30 years. A total of 113 (44%) sustained a gunshot wound and the remaining 56% (144/257) sustained a stab wound. Some 88% (226/257) of all patients sustained a single colonic injury, while 12% (31/257) sustained more than one colonic injury. A total of 294 colonic injuries were found at laparotomy. Multiple colonic injuries were less commonly encountered in stab wounds (6%, 9/144 vs. 19%, 22/113, P colonic stab wounds and colonic gunshot wounds are different in terms of severity of the injury and in terms of outcome. While primary repair is almost always applicable to the management of colonic stab wounds, the same cannot be said for colonic gunshot wounds. The management of colonic gunshot wounds should be examined separately from that of stab wounds.

  7. Mutation in rod PDE6 linked to congenital stationary night blindness impairs the enzyme inhibition by its gamma-subunit.

    Science.gov (United States)

    Muradov, Khakim G; Granovsky, Alexey E; Artemyev, Nikolai O

    2003-03-25

    Photoreceptor cGMP phosphodiesterase (PDE6) is the effector enzyme in the vertebrate visual transduction cascade. The activity of rod PDE6 catalytic alpha- and beta-subunits is blocked in the dark by two inhibitory Pgamma-subunits. The inhibition is released upon light-stimulation of photoreceptor cells. Mutation H258N in PDE6beta has been linked to congenital stationary night blindness (CSNB) in a large Danish family (Rambusch pedigree) (Gal, A., Orth, U., Baehr, W., Schwinger, E., and Rosenberg, T. (1994) Nat. Genet. 7, 64-67.) We have analyzed the consequences of this mutation for PDE6 function using a Pgamma-sensitive PDE6alpha'/PDE5 chimera, Chi16. Biochemical analysis of the H257N mutant, an equivalent of PDE6betaH258N, demonstrates that this substitution does not alter the ability of chimeric PDE to dimerize or the enzyme's catalytic properties. The sensitivity of H257N to a competitive inhibitor zaprinast was also unaffected. However, the mutant displayed a significant impairment in the inhibitory interaction with Pgamma, which was apparent from a approximately 20-fold increase in the K(i) value (46 nM) and incomplete maximal inhibition. The inhibitory defect of H257N is not due to perturbation of noncatalytic cGMP binding to the PDE6alpha' GAF domains. The noncatalytic cGMP-binding characteristics of the H257N mutant were similar to those of the parent PDE6alpha'/PDE5 chimera. Since rod PDE6 in the Rambusch CSNB is a catalytic heterodimer of the wild-type PDE6alpha and mutant PDE6beta, Chi16 and H257N were coexpressed, and a heterodimeric PDE, Chi16/H257N, was isolated. It displayed two Pgamma inhibitory sites with the K(i) values of 5 and 57 nM. Our results support the hypothesis that mutation H258N in PDE6beta causes CSNB through incomplete inhibition of PDE6 activity by Pgamma, which leads to desensitization of rod photoreceptors.

  8. Structure of an N276-Dependent HIV-1 Neutralizing Antibody Targeting a Rare V5 Glycan Hole Adjacent to the CD4 Binding Site

    Energy Technology Data Exchange (ETDEWEB)

    Wibmer, Constantinos Kurt; Gorman, Jason; Anthony, Colin S.; Mkhize, Nonhlanhla N.; Druz, Aliaksandr; York, Talita; Schmidt, Stephen D.; Labuschagne, Phillip; Louder, Mark K.; Bailer, Robert T.; Karim, Salim S. Abdool; Mascola, John R.; Williamson, Carolyn; Moore, Penny L.; Kwong, Peter D.; Morris, Lynn (NHLS-South Africa); (NIH); (Witwatersrand); (KwaZulu-Natal)

    2016-08-31

    ABSTRACT

    All HIV-1-infected individuals develop strain-specific neutralizing antibodies to their infecting virus, which in some cases mature into broadly neutralizing antibodies. Defining the epitopes of strain-specific antibodies that overlap conserved sites of vulnerability might provide mechanistic insights into how broadly neutralizing antibodies arise. We previously described an HIV-1 clade C-infected donor, CAP257, who developed broadly neutralizing plasma antibodies targeting an N276 glycan-dependent epitope in the CD4 binding site. The initial CD4 binding site response potently neutralized the heterologous tier 2 clade B viral strain RHPA, which was used to design resurfaced gp120 antigens for single-B-cell sorting. Here we report the isolation and structural characterization of CAP257-RH1, an N276 glycan-dependent CD4 binding site antibody representative of the early CD4 binding site plasma response in donor CAP257. The cocrystal structure of CAP257-RH1 bound to RHPA gp120 revealed critical interactions with the N276 glycan, loop D, and V5, but not with aspartic acid 368, similarly to HJ16 and 179NC75. The CAP257-RH1 monoclonal antibody was derived from the immunoglobulin-variable IGHV3-33 and IGLV3-10 genes and neutralized RHPA but not the transmitted/founder virus from donor CAP257. Its narrow neutralization breadth was attributed to a binding angle that was incompatible with glycosylated V5 loops present in almost all HIV-1 strains, including the CAP257 transmitted/founder virus. Deep sequencing of autologous CAP257 viruses, however, revealed minority variants early in infection that lacked V5 glycans. These glycan-free V5 loops are unusual holes in the glycan shield that may have been necessary for initiating this N276 glycan-dependent CD4 binding site B-cell lineage.

    IMPORTANCEThe conserved CD4 binding site on gp120 is a major target for HIV-1 vaccine design, but key events in the elicitation and maturation of

  9. Histopathologic Patterns of Breast Lesions in Northern Saudi Arabia

    Directory of Open Access Journals (Sweden)

    Hussain Gadelkarim Ahmed

    2017-10-01

    Full Text Available Objective: The aim of this study was to find out the prevalence rates of common types of breast cancer in Northern Saudi Arabia. Methodology: A retrospective cohort study was carried out over a five-year period in two referral hospitals. In this study 257 files were retrieved from departments of Surgery from different hospitals in Hail region, Kingdom of Saudi Arabia (KSA. Results: Of the 257 samples diagnosed using Fine Needle Aspiration Cytology (FNAC, histopathological diagnosis was confirmed for 158 patients. Of the 158 diagnosed samples, 46/158 (23.2% were ductal carcinoma, 7/158 (4.4% were lobular carcinoma, 3/158 (1.9% were mixed tumours, and 102/158 (64.6 were fibroadenoma. Conclusion: Fibroadenoma and ductal carcinoma are the prevalent breast lesions in Hail Region of Saudi Arabia.

  10. Moisture dependence of positron lifetime in Kevlar-49

    Science.gov (United States)

    Singh, Jag J.; Holt, William H.; Mock, Willis, Jr.

    1984-01-01

    Because of filamentary character of Kevlar-49 aramid fibers, there is some concern about the moisture uptake and its effect on plastic composites reinforced with Kevlar-49 fibers. As part of continuing studies of positron lifetime in polymers, we have measured positron lifetime spectra in Kevlar-49 fibers as a function of their moisture content. The long lifetime component intensities are rather low, being only of the order of 2-3 percent. The measured values of long component lifetimes at various moisture levels in the specimens are as follows: 2072 +/- 173 ps (dry); 2013 +/- 193 ps (20.7 percent saturation); 1665 +/- 85 ps (25.7 percent saturation); 1745 +/- 257 ps (32.1 percent saturation); and 1772 +/- 217 ps (100 percent saturation). It is apparent that the long component lifetime at first decreases and then increases as the specimen moisture content increases. These results have been compared with those inferred from Epon-815 and Epon-815/K-49 composite data.

  11. Raman Spectra and Bulk Modulus of Nanodiamond in a Size Interval of 2-5 nm

    Science.gov (United States)

    Popov, Mikhail; Churkin, Valentin; Kirichenko, Alexey; Denisov, Viktor; Ovsyannikov, Danila; Kulnitskiy, Boris; Perezhogin, Igor; Aksenenkov, Viktor; Blank, Vladimir

    2017-10-01

    Nanodiamond in a 2-5-nm size interval (which is typical for an appearance of quantum confinement effect) show Raman spectra composed of 3 bands at 1325, 1600, and 1500 cm-1 (at the 458-nm laser excitation) which shifts to 1630 cm-1 at the 257-nm laser excitation. Contrary to sp2-bonded carbon, relative intensities of the bands do not depend on the 458- and 257-nm excitation wavelengths, and a halfwidth and the intensity of the 1600 cm-1 band does not change visibly under pressure at least up to 50 GPa. Bulk modulus of the 2-5-nm nanodiamond determined from the high-pressure study is around 560 GPa. Studied 2-5-nm nanodiamond was purified from contamination layers and dispersed in Si or NaCl.

  12. Raman Spectra and Bulk Modulus of Nanodiamond in a Size Interval of 2-5 nm.

    Science.gov (United States)

    Popov, Mikhail; Churkin, Valentin; Kirichenko, Alexey; Denisov, Viktor; Ovsyannikov, Danila; Kulnitskiy, Boris; Perezhogin, Igor; Aksenenkov, Viktor; Blank, Vladimir

    2017-10-10

    Nanodiamond in a 2-5-nm size interval (which is typical for an appearance of quantum confinement effect) show Raman spectra composed of 3 bands at 1325, 1600, and 1500 cm -1 (at the 458-nm laser excitation) which shifts to 1630 cm -1 at the 257-nm laser excitation. Contrary to sp 2 -bonded carbon, relative intensities of the bands do not depend on the 458- and 257-nm excitation wavelengths, and a halfwidth and the intensity of the 1600 cm -1 band does not change visibly under pressure at least up to 50 GPa. Bulk modulus of the 2-5-nm nanodiamond determined from the high-pressure study is around 560 GPa. Studied 2-5-nm nanodiamond was purified from contamination layers and dispersed in Si or NaCl.

  13. Measurement of differential Z / gamma* + jet + X cross sections in p anti-p collisions at s**(1/2) =1.96 TeV

    Czech Academy of Sciences Publication Activity Database

    Abazov, V. M.; Abbott, B.; Abolins, M.; Kupčo, Alexander; Lokajíček, Miloš

    2008-01-01

    Roč. 669, č. 5 (2008), s. 278-286 ISSN 0370-2693 R&D Projects: GA MŠk LA08047; GA MŠk 1P05LA257; GA MŠk LC527 Institutional research plan: CEZ:AV0Z10100502 Keywords : differential cross * D0 detector Subject RIV: BF - Elementary Particles and High Energy Physics Impact factor: 4.034, year: 2008

  14. Search for long-lived particles decaying into electron or photon pairs with the D0 detector

    Czech Academy of Sciences Publication Activity Database

    Abazov, V. M.; Abbott, B.; Abolins, M.; Kupčo, Alexander; Lokajíček, Miloš

    2008-01-01

    Roč. 101, č. 11 (2008), 111802/1-111802/6 ISSN 0031-9007 R&D Projects: GA MŠk LC527; GA MŠk LA08047; GA MŠk 1P05LA257 Institutional research plan: CEZ:AV0Z10100502 Keywords : D0 * supersymmetry * quark Subject RIV: BF - Elementary Particles and High Energy Physics Impact factor: 7.180, year: 2008

  15. Measurement of the ratio of the p anti-p --> W+c-jet cross section to the inclusive p anti-p --> W+jets cross section

    Czech Academy of Sciences Publication Activity Database

    Abazov, V. M.; Abbott, B.; Abolins, M.; Kupčo, Alexander; Lokajíček, Miloš

    2008-01-01

    Roč. 666, č. 1 (2008), s. 23-30 ISSN 0370-2693 R&D Projects: GA MŠk LA08047; GA MŠk 1P05LA257; GA MŠk LC527 Institutional research plan: CEZ:AV0Z10100502 Keywords : D0 * Tevatron * collisions Subject RIV: BF - Elementary Particles and High Energy Physics Impact factor: 4.034, year: 2008

  16. Draft Genome Sequences of Vibrio alginolyticus Strains V1 and V2, Opportunistic Marine Pathogens

    DEFF Research Database (Denmark)

    Castillo, Daniel; D'Alvise, Paul; Kalatzis, Panos G.

    2015-01-01

    We announce the draft genome sequences of Vibrio alginolyticus strains V1 and V2, isolated from juvenile Sparus aurata and Dentex dentex, respectively, during outbreaks of vibriosis. The genome sequences are 5,257,950 bp with a G+C content of 44.5% for V. alginolyticus V1 and 5,068,299 bp with a G...

  17. HIV and intestinal parasites in adult TB patients in a teaching hospital in Northwest Ethiopia.

    Science.gov (United States)

    Kassu, Afework; Mengistu, Getahun; Ayele, Belete; Diro, Ermias; Mekonnen, Firew; Ketema, Dereje; Moges, Feleke; Mesfin, Tsehay; Getachew, Assefa; Ergicho, Bahiru; Elias, Daniel; Wondmikun, Yared; Aseffa, Abraham; Ota, Fusao

    2007-10-01

    The level of HIV infection and intestinal parasitoses among TB patients was assessed in a hospital-based cross-sectional study involving 257 patients in Gondar, Ethiopia. In TB patients, our study reported co-infection with HIV (52.1%) and intestinal parasites (40.9%) The high prevalence of HIV and intestinal parasites indicates an increased morbidity inTB patients and emphasized the importance of continued HIV sero-surveillance, stool analysis and treatment.

  18. Annual Progress Report FY-91. Volume 1 and 2.

    Science.gov (United States)

    1992-03-12

    Yancy LTC MC. The Effect of Face Mask CPAP on 258 Radionuclide Ventilation Perfusion Scanning of the Lung in the Setting of Postoperative...infarction, 109, 111, 464 myocardial ischemia, 464 nail bands, 125 narcolepsy, 274 narcotics, 458, 461 nasal CPAP , 257, 258 natural history, 46, 53, 101...formalin-fixed, paraffin-embedded) or flash frozen for immune cell phenotyping. Routine histochemistry, special stains, and immune cell phenotyping

  19. The Shock and Vibration Bulletin. Part 3. Machinery Dynamics, System Identification and Structural Analysis

    Science.gov (United States)

    1985-06-01

    purposes. 55 15 525 + 2 225L L53 + L3 ) + 2G3(L 2 + L35L4 + L45)" For the present system identification + 2G(L45 2 + L45L5 + L5 "L 1 technique, the...orbital model is comprised of 257 nodes and 819 dynamic:"DOF’s. k; were compared to ITD results for a wide variety of TD input parameters. Overall, the

  20. Ecological traits affect the sensitivity of bees to land?use pressures in European agricultural landscapes

    OpenAIRE

    De Palma, Adriana; Kuhlmann, Michael; Roberts, Stuart P.M.; Potts, Simon G.; B?rger, Luca; Hudson, Lawrence N.; Lysenko, Igor; Newbold, Tim; Purvis, Andy

    2015-01-01

    1.Bees are a functionally important and economically valuable group, but are threatened by land-use conversion and intensification. Such pressures are not expected to affect all species identically; rather, they are likely to be mediated by the species' ecological traits. 2.Understanding which types of species are most vulnerable under which land uses is an important step towards effective conservation planning. 3.We collated occurrence and abundance data for 257 bee species at 1584 Eur...

  1. Protecting Cryptographic Keys and Functions from Malware Attacks

    Science.gov (United States)

    2010-12-01

    2009. 92 [17] D. Chaum and E. Van Heyst. Group signatures. In D. W. Davies, editor, Advances in Cryptology — Eurocrypt ’91, pages 257–265, Berlin...and David A. Patterson. Computer Architecture - A Quantitative Ap- proach. Morgan Kaufmann Publishers, pub-MORGAN-KAUFMANN:adr, third edition, 2002...to provide data secrecy for user appli- cations on a per-page basis. In David Gregg, Vikram S. Adve, and Brian N. Bershad, editors, Proceedings of the

  2. Five years of specialised early intervention versus two years of specialised early intervention followed by three years of standard treatment for patients with a first episode psychosis

    DEFF Research Database (Denmark)

    Albert, Nikolai; Melau, Marianne; Jensen, Heidi

    2017-01-01

    , alogia, and affective blunting). Secondary outcomes were remission of both negative and psychotic symptoms, psychotic symptoms, suicidal ideation, substance abuse, compliance with medical treatment, adherence with treatment, client satisfaction, days in hospital care, and labour market affiliation...... with specialised mental health services (90.4% v 55.6%, Psatisfaction (estimated mean difference 2.57 points (95% confidence interval 1.36 to 3.79), P

  3. L’ÉTUDE CLINIQUE DU MOIS TECOS : confirmation de la sécurité cardiovasculaire de la sitagliptine

    OpenAIRE

    SCHEEN, André; PAQUOT, Nicolas

    2015-01-01

    Summary : The cardiovascular safety of sitagliptin has been evaluated in TECOS («Trial Evaluating Cardiovascular Outcomes with Sitagliptin»). TECOS recruited patients with type 2 diabetes and a history of cardiovascular disease who received, as add-on to their usual therapy, either sitagliptin (n = 7.257) or placebo (n = 7.266), with a median follow-up of 3 years. The primary cardiovascular outcome was a composite of cardiovascular death, nonfatal myocardial infarction, nonfatal stroke, or ho...

  4. Design and Performance Evaluation of a 200 deg C Interleaved Boost Converter (Preprint)

    Science.gov (United States)

    2012-09-01

    applications in which longer life operation is desired, SiC die are brazed in metal TO-257 hermetic packages, which do provide superior high temperature ...reliability. Optimization of a high temperature X-perm core based coupled inductor architecture, in terms of ac flux balancing and dc flux cancellation...by ~60% due to the rapid decline in X7R capacitance at the high temperature extreme. The results obtained during this study suggest that the

  5. Effect of peanut shells amendment on soil properties and growth of seedlings of Senegalia senegal (L.) Britton, Vachellia seyal (Delile) P. Hurter, and Prosopis juliflora (Swartz) DC in salt-affected soils

    OpenAIRE

    Fall, D.; Bakhoum, N.; Fall, F.; Diouf, F.; Ndiaye, C.; Faye, M. N.; Hocher, Valérie; Diouf, D.

    2018-01-01

    Key message The soil amendment with peanut shells (4, 6 or 8 t ha(-1)) improves soil properties and growth of Senegalia senegal (L.) Britton, Vachellia seyal (Delile) P. Hurter and Prosopis juliflora (Swartz) DC seedlings on salty soils (86, 171, 257 mM NaCl). Context Salinization causes the degradation of biological, chemical, and physical properties of soils. Salty soils reclamation can be achieved with organic amendments and afforestation with salt tolerant species.Aims The aim of the stud...

  6. The Relations between the Organizational Happiness and the Organizational Socialization Perceptions of Teachers: The Sample of Physical Education and Sport

    OpenAIRE

    Tosten, Rasim; Avci, Yunus Emre; Sahin, Erhan

    2018-01-01

    The main purpose of this research is to examine the relationship between levels of organizational happiness and organizational socialization of physical education and sport teachers. The research is quantitative and correlational model. The population of the research is composed of 257 physical education and sports teachers working in Siirt province. The entire universe was tried to be reached and 244 physical education and sports teachers were reached at the target stage. Within the scope of...

  7. Design Structure Matrix (DSM) Methods and Applications for Naval Ship Design

    Science.gov (United States)

    2013-05-23

    Fax: 817-257-7227 E-mail: t.browninufetcu.edu Web : www. t vsonbrown i ng. com Administrative/Business Contact: Mrs. Teresa Miles Hendrix, MPA...mail: t.browninu(ajtcii.edu Web : www.tvsonbrownina.com Administrative/Business Contact: Mrs. Teresa Miles Hendrix, MPA Assistant Director of...STAKEHOLDER COM ABORDAGEM DE SISTEMAS ADAPTATIVOS A COMPLEXIDADE John Findlay, Ph D. e Abby Straus, M. Div. IMPLEMENTANDO FLEXIBILIDADE

  8. 78 FR 36543 - Sunshine Act Meeting

    Science.gov (United States)

    2013-06-18

    ... Between Natural Gas and Electricity Markets. ELECTRIC E-1 ER13-93-000 Avista Corporation. ER13-94-000 ER13... Transmission System Operator, Inc. E-6 EL13-52-000 Western Electricity Coordinating Council. E-7 RM13-8-000...-001 Idaho Wind Partners 1, LLC. HYDRO H-1 P-2144-040 City of Seattle, Washington. H-2 P-2114-257...

  9. Effects of long-term immobilization and recovery on human triceps surae and collagen turnover in the Achilles tendon in patients with healing ankle fracture

    DEFF Research Database (Denmark)

    Christensen, Britt; Dyrberg, Eva; Aagaard, Per

    2008-01-01

    increased (PINP: 257 vs. 56 ng/ml; ICTP: 9.8 vs. 2.1 microg/l) in the immobilized leg compared with the control leg after the 7 wk of immobilization, and levels decreased again in the immobilized leg during the recovery period (PINP: 103 vs. 44 ng/ml; ICTP: 4.2 vs. 1.9 microg/l). A significant reduction...

  10. Environmental Compliance Assessment and Management Program (ECAMP)

    Science.gov (United States)

    1994-06-01

    and liquid fluorine have a copy of this plan. (1) ar required to have a copy of the AF Multi-Product Emergency Response Plan (AFI 324002, para 2.5.7...portable or stationary engine - flammable or combustible paints, oils, varnishes , or similar mixtures used for painting or maintenance when not kept for a...or combustible paints, oils, varnishes , or similar mixtures used for egress of people (29 CFR painting or maintenance when not kept for a period in

  11. High Velocity Jet Noise Source Location and Reduction. Task 6. Noise Abatement Nozzle Design Guide.

    Science.gov (United States)

    1979-04-01

    the Conical Nozzle 255 on the Bertin Aerotrain . xvi ji4 ’ . _______ p .. LIST OF ILLUSTRATIONS (Continued) Figure Page D-37. Predicted and Measured...Moving-Frame Noise from the 256 Conical Nozzle on the Bertin Aerotrain . D-38. Predicted and Measured Static Noise from the 104-Tube 257 Nozzle on the...Bertin Aerotrain . D-39. Predicted and Measured Moving-Frame Noise from the 104- 258 Tube Nozzle on the Bertin Aerotrain . D-40. Relative Velocity Index m

  12. First report of metacercariae of Cyathocotyle prussica parasitising a fish host in the Czech Republic, Central Europe

    Czech Academy of Sciences Publication Activity Database

    Kvach, Yuriy; Ondračková, Markéta; Jurajda, Pavel

    2016-01-01

    Roč. 53, č. 3 (2016), s. 257-261 ISSN 0440-6605 R&D Projects: GA ČR(CZ) GBP505/12/G112; GA ČR(CZ) GAP505/12/2569 Institutional support: RVO:68081766 Keywords : Cyathocotyle prussica * Proterorhinus semilunaris * metacercariae * morphology * first finding Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine Impact factor: 0.472, year: 2016

  13. Health Professionals Facing Burnout: What Do We Know about Nursing Managers?

    OpenAIRE

    Heeb, Jean-Luc; Haberey-Knuessi, Véronique

    2014-01-01

    Objective. To address the degree of burnout in nursing managers in hospitals of Western Switzerland, including comparison with medical managers, and its relationship with personal, work-related, and organizational characteristics. Methods. Statistical analysis of the scores of the Maslach Burnout Inventory-Human Services Survey from 257 nursing managers who answered a standardized electronic questionnaire. Results. Nursing managers showed a low degree of burnout, which was similar to that of ...

  14. Financial Stress in the Czech Republic: Measurement and Effects on the Real Economy

    Czech Academy of Sciences Publication Activity Database

    Horváth, Roman; Malega, J.

    2017-01-01

    Roč. 2017, č. 3 (2017), s. 257-268 ISSN 1210-0455 R&D Projects: GA ČR GA15-10331S Institutional support: RVO:67985556 Keywords : financial stress indicator * vector autoregression * Czech Republic Subject RIV: AH - Economics OBOR OECD: Finance Impact factor: 0.710, year: 2016 http://library.utia.cas.cz/separaty/2017/E/horvath-0466511.pdf

  15. Mechanism of selenium hydride atomization, fate of free atoms and temperature distribution in an argon shielded, highly fuel-rich, hydrogen-oxygen diffusion micro-flame studied by atomic absorption spectrometry

    Czech Academy of Sciences Publication Activity Database

    D'Ulivo, A.; Dědina, Jiří; Lampugnani, L.; Matoušek, Tomáš

    2002-01-01

    Roč. 17, č. 3 (2002), s. 253-257 ISSN 0267-9477 R&D Projects: GA ČR GA203/01/0453; GA ČR GA203/98/0754 Institutional research plan: CEZ:AV0Z4031919 Keywords : hydride atomization * hydride generation * atomic absorption spectrometry Subject RIV: CB - Analytical Chemistry, Separation Impact factor: 4.250, year: 2002

  16. Late Devonian (Famennian) Glaciation in south America and marine offlap on other continents

    Czech Academy of Sciences Publication Activity Database

    Isaacson, P. E.; Hladil, Jindřich; Jian-Wei, S.; Kalvoda, J.; Grader, G.

    1999-01-01

    Roč. 54, - (1999), s. 239-257 ISSN 0016-7800 R&D Projects: GA ČR GA205/98/1347; GA AV ČR IAA3013809; GA ČR GA205/96/0137 Grant - others:XX(XC) IGCP421 Institutional research plan: CEZ:AV0Z3013912 Subject RIV: DA - Hydrology ; Limnology http://www.geologie.ac.at/filestore/download/AB0054_239_A.pdf

  17. Optimism Predicts Positive Health in Repatriated Prisoners of War

    Science.gov (United States)

    2014-09-08

    of officer rank (93%), educated (M 16 years, SD 2), and approximately 72 years old (SD 6). Informed consent was obtained from each repatriate...total cholesterol to HDL cholesterol (5.9), HDL cholesterol (37 g/dl), glycosylated hemoglobin (7.1%), urine cortisol (25.7 g/g creatinine), urine...strength, nutritional status, fatigue, and overall phys- ical function (Waldo, 1996; Cooper, 2007). To assess grip strength, we used the Lafayette Hand

  18. Search for stopped gluinos from p-anti-p collisions at s**(1/2) = 1.96 TeV

    Czech Academy of Sciences Publication Activity Database

    Abazov, V. M.; Abbott, B.; Abolins, M.; Kupčo, Alexander; Lokajíček, Miloš; Šimák, Vladislav

    2007-01-01

    Roč. 99, č. 13 (2007), 131801/1-131801/7 ISSN 0031-9007 R&D Projects: GA MŠk 1P04LA210; GA MŠk 1P05LA257 Institutional research plan: CEZ:AV0Z10100502 Keywords : supersymmetry * gluino * neutralino * D0 * DZero Subject RIV: BF - Elementary Particle s and High Energy Physics Impact factor: 6.944, year: 2007

  19. Swimming ability and physiological response to swimming fatigue in ...

    African Journals Online (AJOL)

    The swimming endurance of kuruma shrimp, Marsupenaeus japonicus (11.04 ± 2.43 g) at five swimming speeds (23.0, 26.7, 31.0, 34.6 and 38.6 cm s-1) was determined in a circulating flume at 25.7 ± 0.7°C. The plasma glucose and total protein, hepatopancreas and pleopods muscle glycogen concentrations were ...

  20. Expression pattern of the AHP gene family from Arabidopsis thaliana and organ specific alternative splicing in the AHP5 gene

    Czech Academy of Sciences Publication Activity Database

    Hradilová, Jana; Brzobohatý, Břetislav

    2007-01-01

    Roč. 51, č. 2 (2007), s. 257-267 ISSN 0006-3134 Grant - others:GA MŠk(CZ) LN00A081; GA AV ČR(CZ) IAA600040612 Program:LN; IA Institutional research plan: CEZ:AV0Z50040507; CEZ:AV0Z50040702 Keywords : Arabidopsis two component systems * gene expression analysis * real time RT-PCR Subject RIV: BO - Biophysics Impact factor: 1.259, year: 2007

  1. Advanced resources for plant genomics: BAC library specific for the short arm of wheat chromosome 1B

    Czech Academy of Sciences Publication Activity Database

    Janda, Jaroslav; Šafář, Jan; Kubaláková, Marie; Bartoš, Jan; Kovářová, Pavlína; Suchánková, Pavla; Pateyron, S.; Čihalíková, Jarmila; Sourdille, P.; Šimková, Hana; Faivre-Rampant, P.; Hřibová, Eva; Bernard, M.; Lukaszewski, A.; Doležel, Jaroslav; Chalhoub, B.

    2006-01-01

    Roč. 47, - (2006), s. 977-986 ISSN 0960-7412 R&D Projects: GA ČR GA521/04/0607; GA ČR GP521/05/P257; GA ČR GD521/05/H013; GA MŠk LC06004 Institutional research plan: CEZ:AV0Z50380511 Keywords : wheat * genomics * chromosome sorting Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 6.565, year: 2006

  2. Measurement of the shape of the boson transverse momentum distribution in p anti-p ---> Z / gamma* ---> e+ e- + X events produced at s**(1/2) = 1.96 TeV

    Czech Academy of Sciences Publication Activity Database

    Abazov, V. M.; Abbott, B.; Abolins, M.; Kupčo, Alexander; Lokajíček, Miloš

    2008-01-01

    Roč. 100, č. 10 (2008), 102002/1-10200/7 ISSN 0031-9007 R&D Projects: GA MŠk LA08047; GA MŠk 1P05LA257 Institutional research plan: CEZ:AV0Z10100502 Keywords : D0 * Tevatron * boson Subject RIV: BF - Elementary Particles and High Energy Physics Impact factor: 7.180, year: 2008

  3. Measurement of the electron charge asymmetry in p anti-p --> W + X --> e nu + X events at s**(1/2) = 1.96 TeV

    Czech Academy of Sciences Publication Activity Database

    Abazov, V. M.; Abbott, B.; Abolins, M.; Kupčo, Alexander; Lokajíček, Miloš

    2008-01-01

    Roč. 101, č. 21 (2008), 211801/1-211801/7 ISSN 0031-9007 R&D Projects: GA MŠk LA08047; GA MŠk 1P05LA257; GA MŠk LC527 Institutional research plan: CEZ:AV0Z10100502 Keywords : charge asymmetry * D0 * parton distribution function Subject RIV: BF - Elementary Particles and High Energy Physics Impact factor: 7.180, year: 2008

  4. Measurement of the shape of the boson rapidity distribution for p anti-p --> Z/gamma* --> e+ e- + X events produced at s**(1/2) of 1.96 TeV

    Czech Academy of Sciences Publication Activity Database

    Abazov, V. M.; Abbott, B.; Abolins, M.; Kupčo, Alexander; Lokajíček, Miloš; Šimák, Vladislav

    2007-01-01

    Roč. 76, č. 1 (2007), 012003/1-012003/11 ISSN 1550-7998 R&D Projects: GA MŠk 1P04LA210; GA MŠk 1P05LA257 Institutional research plan: CEZ:AV0Z10100502 Keywords : Z boson * Z boson rapidity * D0 * DZero Subject RIV: BF - Elementary Particles and High Energy Physics Impact factor: 4.696, year: 2007

  5. Apo and Iron Bound Fur Repression and the Role of Fur in vivo

    Science.gov (United States)

    2010-03-24

    transport (frpB, ceuE) (257). IG-443 is encoded in the intergenic region between fur and HP1033, and is predicted to regulate the flagellar motor ...relationship with the development of gastroesophageal reflux disease (33), Barrett’s esophagus (64), esophageal adenocarcinoma (73), diarrheal diseases (55...active tuberculosis (51), asthma, and other allergic disorders (7, 13, 53). Because of this, a vaccination or therapeutic approach to abrogate H

  6. Complexity of deciding detectability in discrete event systems

    Czech Academy of Sciences Publication Activity Database

    Masopust, Tomáš

    2018-01-01

    Roč. 93, July (2018), s. 257-261 ISSN 0005-1098 Institutional support: RVO:67985840 Keywords : discrete event systems * finite automata * detectability Subject RIV: BA - General Mathematics OBOR OECD: Computer science s, information science , bioinformathics (hardware development to be 2.2, social aspect to be 5.8) Impact factor: 5.451, year: 2016 https://www. science direct.com/ science /article/pii/S0005109818301730

  7. Strength, elasticity and failure of composites with pyrolyzed matrices based on polymethylsiloxane resins with optimized ratio of D and T components

    Czech Academy of Sciences Publication Activity Database

    Černý, Martin; Strachota, Adam; Chlup, Zdeněk; Sucharda, Zbyněk; Žaloudková, Margit; Glogar, Petr; Kuběna, Ivo

    2013-01-01

    Roč. 47, č. 8 (2013), s. 1055-1066 ISSN 0021-9983 R&D Projects: GA ČR GA106/09/1101 Institutional support: RVO:67985891 ; RVO:61389013 ; RVO:68081723 Keywords : fibre-reinforced composite * fracture toughness * mechanical properties * pyrolyzed siloxane resin Subject RIV: JI - Composite Materials Impact factor: 1.257, year: 2013 http://jcm.sagepub.com/content/47/8/1055.full.pdf+html

  8. Platinum(IV) complex LA-12 induces cell cycle phase specific apoptosis in colon carcinoma cell line HCT-116

    Czech Academy of Sciences Publication Activity Database

    Vondálová Blanářová, Olga; Jelínková, Iva; Jendželovský, R.; Souček, Karel; Hofmanová, Jiřina; Sova, P.; Kozubík, Alois

    2009-01-01

    Roč. 276, č. 1 (2009), s. 256-257 ISSN 1742-464X. [34th FEBS Congress. 04.07.2009-09.07.2009, Prague] R&D Projects: GA AV ČR(CZ) 1QS500040507; GA ČR(CZ) GA301/07/1557 Institutional research plan: CEZ:AV0Z50040507; CEZ:AV0Z50040702 Keywords : platinum drugs * cell cycle apoptosis Subject RIV: BO - Biophysics

  9. The Insect SNMP Gene Family

    Science.gov (United States)

    2009-01-01

    CD36. Eur. J. Biochem. 257, 488–494. Robertson, H.M., Wanner, K.W., 2006. The chemoreceptor superfamily in the honey bee , Apis mellifera: expansion of...keywords: Pheromone Receptors Olfactory Gustatory Chemosensory Gustatory Mosquito Fly a b s t r a c t SNMPs are membrane proteins observed to associate with...present indirect evidence based on evolutionary selection (dN/dS) that the dipteran SNMPs are expressed as functional proteins . We observed expansions

  10. Global and National Socioeconomic Disparities in Obesity, Overweight, and Underweight Status

    Directory of Open Access Journals (Sweden)

    Spencer Moore

    2010-01-01

    Results. Globally, 6.7% was underweight, 25.7% overweight, and 8.9% obese. Underweight status was least (5.8% and obesity (9.3% most prevalent in the richest quintile. There was variability between countries, with a tendency for lower-income quintiles to be at increased risk for underweight and reduced risk for obesity. Conclusion. International policies may require flexibility in addressing cross-national differences in the socio-economic covariates of BMI status.

  11. Effect of dietary yeast autolysate on performance, slaughter, and ...

    African Journals Online (AJOL)

    TOSHIBA

    2017-05-22

    May 22, 2017 ... During the study (from 1st to 42nd day), quails fed dietary treatments ... affect poultry performance parameters and carcass characteristics (Aydin & Aydin, .... Serum sample levels of AST, ALP, cholesterol, high-density lipoprotein (HDL), total ... 28th day. M 98 93.26 ± 1.97 96 97.26 ± 2.57 96 97.50 ± 2.24 99 ...

  12. Medical Practitioners Act 2007: the increased medical record burden.

    LENUS (Irish Health Repository)

    Byrne, D

    2010-03-01

    New medical record keeping obligations are implemented by the Medical Practitioners Act (2007), effective July 2009. This audit, comprising review of 347 medical entries in 257 charts on one day, investigated compliance with the Act together with the general standard of medical record keeping. The Medical Council requirement was absent all but 3 (0.9%) of entries; there was no unique identifier or signature in 28 (8%) and 135 (39%) of entries respectively. The case for change is discussed.

  13. Alzheimer's Disease: Mechanism and Approach to Cell Therapy

    Czech Academy of Sciences Publication Activity Database

    Amemori, Takashi; Jendelová, Pavla; Růžička, Jiří; Machová-Urdzíková, Lucia; Syková, Eva

    2015-01-01

    Roč. 16, č. 11 (2015), s. 26417-26451 E-ISSN 1422-0067 R&D Projects: GA ČR(CZ) GBP304/12/G069; GA ČR(CZ) GAP304/11/0184 Institutional support: RVO:68378041 Keywords : alzheimer’s disease * tau * amyloid-β * mesenchymal stem cell s * neural stem cell s Subject RIV: FH - Neurology Impact factor: 3.257, year: 2015

  14. Physiotherapy for plantar fasciitis: a UK-wide survey of current practice.

    Science.gov (United States)

    Grieve, Rob; Palmer, Shea

    2017-06-01

    To identify how United Kingdom (UK) physiotherapists currently diagnose, assess and manage plantar fasciitis in routine practice. Online questionnaire survey. Practising physiotherapists across the UK who treat patients with plantar fasciitis. Physiotherapists were approached via 'interactive Chartered Society of Physiotherapy (CSP)' online networks and an email database of clinical educators in South West England. An online questionnaire was developed by reviewing similar existing physiotherapy surveys and consultation with experienced musculoskeletal researchers/clinicians. Descriptive statistics were used to analyse the data. 285 physiotherapists responded, with 257 complete survey responses. Pain on palpation and early morning pain were the most common diagnostic criteria, with some physiotherapists using no formal test criteria. Advice (237/257, 92%), plantar fasciitis pathology education (207/257, 81%) and general stretching exercises (189/257, 74%) were most routinely used. Prefabricated orthotics, custom made orthotics and night splints were seldom always used. For the manual therapy approach, the most frequently used modalities were massage, myofascial release, specific soft tissue mobilisations and myofascial trigger point therapy. Commonly used outcome measures were pain assessment, functional tests and range of movement. Physiotherapists appeared to follow most of the established diagnostic criteria for PF, but have not followed established outcome measure guidelines. Advice as well as education with an emphasis on self-management including calf/hamstring stretching was the most commonly reported treatment approach. There was uncertainty whether this approach accurately reflected clinical practice used throughout the UK, owing to potential response bias/unknown response rate and the low number of patients with PF treated by the respondents. Copyright © 2016 Chartered Society of Physiotherapy. Published by Elsevier Ltd. All rights reserved.

  15. Evaluation of novel arginine based inhibitors of DDAH and investigations into radical hydroacylation of vinyl sulfonates

    OpenAIRE

    Khanom, N.

    2010-01-01

    The thesis is in two main sections. In the first section, studies on methylarginine processing enzymes are presented. Dimethyalrginine dimethylaminohydrolase (DDAH) is a class of enzymes involved in the metabolism of methylarginines ADMA and L-NMMA, which indirectly regulate physiological nitric oxide levels. It is desirable to inhibit excess NO in pathological situations, and the arginine mimetic L-257 is a DDAH inhibitor which reduces levels of NO. Synthesis of ester analo...

  16. Nuclear magnetic resonance spectrometry

    International Nuclear Information System (INIS)

    Wasson, J.R.; Salinas, J.E.

    1980-01-01

    Of the thousands of publications available for the period from July 1977 to July 1979, only a few were selected for this review. Approximately 130 review sources are summarized in tabular form as to topic(s) covered in the review. Other parts of the review article deal with apparatus and techniques, spectral analysis, computer applications, analytical applications, selected organic systems, and selected inorganic systems. A total of 257 references are cited

  17. Seasonal and inter-annual variability of soil CO2 efflux in a Norway spruce forest over an eight-year study

    Czech Academy of Sciences Publication Activity Database

    Acosta, Manuel; Dařenová, Eva; Krupková, Lenka; Pavelka, Marian

    256-257 (2018), s. 93-103 ISSN 0168-1923 R&D Projects: GA MŠk(CZ) LO1415; GA MŠk(CZ) EF16_013/0001609 Institutional support: RVO:86652079 Keywords : Automated chamber system * Day of the year * Picea abies * Soil carbon flux * Temperature Soil water content Subject RIV: EH - Ecology, Behaviour OBOR OECD: Ecology Impact factor: 3.887, year: 2016

  18. ORIGINAL ARTICLES

    African Journals Online (AJOL)

    therefore regressive, Ho-v\\rever, since the poor tend to reduce their consumption by a greater percentage than the rich in ... 14 000 and 30 000 respondents and covers the period 1993 -. 2000. .... Indian. 2.6. 32.3. Age group (yrs). 16- 24. 28.0. 24.0. 25-34. 25.7. 38.7. 35-49 .... excise tax to more than 70% of the retail price.

  19. Site specific modification of the human plasma proteome by methylglyoxal

    International Nuclear Information System (INIS)

    Kimzey, Michael J.; Kinsky, Owen R.; Yassine, Hussein N.; Tsaprailis, George; Stump, Craig S.; Monks, Terrence J.; Lau, Serrine S.

    2015-01-01

    Increasing evidence identifies dicarbonyl stress from reactive glucose metabolites, such as methylglyoxal (MG), as a major pathogenic link between hyperglycemia and complications of diabetes. MG covalently modifies arginine residues, yet the site specificity of this modification has not been thoroughly investigated. Sites of MG adduction in the plasma proteome were identified using LC–MS/MS analysis in vitro following incubation of plasma proteins with MG. Treatment of plasma proteins with MG yielded 14 putative MG hotspots from five plasma proteins (albumin [nine hotspots], serotransferrin, haptoglobin [2 hotspots], hemopexin, and Ig lambda-2 chain C regions). The search results revealed two versions of MG-arginine modification, dihydroxyimidazolidine (R + 72) and hydroimidazolone (R + 54) adducts. One of the sites identified was R257 in human serum albumin, which is a critical residue located in drug binding site I. This site was validated as a target for MG modification by a fluorescent probe displacement assay, which revealed significant drug dissociation at 300 μM MG from a prodan–HSA complex (75 μM). Moreover, twelve human plasma samples (six male, six female, with two type 2 diabetic subjects from both genders) were analyzed using multiple reaction monitoring (MRM) tandem mass spectrometry and revealed the presence of the MG-modified albumin R257 peptide. These data provide insights into the nature of the site-specificity of MG modification of arginine, which may be useful for therapeutic treatments that aim to prevent MG-mediated adverse responses in patients. - Highlights: • Methylglyoxal (MG) selectively modifies arginine sites in human plasma proteome. • Dihydroxyimidazolidine and hydroimidazolone adducts on serum albumin identified • MG modification on albumin R257 associated with loss of drug site I binding capacity • MRM-tandem mass spectrometry enables sensitive detection of albumin MG-R257. • Site-specific MG modification may

  20. Site specific modification of the human plasma proteome by methylglyoxal

    Energy Technology Data Exchange (ETDEWEB)

    Kimzey, Michael J.; Kinsky, Owen R. [Southwest Environmental Health Sciences Center, Department of Pharmacology & Toxicology, College of Pharmacy, The University of Arizona, Tucson, AZ 85721 (United States); Yassine, Hussein N. [Department of Medicine, The University of Arizona, Tucson, AZ 85721 (United States); Tsaprailis, George [Southwest Environmental Health Sciences Center, Department of Pharmacology & Toxicology, College of Pharmacy, The University of Arizona, Tucson, AZ 85721 (United States); Stump, Craig S. [Department of Medicine, The University of Arizona, Tucson, AZ 85721 (United States); Southern Arizona VA Health Care System, Tucson, AZ 85723 (United States); Monks, Terrence J. [Southwest Environmental Health Sciences Center, Department of Pharmacology & Toxicology, College of Pharmacy, The University of Arizona, Tucson, AZ 85721 (United States); Lau, Serrine S., E-mail: lau@pharmacy.arizona.edu [Southwest Environmental Health Sciences Center, Department of Pharmacology & Toxicology, College of Pharmacy, The University of Arizona, Tucson, AZ 85721 (United States)

    2015-12-01

    Increasing evidence identifies dicarbonyl stress from reactive glucose metabolites, such as methylglyoxal (MG), as a major pathogenic link between hyperglycemia and complications of diabetes. MG covalently modifies arginine residues, yet the site specificity of this modification has not been thoroughly investigated. Sites of MG adduction in the plasma proteome were identified using LC–MS/MS analysis in vitro following incubation of plasma proteins with MG. Treatment of plasma proteins with MG yielded 14 putative MG hotspots from five plasma proteins (albumin [nine hotspots], serotransferrin, haptoglobin [2 hotspots], hemopexin, and Ig lambda-2 chain C regions). The search results revealed two versions of MG-arginine modification, dihydroxyimidazolidine (R + 72) and hydroimidazolone (R + 54) adducts. One of the sites identified was R257 in human serum albumin, which is a critical residue located in drug binding site I. This site was validated as a target for MG modification by a fluorescent probe displacement assay, which revealed significant drug dissociation at 300 μM MG from a prodan–HSA complex (75 μM). Moreover, twelve human plasma samples (six male, six female, with two type 2 diabetic subjects from both genders) were analyzed using multiple reaction monitoring (MRM) tandem mass spectrometry and revealed the presence of the MG-modified albumin R257 peptide. These data provide insights into the nature of the site-specificity of MG modification of arginine, which may be useful for therapeutic treatments that aim to prevent MG-mediated adverse responses in patients. - Highlights: • Methylglyoxal (MG) selectively modifies arginine sites in human plasma proteome. • Dihydroxyimidazolidine and hydroimidazolone adducts on serum albumin identified • MG modification on albumin R257 associated with loss of drug site I binding capacity • MRM-tandem mass spectrometry enables sensitive detection of albumin MG-R257. • Site-specific MG modification may