WorldWideScience

Sample records for mendelevium 256

  1. Chemical properties of mendelevium

    International Nuclear Information System (INIS)

    Hulet, E.K.

    1980-01-01

    The isotope 256 Md is nearly always employed for chemical studies of this element. This nuclide can be made by bombardment of fractions of a microgram of 254 Es with intense alpha-particle beams which will produce about 10 6 atoms of 256 Md with a half-life of 77 minutes. Even with the most intense ion beams and the largest available quantities of target isotope, about 10 6 atoms at a time is all the Md that can be produced for chemical studies. This lack of sufficient sample size coupled with the very short lifetimes of the few atoms produced has severly restricted the gathering and broadening of our knowledge concerning the properties of Md and the heavier elements. To illustrate, the literature contains a mere eleven references to the chemical studies of Md, and none of these deal with bulk properties associated with element found in solid phases. Some of these findings are: Md was found to be more volatile than other actinide metals which lead to the belief that it is divalent in the metallic state; separation of Md from the other actinides can be accomplished either by reduction of Md to the divalent state or by chromatographic separations with Md remaining in the tripositive state; extraction of Md with bis(2-ethylhexyl)phosphoric acid is much poorer than the extraction of the neighboring tripositive actinides; attempts to oxidize Md wih sodium bismuthate failed to show any evidence of Md 4+ ; standard reduction potential of Md 3+ was found to be close to -0.1 volt; Md 3+ can be reduced to Md(Hg) by sodium amalgams and by electrolysis; the electrochemical behavior of Md is very similar to that of Fm and can be summarized in the equation, Md 2+ + 2e - = Md(Hg), and E 0 = 1.5 V

  2. Symposium commemorating the 25th anniversary of the discovery of mendelevium

    Energy Technology Data Exchange (ETDEWEB)

    Seaborg, G.T. (ed.)

    1980-01-01

    The Symposium honoring the 25th Anniversary of the discovery of mendelevium was held at the Lawrence Berkeley Laboratory on March 28, 1980. The following three papers were presented: Chemical Properties of Mendelevium; Nuclear Properties of Mendelevium; and Radioactive Decay of Md Isotopes. Besides these papers there were introductory remarks, reminiscences, and concluding remarks.

  3. Studies on some physico-chemical properties of the monovalent mendelevium

    International Nuclear Information System (INIS)

    Kamenskaya, A.N.; Mikheev, N.B.; Novichenko, V.L.

    1979-01-01

    It was established that Md 3+ reduced by Yb 2+ or Eu 2+ co-crystallizes with NaCl in water-ethanol solutions. The co-crystallization coefficient is independent of the relative quantities of the solid and liquid phase, of the concentration of the reducing agent in the concentration range from 1 to 8 mg/ml, and of the concentration of the chloride ion in the solution. Basing on the knowledge of anomalous mixed crystals and on the thermodynamical analysis of the formation of truly isomorphical solid solutions and anomalous mixed crystals, it was shown that mendelevium co-crystallizing with NaCl is in its monovalent state. Besides, it was concluded that up to 1.5 M chloride concentration the monovalent mendelevium does not form stable chloride complexes in water-ethanol solutions. (author)

  4. Chemical properties of mendelevium

    Energy Technology Data Exchange (ETDEWEB)

    Hulet, E.K.

    1980-11-01

    Even with the most intense ion beams and the largest available quantities of target isotope, about 10/sup 6/ atoms at a time is all the Md that can be produced for chemical studies. This lack of sufficient sample size coupled with the very short lifetimes of the few atoms produced has severely restricted the gathering and the broadness of our knowledge concerning the properties of Md and the heavier elements. To illustrate, the literature contains a mere eleven references to the chemical studies of Md, and none of these deal with bulk properties associated with the element bound in solid phases. Some of these findings are: Md was found to be more volatile than other actinide metals which lead to the belief that it is divalent in the metallic state; separation of Md from the other actinides can be accomplished either by reduction of Md/sup 3 +/ to the divalent state or by chromatographic separations with Md remaining in the tripositive state; extraction of Md/sup 2 +/ with bis(2-ethylhexyl)phosphoric acid is much poorer than the extraction of the neighboring tripositive actinides; attempts to oxidize Md/sup 3 +/ with sodium bismuthate failed to show any evidence for Md/sup 4 +/; reduction potential of Md/sup 3 +/ was found to be close to -0.1 volt; Md/sup 3 +/ can be reduced to Md(Hg) by sodium amalgams and by electrolysis; the electrochemical behavior of Md is very similar to that of Fm and can be summarized in the equation, Md/sup 2 +/ + 2e/sup -/ = Md(Hg) and E/sup 0/ = -1.50 V.; and Md cannot be reduced to a monovalent ion with Sm/sup 2 +/.

  5. Chemical properties of mendelevium

    International Nuclear Information System (INIS)

    Hulet, E.K.

    1980-11-01

    Even with the most intense ion beams and the largest available quantities of target isotope, about 10 6 atoms at a time is all the Md that can be produced for chemical studies. This lack of sufficient sample size coupled with the very short lifetimes of the few atoms produced has severely restricted the gathering and the broadness of our knowledge concerning the properties of Md and the heavier elements. To illustrate, the literature contains a mere eleven references to the chemical studies of Md, and none of these deal with bulk properties associated with the element bound in solid phases. Some of these findings are: Md was found to be more volatile than other actinide metals which lead to the belief that it is divalent in the metallic state; separation of Md from the other actinides can be accomplished either by reduction of Md 3+ to the divalent state or by chromatographic separations with Md remaining in the tripositive state; extraction of Md 2+ with bis(2-ethylhexyl)phosphoric acid is much poorer than the extraction of the neighboring tripositive actinides; attempts to oxidize Md 3+ with sodium bismuthate failed to show any evidence for Md 4+ ; reduction potential of Md 3+ was found to be close to -0.1 volt; Md 3+ can be reduced to Md(Hg) by sodium amalgams and by electrolysis; the electrochemical behavior of Md is very similar to that of Fm and can be summarized in the equation, Md 2+ + 2e - = Md(Hg) and E 0 = -1.50 V.; and Md cannot be reduced to a monovalent ion with Sm 2+

  6. 17 CFR 256.184 - Clearing accounts.

    Science.gov (United States)

    2010-04-01

    ... 17 Commodity and Securities Exchanges 3 2010-04-01 2010-04-01 false Clearing accounts. 256.184 Section 256.184 Commodity and Securities Exchanges SECURITIES AND EXCHANGE COMMISSION (CONTINUED) UNIFORM... COMPANY ACT OF 1935 4. Deferred Debits § 256.184 Clearing accounts. This account shall include...

  7. 40 CFR 256.40 - Requirements.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 24 2010-07-01 2010-07-01 false Requirements. 256.40 Section 256.40 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) SOLID WASTES GUIDELINES FOR DEVELOPMENT AND IMPLEMENTATION OF STATE SOLID WASTE MANAGEMENT PLANS Facility Planning and Implementation § 256.40...

  8. 30 CFR 256.40 - Definitions.

    Science.gov (United States)

    2010-07-01

    ... 30 Mineral Resources 2 2010-07-01 2010-07-01 false Definitions. 256.40 Section 256.40 Mineral... IN THE OUTER CONTINENTAL SHELF Issuance of Leases § 256.40 Definitions. The following definitions... means 42 U.S. gallons. (e) Crude oil means a mixture of liquid hydrocarbons including condensate that...

  9. 40 CFR 96.256 - Account error.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 20 2010-07-01 2010-07-01 false Account error. 96.256 Section 96.256... Tracking System § 96.256 Account error. The Administrator may, at his or her sole discretion and on his or her own motion, correct any error in any CAIR SO2 Allowance Tracking System account. Within 10...

  10. 40 CFR 256.50 - Requirements.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 24 2010-07-01 2010-07-01 false Requirements. 256.50 Section 256.50 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) SOLID WASTES GUIDELINES FOR DEVELOPMENT AND IMPLEMENTATION OF STATE SOLID WASTE MANAGEMENT PLANS Coordination With Other Programs § 256.50...

  11. Imaging by photon counting with 256 x 256 pixel matrix

    CERN Document Server

    Tlustos, Lukas; Heijne, Erik H M; Llopart-Cudie, Xavier

    2004-01-01

    Using 0.25 mum standard CMOS we have developed 2-D semiconductor matrix detectors with sophisticated functionality integrated inside each pixel of a hybrid sensor module. One of these sensor modules is a matrix of 256 multiplied by 256 square 55mum pixels intended for X- ray imaging. This device is called 'Medipix2' and features a fast amplifier and two-level discrimination for signals between 1000 and 100000 equivalent electrons, with overall signal noise similar to 150 e- rms. Signal polarity and comparator thresholds are programmable. A maximum count rate of nearly 1 MHz per pixel can be achieved, which corresponds to an average flux of 3 multiplied by 10exp10 photons per cm2. The selected signals can be accumulated in each pixel in a 13- bit register. The serial readout takes 5-10 ms. A parallel readout of similar to 300 mus could also be used. Housekeeping functions such as local dark current compensation, test pulse generation, silencing of noisy pixels and threshold tuning in each pixel contribute to t...

  12. Improved security analysis of Fugue-256

    DEFF Research Database (Denmark)

    Gauravaram, Praveen; Bagheri, Nasour; Knudsen, Lars Ramkilde

    2011-01-01

    in the G transform. Next we improve the designers’ meet-in-the-middle preimage attack on Fugue-256 from 2480 time and memory to 2416. Next we study the security of Fugue-256 against free-start distinguishers and free-start collisions. In this direction, we use an improved variant of the differential...... transform is mapped with a transform to a 256-bit digest. In this paper, we present some improved as well as new analytical results of Fugue-256 (with lengthpadding). First we improve Aumasson and Phans’ integral distinguisher on the 5.5 rounds of the G transform to 16.5 rounds, thus showing weak diffusion...

  13. Improved security analysis of Fugue-256 (poster)

    DEFF Research Database (Denmark)

    Gauravaram, Praveen; Knudsen, Lars Ramkilde; Bagheri, Nasoor

    2011-01-01

    We present some improved analytical results as part of the ongoing work on the analysis of Fugue-256 hash function, a second round candidate in the NIST's SHA3 competition. First we improve Aumasson and Phans' integral distinguisher on the 5.5 rounds of the final transformation of Fugue-256 to 16.......5 rounds. Next we improve the designers' meet-in-the-middle preimage attack on Fugue-256 from 2480 time and memory to 2416. Finally, we comment on possible methods to obtain free-start distinguishers and free-start collisions for Fugue-256. © 2011 Springer-Verlag....

  14. 17 CFR 256.232 - Accounts payable.

    Science.gov (United States)

    2010-04-01

    ... 17 Commodity and Securities Exchanges 3 2010-04-01 2010-04-01 false Accounts payable. 256.232... SYSTEM OF ACCOUNTS FOR MUTUAL SERVICE COMPANIES AND SUBSIDIARY SERVICE COMPANIES, PUBLIC UTILITY HOLDING COMPANY ACT OF 1935 7. Current and Accrued Liabilities § 256.232 Accounts payable. This account shall...

  15. 17 CFR 256.924 - Property insurance.

    Science.gov (United States)

    2010-04-01

    ... 17 Commodity and Securities Exchanges 3 2010-04-01 2010-04-01 false Property insurance. 256.924... COMPANY ACT OF 1935 2. Expense § 256.924 Property insurance. (a) This account shall include the cost of insurance premiums to protect the service company against losses and damages to owned or leased property...

  16. 49 CFR 256.7 - Financial assistance.

    Science.gov (United States)

    2010-10-01

    ... shall not exceed 80 percent of the total allowable project costs. The non-Federal share may not be... 49 Transportation 4 2010-10-01 2010-10-01 false Financial assistance. 256.7 Section 256.7..., DEPARTMENT OF TRANSPORTATION FINANCIAL ASSISTANCE FOR RAILROAD PASSENGER TERMINALS Regulations Governing...

  17. 40 CFR 97.256 - Account error.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 20 2010-07-01 2010-07-01 false Account error. 97.256 Section 97.256... Account error. The Administrator may, at his or her sole discretion and on his or her own motion, correct any error in any CAIR SO2 Allowance Tracking System account. Within 10 business days of making such...

  18. Improved security analysis of Fugue-256 (poster)

    DEFF Research Database (Denmark)

    Gauravaram, Praveen; Knudsen, Lars Ramkilde; Bagheri, Nasoor

    2011-01-01

    We present some improved analytical results as part of the ongoing work on the analysis of Fugue-256 hash function, a second round candidate in the NIST's SHA3 competition. First we improve Aumasson and Phans' integral distinguisher on the 5.5 rounds of the final transformation of Fugue-256 to 16...

  19. 17 CFR 256.409 - Income taxes.

    Science.gov (United States)

    2010-04-01

    ... income statement to meet the actual liability for such taxes. As the exact amount of taxes become known... 17 Commodity and Securities Exchanges 3 2010-04-01 2010-04-01 false Income taxes. 256.409 Section... COMPANY ACT OF 1935 Income and Expense Accounts § 256.409 Income taxes. (a) This account shall include the...

  20. 15 CFR 256.1 - Introduction.

    Science.gov (United States)

    2010-01-01

    ... 15 Commerce and Foreign Trade 1 2010-01-01 2010-01-01 false Introduction. 256.1 Section 256.1 Commerce and Foreign Trade Regulations Relating to Commerce and Foreign Trade NATIONAL INSTITUTE OF... collaborative research aimed at furthering the Nation's scientific, industrial, and economic growth. Such...

  1. Nuclear Data Sheets for A=256

    Energy Technology Data Exchange (ETDEWEB)

    Singh, Balraj

    2017-03-15

    Available nuclear structure information for the known A=256 nuclei (Cf, Es, Fm, Md, No, Lr, Rf and Db) is presented together with Adopted properties of levels and gamma rays. This evaluation supersedes data in the previous evaluations of A=256 nuclides by 1999Ak02, 1989Sc26, 1981Sc06 and 1976Sc02.

  2. A Cache Timing Analysis of HC-256

    DEFF Research Database (Denmark)

    Zenner, Erik

    2009-01-01

    In this paper, we describe a cache-timing attack against the stream cipher HC-256, which is the strong version of eStream winner HC-128. The attack is based on an abstract model of cache timing attacks that can also be used for designing stream ciphers. From the observations made in our analysis,...

  3. 17 CFR 256.233 - Notes payable to associate companies.

    Science.gov (United States)

    2010-04-01

    ... associate companies. ... 17 Commodity and Securities Exchanges 3 2010-04-01 2010-04-01 false Notes payable to associate companies. 256.233 Section 256.233 Commodity and Securities Exchanges SECURITIES AND EXCHANGE COMMISSION...

  4. 17 CFR 256.458 - Services rendered to nonassociate companies.

    Science.gov (United States)

    2010-04-01

    ... nonassociate companies. 256.458 Section 256.458 Commodity and Securities Exchanges SECURITIES AND EXCHANGE COMMISSION (CONTINUED) UNIFORM SYSTEM OF ACCOUNTS FOR MUTUAL SERVICE COMPANIES AND SUBSIDIARY SERVICE COMPANIES, PUBLIC UTILITY HOLDING COMPANY ACT OF 1935 Income and Expense Accounts § 256.458 Services...

  5. 30 CFR 256.80 - Leases of other minerals.

    Science.gov (United States)

    2010-07-01

    ... 30 Mineral Resources 2 2010-07-01 2010-07-01 false Leases of other minerals. 256.80 Section 256.80 Mineral Resources MINERALS MANAGEMENT SERVICE, DEPARTMENT OF THE INTERIOR OFFSHORE LEASING OF SULPHUR OR OIL AND GAS IN THE OUTER CONTINENTAL SHELF Section 6 Leases § 256.80 Leases of other minerals. The...

  6. 27 CFR 24.256 - Bottle aging wine.

    Science.gov (United States)

    2010-04-01

    ... 27 Alcohol, Tobacco Products and Firearms 1 2010-04-01 2010-04-01 false Bottle aging wine. 24.256 Section 24.256 Alcohol, Tobacco Products and Firearms ALCOHOL AND TOBACCO TAX AND TRADE BUREAU, DEPARTMENT OF THE TREASURY LIQUORS WINE Storage, Treatment and Finishing of Wine Bottling, Packing, and Labeling of Wine § 24.256 Bottle aging wine. Wine...

  7. 17 CFR 256.123 - Investment in associate companies.

    Science.gov (United States)

    2010-04-01

    ... UTILITY HOLDING COMPANY ACT OF 1935 2. Investments § 256.123 Investment in associate companies. This... 17 Commodity and Securities Exchanges 3 2010-04-01 2010-04-01 false Investment in associate companies. 256.123 Section 256.123 Commodity and Securities Exchanges SECURITIES AND EXCHANGE COMMISSION...

  8. 27 CFR 25.6 - Delegations of the Administrator.

    Science.gov (United States)

    2010-04-01

    ... Administrator. 25.6 Section 25.6 Alcohol, Tobacco Products and Firearms ALCOHOL AND TOBACCO TAX AND TRADE BUREAU, DEPARTMENT OF THE TREASURY LIQUORS BEER Scope of Regulations § 25.6 Delegations of the Administrator. The regulatory authorities of the Administrator contained in this part are delegated to appropriate TTB officers...

  9. 30 CFR 256.25 - Areas near coastal States.

    Science.gov (United States)

    2010-07-01

    ... 30 Mineral Resources 2 2010-07-01 2010-07-01 false Areas near coastal States. 256.25 Section 256... SULPHUR OR OIL AND GAS IN THE OUTER CONTINENTAL SHELF Call for Information and Nominations § 256.25 Areas near coastal States. (a) At the time information is solicited for leasing of areas within 3...

  10. 30 CFR 256.8 - Leasing maps and diagrams.

    Science.gov (United States)

    2010-07-01

    ... 30 Mineral Resources 2 2010-07-01 2010-07-01 false Leasing maps and diagrams. 256.8 Section 256.8 Mineral Resources MINERALS MANAGEMENT SERVICE, DEPARTMENT OF THE INTERIOR OFFSHORE LEASING OF SULPHUR OR..., General § 256.8 Leasing maps and diagrams. (a) Any area of the OCS which has been appropriately platted as...

  11. A 256-channel pulse-height analyser

    International Nuclear Information System (INIS)

    Berset, J.C.; Delavallade, G.; Lindsay, J.

    1975-01-01

    The design, construction, and testing of a small, low-cost 256-channel pulse-height analyser is briefly discussed. The analyser, intended for use in the setting up of experiments in high-energy physics, is fully compatible with the CERN/NIM nucleonic instrumentation. It has a digital display of channel and content as well as outputs for printing, plotting, and binary transfer. The logic circuitry is made with TTL integrated circuits and has a static random-access MOS memory. Logic and timing diagrams are given. Detailed specifications are also included. (Author)

  12. Radiation characterization of a C256 EEPROM

    International Nuclear Information System (INIS)

    Wrobel, T.F.

    1989-01-01

    Total dose, dose-rate and high dose-rate memory retention results are presented for the SEEQ Technologies Inc., 28C256 floating gate electrically erasable programmable read only memory (EEPROM). Total dose failure levels are mode dependent, i.e. ∼33 krad(Si) for reading and ∼9.5 krad(Si) for writing. The write-mode failure level is dose-rated dependent, increasing from ∼10 krad(Si) at ∼11 rad(Si)/s to ∼ 28 krad(Si) at dose rates ∼0,1 rad(Si)/s Average upset and latch-up thresholds are 3.8 x 10 8 rad(Si)/s and 7.7 x 10 8 rad(Si)/s respectively. No latch-up windows were observed. Memory contents were retained following exposure up to 108 krad (Si) and following 1 x 10 12 rad(Si)/s

  13. 42 CFR 84.256 - Quality control requirements.

    Science.gov (United States)

    2010-10-01

    ... 42 Public Health 1 2010-10-01 2010-10-01 false Quality control requirements. 84.256 Section 84.256... § 84.256 Quality control requirements. (a) In addition to the construction and performance requirements specified in §§ 84.251, 84.252, 84.253, 84.254, and 84.255, the quality control requirements in paragraphs...

  14. 25 CFR 256.24 - Will I need flood insurance?

    Science.gov (United States)

    2010-04-01

    ... 25 Indians 1 2010-04-01 2010-04-01 false Will I need flood insurance? 256.24 Section 256.24... Will I need flood insurance? You will need flood insurance if your dwelling is located in an area identified as having special flood hazards under the Flood Disaster Protection Act of 1973 (Pub. L. 93-234...

  15. 17 CFR 256.01-10 - Billing procedures.

    Science.gov (United States)

    2010-04-01

    ...) UNIFORM SYSTEM OF ACCOUNTS FOR MUTUAL SERVICE COMPANIES AND SUBSIDIARY SERVICE COMPANIES, PUBLIC UTILITY HOLDING COMPANY ACT OF 1935 General Instructions § 256.01-10 Billing procedures. All invoices for services... 17 Commodity and Securities Exchanges 3 2010-04-01 2010-04-01 false Billing procedures. 256.01-10...

  16. 17 CFR 256.255 - Accumulated deferred investment tax credits.

    Science.gov (United States)

    2010-04-01

    ... investment tax credits. 256.255 Section 256.255 Commodity and Securities Exchanges SECURITIES AND EXCHANGE... investment tax credits. (a) This account shall be credited and account 411.5, Investment tax credit, debited with investment tax credits deferred by companies which do not apply such credits as a reduction of the...

  17. 17 CFR 256.146 - Accounts receivable from associate companies.

    Science.gov (United States)

    2010-04-01

    ... associate companies. 256.146 Section 256.146 Commodity and Securities Exchanges SECURITIES AND EXCHANGE... receivable from associate companies. This account shall include notes and balances in open accounts due from associate companies which are expected to be paid in full within one year. Note: Occasional payments to...

  18. 17 CFR 256.234 - Accounts payable to associate companies.

    Science.gov (United States)

    2010-04-01

    ... associate companies. These accounts shall include notes and balances in open accounts due to associate... 17 Commodity and Securities Exchanges 3 2010-04-01 2010-04-01 false Accounts payable to associate companies. 256.234 Section 256.234 Commodity and Securities Exchanges SECURITIES AND EXCHANGE COMMISSION...

  19. 17 CFR 256.101 - Service company property.

    Science.gov (United States)

    2010-04-01

    ... 17 Commodity and Securities Exchanges 3 2010-04-01 2010-04-01 false Service company property. 256...) UNIFORM SYSTEM OF ACCOUNTS FOR MUTUAL SERVICE COMPANIES AND SUBSIDIARY SERVICE COMPANIES, PUBLIC UTILITY HOLDING COMPANY ACT OF 1935 Balance Sheet Accounts: Assets and Other Debit Accounts § 256.101 Service...

  20. 17 CFR 256.411.5 - Investment tax credit.

    Science.gov (United States)

    2010-04-01

    ... 17 Commodity and Securities Exchanges 3 2010-04-01 2010-04-01 false Investment tax credit. 256.411... HOLDING COMPANY ACT OF 1935 Income and Expense Accounts § 256.411.5 Investment tax credit. (a) This account shall be debited with the amounts of investment tax credits related to service company property...

  1. 17 CFR 256.201 - Common stock issued.

    Science.gov (United States)

    2010-04-01

    ... 17 Commodity and Securities Exchanges 3 2010-04-01 2010-04-01 false Common stock issued. 256.201... COMPANY ACT OF 1935 Liabilities and Other Credit Accounts § 256.201 Common stock issued. This account shall include the par or stated value of all common capital stock issued and outstanding. ...

  2. Dicty_cDB: VFJ256 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VF (Link to library) VFJ256 (Link to dictyBase) - - - Contig-U10140-1 VFJ256E (Link...) Clone ID VFJ256 (Link to dictyBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U10140-1 Ori...*nq*fylv*l*vx*KMNKLHLPIKENHHQXIKSIELIKNEFPEILICTDLCLC AYTDHGHCGVLTEEGFIENEKSIIRLG...iiikiih iiyivdmpiqlldhgkvimsf*nln*fiqfllqi*liqklklnpyqdnikfqvi**lnf* dhwlrkd*nq*fylv*l*vx*KMNKLHLPIKENHHQXIKSIELIKNEFPEILICT...pdate 2002.12.18 Homology vs DNA Score E Sequences producing significant alignments: (bits) Value N ( BJ432755 ) Dict

  3. 17 CFR 256.190 - Accumulated deferred income taxes.

    Science.gov (United States)

    2010-04-01

    .... proprietary capital ... (CONTINUED) UNIFORM SYSTEM OF ACCOUNTS FOR MUTUAL SERVICE COMPANIES AND SUBSIDIARY SERVICE COMPANIES, PUBLIC UTILITY HOLDING COMPANY ACT OF 1935 4. Deferred Debits § 256.190 Accumulated deferred income taxes. (a...

  4. 17 CFR 256.174 - Miscellaneous current and accrued assets.

    Science.gov (United States)

    2010-04-01

    ... COMMISSION (CONTINUED) UNIFORM SYSTEM OF ACCOUNTS FOR MUTUAL SERVICE COMPANIES AND SUBSIDIARY SERVICE COMPANIES, PUBLIC UTILITY HOLDING COMPANY ACT OF 1935 3. Current and Accrued Assets § 256.174 Miscellaneous... nature of each asset included herein. 4. deferred debits ...

  5. 17 CFR 256.136 - Temporary cash investments.

    Science.gov (United States)

    2010-04-01

    ... (CONTINUED) UNIFORM SYSTEM OF ACCOUNTS FOR MUTUAL SERVICE COMPANIES AND SUBSIDIARY SERVICE COMPANIES, PUBLIC UTILITY HOLDING COMPANY ACT OF 1935 3. Current and Accrued Assets § 256.136 Temporary cash investments... the purpose of temporarily investing cash. ...

  6. Design and Development of 256x256 Linear Mode Low-Noise Avalanche Photodiode Arrays

    Science.gov (United States)

    Yuan, Ping; Sudharsanan, Rengarajan; Bai, Xiaogang; Boisvert, Joseph; McDonald, Paul; Chang, James

    2011-01-01

    A larger format photodiode array is always desirable for many LADAR imaging applications. However, as the array format increases, the laser power or the lens aperture has to increase to maintain the same flux per pixel thus increasing the size, weight and power of the imaging system. In order to avoid this negative impact, it is essential to improve the pixel sensitivity. The sensitivity of a short wavelength infrared linear-mode avalanche photodiode (APD) is a delicate balance of quantum efficiency, usable gain, excess noise factor, capacitance, and dark current of APD as well as the input equivalent noise of the amplifier. By using InA1As as a multiplication layer in an InP-based APD, the ionization coefficient ratio, k, is reduced from 0.40 (lnP) to 0.22, and the excess noise is reduced by about 50%. An additional improvement in excess noise of 25% was achieved by employing an impact-ionization-engineering structure with a k value of 0.15. Compared with the traditional InP structure, about 30% reduction in the noise-equivalent power with the following amplifier can be achieved. Spectrolab demonstrated 30-um mesa APD pixels with a dark current less than 10 nA and a capacitance of 60 fF at gain of 10. APD gain uninformity determines the usable gain of most pixels in an array, which is critical to focal plane array sensitivity. By fine tuning the material growth and device process, a break-down-voltage standard deviation of 0.1 V and gain of 30 on individual pixels were demonstrated in our 256x256 linear-mode APD arrays.

  7. A 256 channel digital filter for a data acquisition system

    International Nuclear Information System (INIS)

    Roberts, W.; Aikens, B.

    1991-01-01

    The TRIUMF Central Control System (CCS) employs several data acquisition systems to monitor its operational parameters. Each system multiplexes 256 analog channels into one analog to digital converter. Space constraints on the multiplexer cards prohibit the installation of adequate anti-alias filters which allows 60 Hz and other noise to corrupt the measurements. The new system overcomes this problem by sampling each channel at a 160 samples/second rate and using a DSP microcomputer to lowpass filter the data. The multiplexer and analog-digital converter operate at 256 times the channel sample rate. The channel filter bandwidth is restricted to approximately 1 Hz due to the rate at which the CCS reads the data. One DSP microcomputer is able to filter the 256 channels in a multiplexed system at a cost less than that of the anti-alias filters which would otherwise have been required

  8. 38 CFR 3.256 - Eligibility reporting requirements.

    Science.gov (United States)

    2010-07-01

    ....256 Eligibility reporting requirements. (a) Obligation to report changes in factors affecting... compensation must promptly notify the Secretary of any change affecting entitlement in any of the following: (1) Income; (2) Net worth or corpus of estate; (3) Marital status; (4) Nursing home patient status; (5...

  9. 17 CFR 256.403 - Depreciation and amortization expense.

    Science.gov (United States)

    2010-04-01

    ... 17 Commodity and Securities Exchanges 3 2010-04-01 2010-04-01 false Depreciation and amortization... UTILITY HOLDING COMPANY ACT OF 1935 Income and Expense Accounts § 256.403 Depreciation and amortization expense. This account shall include the amount of depreciation and amortization for all service plant, and...

  10. 17 CFR 256.426.5 - Other deductions.

    Science.gov (United States)

    2010-04-01

    ...) UNIFORM SYSTEM OF ACCOUNTS FOR MUTUAL SERVICE COMPANIES AND SUBSIDIARY SERVICE COMPANIES, PUBLIC UTILITY HOLDING COMPANY ACT OF 1935 Income and Expense Accounts § 256.426.5 Other deductions. (a) This account shall include other miscellaneous expenses which are nonoperating in nature but which are properly...

  11. 17 CFR 256.242 - Miscellaneous current and accrued liabilities.

    Science.gov (United States)

    2010-04-01

    ... COMMISSION (CONTINUED) UNIFORM SYSTEM OF ACCOUNTS FOR MUTUAL SERVICE COMPANIES AND SUBSIDIARY SERVICE COMPANIES, PUBLIC UTILITY HOLDING COMPANY ACT OF 1935 7. Current and Accrued Liabilities § 256.242... as to show the nature of each liability included herein. 8. deferred credits ...

  12. 17 CFR 256.923 - Outside services employed.

    Science.gov (United States)

    2010-04-01

    ...) UNIFORM SYSTEM OF ACCOUNTS FOR MUTUAL SERVICE COMPANIES AND SUBSIDIARY SERVICE COMPANIES, PUBLIC UTILITY HOLDING COMPANY ACT OF 1935 2. Expense § 256.923 Outside services employed. (a) This account shall include... services. (b) Records shall be so maintained to permit ready analysis showing nature of service, identity...

  13. 17 CFR 256.308 - Office furniture and equipment.

    Science.gov (United States)

    2010-04-01

    ... 17 Commodity and Securities Exchanges 3 2010-04-01 2010-04-01 false Office furniture and equipment... UTILITY HOLDING COMPANY ACT OF 1935 Service Company Property Accounts § 256.308 Office furniture and equipment. This account shall include the cost of office furniture and equipment owned by the service...

  14. 17 CFR 256.457 - Services rendered to associate companies.

    Science.gov (United States)

    2010-04-01

    ... UTILITY HOLDING COMPANY ACT OF 1935 Income and Expense Accounts § 256.457 Services rendered to associate companies. This control account shall include amounts billed to associate companies for services rendered at... 17 Commodity and Securities Exchanges 3 2010-04-01 2010-04-01 false Services rendered to associate...

  15. 17 CFR 256.223 - Advances from associate companies.

    Science.gov (United States)

    2010-04-01

    ... UTILITY HOLDING COMPANY ACT OF 1935 6. Long-Term Debt § 256.223 Advances from associate companies. This... settlement which are includable in account 233, Notes payable to associate companies or account 234, Accounts payable to associate companies. Note: Subaccounts shall be maintained for each class of obligation, and...

  16. 17 CFR 256.928 - Regulatory commission expense.

    Science.gov (United States)

    2010-04-01

    ... own behalf or on behalf of associated companies, including payments made to a regulatory commission... (CONTINUED) UNIFORM SYSTEM OF ACCOUNTS FOR MUTUAL SERVICE COMPANIES AND SUBSIDIARY SERVICE COMPANIES, PUBLIC UTILITY HOLDING COMPANY ACT OF 1935 2. Expense § 256.928 Regulatory commission expense. This account shall...

  17. 49 CFR 256.15 - Disbursement of financial assistance.

    Science.gov (United States)

    2010-10-01

    ... disposition by such recipient of the proceeds of such assistance, the total cost of the project or undertaking... 49 Transportation 4 2010-10-01 2010-10-01 false Disbursement of financial assistance. 256.15... ADMINISTRATION, DEPARTMENT OF TRANSPORTATION FINANCIAL ASSISTANCE FOR RAILROAD PASSENGER TERMINALS Regulations...

  18. 17 CFR 256.311 - Other service company property.

    Science.gov (United States)

    2010-04-01

    ... 17 Commodity and Securities Exchanges 3 2010-04-01 2010-04-01 false Other service company property... (CONTINUED) UNIFORM SYSTEM OF ACCOUNTS FOR MUTUAL SERVICE COMPANIES AND SUBSIDIARY SERVICE COMPANIES, PUBLIC UTILITY HOLDING COMPANY ACT OF 1935 Service Company Property Accounts § 256.311 Other service company...

  19. 17 CFR 256.930.1 - General advertising expenses.

    Science.gov (United States)

    2010-04-01

    ... 17 Commodity and Securities Exchanges 3 2010-04-01 2010-04-01 false General advertising expenses... UTILITY HOLDING COMPANY ACT OF 1935 2. Expense § 256.930.1 General advertising expenses. This account shall include the cost of materials used and expenses incurred in advertising and related activities...

  20. 17 CFR 256.01-4 - Construction or service contracts, and centralized procurement accounting.

    Science.gov (United States)

    2010-04-01

    ... contracts, and centralized procurement accounting. 256.01-4 Section 256.01-4 Commodity and Securities... § 256.01-4 Construction or service contracts, and centralized procurement accounting. (a) Specific accounts have not been provided in which to classify expenditures made in the performance of construction...

  1. 17 CFR 256.108 - Accumulated provision for depreciation and amortization of service company property.

    Science.gov (United States)

    2010-04-01

    ... depreciation and amortization of service company property. 256.108 Section 256.108 Commodity and Securities... Accounts: Assets and Other Debit Accounts § 256.108 Accumulated provision for depreciation and amortization... 403, Depreciation and amortization expense. (b) At the time of retirement of depreciable service...

  2. 6 CFR 25.6 - Procedures for designation of qualified anti-terrorism technologies.

    Science.gov (United States)

    2010-01-01

    ...-terrorism technologies. 25.6 Section 25.6 Domestic Security DEPARTMENT OF HOMELAND SECURITY, OFFICE OF THE SECRETARY REGULATIONS TO SUPPORT ANTI-TERRORISM BY FOSTERING EFFECTIVE TECHNOLOGIES § 25.6 Procedures for designation of qualified anti-terrorism technologies. (a) Application Procedure. Any person, firm or other...

  3. 32 CFR 256.10 - Air installations compatible use zone noise descriptors.

    Science.gov (United States)

    2010-07-01

    ... 32 National Defense 2 2010-07-01 2010-07-01 false Air installations compatible use zone noise descriptors. 256.10 Section 256.10 National Defense Department of Defense (Continued) OFFICE OF THE SECRETARY OF DEFENSE (CONTINUED) MISCELLANEOUS AIR INSTALLATIONS COMPATIBLE USE ZONES § 256.10 Air installations compatible use zone noise descriptors. (...

  4. Metalloproteins during development of Walker-256 carcinosarcoma resistant phenotype

    Directory of Open Access Journals (Sweden)

    V. F. Chekhun

    2015-04-01

    Full Text Available The study was focused on the detection of changes in serum and tumor metal-containing proteins in animals during development of doxorubicin-resistant phenotype in malignant cells after 12 courses of chemotherapy. We found that on every stage of resistance development there was a significant increase in content of ferritin and transferrin proteins (which take part in iron traffick and storage in Walker-256 carcinosarcoma tissue. We observed decreased serum ferritin levels at the beginning stage of the resistance development and significant elevation of this protein levels in the cases with fully developed resistance phenotype. Transferrin content showed changes opposite to that of ferritin. During the development of resistance phenotype the tumor tissue also exhibited increased ‘free iron’ concentration that putatively correlate with elevation of ROS generation and levels of MMP-2 and MMP-9 active forms. The tumor non-protein thiol content increases gradually as well. The serum of animals with early stages of resistance phenotype development showed high ceruloplasmin activity and its significant reduction after loss of tumor sensitivity to doxorubicin. Therefore, the development of resistance phenotype in Walker-256 carcinosarcoma is accompanied by both the deregulation of metal-containing proteins in serum and tumor tissue and by the changes in activity of antioxidant defense system. Thus, the results of this study allow us to determine the spectrum of metal-containing proteins that are involved in the development of resistant tumor phenotype and that may be targeted for methods for doxorubicin sensitivity correction therapy.

  5. Phenotype-gene: 256 [Arabidopsis Phenome Database[Archive

    Lifescience Database Archive (English)

    Full Text Available 256 http://metadb.riken.jp/db/SciNetS_ria224i/cria224u3ria224u1254i delayed in org...an named root hair cell during process named organ development for AT1G71230 Dohmann Esther M N et al. 2005 ...Jul. Plant Cell 17(7):1967-78. http://metadb.riken.jp/db/SciNetS_ria224i/cria224u4ria224u15923347i delayed i...n organ named root hair cell during process named organ development http://metadb.riken.jp/db/SciNetS_ria224i/cria224u1ria224u752i AT1G71230

  6. Decay properties of {sup 256-339}Ds superheavy nuclei

    Energy Technology Data Exchange (ETDEWEB)

    Santhosh, K.P.; Nithya, C. [Kannur University, School of Pure and Applied Physics, Payyanur, Kerala (India)

    2017-09-15

    The decay properties of 84 isotopes of darmstadtium superheavy nuclei (Z = 110) have been studied using various theoretical models. The proton emission half-lives, the alpha decay half-lives, the spontaneous fission half-lives and the cluster decay half-lives of all the isotopes are evaluated. The one-proton emission half-lives and the alpha decay half-lives are predicted using the Coulomb and proximity potential model for deformed nuclei (CPPMDN). The calculated alpha half-lives are compared with the available experimental results as well as with the predictions of other theoretical models. The predicted half-lives matches well with the experimental results. The one-proton half-lives are also compared with the predictions using other formalisms. The shell-effect-dependent formula of Santhosh et al. has been employed for calculating the spontaneous fission half-lives. A theoretical comparison of spontaneous fission half-lives with four different formalisms is performed. By comparing the one-proton emission half-lives, the alpha decay half-lives and the spontaneous fission half-lives decay modes are predicted for all the isotopes of Ds. It is seen that the isotopes within the range 256 ≤ A ≤ 263 and 279 ≤ A ≤ 339 decay through spontaneous fission and the isotopes 264 ≤ A ≤ 278 exhibit alpha decay. Cluster decay half-lives are calculated using different models including the Coulomb and proximity potential (CPPM), for determining the magicities in the superheavy region. The effect of magicity at N = 184 and N = 202 were confirmed from the plot of log{sub 10}T{sub 1/2} versus neutron number of the daughter nuclei for the emission of different clusters. We hope that the systematic and detailed study of all the possible decay modes of {sup 256-339}Ds using various theoretical models will be helpful in the experimental identification of the isotopes of the element in the future. (orig.)

  7. Glucagon degradation by a product of the Walker 256 carcinosarcoma

    International Nuclear Information System (INIS)

    Zepp, E.A.

    1986-01-01

    Male Sprague-Dawley rats (125-150g) were implanted (im.) with the Walker 256 carcinosarcoma. After both 7 and 10 days, plasma levels of glucagon in tumor-bearing rats were approximately half the level seen in control rats (P 125 I-glucagon (0.075 μCi, 2200 Ci/mmol) in 20mM TRIS-HCl buffer (pH 7.4) with 2.5% bovine serum albumin (total volume of 750 μl) for 45 min. After incubation with tumor cells, only about 25% of the total radiolabel was TCA-precipitable vs 97% in the control (minus tumor cells) incubations. It also appears that the tumor cells may release a substance which degrades hormone. If tumor cells are preincubated for 60 min at 37 0 then removed from the medium, the incubation medium contains a factor which degrades subsequently added 125 I-glucagon (57% TCA-precipitable vs 98% in control incubations). That this factor is a protease is suggested by the results of another experiment in which aprotinin (a protease inhibitor, 1 mg/ml), when added along with the labeled glucagon, virtually eliminated degradation by a factor released from the tumor cells (79% TCA-precipitable in the absence of aprotinin vs 94% in its presence and 98% in controls)

  8. 31 CFR 256.41 - When is reimbursement due for CDA and No FEAR payments?

    Science.gov (United States)

    2010-07-01

    ... No FEAR payments? 256.41 Section 256.41 Money and Finance: Treasury Regulations Relating to Money and... When is reimbursement due for CDA and No FEAR payments? Reimbursement for a CDA or No FEAR payment... Management (OPM) regulations, No FEAR reimbursements or payment reimbursement plans must be made within 45...

  9. 17 CFR 256.01-5 - Determination of service cost accounting.

    Science.gov (United States)

    2010-04-01

    ... accounting. Service at cost and fair allocation of costs require, first of all, an accurate accounting for... 17 Commodity and Securities Exchanges 3 2010-04-01 2010-04-01 false Determination of service cost accounting. 256.01-5 Section 256.01-5 Commodity and Securities Exchanges SECURITIES AND EXCHANGE COMMISSION...

  10. 17 CFR 256.411 - Provision for deferred income taxes-credit.

    Science.gov (United States)

    2010-04-01

    ... taxes-credit. 256.411 Section 256.411 Commodity and Securities Exchanges SECURITIES AND EXCHANGE... deferred income taxes—credit. This account shall be credited and Accumulated Deferred Income Taxes debited with an amount equal to the portion of taxes on income payable for the year which is attributable to a...

  11. 17 CFR 256.457-3 - Compensation for use of capital-associate companies.

    Science.gov (United States)

    2010-04-01

    ... capital-associate companies. 256.457-3 Section 256.457-3 Commodity and Securities Exchanges SECURITIES AND... Compensation for use of capital-associate companies. This account shall include only the portion of... properly allocable to services rendered to each associate company. ...

  12. 17 CFR 256.457-2 - Indirect costs charged to associate companies.

    Science.gov (United States)

    2010-04-01

    ... associate companies. 256.457-2 Section 256.457-2 Commodity and Securities Exchanges SECURITIES AND EXCHANGE... charged to associate companies. This account shall include recovery of those indirect costs which cannot be separately identified to a single or group of associate companies and therefore must be allocated...

  13. 17 CFR 256.457-1 - Direct costs charged to associate companies.

    Science.gov (United States)

    2010-04-01

    ... associate companies. 256.457-1 Section 256.457-1 Commodity and Securities Exchanges SECURITIES AND EXCHANGE... charged to associate companies. This account shall include those direct costs which can be identified through a work order system as being applicable to services performed for associate companies. This...

  14. 42 CFR 422.256 - Review, negotiation, and approval of bids.

    Science.gov (United States)

    2010-10-01

    ... 42 Public Health 3 2010-10-01 2010-10-01 false Review, negotiation, and approval of bids. 422.256... Information and Plan Approval § 422.256 Review, negotiation, and approval of bids. (a) Authority. Subject to... submitted under § 422.252 and conduct negotiations with MA organizations regarding these bids (including the...

  15. 17 CFR 256.01-3 - General structure of accounting system.

    Science.gov (United States)

    2010-04-01

    ... accounting system. 256.01-3 Section 256.01-3 Commodity and Securities Exchanges SECURITIES AND EXCHANGE COMMISSION (CONTINUED) UNIFORM SYSTEM OF ACCOUNTS FOR MUTUAL SERVICE COMPANIES AND SUBSIDIARY SERVICE... accounting system. (a) The accounts provided herein are in two general categories: Balance sheet accounts and...

  16. 40 CFR 52.256 - Control of evaporative losses from the filling of vehicular tanks.

    Science.gov (United States)

    2010-07-01

    ... filling of vehicular tanks. 52.256 Section 52.256 Protection of Environment ENVIRONMENTAL PROTECTION... discharge of hydrocarbon vapors to the atmosphere from either the vehicle filler neck or dispensing nozzle... sign all necessary contracts for emission control systems, or issue orders for the purchase of...

  17. 25 CFR 256.19 - Who performs the improvements, repairs, or replacement of my dwelling?

    Science.gov (United States)

    2010-04-01

    ... my dwelling? 256.19 Section 256.19 Indians BUREAU OF INDIAN AFFAIRS, DEPARTMENT OF THE INTERIOR... dwelling? Independent or tribal repair or construction trades persons, home building contractors, or construction companies will perform the repairs, renovation, or replacement of your dwelling. [63 FR 10134, Mar...

  18. Glucagon degradation by a product of the Walker 256 carcinosarcoma

    Energy Technology Data Exchange (ETDEWEB)

    Zepp, E.A.

    1986-03-05

    Male Sprague-Dawley rats (125-150g) were implanted (im.) with the Walker 256 carcinosarcoma. After both 7 and 10 days, plasma levels of glucagon in tumor-bearing rats were approximately half the level seen in control rats (P < 0.01) even though fasting plasma glucose levels were slightly (but not significantly) less in the tumor-bearing rats. To determine if the tumor degrades the hormone, tumor cells were incubated at room temperature with /sup 125/I-glucagon (0.075 ..mu..Ci, 2200 Ci/mmol) in 20mM TRIS-HCl buffer (pH 7.4) with 2.5% bovine serum albumin (total volume of 750 ..mu..l) for 45 min. After incubation with tumor cells, only about 25% of the total radiolabel was TCA-precipitable vs 97% in the control (minus tumor cells) incubations. It also appears that the tumor cells may release a substance which degrades hormone. If tumor cells are preincubated for 60 min at 37/sup 0/ then removed from the medium, the incubation medium contains a factor which degrades subsequently added /sup 125/I-glucagon (57% TCA-precipitable vs 98% in control incubations). That this factor is a protease is suggested by the results of another experiment in which aprotinin (a protease inhibitor, 1 mg/ml), when added along with the labeled glucagon, virtually eliminated degradation by a factor released from the tumor cells (79% TCA-precipitable in the absence of aprotinin vs 94% in its presence and 98% in controls).

  19. Incidental sinus abnormalities in 256 patients referred for brain MRI

    Directory of Open Access Journals (Sweden)

    Ghanaati H

    2007-06-01

    Full Text Available Background: Imaging abnormalities in the paranasal sinuses are regularly noted as incidental findings on MRI, however, little is known about their prevalence in the Iranian population. The purpose of this study was to classify these findings in the paranasal sinuses as seen on MRI and to investigate the prevalence, according to site and type of paranasal abnormality. Methods: In this cross-sectional study, the T2-weighted axial MRI of 256 patients with diseases unrelated to their paranasal sinuses were reviewed between May 2002 and June 2003. The findings were categorized according to the anatomic location and the imaging characteristics of the abnormality. The abnormalities recorded included total sinus opacification, mucoperiosteal thickening >5mm, air fluid levels and retention cysts or polyps. Unilateral or bilateral involvement and septal deviation were also noted. A sinus was considered normal if it was fully aerated and no soft-tissue density was apparent within the cavity. Results: Among our cases, 111 (43.5% were male and 145 (56.5% were female. Of these patients, abnormalities in one or more of the sinus groups were found in 110 subjects (42.9%, 55.5% of which were male and 44.5% were female (P=0.001. Maxillary sinus abnormalities were observed in 66.4% of the patients, while ethmoid sinus abnormalities were found in 63.6%. Of the ethmoid abnormalities, 21% were found in the anterior section, 9% in the middle ethmoid, and 8% in the posterior ethmoid. The most common abnormality found was mucosal thickening. Among our cases, 23.4% had septal deviation, which was significantly higher among those with sinusitis (29% versus 19.1%; P<0.01. Of those patients with sinus involvement, 16% were involved in the sphenoid sinus and 5% in the frontal sinus. The results obtained from the patients with sinus abnormality revealed that 85% suffered from cough, nasal obstruction, runny nose, facial pain and post nasal discharge and 24% had been diagnosed

  20. 25 CFR 256.26 - Can I receive Housing Improvement Program services if I am living in a mobile home?

    Science.gov (United States)

    2010-04-01

    ... § 256.7. If you require Category B services and your mobile home has exterior walls of less than three... 25 Indians 1 2010-04-01 2010-04-01 false Can I receive Housing Improvement Program services if I am living in a mobile home? 256.26 Section 256.26 Indians BUREAU OF INDIAN AFFAIRS, DEPARTMENT OF THE...

  1. High-Speed, Low Power 256 Channel Gamma Radiation Array Detector ASIC, Phase I

    Data.gov (United States)

    National Aeronautics and Space Administration — Building on prior success in detector electronics, we propose to design and fabricate a 256 channel readout ASIC for solid state gamma radiation array detectors...

  2. Nonlinear Phase Noise Compensation in Experimental WDM Systems with 256QAM

    DEFF Research Database (Denmark)

    Yankov, Metodi Plamenov; Da Ros, Francesco; Porto da Silva, Edson

    2017-01-01

    Nonlinear phase noise (NLPN) is studied in an experimental wavelength division multiplexed (WDM) system operating at 256QAM. Extremely narrow linewidth lasers (extracting the phase part of the nonlinear noise in a Raman amplified link. Based...

  3. Shot-By-Shot Erosion Modeling of Retired 120mm M256 Gun Tube #1988

    National Research Council Canada - National Science Library

    Sopok, S

    1998-01-01

    .... Our Materials Ablation Conduction Erosion (MACE) M256/M829A2 gun system erosion model, with its interior ballistics, thermochemistry, and boundary layer components, is constantly being refined by this erosion data...

  4. Investigation of Antioxidative and Anticancer Potentials of Streptomyces sp. MUM256 Isolated from Malaysia Mangrove Soil.

    Science.gov (United States)

    Tan, Loh Teng-Hern; Ser, Hooi-Leng; Yin, Wai-Fong; Chan, Kok-Gan; Lee, Learn-Han; Goh, Bey-Hing

    2015-01-01

    A Streptomyces strain, MUM256 was isolated from Tanjung Lumpur mangrove soil in Malaysia. Characterization of the strain showed that it has properties consistent with those of the members of the genus Streptomyces. In order to explore the potential bioactivities, extract of the fermented broth culture of MUM256 was prepared with organic solvent extraction method. DPPH and SOD activity were utilized to examine the antioxidant capacity and the results have revealed the potency of MUM256 in superoxide anion scavenging activity in dose-dependent manner. The cytotoxicity of MUM256 extract was determined using cell viability assay against 8 different panels of human cancer cell lines. Among all the tested cancer cells, HCT116 was the most sensitive toward the extract treatment. At the highest concentration of tested extract, the result showed 2.3-, 2.0-, and 1.8-folds higher inhibitory effect against HCT116, HT29, and Caco-2 respectively when compared to normal cell line. This result has demonstrated that MUM256 extract was selectively cytotoxic toward colon cancer cell lines. In order to determine the constituents responsible for its bioactivities, the extract was then subjected to chemical analysis using GC-MS. The analysis resulted in the identification of chemical constituents including phenolic and pyrrolopyrazine compounds which may responsible for antioxidant and anticancer activities observed. Based on the findings of this study, the presence of bioactive constituents in MUM256 extract could be a potential source for the development of antioxidative and chemopreventive agents.

  5. Investigation of antioxidative and anticancer potentials of Streptomyces sp. MUM256 isolated from Malaysia mangrove soil

    Directory of Open Access Journals (Sweden)

    Tan Loh eTeng Hern

    2015-11-01

    Full Text Available A Streptomyces strain, MUM256 was isolated from Tanjung Lumpur mangrove soil in Malaysia. Characterization of the strain showed that it has properties consistent with those of the members of the genus Streptomyces. In order to explore the potential bioactivities, extract of the fermented broth culture of MUM256 was prepared with organic solvent extraction method. DPPH and SOD activity were utilized to examine the antioxidant capacity and the results have revealed the potency of MUM256 in superoxide anion scavenging activity in dose-dependent manner. The cytotoxicity of MUM256 extract was determined using cell viability assay against 8 different panels of human cancer cell lines. Among all the tested cancer cells, HCT116 was the most sensitive toward the extract treatment. At the highest concentration of tested extract, the result showed 2.3, 2.0 and 1.8 folds higher inhibitory effect against HCT116, HT29 and Caco-2 respectively when compared to normal cell line. This result has demonstrated that MUM256 extract was selectively cytotoxic towards colon cancer cell lines. In order to determine the constituents responsible for its bioactivities, the extract was then subjected to chemical analysis using GC-MS. The analysis resulted in the identification of chemical constituents including phenolic and pyrrolopyrazine compounds which may responsible for antioxidant and anticancer activities observed. Based on the findings of this study, the presence of bioactive constituents in MUM256 extract could be a potential source for the development of antioxidative and chemopreventive agents.

  6. The RBE of Fractionated Fast Neutron on Walker 256 Carcinosarcoma with KCCH-Cyclotron

    Energy Technology Data Exchange (ETDEWEB)

    Yoo, Seong Yul; Koh, Kyoung Hwan; Cho, Chul Koo [Korea Cancer Center Hospital, Seoul (Korea, Republic of); Park, Charn Il; Kang, Wee Saing [Seoul National University College of Medicine, Seoul (Korea, Republic of)

    1987-12-15

    For evaluation of biological effect of p+(50.5 MeV) Be neutron beam produced by Korea Cancer Center Hospital(KCCH) cyclotron the RBE had been measured in experimental tumor Walker 256 carcinosarcoma as well as normal tissue, mouse intestine and bone marrow, in single and fractionated irradiation. As pilot study, the RBE had been measured for the mouse jejunal crypt cells in single whole body irradiation of which the result was 2.8. The obtained RBE values of TCD 50 of Walker 256 tumor, bone marrow and intestine in single irradiation were 1.9, 1.9 and 1.5 respectively. In fractionated irradiation, the RBE value of tumor Walker 256 was decreased as increasing of fraction number and increased as increasing of fraction size.

  7. PERBANDINGAN APLIKASI MENGGUNAKAN METODE CAMELLIA 128 BIT KEY DAN 256 BIT KEY

    Directory of Open Access Journals (Sweden)

    Lanny Sutanto

    2014-01-01

    Full Text Available The rapid development of the Internet today to easily exchange data. This leads to high levels of risk in the data piracy. One of the ways to secure data is using cryptography camellia. Camellia is known as a method that has the encryption and decryption time is fast. Camellia method has three kinds of scale key is 128 bit, 192 bit, and 256 bit.This application is created using the C++ programming language and using visual studio 2010 GUI. This research compare the smallest and largest key size used on the file extension .Txt, .Doc, .Docx, .Jpg, .Mp4, .Mkv and .Flv. This application is made to comparing time and level of security in the use of 128-bit key and 256 bits. The comparison is done by comparing the results of the security value of avalanche effect 128 bit key and 256 bit key.

  8. Presence of dynorphin-like immunoreactivity but not opiate binding in Walker-256 tumors

    Energy Technology Data Exchange (ETDEWEB)

    Bryant, H.U.; Conroy, W.G.; Isom, G.E.; Malven, P.V.; Yim, G.K.W.

    1985-07-15

    Walker-256 tumor tissue was removed from rats on day 8 of tumor growth. An acidified methanol extract of the tumor tissue was assayed for immunoreactive (ir) dynorphin-A 1-17 (DYN-17) and ir-dynorphin-A (DYN-8). Levels of ir-DYN-17 and ir-DYN-8 were nearly 4- and 8-fold higher, respectively, in tumors versus normal muscle. However, tumor homogenates did not exhibit specific /sup 3/H-naloxone binding. These results indicate that although the Walker-256 carcinosarcoma may produce opioids, it is unlikely that these ectopic substances have direct opioid actions on the tumor itself. 34 references, 1 figure.

  9. 25 CFR 256.18 - How will I be advised of what work is to be done?

    Science.gov (United States)

    2010-04-01

    ... 25 Indians 1 2010-04-01 2010-04-01 false How will I be advised of what work is to be done? 256.18 Section 256.18 Indians BUREAU OF INDIAN AFFAIRS, DEPARTMENT OF THE INTERIOR HOUSING HOUSING IMPROVEMENT PROGRAM § 256.18 How will I be advised of what work is to be done? You will receive written notice from the servicing housing office of what work...

  10. 17 CFR 256.309 - Automobiles, other vehicles, and related garage equipment.

    Science.gov (United States)

    2010-04-01

    ... 17 Commodity and Securities Exchanges 3 2010-04-01 2010-04-01 false Automobiles, other vehicles... § 256.309 Automobiles, other vehicles, and related garage equipment. This account shall include the delivered cost of all service company owned automobiles, vans, trucks, and other vehicles used by the...

  11. 40 CFR 256.61 - Requirements for public participation in the annual State work program.

    Science.gov (United States)

    2010-07-01

    ... MANAGEMENT PLANS Public Participation § 256.61 Requirements for public participation in the annual State work program. (a) A public participation work plan in accord with 40 CFR 25.11 shall be included in the annual State work program. (b) The State shall consult with the public in the development of the annual work...

  12. 31 CFR 256.52 - How does FMS issue a payment?

    Science.gov (United States)

    2010-07-01

    ... requirement for payment by EFT is appropriate, FMS will issue a payment by check. The Voucher for Payment must... 31 Money and Finance: Treasury 2 2010-07-01 2010-07-01 false How does FMS issue a payment? 256.52... SERVICE, DEPARTMENT OF THE TREASURY FINANCIAL MANAGEMENT SERVICE OBTAINING PAYMENTS FROM THE JUDGMENT FUND...

  13. 40 CFR 256.02 - Scope of the State solid waste management plan.

    Science.gov (United States)

    2010-07-01

    ...) SOLID WASTES GUIDELINES FOR DEVELOPMENT AND IMPLEMENTATION OF STATE SOLID WASTE MANAGEMENT PLANS Purpose, General Requirements, Definitions § 256.02 Scope of the State solid waste management plan. (a)(1) The... plan shall consider the following aspects of solid waste management: (i) Resource conservation; (ii...

  14. Ultrahigh-Density 256-Channel Neural Sensing Microsystem Using TSV-Embedded Neural Probes.

    Science.gov (United States)

    Huang, Yu-Chieh; Huang, Po-Tsang; Wu, Shang-Lin; Hu, Yu-Chen; You, Yan-Huei; Chen, Jr-Ming; Huang, Yan-Yu; Chang, Hsiao-Chun; Lin, Yen-Han; Duann, Jeng-Ren; Chiu, Tzai-Wen; Hwang, Wei; Chen, Kuan-Neng; Chuang, Ching-Te; Chiou, Jin-Chern

    2017-10-01

    Highly integrated neural sensing microsystems are crucial to capture accurate signals for brain function investigations. In this paper, a 256-channel neural sensing microsystem with a sensing area of 5 × 5 mm 2 is presented based on 2.5-D through-silicon-via (TSV) integration. This microsystem composes of dissolvable μ-needles, TSV-embedded μ-probes, 256-channel neural amplifiers, 11-bit area-power-efficient successive approximation register analog-to-digital converters, and serializers. This microsystem can detect 256 electrocorticography and local field potential signals within a small area of 5 mm × 5 mm. The neural amplifier realizes 57.8 dB gain with only 9.8 μW per channel. The overall power of this microsystem is only 3.79 mW for 256-channel neural sensing. A smaller microsystem with dimension of 6 mm × 4 mm has been also implanted into rat brain for somatosensory evoked potentials (SSEPs) recording by using contralateral and ipsilateral electrical stimuli with intensity from 0.2 to 1.0 mA, and successfully observed different SSEPs from left somatosensory cortex of a rat.

  15. 17 CFR 256.430 - Interest on debt to associate companies.

    Science.gov (United States)

    2010-04-01

    ... UTILITY HOLDING COMPANY ACT OF 1935 Income and Expense Accounts § 256.430 Interest on debt to associate... associate companies, and account 233, Notes payable to associate companies. The records supporting the... 17 Commodity and Securities Exchanges 3 2010-04-01 2010-04-01 false Interest on debt to associate...

  16. Genetic Fingerprinting of Wheat and Its Progenitors by Mitochondrial Gene orf256

    Directory of Open Access Journals (Sweden)

    Mona M. Elseehy

    2012-04-01

    Full Text Available orf256 is a wheat mitochondrial gene associated with cytoplasmic male sterility (CMS that has different organization in various species. This study exploited the orf256 gene as a mitochondrial DNA marker to study the genetic fingerprint of Triticum and Aegilops species. PCR followed by sequencing of common parts of the orf256 gene were employed to determine the fingerprint and molecular evolution of Triticum and Aegilops species. Although many primer pairs were used, two pairs of orf256 specific primers (5:-94/C: 482, 5:253/C: 482, amplified DNA fragments of 576 bp and 230 bp respectively in all species were tested. A common 500 bp of nine species of Triticum and Aegilops were aligned and showed consistent results with that obtained from other similar chloroplast or nuclear genes. Base alignment showed that there were various numbers of base substitutions in all species compared to S. cereal (Sc (the outgroup species. Phylogenetic relationship revealed similar locations and proximity on phylogenetic trees established using plastid and nuclear genes. The results of this study open a good route to use unknown function genes of mitochondria in studying the molecular relationships and evolution of wheat and complex plant genomes.

  17. Young Stars and Non-Stella Emission in the Aligned Radio Galaxy 3C 256

    Science.gov (United States)

    Eisenhardt, P.; Simpson, C.; Armus, L.; Chokshi, A.; Dicksinson, M.; Djorgovski, S.; Elston, R.; Jannuzi, B.; McCarthy, P.; Pahre, M.; hide

    1999-01-01

    We present ground-based images of the z=1.824 radio galaxy 3C 256 in the standard BVRIJHK filters and an interference filter centered at 8800 A, a Hubble Space Telescope image in a filter dominated by Ly alpha emission (F336W), and spectra covering rest-frame wavelengths from Ly alpha to [O III} lambda 5007.

  18. Den danske Rødliste opdateret med 1.256 arter af planter og dyr

    DEFF Research Database (Denmark)

    Pedersen, Jens Christian; Wind, Peter

    2009-01-01

    I dag offentliggør Danmarks Miljøundersøgelser (DMU) ved Aarhus Universitet rødlistestatus for i alt 1.256 arteraf danske insekter, svampe og karplanter. Status viser at hver tredje af de arter hvor der findes tilstrækkelige data er kategoriseret som truet i mindre eller større grad eller som for...

  19. 32 CFR 256.9 - Real estate interests to be considered for clear zones and accident potential zone.

    Science.gov (United States)

    2010-07-01

    ... 32 National Defense 2 2010-07-01 2010-07-01 false Real estate interests to be considered for clear zones and accident potential zone. 256.9 Section 256.9 National Defense Department of Defense (Continued....9 Real estate interests to be considered for clear zones and accident potential zone. (a) The right...

  20. 25 CFR 256.11 - What are the occupancy and square footage standards for a dwelling provided with Category C...

    Science.gov (United States)

    2010-04-01

    ... dwelling provided with Category C assistance? 256.11 Section 256.11 Indians BUREAU OF INDIAN AFFAIRS... footage standards for a dwelling provided with Category C assistance? A modest dwelling provided with... bedrooms Total dwelling square footage 1 (maximum) 1-3 2 2 900 4-6 2 3 1050 7 or more 2 4 31350 1 Total...

  1. 25 CFR 256.16 - Who is responsible for identifying what work will be done on my dwelling?

    Science.gov (United States)

    2010-04-01

    ... on my dwelling? 256.16 Section 256.16 Indians BUREAU OF INDIAN AFFAIRS, DEPARTMENT OF THE INTERIOR... my dwelling? The servicing housing office is responsible for identifying what work is to be done on your dwelling or whether your dwelling will be replaced. This includes responsibility to communicate...

  2. 25 CFR 256.15 - How long will I have to wait for repair, renovation, or replacement of my dwelling?

    Science.gov (United States)

    2010-04-01

    ... replacement of my dwelling? 256.15 Section 256.15 Indians BUREAU OF INDIAN AFFAIRS, DEPARTMENT OF THE INTERIOR... replacement of my dwelling? The length of time that it takes to accomplish the work to be done on your dwelling is dependent on: (a) Whether funds are available; (b) The type of work to be done; (c) The climate...

  3. 25 CFR 256.25 - Is my Federal government-assisted dwelling eligible for services under the Housing Improvement...

    Science.gov (United States)

    2010-04-01

    ... 25 Indians 1 2010-04-01 2010-04-01 false Is my Federal government-assisted dwelling eligible for services under the Housing Improvement Program? 256.25 Section 256.25 Indians BUREAU OF INDIAN AFFAIRS... dwelling eligible for services under the Housing Improvement Program? Yes. You may receive services under...

  4. Performance analysis of commercial MOSFET packages in Class E converter operating at 2.56 MHz

    DEFF Research Database (Denmark)

    Nair, Unnikrishnan Raveendran; Munk-Nielsen, Stig; Jørgensen, Asger Bjørn

    2017-01-01

    are not commercially available and power modules have to be custom designed for these applications. This work demonstrates performance of various commercial MOSFET packages at frequency of 2.56 MHz. Commercial SiC MOSFETs in TO-247 and D2Pak packs are tested in Class E resonant converter operating at 2.56 MHz...... resistance and high temperature operation over Si devices have aided in the paradigm shift towards wide bandgap devices. The low gate charge requirements of SiC MOSFETs enables use of these devices in radio frequency (RF) converters using resonant topologies operating at MHz frequency range. The RF...... converters employed in various industrial applications are currently realized with vacuum tubes. Replacing vacuum tubes with solid state devices provides greater reliability. This requires power switches transferring high power at high switching speeds. Wide bandgap devices operating at these specifications...

  5. First prompt in-beam γ-ray spectroscopy of a superheavy element: the 256Rf

    International Nuclear Information System (INIS)

    Rubert, J; Dorvaux, O; Gall, B J P; Asfari, Z; Piot, J; Greenlees, P T; Grahn, T; Herzan, A; Jakobsson, U; Jones, P; Julin, R; Juutinen, S; Andersson, L L; Cox, D M; Herzberg, R-D; Asai, M; Dechery, F; Hauschild, K; Henning, G; Heßberger, F P

    2013-01-01

    Using state-of-the-art γ-ray spectroscopic techniques, the first rotational band of a superheavy element, extending up to a spin of 20 h, was discovered in the nucleus 256 Rf. To perform such an experiment at the limits of the present instrumentation, several developments were needed. The most important of these developments was of an intense isotopically enriched 50 Ti beam using the MIVOC method. The experimental set-up and subsequent analysis allowed the 256 Rf ground-state band to be revealed. The rotational properties of the band are discussed and compared with neighboring transfermium nuclei through the study of their moments of inertia. These data suggest that there is no evidence of a significant deformed shell gap at Z = 104.

  6. Binary fragmentation based studies for the near super-heavy compound nucleus {sup 256}Rf

    Energy Technology Data Exchange (ETDEWEB)

    Thakur, Meenu; Behera, B.R.; Mahajan, Ruchi; Kaur, Gurpreet; Sharma, Priya; Kapoor, Kushal; Rani, Kavita [Panjab University, Department of Physics, Chandigarh (India); Saneesh, N.; Dubey, R.; Yadav, A.; Sugathan, P.; Jhingan, A.; Chatterjee, A.; Chatterjee, M.B. [Inter University Accelerator Centre, New Delhi (India); Kumar, Neeraj; Mandal, S. [University of Delhi, Department of Physics and Astrophysics, Delhi (India); Kumar, S. [Andhra University, Department of Nuclear Physics, Visakhapatnam (India); Saxena, A.; Kailas, S. [Bhabha Atomic Research Centre, Nuclear Physics Division, Mumbai (India); Pal, Santanu [CS, Kolkata (India); Nasirov, Avazbek [JINR, Bogoliubov Laboratory of Theoretical Physics, Dubna (Russian Federation); National University, Department of Physics, Tashkent (Uzbekistan); Kayumov, Bakhodir [National University, Department of Physics, Tashkent (Uzbekistan)

    2017-06-15

    Binary fragmentation of the near super-heavy compound nucleus {sup 256}Rf has been studied through the reaction {sup 48}Ti + {sup 208}Pb at a bombarding energy well above the Coulomb barrier. For a better understanding of its reaction dynamics, the mass distribution, mass-energy distribution and mass-angle distribution of the fission fragments produced from {sup 256}Rf have been investigated thoroughly. The masses and kinetic energies of the fission fragments were reconstructed event-by-event from their measured velocities and emission angles. From the mass-energy analysis, a sizeable contribution from the asymmetric fission was observed on the edges of symmetric mass distribution. Evidence of asymmetric fission was also clued from the observed correlation between the masses and emission angles of the fission fragments. Contribution of the quasi-fission products has also been estimated by performing the theoretical dinuclear system calculations. (orig.)

  7. Performance analysis of commercial MOSFET packages in Class E converter operating at 2.56 MHz

    DEFF Research Database (Denmark)

    Nair, Unnikrishnan Raveendran; Munk-Nielsen, Stig; Jørgensen, Asger Bjørn

    2017-01-01

    resistance and high temperature operation over Si devices have aided in the paradigm shift towards wide bandgap devices. The low gate charge requirements of SiC MOSFETs enables use of these devices in radio frequency (RF) converters using resonant topologies operating at MHz frequency range. The RF...... converters employed in various industrial applications are currently realized with vacuum tubes. Replacing vacuum tubes with solid state devices provides greater reliability. This requires power switches transferring high power at high switching speeds. Wide bandgap devices operating at these specifications...... are not commercially available and power modules have to be custom designed for these applications. This work demonstrates performance of various commercial MOSFET packages at frequency of 2.56 MHz. Commercial SiC MOSFETs in TO-247 and D2Pak packs are tested in Class E resonant converter operating at 2.56 MHz...

  8. Influence of ciprofloxacin and vancomycin on mutation rate and transposition of IS256 in Staphylococcus aureus.

    Science.gov (United States)

    Nagel, Michael; Reuter, Tina; Jansen, Andrea; Szekat, Christiane; Bierbaum, Gabriele

    2011-03-01

    In Staphylococcus aureus, the development of intermediate resistance to vancomycin is due to an accumulation of mutations. To elucidate the mechanisms involved here, a standard laboratory strain (S. aureus HG001) and a clinical MRSA mutator strain (S. aureus SA1450/94, which is characterized by a spontaneous insertion of IS256 into the gene of the mismatch repair enzyme MutS) were incubated at subinhibitory concentrations of ciprofloxacin and vancomycin. Ciprofloxacin increased the mutation rates of both strains, but this effect was inhibited when the SOS response was blocked by the presence of a non-cleavable variant of the LexA repressor. In the presence of vancomycin, the mutation rate was slightly elevated in the mutator strain, and this increase also depended on the strain's ability to induce the SOS response. Furthermore, treatment with subinhibitory concentrations of both antibiotics resulted in an activation of transposition frequency of the insertion element IS256 in S. aureus HG001. Transposition was dependent on the presence of a functional transposase, and the activation of transposition depended on the presence of the functional phosphatase RsbU, which activates SigB transcription activity. An in silico analysis indicated a putative antisense sigma B promoter sequence within the transposase gene. Scrambling of this promoter resulted in an about 20-fold activation of transposition activity of IS256. These data indicate that sigma B is involved in the regulation of IS256 activity by generation of an antisense RNA. Copyright © 2010 Elsevier GmbH. All rights reserved.

  9. A 1 GHz sample rate, 256-channel, 1-bit quantization, CMOS, digital correlator chip

    Science.gov (United States)

    Timoc, C.; Tran, T.; Wongso, J.

    1992-01-01

    This paper describes the development of a digital correlator chip with the following features: 1 Giga-sample/second; 256 channels; 1-bit quantization; 32-bit counters providing up to 4 seconds integration time at 1 GHz; and very low power dissipation per channel. The improvements in the performance-to-cost ratio of the digital correlator chip are achieved with a combination of systolic architecture, novel pipelined differential logic circuits, and standard 1.0 micron CMOS process.

  10. Performance of a 256 pad hybrid photon detector for ring imaging

    Science.gov (United States)

    Chesi, E.; Martinengo, P.; Weilhammer, P.; Roe, S.; Jobez, J. P.; Seguinot, J.; Ypsilantis, T.; Dulinski, W.; Zichichi, A.

    1997-02-01

    We report a detailed experimental investigation of a proximity focused HPD with 256 pads of 4 × 4 mm 2 for applications to RICH detectors. A signal to noise ratio of 16 is obtained for single photoelectrons with a low noise (ENC ≤ 200 e) front-end electronics and 15.7 kV acceleration voltage. A single photoelectron detection efficiency of 95% is achieved with about 1% bias from electron back scattering.

  11. Performance of a 256 pad hybrid photon detector for ring imaging

    CERN Document Server

    Chesi, Enrico Guido; Roe, S; Weilhammer, Peter; Jobez, J P; Séguinot, Jacques; Ypsilantis, Thomas; Dulinski, W

    1997-01-01

    We report a detailed experimental investigation of a proximity focused JiIPD with 256 pads of 4 x 4 mm2 for applications on RICH detectors. A signal to noise ratio of 16 is obtained for single photoelectrons with a low noise (ENC I 200 e) front-end electronics and 15.7 kV acceleration voltage. A single photoelectron detection efficiency of 95% is achieved with about 1% bias from electron back scattering.

  12. A comparative study of Message Digest 5(MD5) and SHA256 algorithm

    Science.gov (United States)

    Rachmawati, D.; Tarigan, J. T.; Ginting, A. B. C.

    2018-03-01

    The document is a collection of written or printed data containing information. The more rapid advancement of technology, the integrity of a document should be kept. Because of the nature of an open document means the document contents can be read and modified by many parties so that the integrity of the information as a content of the document is not preserved. To maintain the integrity of the data, it needs to create a mechanism which is called a digital signature. A digital signature is a specific code which is generated from the function of producing a digital signature. One of the algorithms that used to create the digital signature is a hash function. There are many hash functions. Two of them are message digest 5 (MD5) and SHA256. Those both algorithms certainly have its advantages and disadvantages of each. The purpose of this research is to determine the algorithm which is better. The parameters which used to compare that two algorithms are the running time and complexity. The research results obtained from the complexity of the Algorithms MD5 and SHA256 is the same, i.e., ⊖ (N), but regarding the speed is obtained that MD5 is better compared to SHA256.

  13. Active immunotherapy of Walker-256 carcinosarcoma by tumor-infiltrating lymphocytes associated with photodynamic therapy

    Science.gov (United States)

    Dima, Vasile F.; Vasiliu, Virgil V.; Laky, Dezideriu; Ionescu, Paul; Dima, Stefan V.

    1995-01-01

    Experiments were performed on five batches of Wistar inbred rats with Walker-256 carcinosarcoma receiving as sole treatment photodynamic therapy (PDT), tumor-infiltrating lymphocytes (TIL), or associated therapy (PDT + TIL - A; PDT + TIL - B). The control batch (HBSS) consisted of animals with untreated Walker-256 tumors. The results were as follows: the sole treatment (PDT, TIL) gave survival rates between 41.4 and 52.9%, the cure rates ranging from 13.8 to 38.2%. The `combined' therapy in multiple doses increased significantly (92.8%) the survival rate of tumor bearing rats as well as the highest incidence of complete tumor regression (82.1%). Cell-mediated immunity test values in batches III and IV exposed to multiple doses of PDT + TIL showed higher values as compared to the values noticed in batches I - II and the control batch V, performed at 10 and 21 days post-treatment. Summing up, this work demonstrates that `combined' photodynamic therapy with immunotherapy with TIL stimulates cell-mediated antitumoral activity, increases survival rates, and reduces incidence of Walker-256 carcinosarcoma in the rat model.

  14. Protective Effect of Metformin Against Walker 256 Tumor Growth is Not Dependent on Metabolism Improvement

    Directory of Open Access Journals (Sweden)

    Claudinéia Conationi da Silva Franco

    2014-11-01

    Full Text Available Background/Aims: The objective of the current work was to test the effect of metformin on the tumor growth in rats with metabolic syndrome. Methods: We obtained pre-diabetic hyperinsulinemic rats by neonatal treatment with monosodium L-glutamate (MSG, which were chronically treated every day, from weaning to 100 day old, with dose of metformin (250 mg/kg body weight. After the end of metformin treatment, the control and MSG rats, treated or untreated with metformin, were grafted with Walker 256 carcinoma cells. Tumor weight was evaluated 14 days after cancer cell inoculation. The blood insulin, glucose levels and glucose-induced insulin secretion were evaluated. Results: Chronic metformin treatment improved the glycemic homeostasis in pre-diabetic MSG-rats, glucose intolerance, tissue insulin resistance, hyperinsulinemia and decreased the fat tissue accretion. Meanwhile, the metformin treatment did not interfere with the glucose insulinotropic effect on isolated pancreatic islets. Chronic treatment with metformin was able to decrease the Walker 256 tumor weight by 37% in control and MSG rats. The data demonstrated that the anticancer effect of metformin is not related to its role in correcting metabolism imbalances, such as hyperinsulinemia. However, in morphological assay to apoptosis, metformin treatment increased programmed cell death. Conclusion: Metformin may have a direct effect on cancer growth, and it may programs the rat organism to attenuate the growth of Walker 256 carcinoma.

  15. 25 CFR 256.21 - Will I have to vacate my dwelling while repair work or replacement of my dwelling is being done?

    Science.gov (United States)

    2010-04-01

    ... 25 Indians 1 2010-04-01 2010-04-01 false Will I have to vacate my dwelling while repair work or replacement of my dwelling is being done? 256.21 Section 256.21 Indians BUREAU OF INDIAN AFFAIRS, DEPARTMENT OF THE INTERIOR HOUSING HOUSING IMPROVEMENT PROGRAM § 256.21 Will I have to vacate my dwelling while...

  16. Modelo experimental de tumor na cavidade oral de ratos com carcinossarcoma de Walker 256 Experimental model of Walker 256 carcinosarcoma developed in the oral cavity of rats

    Directory of Open Access Journals (Sweden)

    Ana Paula Negreiros Nunes Alves

    2004-08-01

    Full Text Available OBJETIVO: Estabelecer um modelo experimental de desenvolvimento tumoral na cavidade oral de ratos, permitindo, assim, o estudo da osteólise induzida pelo tumor nos ossos do complexo maxilomandibular como também nas estruturas dentais, através da caracterização histomorfológica da reabsorção óssea e dentária. MÉTODOS: Uma suspensão de células tumorais (0,1mL do Carcinossarcoma de Walker 256, na concentração de 10(6 células/mL foi implantado na cavidade alveolar de ratos previamente aberta por exodontia. Os animais foram observados durante 12 (doze dias consecutivos para determinação da curva de peso corpóreo, sendo posteriormente sacrificados e as mandíbulas removidas para exames radiográfico e histológico. RESULTADOS: No exame radiográfico foi verificada área lítica, sem evidência de reparo, na região dos alvéolos. No exame microscópico foi identificada infiltração óssea, periférica e central, de pequenas células hipercromáticas e pleomórficas, com leve infiltrado inflamatório mononuclear associado e áreas de necrose. O índice de pega foi de 100%. CONCLUSÃO: O modelo animal de invasão óssea, do tumor de Walker na cavidade oral, possibilita a avaliação in vivo de drogas antitumorais e esquemas terapêuticos no tratamento do câncer bucal.PURPOSE: To estabilish an experimental model of tumor development in the oral cavity of rats, that would enable to study the tumor-induced autolysis in the maxillomandibular bone complex as well as of the dental structures, through histomorphological characterization of bone and dental resorption. METHODS: Walker 256 carcinossarcoma cell suspension (0,1 mL containing 10(6 cell/mL was implanted in the alveoli of first and second molars. The animals were observed during twelve consecutive days and the body weigth were determined. Later, the animals were sacrificed and their mandibles removed to radiographic and hystologic analysis. RESULTS: The radiographic image

  17. Lamellipodia and Membrane Blebs Drive Efficient Electrotactic Migration of Rat Walker Carcinosarcoma Cells WC 256.

    Science.gov (United States)

    Sroka, Jolanta; Krecioch, Izabela; Zimolag, Eliza; Lasota, Slawomir; Rak, Monika; Kedracka-Krok, Sylwia; Borowicz, Pawel; Gajek, Marta; Madeja, Zbigniew

    2016-01-01

    The endogenous electric field (EF) may provide an important signal for directional cell migration during wound healing, embryonic development and cancer metastasis but the mechanism of cell electrotaxis is poorly understood. Additionally, there is no research addressing the question on the difference in electrotactic motility of cells representing various strategies of cell movement-specifically blebbing vs. lamellipodial migration. In the current study we constructed a unique experimental model which allowed for the investigation of electrotactic movement of cells of the same origin but representing different modes of cell migration: weakly adherent, spontaneously blebbing (BC) and lamellipodia forming (LC) WC256 cells. We report that both BC and LC sublines show robust cathodal migration in a physiological EF (1-3 V/cm). The directionality of cell movement was completely reversible upon reversing the field polarity. However, the full reversal of cell direction after the change of EF polarity was much faster in the case of BC (10 minutes) than LC cells (30 minutes). We also investigated the distinct requirements for Rac, Cdc42 and Rho pathways and intracellular Ca2+ in electrotaxis of WC256 sublines forming different types of cell protrusions. It was found that Rac1 is required for directional movement of LC to a much greater extent than for BC, but Cdc42 and RhoA are more crucial for BC than for LC cells. The inhibition of ROCK did not affect electrotaxis of LC in contrast to BC cells. The results also showed that intracellular Ca2+ is essential only for the electrotactic reaction of BC cells. Moreover, inhibition of MLCK and myosin II did not affect the electrotaxis of LC in contrast to BC cells. In conclusion, our results revealed that both lamellipodia and membrane blebs can efficiently drive electrotactic migration of WC 256 carcinosarcoma cells, however directional migration is mediated by different signalling pathways.

  18. Lamellipodia and Membrane Blebs Drive Efficient Electrotactic Migration of Rat Walker Carcinosarcoma Cells WC 256.

    Directory of Open Access Journals (Sweden)

    Jolanta Sroka

    Full Text Available The endogenous electric field (EF may provide an important signal for directional cell migration during wound healing, embryonic development and cancer metastasis but the mechanism of cell electrotaxis is poorly understood. Additionally, there is no research addressing the question on the difference in electrotactic motility of cells representing various strategies of cell movement-specifically blebbing vs. lamellipodial migration. In the current study we constructed a unique experimental model which allowed for the investigation of electrotactic movement of cells of the same origin but representing different modes of cell migration: weakly adherent, spontaneously blebbing (BC and lamellipodia forming (LC WC256 cells. We report that both BC and LC sublines show robust cathodal migration in a physiological EF (1-3 V/cm. The directionality of cell movement was completely reversible upon reversing the field polarity. However, the full reversal of cell direction after the change of EF polarity was much faster in the case of BC (10 minutes than LC cells (30 minutes. We also investigated the distinct requirements for Rac, Cdc42 and Rho pathways and intracellular Ca2+ in electrotaxis of WC256 sublines forming different types of cell protrusions. It was found that Rac1 is required for directional movement of LC to a much greater extent than for BC, but Cdc42 and RhoA are more crucial for BC than for LC cells. The inhibition of ROCK did not affect electrotaxis of LC in contrast to BC cells. The results also showed that intracellular Ca2+ is essential only for the electrotactic reaction of BC cells. Moreover, inhibition of MLCK and myosin II did not affect the electrotaxis of LC in contrast to BC cells. In conclusion, our results revealed that both lamellipodia and membrane blebs can efficiently drive electrotactic migration of WC 256 carcinosarcoma cells, however directional migration is mediated by different signalling pathways.

  19. The influence of septal lesions on sodium and water retention induced by Walker 256 tumor

    Directory of Open Access Journals (Sweden)

    F. Guimarães

    1999-03-01

    Full Text Available In the course of studies on the effects of septal area lesions on neuroimmunomodulation and Walker 256 tumor development, it was observed that tumor-induced sodium and water retention was less marked in lesioned than in non-lesioned rats. In the present study possible mechanisms involved in this phenomenon were investigated. The experiments were performed in septal-lesioned (LW; N = 15 and sham-operated (SW; N = 7 8-week-old male Wistar rats, which received multifocal simultaneous subcutaneous (sc inoculations of Walker 256 tumor cells about 30 days after the stereotaxic surgery. Control groups (no tumor, sham-operated food-restricted (SFR, N = 7 and lesioned food-restricted (LFR, N = 10 were subjected to a feeding pattern similar to that observed in tumor-bearing animals. Multifocal inoculation of Walker 256 tumor rapidly induces anorexia, which is paradoxically accompanied by an increase in body weight, as a result of renal Na+ and fluid retention. These effects of the tumor were also seen in LW rats, although the rise in fractional sodium balance during the early clinical period was significantly smaller than in SW rats (day 4: SW = 47.6 ± 6.4% and LW = 13.8 ± 5.2%; day 5: SW = 57.5 ± 3.5% and LW = 25.7 ± 4.8%; day 6: SW = 54.4 ± 3.8% and LW = 32.1 ± 4.4%; P<0.05, suggesting a temporary reduction in tumor-induced sodium retention. In contrast, urine output was significantly reduced in SW rats and increased in LW rats (LW up to -0.85 and SW up to 4.5 ml/100 g body weight, with no change in osmolar excretion. These temporary changes in the tumor's effects on LW rats may reflect a "reversal" of the secondary central antidiuretic response induced by the tumor (from antidiuretic to diuretic.

  20. Robust spinal neuroinflammation mediates mechanical allodynia in Walker 256 induced bone cancer rats

    Directory of Open Access Journals (Sweden)

    Mao-Ying Qi-Liang

    2012-05-01

    Full Text Available Abstract It has been reported that remarkable and sustained activation of astrocytes and/or microglia occurs in cancer induced pain (CIP, which is different from neuropathic and inflammatory pain. The present study was designed to investigate the role of spinal Toll-like receptor 4 (TLR4 induced glial neuroinflammation in cancer induced pain using a modified rat model of bone cancer. The rat model of CIP consisted of unilateral intra-tibial injection with Walker 256 mammary gland carcinoma. Nine days after Walker 256 inoculation, a robust activation of both astrocytes and microglia in bilateral spinal dorsal horn was observed together with significant bilateral mechanical allodynia. This neuroinflammation was characterized by enhanced immunostaining of both glial fibrillary acidic protein (GFAP, astrocyte marker and OX-42 (microglia marker, and an elevated level of IL-1β, IL-6 and TNF-α mRNA. I.t. administration of fluorocitrate (an inhibitor of glial metabolism, 1 nmol or minocycline (an inhibitor of microglia, 100 μg has significant anti-allodynic effects on day 12 after Walker 256 inoculation. Naloxone (a nonstereoselective TLR4 signaling blocker, 60 μg, i.t. also significantly alleviated mechanical allodynia and simultaneously blocked the increased inflammatory cytokine mRNA. The results suggested that spinal TLR4 might play an important role in the sustained glial activation that critically contributed to the robust and sustained spinal neuroinflammation in CIP. This result could potentially help clinicians and researchers to better understand the mechanism of complicated cancer pain.

  1. The ECLine - Driver: a flexible, 20MHz, 256 words ECLine generator

    International Nuclear Information System (INIS)

    Chollet, F.; Degre, A.; Lacotte, J.C.; Lecoq, J.

    1989-01-01

    The ECLine - Driver is a dual 256x16 - bits words fast ECLine generator fully controlled by CAMAC. Designed to fit requirements of High Energy Physics experiments, its flexibility makes it a general purpose unit. It is used on the LEP - L3 experiment, at CERN, to implement two applications. In the first one, it generates the ''trigger detector'' response in order to exercize the different trigger processors under experimental conditions. In the second one, it generates some 10000 synchronisation signals required to drive the level-1 energy trigger processor. 70 units are installed on the experiment

  2. In vitro evaluation of 56 coronary artery stents by 256-slice multi-detector coronary CT

    Energy Technology Data Exchange (ETDEWEB)

    Steen, Henning, E-mail: henning.steen@med.uni-heidelberg.de [University of Heidelberg, Department of Cardiology, Im Neuenheimer Feld 410, Heidelberg 69120 (Germany); Andre, Florian, E-mail: Florian.Andre@med.uni-heidelberg.de [University of Heidelberg, Department of Cardiology, Im Neuenheimer Feld 410, Heidelberg 69120 (Germany); Korosoglou, Grigorios, E-mail: Grigorios.Korosoglou@med.uni-heidelberg.de [University of Heidelberg, Department of Cardiology, Im Neuenheimer Feld 410, Heidelberg 69120 (Germany); Mueller, Dirk, E-mail: Dirk.Mueller@philips.com [Philips GmbH Healthcare Division, Luebeckertordamm 5, Hamburg 20099 (Germany); Hosch, Waldemar, E-mail: Waldemar.Hosch@med.uni-heidelberg.de [University of Heidelberg, Department of Diagnostic and Interventional Radiology, Im Neuenheimer Feld 410, Heidelberg 69120 (Germany); Kauczor, Hans-Ulrich, E-mail: Hans-Ulrich.Kauczor@med.uni-heidelberg.de [University of Heidelberg, Department of Diagnostic and Interventional Radiology, Im Neuenheimer Feld 410, Heidelberg 69120 (Germany); Giannitsis, Evangelos, E-mail: Evangelos.Giannitsis@med.uni-heidelberg.de [University of Heidelberg, Department of Cardiology, Im Neuenheimer Feld 410, Heidelberg 69120 (Germany); Katus, Hugo A., E-mail: Hugo.Katus@med.uni-heidelberg.de [University of Heidelberg, Department of Cardiology, Im Neuenheimer Feld 410, Heidelberg 69120 (Germany)

    2011-10-15

    Objective: We sought to investigate stent lumen visibility of 56 coronary stents with the newest 256-multi-slice-CT (256-MDCT) technology for different reconstruction algorithms in an in vitro model. Background: Early identification of in-stent restenosis (ISR) is important to avoid recurrent ischemia and prevent acute myocardial infarction (AMI). Since angiography has the disadvantage of high costs and its invasiveness, MDCT could be a convenient and safe non-invasive alternative for detection of ISR. Material and methods: Percentages of in-stent lumen diameter and in-stent signal attenuation (measured as contrast-to-noise ratio (CNR)) of 56 coronary stents (group A {<=}2.5 mm; group B = 2.75-3.0 mm; group C = 3.5-4.0 mm) were evaluated in a coronary vessel in vitro phantom (iodine-filled plastic tubes) employing four different reconstruction algorithms (XCD, CC, CD, XCB) on a novel 256-MDCT (Philips-iCT, collimation = 128 mm x 0.625 mm; rotation time = 270 ms; tube current = 800 mA s with 120 kV). Analysis was conducted with the semi-automatical full-width-at-half-maximum (FWHM) method. P-values <0.05 were regarded statistically significant. Results: In-stent lumen diameter >60% for group C stents was significantly larger and CNR was significantly lower (both p < 0.05) for sharp kernels (CD; XCD) when compared to groups A/B. The FWHM-method showed significantly smaller in-stent lumen diameter (p < 0.05) when compared to the manual method. Conclusion: 256-MDCT could potentially be employed for clinical assessment of stent patency in stents >3.0 mm when analysed with cardio-dedicated sharp kernels, although clinical studies corroborating this claim should be performed. However, stents {<=}3.0 mm reconstructed by soft kernels revealed insufficient in-stent lumen visualisation and should not be used in clinical practice. Further improvements in spatial and temporal image resolution as well as reductions of radiation exposure and image noise have to be accomplished

  3. Characterization of 256 Kbits SRAMs under californium 252 and protons irradiations

    Science.gov (United States)

    Chabannes, Patrice L.; Hess, Jean-Marie; Buisson, Jacques; Brunet, Jean-Pierre

    1991-03-01

    Results of two experiments carried out on 256 Kbits Complementary Metal Oxide Semiconductors (MOS) resistive load Static Random Access Memories (SRAM'S) with and heavy ion radiation are presented. The tests are conducted on ten different types of nonradiation hardened devices, even though some manufacturer could provide available hardened technologies. Single Event Upset (SEU) cross sections recorded under 1 GeV protons and Cf-252 heavy ions exposures are presented. Saturation cross sections are unavailable using Cf-252 heavy ions because they could not reach deeper sensitive zones of the dies.

  4. One-stop shop assessment for atrial septal defect closure using 256-slice coronary CT angiography

    Energy Technology Data Exchange (ETDEWEB)

    Yamasaki, Yuzo; Kamitani, Takeshi; Sagiyama, Koji; Yamanouchi, Torahiko; Honda, Hiroshi [Kyushu University, Department of Clinical Radiology, Graduate School of Medical Sciences, 3-1-1 Maidashi, Higashi-ku, Fukuoka (Japan); Nagao, Michinobu; Kawanami, Satoshi [Kyushu University, Department of Molecular Imaging and Diagnosis, Graduate School of Medical Sciences, Fukuoka (Japan); Sakamoto, Ichiro [Kyushu University, Department of Cardiovascular Medicine, Graduate School of Medical Sciences, Fukuoka (Japan); Yamamura, Kenichiro [Kyushu University, Department of Pediatrics, Graduate School of Medical Sciences, Fukuoka (Japan); Yabuuchi, Hidetake [Kyushu University, Department of Health Sciences, Graduate School of Medical Sciences, Fukuoka (Japan)

    2017-02-15

    To investigate the feasibility and accuracy of measurement of the pulmonary to systemic blood flow ratio (Qp/Qs) and defect and rim sizes in secundum atrial septal defects (ASDs) using 256-slice CT, compared to the reference transoesophageal echocardiography (TEE) and right heart catheterization (RHC) measurements. Twenty-three consecutive adult patients with secundum ASDs who underwent retrospective ECG-gated coronary CT angiography (CCTA), TEE and RHC were enrolled in this study. Right ventricular (RV) and left ventricular (LV) stroke volumes (SV) were calculated by biventricular volumetry of CCTA. Qp/Qs-CT was defined as RVSV/LVSV. The sizes of the defect and rim were measured by multi-planar reconstruction CT images. Correlations between Qp/Qs-CT and Qp/Qs-RHC and between the defect diameter obtained by CT and TEE were analyzed by Pearson's coefficient analysis. Rim sizes by CT and TEE were compared by paired t-test. Qp/Qs-CT was significantly correlated with Qp/Qs-RHC (r = 0.83, p < 0.0001), and the defect diameter by CT was significantly correlated with that by TEE (r = 0.95, p < 0.0001). There was no significant difference between CT and TEE in measurements of rim size. 256-slice CCTA allows measuring Qp/Qs and size of defects and rims in patients with secundum ASDs, accomplishing pretreatment evaluation non-invasively and comprehensively. (orig.)

  5. Structural Variations of Human Glucokinase Glu256Lys in MODY2 Condition Using Molecular Dynamics Study

    Directory of Open Access Journals (Sweden)

    Nanda Kumar Yellapu

    2013-01-01

    Full Text Available Glucokinase (GK is the predominant hexokinase that acts as glucose sensor and catalyses the formation of Glucose-6-phosphate. The mutations in GK gene influence the affinity for glucose and lead to altered glucose levels in blood causing maturity onset diabetes of the young type 2 (MODY2 condition, which is one of the prominent reasons of type 2 diabetic condition. In view of the importance of mutated GK resulting in hyperglycemic condition, in the present study, molecular dynamics simulations were carried out in intact and 256 E-K mutated GK structures and their energy values and conformational variations were correlated. Energy variations were observed in mutated GK (3500 Kcal/mol structure with respect to intact GK (5000 Kcal/mol, and it showed increased γ-turns, decreased β-turns, and more helix-helix interactions that affected substrate binding region where its volume increased from 1089.152 Å2 to 1246.353 Å2. Molecular docking study revealed variation in docking scores (intact = −12.199 and mutated = −8.383 and binding mode of glucose in the active site of mutated GK where the involvement of A53, S54, K56, K256, D262 and Q286 has resulted in poor glucose binding which probably explains the loss of catalytic activity and the consequent prevailing of high glucose levels in MODY2 condition.

  6. Refolding additive, dimethylbenzylammonium propane sulfonate (NDSB- 256), accelerates gly-pro cis-trans isomerization.

    Science.gov (United States)

    Wang, Haimei; Hosoda, Kazuo; Terawaki, Shin-Ichi; Wakamatsu, Kaori

    2014-01-01

    Proline cis-trans isomerization plays a key role in the rate-determining steps of protein folding, and many different peptide-proline cis-trans isomerases (PPIases) catalyze this reaction. The acceleration of isomerization would be beneficial for in vitro refolding of protein preparations for industrial and research purposes. So we analyzed whether low-molecular-weight compounds that have been reported to enhance protein refolding have the activity to accelerate the isomerization. To evaluate the effects of chemicals on the isomerization rate, we set up a new NMR (EXSY) method that is invulnerable to their inhibitory activity, if any, and to their large NMR signals. With this method, we found that dimethylbenzylammonium propane sulfonate (NDSB-256) increase the isomerization rate in a concentration-dependent manner for the first time. Acceleration by imidazole (suggested but not experimentally confirmed) was also demonstrated. Arginine, a most popular refolding additive, did not show any significant effects on the isomerization reaction as expected.

  7. Walkdown Results from RARA Projects 256 ''Higher Priority''New Sites

    International Nuclear Information System (INIS)

    W.M. Hayward

    1998-01-01

    This report presents the results from walkdowns and reviews of 256 ''Higher Priority'' waste sites that were assigned to the Environmental Restoration Contractor (ERC) and the Radiation Area Remedial Action(RARA) Project. The objective of this activity was to obtain background information on each new site, observe and document the ''pre-existing'' condition of the site, identify potential hazards or issues observable at the sites, propose a surveillance and maintenance base, identify any conditions in need of immediate corrective actions, record the coordinates of the site using Global Positioning System and, using a digital camera, obtain a current photograph of the site. It was not the objective of this activity to perform a detailed and complete evaluation of all real or potential hazards or issues related to these sites

  8. Fabrication and total dose testing of a 256K x 1 radiation-hardened SRAM

    Science.gov (United States)

    Kushner, R. A.; Kohler, R. A.; Steenwyk, S. D.; Desko, J. C.; Alchesky, L. C.

    1988-12-01

    A 256K x 1 radiation-hard SRAM and the process enhancements that resulted in its successful fabrication are described, and total-dose-exposure results are presented. Typical performance values include an address-activated access time of 36 nsec and a write time of 34 nsec. Soft-error studies predict the memory cell to be SEU-insensitive, and rail-span collapse simulations estimate transient dose immunity to greater than 4 Grad(Si)/sec. The technology used was a standard 1.0-micron two-level metal, non-SORT CMOS, radiation-hard process. SORT (selective oxidation to reduce topography) is a process that uses silicon nitride masking of active device areas during field oxide growth to reduce vertical dimensions. To improve reliability and cosmetic quality, the process has been modified to provide about 50-percent metal step coverage at both metal levels.

  9. Radiation dose to patients and image quality evaluation from coronary 256-slice computed tomographic angiography

    Energy Technology Data Exchange (ETDEWEB)

    Chen, Liang-Kuang [Department of Radiology, Shin Kong Wu Ho-Su Memorial Hospital, Taiwan (China); College of Medicine, Fu Jen Catholic University, Taiwan (China); Department of Radiological Technology, Yuan Pei University, Taiwan (China); Wu, Tung-Hsin [Department of Biomedical Imaging and Radiological Sciences, National Yang Ming University, 155 Li-Nong St., Section 2, Taipei 112, Taiwan (China); Yang, Ching-Ching [Department of Radiological Technology, Tzu Chi College of Technology, Hualien, Taiwan (China); Tsai, Chia-Jung [Department of Biomedical Imaging and Radiological Sciences, National Yang Ming University, 155 Li-Nong St., Section 2, Taipei 112, Taiwan (China); Lee, Jason J.S., E-mail: jslee@ym.edu.t [Department of Biomedical Imaging and Radiological Sciences, National Yang Ming University, 155 Li-Nong St., Section 2, Taipei 112, Taiwan (China)

    2010-07-21

    The aim of this study is to assess radiation dose and the corresponding image quality from suggested CT protocols which depends on different mean heart rate and high heart rate variability by using 256-slice CT. Fifty consecutive patients referred for a cardiac CT examination were included in this study. All coronary computed tomographic angiography (CCTA) examinations were performed on a 256-slice CT scanner with one of five different protocols: retrospective ECG-gating (RGH) with full dose exposure in all R-R intervals (protocol A), RGH of 30-80% pulsing window with tube current modulation (B), RGH of 78{+-}5% pulsing window with tube current modulation (C), prospective ECG-triggering (PGT) of 78% R-R interval with 5% padding window (D) and PGT of 78% R-R interval without padding window (E). Radiation dose parameters and image quality scoring were determined and compared. In this study, no significant differences were found in comparison on image quality of the five different protocols. Protocol A obtained the highest radiation dose comparing with those of protocols B, C, D and E by a factor of 1.6, 2.4, 2.5 and 4.3, respectively (p<0.001), which were ranged between 2.7 and 11.8 mSv. The PGT could significantly reduce radiation dose delivered to patients, as compared to the RGH. However, the use of PGT has limitations and is only good in assessing cases with lower mean heart rate and stable heart rate variability. With higher mean heart rate and high heart rate variability circumstances, the RGH within 30-80% of R-R interval pulsing window is suggested as a feasible technique for assessing diagnostic performance.

  10. Treatment of rat Walker-256 carcinosarcoma with photodynamic therapy and endotoxin irradiated with high-energy electrons

    Science.gov (United States)

    Dima, Vasile F.; Vasiliu, Virgil V.; Laky, Dezideriu; Ionescu, Mircea D.; Dima, Stefan V.

    1994-03-01

    Experiments were performed on five batches of Wistar inbred rats with Walker-256 carcinosarcoma receiving sole treatment photodynamic therapy (PDT), irradiated endotoxin (R-LPS), native-endotoxin (N-LPS), or associated therapy (PDT + R-LPS) and the control batch (saline) consisted of animals with untreated Walker-256 tumors. The results were as follows: the sole treatment (PDT, R-LPS, N-LPS) gave survival rates between 56.3 and 60.7% and cure rates ranging from 32.1 to 37.5%. The `combined' therapy in multiple doses increased significantly (88.6%) the survival rate of tumor bearing rats as well as the highest incidence of complete tumor regression (71.4%). This work demonstrates that `combined' photodynamic and immunotherapy with irradiated endotoxin stimulates cell-mediated antitumoral activity and induces changes in the tumoral incidence in Walker-256 carcinosarcoma in the rat model.

  11. Melanism in guinea fowl (Numida meleagris) is associated with a deletion of Phenylalanine-256 in the MC1R gene.

    Science.gov (United States)

    Vidal, O; Araguas, R M; Fernández, E; Heras, S; Sanz, N; Pla, C

    2010-12-01

    We have characterized a deletion in the MC1R gene causing the loss of one amino acid (p.Phe256del), which is perfectly associated with melanism in guinea fowl (Numida meleagris). Co-segregation of the p.Phe256del with melanism was confirmed in 25 offspring born from a cross of two heterozygote birds; therefore we suggest that this mutation is responsible for the black phenotype. Interestingly, this is the first case of recessive melanism linked to MC1R.

  12. Demonstration of DFT-spread 256QAM-OFDM signal transmission with cost-effective directly modulated laser.

    Science.gov (United States)

    Li, Fan; Yu, Jianjun; Fang, Yuan; Dong, Ze; Li, Xinying; Chen, Lin

    2014-04-07

    We experimentally demonstrated a 256-ary quadrature amplitude modulation (256QAM) direct-detection optical orthogonal frequency division multiplexing (DDO-OFDM) transmission system utilizing a cost-effective directly modulated laser (DML). Intra-symbol frequency-domain averaging (ISFA) is applied to suppress in-band noise while the channel response estimation and Discrete Fourier Transform-spread (DFT-spread) is used to reduce the peak-to-average power ratio (PAPR) of the transmitted OFDM signal. The bit-error ratio (BER) of 15-Gbit/s 256QAM-OFDM signal has been measured after 20-km SSMF transmission that is less than 7% forward-error-correction (FEC) threshold of 3.8 × 10(-3) as the launch power into fiber is set at 6dBm. For 11.85-Gbit/s 256QAM-OFDM signal, with the aid of ISFA-based channel estimation and PAPR reduction enabled by DFT-spread, the BER after 20-km SSMF transmission can be improved from 6.4 × 10(-3) to 6.8 × 10(-4) when the received optical power is -6dBm.

  13. A COMPARATIVE PET STUDY USING DIFFERENT C-11 LABELED AMINO-ACIDS IN WALKER 256 CARCINOSARCOMA-BEARING RATS

    NARCIS (Netherlands)

    DAEMEN, BJG; ELSINGA, PH; ISHIWATA, K; PAANS, AMJ; VAALBURG, W

    1991-01-01

    In Walker 256 carcinosarcoma-bearing rats, the dynamic distribution of L-[1-C-11]tyrosine, L-[methyl-C-11]methionine, L-[1-C-11]methionine and D-[1-C-11]methionine has been measured by PET. An equivalent tumor-imaging potential was observed for each of the three L-amino acids. Thirty minutes after

  14. Assessment of Myocardial Bridge and Mural Coronary Artery Using ECG-Gated 256-Slice CT Angiography: A Retrospective Study

    Directory of Open Access Journals (Sweden)

    En-sen Ma

    2013-01-01

    Full Text Available Recent clinical reports have indicated that myocardial bridge and mural coronary artery complex (MB-MCA might cause major adverse cardiac events. 256-slice CT angiography (256-slice CTA is a newly developed CT system with faster scanning and lower radiation dose compared with other CT systems. The objective of this study is to evaluate the morphological features of MB-MCA and determine its changes from diastole to systole phase using 256-slice CTA. The imaging data of 2462 patients were collected retrospectively. Two independent radiologists reviewed the collected images and the diagnosis of MB-MCA was confirmed when consistency was obtained. The length, diameter, and thickness of MB-MCA in diastole and systole phases were recorded, and changes of MB-MCA were calculated. Our results showed that among the 2462 patients examined, 336 have one or multiple MB-MCA (13.6%. Out of 389 MB-MCA segments, 235 sites were located in LAD2 (60.41%. The average diameter change of MCA in LAD2 from systole phase to diastole phase was  mm, and 34.9% of MCA have more than 50% diameter stenosis in systole phase. This study suggested that 256-slice CTA multiple-phase reconstruction technique is a reliable method to determine the changes of MB-MCA from diastole to systole phase.

  15. A reconfigurable on-line learning spiking neuromorphic processor comprising 256 neurons and 128K synapses

    Science.gov (United States)

    Qiao, Ning; Mostafa, Hesham; Corradi, Federico; Osswald, Marc; Stefanini, Fabio; Sumislawska, Dora; Indiveri, Giacomo

    2015-01-01

    Implementing compact, low-power artificial neural processing systems with real-time on-line learning abilities is still an open challenge. In this paper we present a full-custom mixed-signal VLSI device with neuromorphic learning circuits that emulate the biophysics of real spiking neurons and dynamic synapses for exploring the properties of computational neuroscience models and for building brain-inspired computing systems. The proposed architecture allows the on-chip configuration of a wide range of network connectivities, including recurrent and deep networks, with short-term and long-term plasticity. The device comprises 128 K analog synapse and 256 neuron circuits with biologically plausible dynamics and bi-stable spike-based plasticity mechanisms that endow it with on-line learning abilities. In addition to the analog circuits, the device comprises also asynchronous digital logic circuits for setting different synapse and neuron properties as well as different network configurations. This prototype device, fabricated using a 180 nm 1P6M CMOS process, occupies an area of 51.4 mm2, and consumes approximately 4 mW for typical experiments, for example involving attractor networks. Here we describe the details of the overall architecture and of the individual circuits and present experimental results that showcase its potential. By supporting a wide range of cortical-like computational modules comprising plasticity mechanisms, this device will enable the realization of intelligent autonomous systems with on-line learning capabilities. PMID:25972778

  16. Morphologic classification of the right auricule on 256-slice computed tomography.

    Science.gov (United States)

    Li, Cai-Ying; Gao, Bu-Lang; Pan, Tong; Xiang, Cheng; Liu, Xiao-Wei; Yang, Hai-Qing; Yi, Lan-Ying; Liao, Qi-Bin

    2017-06-01

    To investigate the shape of right auricule on 256-slice computed tomography (CT). Five hundred people (250 men, age range 16-84 years) who had cardiac multidetector CT angiography were recruited in this study. All patients had normal sinus rhythm with normal blood pressure (right auricule was studied and compared after reconstruction of the raw images. All patients successfully had cardiac CT angiography (100%), and the right auricule morphology was divided into five types and nine subtypes, including Type I of triangular shape (Ia and Ib), Type II of M shape (IIa and IIb), Type III of L shape (IIIa and IIIb), Type IV of reverse L shape (IVa and IVb), and Type V of balanced shape. The most common type of right auricule is Type IV (28.4%) followed by Type II (24.0%), whereas the least common is Type V (11.0%). Type Ia was present significantly (P  0.05) sex difference existed in the constitution ratio of the types. The normal angle was greater in Type Ib than in Ia. The greater the normal angle in Type I, the greater the deviation of the right auricule tip towards the left. A good understanding of the right auricule anatomical morphology can better guide atrial pacing, radiofrequency ablation and other surgical procedures while preventing possible intra-procedural complications.

  17. Chronic Glibenclamide Treatment Attenuates Walker-256 Tumour Growth in Prediabetic Obese Rats

    Directory of Open Access Journals (Sweden)

    Claudinéia Conationi da Silva Franco

    2017-05-01

    Full Text Available Background/Aims: The sulphonylurea glibenclamide (Gli is widely used in the treatment of type 2 diabetes. In addition to its antidiabetic effects, low incidences of certain types of cancer have been observed in Gli-treated diabetic patients. However, the mechanisms underlying this observation remain unclear. The aim of the present work was to evaluate whether obese adult rats that were chronically treated with an antidiabetic drug, glibenclamide, exhibit resistance to rodent breast carcinoma growth. Methods: Neonatal rats were treated with monosodium L-glutamate (MSG to induce prediabetes. Control and MSG groups were treated with Gli (2 mg/kg body weight/day from weaning to 100 days old. After Gli treatment, the control and MSG rats were grafted with Walker-256 tumour cells. After 14 days, grafted rats were euthanized, and tumour weight as well as glucose homeostasis were evaluated. Results: Treatment with Gli normalized tissue insulin sensitivity and glucose tolerance, suppressed fasting hyperinsulinaemia, reduced fat tissue accretion in MSG rats, and attenuated tumour growth by 27% in control and MSG rats. Conclusions: Gli treatment also resulted in a large reduction in the number of PCNA-positive tumour cells. Although treatment did improve the metabolism of pre-diabetic MSG-rats, tumour growth inhibition may be a more direct effect of glibenclamide.

  18. Effect of methotrexate on perfusion and nitrogen-13 glutamate uptake in the Walker-256 carcinosarcoma

    Energy Technology Data Exchange (ETDEWEB)

    Knapp, W.H.; Panzer, M.; Helus, F.; Layer, K.; Sinn, H.J.; Ostertag, H.

    1988-02-01

    The tissue uptake of (/sup 13/N)glutamate (glu) was related to that of (/sup 11/C)butanol (but), a highly diffusible perfusion tracer. In 25 rats bearing Walker-256 carcinomas tumor-to-muscle glu uptake averaged 6.34 +/- 2.84 (s.d.) prior to interventions and the respective uptake of but was 6.79 +/- 3.08 (y = 0.03 + 0.94x). One hour after selective intraarterial administration of methotrexate (mtx), glu uptake fell by 47%, whereas blood flow remained within the pretreatment range (N = 9). Four hours after mtx, perfusion was reduced by approximately 40%, and 2 days later both perfusion and glu uptake reached extremely low levels. No significant difference in the effect of 10 and 50 mg/kg mtx was observed. Regional tissue mtx uptake estimations using /sup 77/Br-labeled bromomethotrexate did not reveal any significant uptake in muscle. The relationship between tumor-to-muscle uptake of glu and but (/sup 13/N//sup 11/C-index) was 0.94 +/- 0.015 (s.e.m., N = 25) before intervention. After methotrexate (1 hr, 4 hr, and 2 days) this index was 0.58 +/- 0.06 (N = 9), and 0.85 +/- 0.04 (N = 11) and 1.03 +/- 0.05 (N = 5), respectively. These values demonstrate an early mtx-induced uncoupling of glu uptake with respect to perfusion.

  19. Childhood history of behavioral inhibition and comorbidity status in 256 adults with social phobia.

    Science.gov (United States)

    Rotge, Jean-Yves; Grabot, Denis; Aouizerate, Bruno; Pélissolo, Antoine; Lépine, Jean-Pierre; Tignol, Jean

    2011-03-01

    Behavioral inhibition (BI), a heritable temperament, predisposes one to an increased risk of social phobia. Recent investigations have reported that BI may also be a precursor to anxiety as well as depressive and alcohol-related disorders, which are frequently comorbid with social phobia. In the present study, we explored the relationship between BI and psychiatric disorders in 256 adults with a primary diagnosis of social phobia. BI severity was retrospectively assessed with the Retrospective Self-Report of Inhibition (RSRI). The severity of social phobia and the presence of comorbid diagnoses were evaluated with the Liebowitz Social Anxiety Scale (LSAS) and the Mini-International Neuropsychiatric Interview, respectively. The RSRI score was significantly and positively correlated with both the LSAS score and the occurrence of a major depressive disorder. No significant association was found with other anxiety and substance-related disorders. The assessment of BI was retrospective and self-reported. A childhood history of BI was associated with an increased risk of depressive comorbidity in social phobia. Copyright © 2010 Elsevier B.V. All rights reserved.

  20. 320 x 256 Complementary Barrier Infrared Detector Focal Plane Array for Long-Wave Infrared Imaging

    Science.gov (United States)

    Nguyen, Jean; Rafol, Sir B.; Soibel, Alexander; Khoskhlagh, Arezou; Ting, David Z.-Y.; Liu, John K.; Mumolo, Jason M.; Gunapala, Sarath D.

    2012-01-01

    A 320 x 256 Complementary Barrier Infrared (CBIRD) focal plane array for long-wavelength infrared (LWIR) imaging is reported. The arrays were grown by molecular beam expitaxy (MBE) with a 300 period 1.9 um thick absorber. The mean dark current density of 2.2 x 10-4 A/cm2 was measured at an operating bias of 128 mV with a long wavelength cutoff of 8.8 ?m observed at 50% of the peak. The maximum quantum efficiency was 54% measured at 5.6 ?m. Operating at T = 80K, the array yielded an 81% fill factor with 97% operability. Good imagery with a mean noise equivalent different temperature (NE?T) of 18.6 mK and a mean detectivity of D* = 1.3 x 1011 cm-Hz1/2/W was achieved. The substrate was thinned using mechanical lapping and neither an AR coating nor a passivation layer was applied. This article provides the details of the fabrication process for achieving low-dark current LWIR CBIRD arrays. Discussion for an effective hard mask for excellent pattern transfer is given and appropriate mounting techniques for good thermal contact during the dry etching process is described. The challenges and differences between etching large 200 ?m test diodes and small 28 ?m FPA pixels are given.

  1. 25 CFR 256.22 - How can I be sure that the work that is being done on my dwelling meets minimum construction...

    Science.gov (United States)

    2010-04-01

    ... 25 Indians 1 2010-04-01 2010-04-01 false How can I be sure that the work that is being done on my dwelling meets minimum construction standards? 256.22 Section 256.22 Indians BUREAU OF INDIAN AFFAIRS... is being done on my dwelling meets minimum construction standards? (a) At various stages of...

  2. 25 CFR 256.17 - What will the servicing housing office do to identify what work is to be done on my dwelling?

    Science.gov (United States)

    2010-04-01

    ... what work is to be done on my dwelling? 256.17 Section 256.17 Indians BUREAU OF INDIAN AFFAIRS... office do to identify what work is to be done on my dwelling? (a) First, a trained and qualified representative of your servicing housing office must visit your dwelling to identify what repairs or renovation...

  3. 25 CFR 256.23 - How will I be advised that the repair, renovation or replacement of my dwelling has been completed?

    Science.gov (United States)

    2010-04-01

    ... replacement of my dwelling has been completed? 256.23 Section 256.23 Indians BUREAU OF INDIAN AFFAIRS..., renovation or replacement of my dwelling has been completed? The servicing housing office will advise you, in... final walk-through of the dwelling with your servicing housing office representative. You will be...

  4. Towards the island of superheavy stability - Prompt spectroscopy of 246Fm and 256Rf nuclei

    International Nuclear Information System (INIS)

    Piot, J.

    2010-10-01

    The region of trans-fermium nuclei (Z = 100 to 104) is the last region of the nuclides chart to be accessible to spectroscopic measurements. It therefore provides the ultimate anchor points for nuclear models. This region also lies on the path of the alpha-decay chains of the super-heavy elements. This region represents the limit of today's spectroscopic capabilities. It therefore requires technological developments in order to overcome these limits. My thesis focuses on various aspects of the spectroscopy of trans-fermium nuclei. I took part in the development of the TNT2D digital acquisition cards for germanium detectors. I validated their use on the gamma-ray spectrometer JUROGAM during an in-beam experiment and demonstrated the gain compared to an analogue acquisition system. These tests were part of the developments needed to secure a study of the prompt spectroscopy of 256 Rf. The preparation of this experiment also lead me to work on the development of a 50 Ti beam. For that purpose, I studied and tested the use of titanium organo-metallic compounds compatible with the MIVOC technique. In parallel, I studied the use of metallic and oxide titanium pellets with an inductive oven newly developed at the University of Jyvaeskylae. In addition to these developments, I had the opportunity to study the in-beam prompt spectroscopy of 246 Fm at the University of Jyvaeskylae. The measurements yielded a rotational band built on the ground state of 246 Fm. This band has been observed up to the level 16 + and shows a behaviour quite similar to the neighbouring even-even isotopes, except for the top of the band for which a wider statistics is necessary in order to conclude. (author)

  5. Binding of formyl peptides to Walker 256 carcinosarcoma cells and the chemotactic response of these cells

    Energy Technology Data Exchange (ETDEWEB)

    Rayner, D.C.; Orr, F.W.; Shiu, R.P.

    1985-05-01

    N-Formylmethionylleucylphenylalanine (fMLP) induces chemotaxis in leukocytes, the response being mediated by peptide binding to a receptor on the plasma membrane. In tumor cells, this peptide has been reported to induce cellular swelling and chemotaxis in vitro and to enhance the localization of circulating tumor cells in vivo. In the Boyden chamber, the authors evaluated the migratory responses of Walker carcinosarcoma 256 cells to varying concentrations of fMLP. Sigmoidal dose-response curves were obtained with the dose of chemotactic factor that elicits a half-maximal chemotactic response of 5.0 +/- 2.5 X 10(-8) M. Checkerboard analysis indicated that these responses were dependent upon a concentration gradient of fMLP with increases in migration of circa 2 to 2.5 times that of random movement. To examine the binding of fMLP, the tumor cells were incubated with 5 X 10(-9) M fML-(/sup 3/H)P in Hanks balanced salt solution. Specific binding (0.5 to 1% of total radioligand, to whole cells inhibited by 5 X 10(-6) M fMLP) approached equilibrium after 4 to 6 h at 4 degrees C and after 6 to 10 h at 22 degrees C. Autoradiographic studies demonstrated heterogeneous binding of the peptide by tumor cells and also showed its intracellular localization. In homogenates of Walker cells prepared in 0.1 M Tris HCl, pH 7.4, with 10 mM MgCl2 and bovine serum albumin (1 mg/ml), specific binding of approximately 0.5% of total fML-(/sup 3/H)P reached equilibrium after 60 min at 4 degrees C. In whole cells and homogenates, binding was reversible by addition of unlabeled fMLP.

  6. Quantitative analysis of the right auricle with 256-slice computed tomography.

    Science.gov (United States)

    Li, Cai-Ying; Gao, Bu-Lang; Pan, Tong; Xiang, Cheng; Zhang, Xue-Jing; Liu, Xiao-Wei; Fan, Qiong-Ying

    2017-04-01

    To quantitatively measure the morphology parameters of the right auricle with 256-slice multidetector computed tomography angiography (MDCTA) in healthy people. A retrospective analysis of 200 patients who had undergone coronary MDCTA with negative findings was performed. The raw imaging data were reconstructed and the right auricular volume, right atrial volume, right auricle height, base long and short axes, base perimeter and area, normal angle, and distance were quantitatively measured. Men had significantly (P right auricular volume (13.3 ± 4.0 vs. 11.7 ± 3.7 mL) and height (33.0 ± 5.0 vs. 30.5 ± 5.2 mm), the base long axis (34.4 ± 4.1 vs. 33.2 ± 3.9 mm), area (787.6 ± 177.6 vs. 771.0 ± 143.2 mm 2 ) and perimeter (119.2 ± 17.5 vs. 115.0 ± 13.0), and the normal distance (22.4 ± 6.6 vs. 20.2 ± 6.7 mm). The normal 95 % reference range for the right auricular parameters was put forward. The right auricular parameters had a good correlation with the right atrium volume, aortic diameter, the body weight, height, and body surface area but a bad correlation with the vertebral body height. Significantly (P  0.05) difference existed in the other right auricular parameters. Quantitative measurements of the right auricle can help us get a good understanding of the right auricular morphology and its relationship with surrounding structures and are helpful for cardiac interventions of electrophysiology and radiofrequency ablation.

  7. Peculiar morphology of the high-redshift radio galaxies 3C 13 and 3C 256 in subarcsecond seeing

    International Nuclear Information System (INIS)

    Le Fevre, O.; Hammer, F.; Nottale, L.; Mazure, A.; Christian, C.

    1988-01-01

    High-spatial-resolution imaging is presented for two radio galaxies from the 3C catalog, 3C 13 and 3C 256 with redshifts of 1.351 and 1.819, respectively. The excellent image quality obtained at CFHT, 0.6-arcsec FWHM for 3C 13 and 0.7-arcsec FWHM for 3C 256 in the R band, over long integration times, made it possible to resolve these distant galaxies into complex structures. As suggested by Le Fevre et al. (1987) for another source (the gravitational lens candidate 3C 324) an interpretation in terms of gravitational amplification by foreground galaxies or clusters of galaxies is proposed. 3C 13 appears to be the most serious candidate, since a foreground galaxy, with an absolute luminosity M(R) = 23.3 and a redshift z = 0.477, is only 3.9 in from the extended radio galaxy. 18 references

  8. Abscopal antitumor immune effects of magnet-mediated hyperthermia at a high therapeutic temperature on Walker-256 carcinosarcomas in rats

    OpenAIRE

    WANG, HUI; ZHANG, LI; SHI, YINGRUI; JAVIDIPARSIJANI, SARA; WANG, GUIRONG; LI, XIAO; OUYANG, WEIWEI; ZHOU, JUMEI; ZHAO, LINGYUN; WANG, XIAOWEN; ZHANG, XIAODONG; GAO, FUPING; LIU, JINGSHI; LUO, JUNMING; TANG, JINTIAN

    2014-01-01

    The abscopal effect has previously been described in various tumors and is associated with radiation therapy and hyperthermia, with possible underlying mechanisms explaining each observed case. In the present study, we aimed to investigate the antitumor effects of magnet-mediated hyperthermia on Walker-256 carcinosarcomas in rats at two different temperature ranges (42–46°C and 50–55°C). We also aimed to identify whether a higher therapeutic temperature of magnetic-mediated hyperthermia impro...

  9. Contribution of radiosensitivity study for Walker 256 tumor in rats. Association of early immunization with action of ionized radiation

    International Nuclear Information System (INIS)

    Sakate, A.T.Y.

    1979-01-01

    The suspension of tumoral cells from Walker 256 were irradiated with doses of 2.500, 4.500, 5.000, 5.500 and 7.500 rad for determining the attenuation dose. The suspension of inactives tumoral cells were injected in rats for verifying the immunized effects in relation of active Walker tumor. After be certified the growth of tumor, the rats were irradiated with cobalt 60 and was verified the decrease of tumor. (author)

  10. Preparation of carbon-11 labelled proline for positron emission tomography. Preliminary distribution studies in rats with Walker 256 carcinosarcoma

    Energy Technology Data Exchange (ETDEWEB)

    Bolster, J.M.; Hoeve, W. ten; Vaalburg, W.; Dijk, T.H. van; Zijlstra, J.B.; Paans, A.M.J.; Wynberg, H.; Woldring, M.G. (Rijksuniversiteit Groningen Hospital (Netherlands). Dept. of Nuclear Medicine; Rijksuniversiteit Groningen (Netherlands). Organisch Chemisch Lab.)

    1985-05-01

    DL-(1-/sup 11/C)Proline has been synthesized by carboxylation of ..cap alpha..-lithiopyrrolidyl-N-tert-butyl-formamidine with a radiochemical yield of up to 18% without correction for decay. The total synthesis time is 45 min. Accumulation of DL-(1-/sup 11/C)proline has been shown in Walker 256 carcinosarcoma transplanted in rats. A tumor/non-tumor ratio of 5.9 was found at 45 min after i.v. injection.

  11. Syntheses of carbon-11 labelled ornithine and lysine. Preliminary accumulation studies in rats with Walker 256 carcinosarcoma

    Energy Technology Data Exchange (ETDEWEB)

    Bolster, J.M.; Vaalburg, W.; Dijk, T.H. van; Zijlstra, J.B.; Paans, A.M.J.; Wynberg, H.; Woldring, M.G. (Rijksuniversiteit Groningen (Netherlands))

    1985-04-01

    DL-(1-/sup 11/C)ornithine and lysine have been synthesized by carboxylation of the corresponding ..cap alpha..-lithioisocyanide with a radiochemical yield of up to 14% without correction for decay. The total preparation time is 50 min. Accumulation of both DL-(1-/sup 11/C)ornithine and lysine in Walker 256 carcinosarcoma is observed, with a tumour/non-tumor ratio of 4.9 and 4.5 respectively, at 45 min after intravenous injection.

  12. Qualitative and quantitative assessment of adenosine triphosphate stress whole-heart dynamic myocardial perfusion imaging using 256-slice computed tomography.

    Science.gov (United States)

    Kurata, Akira; Kawaguchi, Naoto; Kido, Teruhito; Inoue, Katsuji; Suzuki, Jun; Ogimoto, Akiyoshi; Funada, Jun-ichi; Higaki, Jitsuo; Miyagawa, Masao; Vembar, Mani; Mochizuki, Teruhito

    2013-01-01

    The aim of this study was to investigate the correlation of the qualitative transmural extent of hypoperfusion areas (HPA) using stress dynamic whole-heart computed tomography perfusion (CTP) imaging by 256-slice CT with CTP-derived myocardial blood flow (MBF) for the estimation of the severity of coronary artery stenosis. Eleven patients underwent adenosine triphosphate (0.16 mg/kg/min, 5 min) stress dynamic CTP by 256-slice CT (coverage: 8 cm, 0.27 s/rotation), and 9 of the 11 patients underwent coronary angiography (CAG). Stress dynamic CTP (whole-heart datasets over 30 consecutive heart beats in systole without spatial and temporal gaps) was acquired with prospective ECG gating (effective radiation dose: 10.4 mSv). The extent of HPAs was visually graded using a 3-point score (normal, subendocardial, transmural). MBF (ml/100g/min) was measured by deconvolution. Differences in MBF (mean ± standard error) according to HPA and CAG results were evaluated. In 27 regions (3 major coronary territories in 9 patients), 11 coronary stenoses (> 50% reduction in diameter) were observed. In 353 myocardial segments, HPA was significantly related to MBF (P 70%], 119 ± 69). The qualitative transmural extent of HPA using stress whole-heart dynamic CTP imaging by 256-slice CT exhibits a good correlation with quantitative CTP-derived MBF and may aid in assessing the hemodynamic significance of coronary artery disease.

  13. Qualitative and quantitative assessment of adenosine triphosphate stress whole-heart dynamic myocardial perfusion imaging using 256-slice computed tomography.

    Directory of Open Access Journals (Sweden)

    Akira Kurata

    Full Text Available BACKGROUND: The aim of this study was to investigate the correlation of the qualitative transmural extent of hypoperfusion areas (HPA using stress dynamic whole-heart computed tomography perfusion (CTP imaging by 256-slice CT with CTP-derived myocardial blood flow (MBF for the estimation of the severity of coronary artery stenosis. METHODS AND RESULTS: Eleven patients underwent adenosine triphosphate (0.16 mg/kg/min, 5 min stress dynamic CTP by 256-slice CT (coverage: 8 cm, 0.27 s/rotation, and 9 of the 11 patients underwent coronary angiography (CAG. Stress dynamic CTP (whole-heart datasets over 30 consecutive heart beats in systole without spatial and temporal gaps was acquired with prospective ECG gating (effective radiation dose: 10.4 mSv. The extent of HPAs was visually graded using a 3-point score (normal, subendocardial, transmural. MBF (ml/100g/min was measured by deconvolution. Differences in MBF (mean ± standard error according to HPA and CAG results were evaluated. In 27 regions (3 major coronary territories in 9 patients, 11 coronary stenoses (> 50% reduction in diameter were observed. In 353 myocardial segments, HPA was significantly related to MBF (P 70%], 119 ± 69. CONCLUSION: The qualitative transmural extent of HPA using stress whole-heart dynamic CTP imaging by 256-slice CT exhibits a good correlation with quantitative CTP-derived MBF and may aid in assessing the hemodynamic significance of coronary artery disease.

  14. Caliste 256: A CdTe imaging spectrometer for space science with a 580 {mu}m pixel pitch

    Energy Technology Data Exchange (ETDEWEB)

    Limousin, O., E-mail: olimousin@cea.fr [CEA/Saclay, DSM/Irfu/Service d' Astrophysique, F-91191 Gif-sur-Yvette (France); Lugiez, F.; Gevin, O. [CEA/Saclay, DSM/Irfu/Service d' Electronique Detecteurs et Informatique, F-91191 Gif-sur-Yvette (France); Meuris, A.; Blondel, C. [CEA/Saclay, DSM/Irfu/Service d' Astrophysique, F-91191 Gif-sur-Yvette (France); Delagnes, E. [CEA/Saclay, DSM/Irfu/Service d' Electronique Detecteurs et Informatique, F-91191 Gif-sur-Yvette (France); Donati, M.; Le Mer, I.; Martignac, J.; Pinsard, F. [CEA/Saclay, DSM/Irfu/Service d' Astrophysique, F-91191 Gif-sur-Yvette (France); Vassal, M.C.; Bocage, R.; Soufflet, F. [3D Plus, 641 rue Helene Boucher, F-78532 Buc (France)

    2011-08-11

    Caliste project aims at hybridizing 1 cm{sup 2} CdTe or CdZnTe pixel detectors with low-noise full custom front-end electronics, in a single component standing in a 1x1x2 cm{sup 3} volume. Caliste device is 4-side buttable and can be used as elementary detection unit of a large mosaic to form a hard X-ray focal plane of any size and shape. Caliste is especially designed to match astronomical space mission requirements and its design takes into account environmental constraints, radiation environment in particular. This new imaging spectrometer for hard X-rays detection offers high spectral and spatial resolution together with accurate time-tagging capability and low dead time. Caliste concept relies on a 3D hybridization technology that consists in stacking full custom ASICs perpendicular to the detection surface into a single component. This technique simultaneously permits to realize a buttable imager and to enhance performance and uniformity response. Our last prototype is called Caliste 256 and integrates 16x16 pixels array, 580 {mu}m pitch and 256 corresponding independent spectroscopy channels. This paper presents Caliste 256 design and properties. We emphasize spectral performance and demonstrate spectral resolution capabilities better than 1 keV FWHM at 60 keV.

  15. Power fading mitigation of 40-Gbit/s 256-QAM OFDM carried by colorless laser diode under injection-locking.

    Science.gov (United States)

    Tsai, Cheng-Ting; Chi, Yu-Chieh; Lin, Gong-Ru

    2015-11-02

    The pre-compensation on power fading effect of a colorless laser diode (CLD) carried 40-Gbit/s 256-QAM OFDM transmission during 25-km is demonstrated. By offsetting the DC bias to thrice the threshold (I(th)) and increasing the injection to 0 dBm, the CLD not only enhances its coherence but also suppresses modulation throughput declination and reduces the relative intensity related noise floor to -50 dBm. Modeling the receiving power of the delivered 256-QAM OFDM subcarriers is established, indicating that raising the bias to 3I(th) down-shifts the power fading induced notch to 8.8 GHz. This further degrades the OFDM subcarrier peak power by -2.9 dB after 25-km transmission, and the corresponded signal-to-noise ratio (SNR), error vector magnitude (EVM) and bit-error-rate (BER) are 26.1 dB, 4.9% and 6.5 × 10(-3), respectively. Pre-leveling the OFDM subcarrier as well as the modulation throughput effectively compromises the over-bias enlarged power fading to promote transmission. With a pre-leveled power slope of 1.5 dB/GHz for 256-QAM OFDM data, the modulation throughput declination of the high biased CLD significantly mitigates under BtB transmission, enabling the receiving sensitivity at -7.2 dBm with SNR, EVM and BER of 29.9 dB, 3.1% and 1.5 × 10(-4), respectively. Increasing the pre-leveling slope to 3.2 dB/GHz minimizes the fiber dispersion induced power fading, which improves the receiving SNR, EVM and BER to 27.4 dB, 4.2% and 2.6 × 10(-3), respectively, with receiving sensitivity of -3 dBm and power penalty of 4.2 dB after 25-km SMF transmission.

  16. Assessment of coronary artery by prospective ECG-triggered 256 multi-slice CT on children with congenital heart disease.

    Science.gov (United States)

    Yao, Li-Ping; Zhang, Li; Li, Hui-Ming; Ding, Ming; Yu, Ling-Wei; Yang, Xin; Li, Xiao-Ming; Sun, Kun

    2017-12-01

    This study aims to investigate the imaging quality and radiation dose of prospective ECG-triggered 256 multi-slice computer tomography (MSCT) in accessing the coronary artery (CA) in children. Coronary arteries of 149 children were evaluated using prospective ECG-triggered 256 MSCT with the same system settings. A four-point scoring system was applied to study the capability of MSCT in detecting CA in these patients. Signal, noise and contrast-to-noise ratios (CNR) were analyzed to investigate the association of image quality with age. Then, volumetric CT dose index (CTDI vol ), dose-length product (DLP), and effective dose (ED) were utilized to study the association of radiation dose with age. The detection rate for original, proximal, middle, distal and the 11 segments of CA was 100, 97, 92, 81 and 92%, respectively; and there was no influence on age during the detection (all, P < 0.05). A negative correlation was found between ED and age (r = -0.664, P < 0.001). Significantly larger EDs were found in younger patients (age: <3 years; 1.2 ± 0.5 and 0.6 ± 0.2 mSv; P < 0.001), while higher DLPs were found in elder patients, although no correlation was found between ages versus DLP (r = 0.092, P = 0.262). Prospective ECG-triggered 256 MSCT has considerable performance for the evaluation of CA in children. However, great caution is needed for children under the age of three in the selection of this examination. Furthermore, the tube current could be further reduced for the examination of children ≥8 years.

  17. Reduction of the estimated radiation dose and associated patient risk with prospective ECG-gated 256-slice CT coronary angiography

    International Nuclear Information System (INIS)

    Efstathopoulos, E P; Kelekis, N L; Pantos, I; Brountzos, E; Argentos, S; Grebac, J; Ziaka, D; Seimenis, I; Katritsis, D G

    2009-01-01

    Computed tomography (CT) coronary angiography has been widely used since the introduction of 64-slice scanners and dual-source CT technology, but high radiation doses have been reported. Prospective ECG-gating using a 'step-and-shoot' axial scanning protocol has been shown to reduce radiation exposure effectively while maintaining diagnostic accuracy. 256-slice scanners with 80 mm detector coverage have been currently introduced into practice, but their impact on radiation exposure has not been adequately studied. The aim of this study was to assess radiation doses associated with CT coronary angiography using a 256-slice CT scanner. Radiation doses were estimated for 25 patients scanned with either prospective or retrospective ECG-gating. Image quality was assessed objectively in terms of mean CT attenuation at selected regions of interest on axial coronary images and subjectively by coronary segment quality scoring. It was found that radiation doses associated with prospective ECG-gating were significantly lower than retrospective ECG-gating (3.2 ± 0.6 mSv versus 13.4 ± 2.7 mSv). Consequently, the radiogenic fatal cancer risk for the patient is much lower with prospective gating (0.0176% versus 0.0737%). No statistically significant differences in image quality were observed between the two scanning protocols for both objective and subjective quality assessments. Therefore, prospective ECG-gating using a 'step-and-shoot' protocol that covers the cardiac anatomy in two axial acquisitions effectively reduces radiation doses in 256-slice CT coronary angiography without compromising image quality.

  18. CT Angiography of Peripheral Arterial Disease by 256-Slice Scanner: Accuracy, Advantages and Disadvantages Compared to Digital Subtraction Angiography.

    Science.gov (United States)

    Mishra, Atul; Jain, Narendra; Bhagwat, Anand

    2017-07-01

    Peripheral arterial occlusive disease (PAOD) may cause disabling claudication or critical limb ischemia. Multidetector computed tomography (CT) technology has evolved to the level of 256-slice CT scanners which has significantly improved the spatial and temporal resolution of the images. This has provided the capability of chasing the contrast bolus at a fast speed enabling angiographic imaging of long segments of the body. These images can be reconstructed in various planes and various modes for detailed analysis of the peripheral vascular diseases which helps in making treatment decision. The aim of this retrospective study was to compare the CT angiograms (CTAs) of all cases of PAOD done by 256-slice CT scanner at a tertiary care vascular center and comparing these images with the digital subtraction angiograms (DSAs) of these patients. The retrospective study included 53 patients who underwent both CTA and DSA at our center over a period of 3 years from March 2013 to March 2016. The CTA showed high sensitivity (93%) and specificity (92.7%) for overall assessment of degree of stenosis in a vascular segment in cases of aortic and lower limb occlusive disease. The assessment of lesions of infrapopliteal segment was comparatively inferior (sensitivity 91.6%, accuracy 73.3%, and positive predictive value 78.5%), more so in the presence of significant calcification. The advantages of CTA were its noninvasive nature, ability to image large area of body, almost no adverse effects to the patients, and better assessment of vessel wall disease. However, the CTA assessment of collaterals was inferior with a sensitivity of only 62.7% as compared to DSA. Overall, 256-slice CTA provides fast and accurate imaging of vascular tree which can restrict DSA only in few selected cases as a problem-solving tool where clinico-radiological mismatch is present.

  19. Predictive Significance of Tumor Grade Using 256-Slice CT Whole-Tumor Perfusion Imaging in Colorectal Adenocarcinoma.

    Science.gov (United States)

    Xu, Yanyan; Sun, Hongliang; Song, Aiping; Yang, Qiang; Lu, Xiaomei; Wang, Wu

    2015-12-01

    The preoperative assessment of tumor grade has important clinical implications for the treatment and prognosis of patients with colorectal adenocarcinomas. The purpose of this study is to investigate the predictive significance of colorectal adenocarcinoma grade using 256-slice whole-tumor computed tomography (CT) perfusion. Fifty-three patients with proven colorectal adenocarcinomas were enrolled. All of them underwent 256-slice whole-tumor CT perfusion. They were divided into two different subgroups according to postoperative pathological results: low grade and high grade. The Kruskal-Wallis test or one-way analysis of variance was used for comparison of CT perfusion parameters between different tumor grades. Multivariant correlation between pathologic tumor stage, histologic tumor differentiation, and whole-tumor CT perfusion parameters was evaluated by Spearman rank correlation coefficient. According to receiver operating characteristic (ROC) curves, perfusion parameters including blood flow (BF), peak enhancement index (PEI), blood volume (BV), and time to peak (TTP) of 53 patients were analyzed, and the sensitivity, specificity, and accuracy of these parameters in predicting tumor grade were calculated. There were significant differences in BF and TTP between low-grade and high-grade tumors. According to the ROC curve, BF and TTP were of diagnostic significance, with the area under the curve values of 0.828 and 0.736, respectively. The diagnostic threshold of BF was 32.12 mL/min/100 g and that of TTP was 18.10 seconds. The CT perfusion parameters (BF, TTP) of first-pass 256-slice whole-tumor CT perfusion imaging can reflect tumor grade in colorectal adenocarcinoma. Copyright © 2015 The Association of University Radiologists. Published by Elsevier Inc. All rights reserved.

  20. Respiratory-gated segment reconstruction for radiation treatment planning using 256-slice CT-scanner during free breathing

    Science.gov (United States)

    Mori, Shinichiro; Endo, Masahiro; Kohno, Ryosuke; Minohara, Shinichi; Kohno, Kazutoshi; Asakura, Hiroshi; Fujiwara, Hideaki; Murase, Kenya

    2005-04-01

    The conventional respiratory-gated CT scan technique includes anatomic motion induced artifacts due to the low temporal resolution. They are a significant source of error in radiotherapy treatment planning for the thorax and upper abdomen. Temporal resolution and image quality are important factors to minimize planning target volume margin due to the respiratory motion. To achieve high temporal resolution and high signal-to-noise ratio, we developed a respiratory gated segment reconstruction algorithm and adapted it to Feldkamp-Davis-Kress algorithm (FDK) with a 256-detector row CT. The 256-detector row CT could scan approximately 100 mm in the cranio-caudal direction with 0.5 mm slice thickness in one rotation. Data acquisition for the RS-FDK relies on the assistance of the respiratory sensing system by a cine scan mode (table remains stationary). We evaluated RS-FDK in phantom study with the 256-detector row CT and compared it with full scan (FS-FDK) and HS-FDK results with regard to volume accuracy and image noise, and finally adapted the RS-FDK to an animal study. The RS-FDK gave a more accurate volume than the others and it had the same signal-to-noise ratio as the FS-FDK. In the animal study, the RS-FDK visualized the clearest edges of the liver and pulmonary vessels of all the algorithms. In conclusion, the RS-FDK algorithm has a capability of high temporal resolution and high signal-to-noise ratio. Therefore it will be useful when combined with new radiotherapy techniques including image guided radiation therapy (IGRT) and 4D radiation therapy.

  1. N-(4-Bromobenzyl-2-(5,6-dimethyl-1H-benzo[d]imid-azol-2-ylbenzeneamine

    Directory of Open Access Journals (Sweden)

    Monika Dziełak

    2018-01-01

    Full Text Available N-(4-Bromobenzyl-2-(5,6-dimethyl-1H-benzo[d]imidazol-2-ylbenzeneamine was obtained by condensation of N-(4-bromobenzyl-3,1-benzoxazine-2,4-dione (N-(4-bromobenzylisatoic anhydride with 4,5-dimethyl-1,2-phenylenediamine in refluxing acetic acid. This is a rare example of condensation of N-substituted 3,1-benzoxazine-2,4-dione with 1,2-phenylenediamine, which resulted in the formation of a benzimidazole derivative with a moderate yield. Crystallographic studies and initial biological screening were performed for the obtained product.

  2. Evaluation of radiation dose of triple rule-out coronary angiography protocols with different scan length using 256-slice CT

    Energy Technology Data Exchange (ETDEWEB)

    Tsai, Chia-Jung; Lee, Jason J.S. [Department of Biomedical Imaging and Radiological Sciences, National Yang Ming University, 155 Li-Nong St., Sec. 2, Taipei 112, Taiwan (China); Chen, Liang-Kuang [Department of Radiology, Shin Kong Wu Ho-Su Memorial Hospital, Taipei, Taiwan (China); College of Medicine, Fu Jen Catholic University, Taipei, Taiwan (China); Mok, Greta S.P. [Department of Electrical and Electronics Engineering, Faculty of Science and Technology, University of Macau (Macau) and Department of Health Technology and Informatics, Hong Kong Polytechnic University (Hong Kong); Hsu, Shih-Ming, E-mail: smhsu@mail.cmu.edu.tw [Department of Biomedical Imaging and Radiological Science, China Medical University No. 91 Hsueh-Shih Road, Taichung 40402, Taiwan (China); Wu, Tung-Hsin, E-mail: tung@ym.edu.tw [Department of Biomedical Imaging and Radiological Sciences, National Yang Ming University, 155 Li-Nong St., Sec. 2, Taipei 112, Taiwan (China)

    2011-10-01

    Triple rule-out coronary CT angiography (TRO-CTA) is a new approach for providing noninvasive visualization of coronary arteries with simultaneous evaluation of pulmonary arteries, thoracic aorta and other intrathoracic structures. The increasing use of TRO-CTA examination with longer scan length is associated with the concerns about radiation dose and their corresponding cancer risk. The purpose of this study is to evaluate organ dose and effective dose for the TRO-CTA examination with 2 scan lengths: TRO{sub std} and TRO{sub ext}, using 256-slice CT. TRO-CTA examinations were performed on a 256-slice CT scanner without ECG-based tube current modulation. Absorbed organ doses were measured using an anthropomorphic phantom and thermal-luminance dosimeters (TLDs). Effective dose was determined by taking a sum of the measured absorbed organ doses multiplied with the tissue weighting factor based on ICRP-103, and compared to that calculated using the dose-length product (DLP) method. We obtained high organ doses in the thyroid, esophagus, breast, heart and lung in both TRO-CTA protocols. Effective doses of the TRO{sub std} and TRO{sub ext} protocols with the phantom method were 26.37 and 42.49 mSv, while those with the DLP method were 19.68 and 38.96 mSv, respectively. Our quantitative dose information establishes a relationship between radiation dose and scanning length, and can provide a practical guidance to best clinical practice.

  3. Evaluation of radiation dose of triple rule-out coronary angiography protocols with different scan length using 256-slice CT

    Science.gov (United States)

    Tsai, Chia-Jung; Lee, Jason J. S.; Chen, Liang-Kuang; Mok, Greta S. P.; Hsu, Shih-Ming; Wu, Tung-Hsin

    2011-10-01

    Triple rule-out coronary CT angiography (TRO-CTA) is a new approach for providing noninvasive visualization of coronary arteries with simultaneous evaluation of pulmonary arteries, thoracic aorta and other intrathoracic structures. The increasing use of TRO-CTA examination with longer scan length is associated with the concerns about radiation dose and their corresponding cancer risk. The purpose of this study is to evaluate organ dose and effective dose for the TRO-CTA examination with 2 scan lengths: TRO std and TRO ext, using 256-slice CT. TRO-CTA examinations were performed on a 256-slice CT scanner without ECG-based tube current modulation. Absorbed organ doses were measured using an anthropomorphic phantom and thermal-luminance dosimeters (TLDs). Effective dose was determined by taking a sum of the measured absorbed organ doses multiplied with the tissue weighting factor based on ICRP-103, and compared to that calculated using the dose-length product (DLP) method. We obtained high organ doses in the thyroid, esophagus, breast, heart and lung in both TRO-CTA protocols. Effective doses of the TRO std and TRO ext protocols with the phantom method were 26.37 and 42.49 mSv, while those with the DLP method were 19.68 and 38.96 mSv, respectively. Our quantitative dose information establishes a relationship between radiation dose and scanning length, and can provide a practical guidance to best clinical practice.

  4. Implementation of RSA 2048-bit and AES 256-bit with Digital Signature for Secure Electronic Health Record Application

    Directory of Open Access Journals (Sweden)

    Mohamad Ali Sadikin

    2016-10-01

    Full Text Available This research addresses the implementation of encryption and digital signature technique for electronic health record to prevent cybercrime such as robbery, modification and unauthorised access. In this research, RSA 2048-bit algorithm, AES 256-bit and SHA 256 will be implemented in Java programming language. Secure Electronic Health Record Information (SEHR application design is intended to combine given services, such as confidentiality, integrity, authentication, and nonrepudiation. Cryptography is used to ensure the file records and electronic documents for detailed information on the medical past, present and future forecasts that have been given only to the intended patients. The document will be encrypted using an encryption algorithm based on NIST Standard. In the application, there are two schemes, namely the protection and verification scheme. This research uses black-box testing and whitebox testing to test the software input, output, and code without testing the process and design that occurs in the system.We demonstrated the implementation of cryptography in SEHR. The implementation of encryption and digital signature in this research can prevent archive thievery.

  5. 256 fs, 2 nJ soliton pulse generation from MoS2 mode-locked fiber laser

    Science.gov (United States)

    Jiang, Zike; Chen, Hao; Li, Jiarong; Yin, Jinde; Wang, Jinzhang; Yan, Peiguang

    2017-12-01

    We demonstrate an Er-doped fiber laser (EDFL) mode-locked by a MoS2 saturable absorber (SA), delivering a 256 fs, 2 nJ soliton pulse at 1563.4 nm. The nonlinear property of the SA prepared by magnetron sputtering deposition (MSD) is measured with a modulation depth (MD) of ∼19.48% and a saturable intensity of 4.14 MW/cm2. To the best of our knowledge, the generated soliton pulse has the highest pulse energy of 2 nJ among the reported mode-locked EDFLs based on transition metal dichalcogenides (TMDs). Our results indicate that MSD-grown SAs could offer an exciting platform for high pulse energy and ultrashort pulse generation.

  6. Shell-structure and pairing interaction in superheavy nuclei: rotational properties of the z=104 nucleus (256)rf.

    Science.gov (United States)

    Greenlees, P T; Rubert, J; Piot, J; Gall, B J P; Andersson, L L; Asai, M; Asfari, Z; Cox, D M; Dechery, F; Dorvaux, O; Grahn, T; Hauschild, K; Henning, G; Herzan, A; Herzberg, R-D; Heßberger, F P; Jakobsson, U; Jones, P; Julin, R; Juutinen, S; Ketelhut, S; Khoo, T-L; Leino, M; Ljungvall, J; Lopez-Martens, A; Lozeva, R; Nieminen, P; Pakarinen, J; Papadakis, P; Parr, E; Peura, P; Rahkila, P; Rinta-Antila, S; Ruotsalainen, P; Sandzelius, M; Sarén, J; Scholey, C; Seweryniak, D; Sorri, J; Sulignano, B; Theisen, Ch; Uusitalo, J; Venhart, M

    2012-07-06

    The rotational band structure of the Z=104 nucleus (256)Rf has been observed up to a tentative spin of 20ℏ using state-of-the-art γ-ray spectroscopic techniques. This represents the first such measurement in a superheavy nucleus whose stability is entirely derived from the shell-correction energy. The observed rotational properties are compared to those of neighboring nuclei and it is shown that the kinematic and dynamic moments of inertia are sensitive to the underlying single-particle shell structure and the specific location of high-j orbitals. The moments of inertia therefore provide a sensitive test of shell structure and pairing in superheavy nuclei which is essential to ensure the validity of contemporary nuclear models in this mass region. The data obtained show that there is no deformed shell gap at Z=104, which is predicted in a number of current self-consistent mean-field models.

  7. Automatic assessment of coronary artery calcium score from contrast-enhanced 256-row coronary computed tomography angiography.

    Science.gov (United States)

    Rubinshtein, Ronen; Halon, David A; Gaspar, Tamar; Lewis, Basil S; Peled, Nathan

    2014-01-01

    The coronary artery calcium score (CS), an independent predictor of cardiovascular events, can be obtained from a stand-alone nonenhanced computed tomography (CT) scan (CSCT) or as an additional nonenhanced procedure before contrast-enhanced coronary CT angiography (CCTA). We evaluated the accuracy of a novel fully automatic tool for computing CS from the CCTA examination. One hundred thirty-six consecutive symptomatic patients (aged 59 ± 11 years, 40% female) without known coronary artery disease who underwent both 256-row CSCT and CCTA were studied. Original scan reconstruction (slice thickness) was maintained (3 mm for CSCT and 0.67 mm for CCTA). CS was computed from CCTA by an automatic tool (COR Analyzer, rcadia Medical Imaging, Haifa, Israel) and compared with CS results obtained by standard assessment of nonenhanced CSCT (HeartBeat CS, Philips, Cleveland, Ohio). We also compared both methods for classification into 5 commonly used CS categories (0, 1 to 10, 11 to 100, 101 to 400, >400 Agatston units). All scans were of diagnostic quality. CS obtained by the COR Analyzer from CCTA classified 111 of 136 (82%) of patients into identical categories as CS by CSCT and 24 of remaining 25 into an adjacent category. Overall, CS values from CCTA showed high correlation with CS values from CSCT (Spearman rank correlation = 0.95, p automatically computed from 256-row CCTA correlated highly with standard CS values obtained from nonenhanced CSCT. CS obtained directly from CCTA may obviate the need for an additional scan and attendant radiation. Copyright © 2014 Elsevier Inc. All rights reserved.

  8. 256-pixel microcalorimeter array for high-resolution γ-ray spectroscopy of mixed-actinide materials

    Energy Technology Data Exchange (ETDEWEB)

    Winkler, R., E-mail: rwinkler@lanl.gov [Los Alamos National Laboratory, Los Alamos, NM (United States); Hoover, A.S.; Rabin, M.W. [Los Alamos National Laboratory, Los Alamos, NM (United States); Bennett, D.A.; Doriese, W.B.; Fowler, J.W.; Hays-Wehle, J.; Horansky, R.D.; Reintsema, C.D.; Schmidt, D.R.; Vale, L.R.; Ullom, J.N. [National Institute of Standards and Technology, Boulder, CO (United States)

    2015-01-11

    The application of cryogenic microcalorimeter detectors to γ-ray spectroscopy allows for measurements with unprecedented energy resolution. These detectors are ideally suited for γ-ray spectroscopy applications for which the measurement quality is limited by the spectral overlap of many closely spaced transitions using conventional detector technologies. The non-destructive analysis of mixed-isotope Pu materials is one such application where the precision can be potentially improved utilizing microcalorimeter detectors compared to current state-of-the-art high-purity Ge detectors (HPGe). The LANL-NIST γ-ray spectrometer, a 256-pixel microcalorimeter array based on transition-edge sensors (TESs), was recently commissioned and used to collect data on a variety of Pu isotopic standards to characterize the instrument performance. These measurements represent the first time the simultaneous readout of all 256 pixels for measurements of mixed-isotope Pu materials has been achieved. The LANL-NIST γ-ray spectrometer has demonstrated an average pixel resolution of 55 eV full-width-at-half-maximum at 100 keV, nearly an order of magnitude better than HPGe detectors. Some challenges of the analysis of many-channel ultra-high resolution data and the techniques used to produce quality spectra for isotopic analysis will be presented. The LANL-NIST γ-ray spectrometer has also demonstrated stable operation and obtained high resolution measurements at total array event rates beyond 1 kHz. For a total event rate of 1.25 kHz, approximately 5.6 cps/pixel, a 72.2 eV average FWHM for the 103 keV photopeak of {sup 153}Gd was achieved.

  9. The optimal dose reduction level using iterative reconstruction with prospective ECG-triggered coronary CTA using 256-slice MDCT

    Energy Technology Data Exchange (ETDEWEB)

    Hou, Yang; Xu, Shu; Guo, Wenli; Vembar, Mani [Department of Radiology, Shengjing Hospital of China Medical University, Shenyang 110004 (China); Guo, Qiyong, E-mail: guoqy@sj-hospital.org [Department of Radiology, Shengjing Hospital of China Medical University, Shenyang 110004 (China)

    2012-12-15

    Aim: To assess the image quality (IQ) of an iterative reconstruction (IR) technique (iDose{sup 4}) from prospective electrocardiography (ECG)-triggered coronary computed tomography angiography (coronary CTA) on a 256-slice multi-detector CT (MDCT) scanner and determine the optimal dose reduction using IR that can provide IQ comparable to filtered back projection (FBP). Method and materials: 110 consecutive patients (69 men, 41 women; age: 54 ± 10 years) underwent coronary CTA on a 256-slice MDCT (Brilliance iCT, Philips Healthcare). The control group (Group A, n = 21) were scanned using the conventional tube output (120 kVp, 210 mAs) and reconstructed using FBP. The other 4 groups were scanned with the same kVp but successively reduced tube output as follows: B[n = 15]: 125 mAs; C[n = 22]: 105 mAs; D[n = 36]: 84 mAs: E[n = 16]: 65 mAs) and reconstructed using IR levels of L3 (Group B), L4 (Group C) and L5 (Groups D and E), to compensate for the noise increase. All images were reconstructed using the same kernel (XCB). Two radiologists graded IQ in a blinded fashion on a 4-point scale (4 – excellent, 3 – good, 2 – fair and 1 – poor). Quantitative measurements of CT values, image noise and contrast-to-noise (CNR) were measured in each group. A receiver-operating characteristic (ROC) analysis was performed to determine a radiation reduction threshold up to which excellent IQ was maintained. Results: There were no significant differences in objective noise, SNR and CNR values among Groups A, B, C, D, and E (P = 0.14, 0.09, 0.17, respectively). There were no significant differences in the scores of the subjective IQ between Group A, and Groups B, C, D, E (P = 0.23–0.97). Significant differences in image sharpness and study acceptability were observed between groups A and E (P < 0.05). Using the criterion of excellent IQ (score 4), the ROC curve of dose levels and IQ acceptability established a reduction of 60% of tube output (Group D) as optimum cutoff point

  10. Exclusive use of arterial grafts in coronary artery bypass operations for three-vessel disease : Use of both thoracic arteries and the gastroepiploic artery in 256 consecutive patients

    NARCIS (Netherlands)

    Grandjean, JG; Voors, AA; Boonstra, PW; denHeyer, P; Ebels, T

    1996-01-01

    Methods: From September 1989 to September 1994 we operated on a consecutive group of 256 patients with three-vessel disease in whom we used the right gastroepiploic artery together with both internal thoracic arteries, Vein grafts were not used in these patients, This population consisted of 233 men

  11. Optimal temporal windows and dose-reducing strategy for coronary artery bypass graft imaging with 256-slice CT

    Energy Technology Data Exchange (ETDEWEB)

    Lu, Kun-Mu [Department of Radiology, Shin Kong Wu Ho-Su Memorial Hospital, 95 Wen Chang Road, Shih Lin District, Taipei 111, Taiwan. (China); Lee, Yi-Wei [Department of Radiology, Kaohsiung Chang Gung Memorial Hospital and Chang Gung University College of Medicine, Kaohsiung, Taiwan (China); Department of Biomedical Imaging and Radiological Sciences, National Yang Ming University, Taipei, Taiwan (China); Guan, Yu-Xiang [Department of Biomedical Imaging and Radiological Sciences, National Yang Ming University, Taipei, Taiwan (China); Chen, Liang-Kuang [Department of Radiology, Shin Kong Wu Ho-Su Memorial Hospital, 95 Wen Chang Road, Shih Lin District, Taipei 111, Taiwan. (China); School of Medicine, Fu Jen Catholic University, Taipei, Taiwan (China); Law, Wei-Yip, E-mail: m002325@ms.skh.org.tw [Department of Radiology, Shin Kong Wu Ho-Su Memorial Hospital, 95 Wen Chang Road, Shih Lin District, Taipei 111, Taiwan. (China); Su, Chen-Tau, E-mail: m005531@ms.skh.org.tw [Department of Radiology, Shin Kong Wu Ho-Su Memorial Hospital, 95 Wen Chang Road, Shih Lin District, Taipei 111, Taiwan. (China); School of Medicine, Fu Jen Catholic University, Taipei, Taiwan (China)

    2013-12-11

    Objective: To determine the optimal image reconstruction windows in the assessment of coronary artery bypass grafts (CABGs) with 256-slice computed tomography (CT), and to assess their associated optimal pulsing windows for electrocardiogram-triggered tube current modulation (ETCM). Methods: We recruited 18 patients (three female; mean age 68.9 years) having mean heart rate (HR) of 66.3 beats per minute (bpm) and a heart rate variability of 1.3 bpm for this study. A total of 36 CABGs with 168 segments were evaluated, including 12 internal mammary artery (33.3%) and 24 saphenous vein grafts (66.7%). We reconstructed 20 data sets in 5%-step through 0–95% of the R–R interval. The image quality of CABGs was assessed by a 5-point scale (1=excellent to 5=non-diagnostic) for each segment (proximal anastomosis, proximal, middle, distal course of graft body, and distal anastomosis). Two reviewers discriminated optimal reconstruction intervals for each CABG segment in each temporal window. Optimal windows for ETCM were also evaluated. Results: The determined optimal systolic and diastolic reconstruction intervals could be divided into 2 groups with threshold HR=68. The determined best reconstruction intervals for low heart rate (HR<68) and high heart rate (HR>68) were 76.0±2.5% and 45.0±0% respectively. Average image quality scores were 1.7±0.6 with good inter-observer agreement (Kappa=0.79). Image quality was significantly better for saphenous vein grafts versus arterial grafts (P<0.001). The recommended windows of ETCM for low HR, high HR and all HR groups were 40–50%, 71–81% and 40–96% of R-R interval, respectively. The corresponding dose savings were about 60.8%, 58.7% and 22.7% in that order. Conclusions: We determined optimal reconstruction intervals and ETCM windows representing a good compromise between radiation and image quality for following bypass surgery using a 256-slice CT.

  12. A Re-configurable On-line Learning Spiking Neuromorphic Processor comprising 256 neurons and 128K synapses

    Directory of Open Access Journals (Sweden)

    Ning eQiao

    2015-04-01

    Full Text Available Implementing compact, low-power artificial neural processing systems with real-time on-line learning abilities is still an open challenge. In this paper we present a full-custom mixed-signal VLSI device with neuromorphic learning circuits that emulate the biophysics of real spiking neurons and dynamic synapses for exploring the properties of computational neuroscience models and for building brain-inspired computing systems. The proposed architecture allows the on-chip configuration of a wide range of network connectivities, including recurrent and deep networks with short-term and long-term plasticity. The device comprises 128 K analog synapse and 256 neuron circuits with biologically plausible dynamics and bi-stable spike-based plasticity mechanisms that endow it with on-line learning abilities. In addition to the analog circuits, the device comprises also asynchronous digital logic circuits for setting different synapse and neuron properties as well as different network configurations. This prototype device, fabricated using a 180 nm 1P6M CMOS process, occupies an area of 51.4 mm 2 , and consumes approximately 4 mW for typical experiments, for example involving attractor networks. Here we describe the details of the overall architecture and of the individual circuits and present experimental results that showcase its potential. By supporting a wide range of cortical-like computational modules comprising plasticity mechanisms, this device will enable the realization of intelligent autonomous systems with on-line learning capabilities.

  13. 256 ORIGINAL ARTICLE

    African Journals Online (AJOL)

    boaz

    accounting for 94.1% of NFGNB and 3.1% of total samples. This was followed by Burkholderia pseudomallei (B. pseudomallei) which accounted for 5.9% of NFGNB and 0.2% of all obtained specimens. Tigecycline antibiotic was the most effective antibiotic against Bcc isolates (68.8% susceptibility) in disc diffusion method.

  14. Abscopal antitumor immune effects of magnet-mediated hyperthermia at a high therapeutic temperature on Walker-256 carcinosarcomas in rats.

    Science.gov (United States)

    Wang, Hui; Zhang, Li; Shi, Yingrui; Javidiparsijani, Sara; Wang, Guirong; Li, Xiao; Ouyang, Weiwei; Zhou, Jumei; Zhao, Lingyun; Wang, Xiaowen; Zhang, Xiaodong; Gao, Fuping; Liu, Jingshi; Luo, Junming; Tang, Jintian

    2014-03-01

    The abscopal effect has previously been described in various tumors and is associated with radiation therapy and hyperthermia, with possible underlying mechanisms explaining each observed case. In the present study, we aimed to investigate the antitumor effects of magnet-mediated hyperthermia on Walker-256 carcinosarcomas in rats at two different temperature ranges (42-46°C and 50-55°C). We also aimed to identify whether a higher therapeutic temperature of magnetic-mediated hyperthermia improves the abscopal antitumor effects, where localised irradiation of the tumor causes not only the irradiated tumor to shrink, but also tumors located far from the area of irradiation. Following induction of carcinosarcoma in both sides of the body, magnet-mediated hyperthermia was applied to one side only, leaving the other side as a control. The changes in tumor growth were observed. Our results demonstrated that magnet-mediated hyperthermia at a higher temperature inhibited the growth of carcinosarcoma at the site of treatment. Furthermore, the growth of the carcinosarcoma on the untreated side was also inhibited. The expression levels of proliferating cell nuclear antigen were decreased in the hyperthermia group, which was more significant in the higher temperature test group. Flow cytometric analysis showed an increased number of CD4- and CD8-positive T cells, and enzyme-linked immunosorbent assay showed increased levels of interferon-γ and interleukin-2 in the higher temperature group. These results suggested that magnet-mediated hyperthermia at a higher temperature (50-55°C) can improve the abscopal antitumor effects and stimulate a greater endogenous immune response in carcinosarcoma-bearing rats.

  15. Nitrogen-13 glutamate uptake and perfusion in Walker 256 carcinosarcoma before and after single-dose irradiation

    Energy Technology Data Exchange (ETDEWEB)

    Knapp, W.H.; Helus, F.; Layer, K.; Panzer, M.; Hoever, K.H.O.; Ostertag, H.

    1986-10-01

    Nitrogen-13 (13N) glutamate uptake was recorded in 18 anesthetized rats, both before and at least once after intervention. Each investigation was immediately followed by imaging of blood flow distribution using (11C)butanol. All animals had Walker 256 carcinosarcoma implants in one hind leg. Tumors were locally irradiated with a dose of 800 rad in 14 rats; in four rats, the vasoactive substance 5-hydroxytryptamine (5-HT) was administered. Prior to interventions, the (13N)glutamate tumor-to-muscle uptake showed a linear correlation with blood flow close to identity (y = 0.117 + 0.915x, r = 0.97). After irradiation, a discordant pattern was observed: blood flow tended to increase, while (13N)glutamate tumor-to-muscle uptake dropped from 4.30 +/- 0.66 (s.e.m.) to 3.06 +/- 0.36 (p less than 0.005) during 30 min and attained 4.04 +/- 0.67 2 days later. If (13N)glutamate tumor-to-muscle uptake was related to that of (11C) butanol in each individual animal, this index dropped from 0.93 +/- 0.03 (s.e.m.) to 0.62 +/- 0.04 (p less than 0.001) 30 min after irradiation and attained 0.90 +/- 0.09 after 2 days. In animals treated with 5-HT, (13N)glutamate and (11C)butanol showed a parallel drop from 6.60 +/- 0.84 to 2.10 +/- 0.60 (p less than 0.05) and from 6.8 +/- 0.78 to 2.08 +/- 0.74 (p less than 0.05), respectively. Thus, single-dose irradiation causes (13N)glutamate uptake to be uncoupled with respect to flow, while (13N)glutamate uptake in untreated tumors is flow-limited and responds together with flow on vasomotion.

  16. Tumor Uptake Rate of Alkaline {sup 99m}Tc-DMSA in Walker Carcinosarcoma 256 Bearing Wistar Rats

    Energy Technology Data Exchange (ETDEWEB)

    Lim, S. M.; Hong, S. W. [Korea Cancer Center Hospital, Seoul (Korea, Republic of); Awh, O. D. [Korea Advanced Energy Research Institute, Seoul (Korea, Republic of); Lee, M. C.; Koh, C. S. [Seoul National University College of Medicine, Seoul (Korea, Republic of)

    1988-03-15

    High affinity complexes for the tumor were obtained by changing pH and composition in the preparation of {sup 99m}Tc-DMSA. The purpose of this study was to investigate the tumor affinity, and in vitro and in vivo characteristics of these complexes. The results obtained were as follows; 1) Tumor imaging agent was formed successfully at pH 6.0-9.0 and renal imaging agent at pH 2.0-5.0. 2) The serum protein binding of {sup 99m}Tc-DMSA was 89.1-92.8% at pH 2.0-5.0 and 11.8-30.5% at pH 6.0-9.0 respectively, and it was not changed with time. 3) The T 1/2 of tumor affinity complex in blood between 3 and 6 hours after injection was 187+-29 minutes (mean+-SD). 4) In the blood, the radioactivity was mainly in the plasma, and less than 1% was in the cellular components. 5) In the Walker carcinosarcoma 256 bearing Wistar rats, the radioactivity in the kidney increased, and decreased in the skeleton with time. The radioactivity in the tumor showed the peak in 6 hours after injection and decreased thereafter. 6) In the tumor cell, the radioactivity localized mainly in the cytosol, the soluble fraction of the cytoplasm. This study provides the basic knowledge about tumor affinity and usefulness of {sup 99m}Tc-DMSA in the diagnosis of malignant disease.

  17. Whole-brain CT perfusion and CT angiography assessment of Moyamoya disease before and after surgical revascularization: preliminary study with 256-slice CT.

    Directory of Open Access Journals (Sweden)

    Jun Zhang

    Full Text Available BACKGROUND/AIMS: The 256-slice CT enables the entire brain to be scanned in a single examination. We evaluated the application of 256-slice whole-brain CT perfusion (CTP in determining graft patency as well as investigating cerebral hemodynamic changes in Moyamoya disease before and after surgical revascularization. METHODS: Thirty-nine cases of Moyamoya disease were evaluated before and after surgical revascularization with 256-slice CT. Whole-brain perfusion images and dynamic 3D CT angiographic images generated from perfusion source data were obtained in all patients. Cerebral blood flow (CBF, cerebral blood volume (CBV, time to peak (TTP and mean transit time (MTT of one hemisphere in the region of middle cerebral artery (MCA distribution and contralateral mirroring areas were measured. Relative CTP values (rCBF, rCBV, rTTP, rMTT were also obtained. Differences in pre- and post- operation perfusion CT values were assessed with paired t test or matched-pairs signed-ranks test. RESULTS: Preoperative CBF, MTT and TTP of potential surgical side were significantly different from those of contralateral side (P<0.01 for all. All graft patencies were displayed using the 3D-CTA images. Postoperative CBF, rCBF and rCBV values of surgical side in the region of MCA were significantly higher than those before operation (P<0.01 for all. Postoperative MTT, TTP, rMTT and rTTP values of the surgical side in the region of MCA were significantly lower than those before operation (P<0.05 for all. CONCLUSION: The 256-slice whole-brain CTP can be used to evaluate cerebral hemodynamic changes in Moyamoya disease before and after surgery and the 3D-CTA is useful for assessing the abnormalities of intracranial arteries and graft patencies.

  18. Whole-brain CT perfusion and CT angiography assessment of Moyamoya disease before and after surgical revascularization: preliminary study with 256-slice CT.

    Science.gov (United States)

    Zhang, Jun; Wang, Jianhong; Geng, Daoying; Li, Yuxin; Song, Donglei; Gu, Yuxiang

    2013-01-01

    The 256-slice CT enables the entire brain to be scanned in a single examination. We evaluated the application of 256-slice whole-brain CT perfusion (CTP) in determining graft patency as well as investigating cerebral hemodynamic changes in Moyamoya disease before and after surgical revascularization. Thirty-nine cases of Moyamoya disease were evaluated before and after surgical revascularization with 256-slice CT. Whole-brain perfusion images and dynamic 3D CT angiographic images generated from perfusion source data were obtained in all patients. Cerebral blood flow (CBF), cerebral blood volume (CBV), time to peak (TTP) and mean transit time (MTT) of one hemisphere in the region of middle cerebral artery (MCA) distribution and contralateral mirroring areas were measured. Relative CTP values (rCBF, rCBV, rTTP, rMTT) were also obtained. Differences in pre- and post- operation perfusion CT values were assessed with paired t test or matched-pairs signed-ranks test. Preoperative CBF, MTT and TTP of potential surgical side were significantly different from those of contralateral side (P<0.01 for all). All graft patencies were displayed using the 3D-CTA images. Postoperative CBF, rCBF and rCBV values of surgical side in the region of MCA were significantly higher than those before operation (P<0.01 for all). Postoperative MTT, TTP, rMTT and rTTP values of the surgical side in the region of MCA were significantly lower than those before operation (P<0.05 for all). The 256-slice whole-brain CTP can be used to evaluate cerebral hemodynamic changes in Moyamoya disease before and after surgery and the 3D-CTA is useful for assessing the abnormalities of intracranial arteries and graft patencies.

  19. Celecoxib and Ibuprofen Restore the ATP Content and the Gluconeogenesis Activity in the Liver of Walker-256 Tumor-Bearing Rats

    Directory of Open Access Journals (Sweden)

    Camila Oliveira de Souza

    2015-07-01

    Full Text Available Background/Aims: The main purpose of this study was to investigate the effects of celecoxib and ibuprofen, both non-steroidal anti-inflammatory drugs (NSAIDs, on the decreased gluconeogenesis observed in liver of Walker-256 tumor-bearing rats. Methods: Celecoxib and ibuprofen (both at 25 mg/Kg were orally administered for 12 days, beginning on the same day when the rats were inoculated with Walker-256 tumor cells. Results: Celecoxib and ibuprofen treatment reversed the reduced production of glucose, pyruvate, lactate and urea from alanine as well as the reduced production of glucose from pyruvate and lactate in perfused liver from tumor-bearing rats. Besides, celecoxib and ibuprofen treatment restored the decreased ATP content, increased triacylglycerol levels and reduced mRNA expression of carnitine palmitoyl transferase 1 (CPT1, while ibuprofen treatment restored the reduced mRNA expression of peroxisome proliferator-activated receptor alpha (PPARα in the liver of tumor-bearing rats. Both treatments tended to decrease TNFα, IL6 and IL10 in the liver of tumor-bearing rats. Finally, the treatment with celecoxib, but not with ibuprofen, reduced the growth of Walker-256 tumor. Conclusion: Celecoxib and ibuprofen restored the decreased gluconeogenesis in the liver of Walker-256 tumor-bearing rats. These effects did not involve changes in tumor growth and probably occurred by anti-inflammatory properties of these NSAIDs, which increased expression of genes associated with fatty acid oxidation (PPARα and CPT1 and consequently the ATP production, normalizing the energy status in the liver of tumor-bearing rats.

  20. 17 bit 4.35 mW 1 kHz Delta Sigma ADC and 256-to-1 multiplexer for remote handling instrumentation equipment

    Energy Technology Data Exchange (ETDEWEB)

    Verbeeck, Jens, E-mail: jens.verbeeck@esat.kuleuven.be [KU Leuven, Department ESAT-MICAS, Kasteelpark Arenberg 10, 3001 Heverlee (Belgium); KH Kempen University College, IBW-RELIC, Kleinhoefstraat 4, 2440 Geel (Belgium); Van Uffelen, Marco [Fusion for Energy, c/Josep, n° 2, Torres Diagonal Litoral, Ed. B3, 08019 Barcelona (Spain); Steyaert, Michiel [KU Leuven, Department ESAT-MICAS, Kasteelpark Arenberg 10, 3001 Heverlee (Belgium); Leroux, Paul [KU Leuven, Department ESAT-MICAS, Kasteelpark Arenberg 10, 3001 Heverlee (Belgium); KH Kempen University College, IBW-RELIC, Kleinhoefstraat 4, 2440 Geel (Belgium)

    2013-10-15

    Highlights: ► We present a radiation hard 17 bit-1 kHz 4.35 mW Delta Sigma ADC. ► A radiation tolerant 256-to-1 multiplexer is shown. ► We propose a generic radiation tolerant ASIC for use in an instrumentation link. ► The ASIC can interface more than hundred pressure or resistive sensors. ► All building blocks have a simulated radiation tolerance of more than 1 MGy. -- Abstract: A radiation tolerant Delta-Sigma Analog-to-Digital Converter (ADC) and multiplexer is presented. The design features a 1.5 V, 17 bit ADC consuming 4.35 mW at a sample frequency of 1 MHz. The ADC features a bandwidth of 1 kHz and utilizes a Correlated Double Sampling technique (CDS) to remove offset and 1/f noise. The circuit maintains its 17 bit resolution upon a simulated radiation dose exceeding 1 MGy and varying temperatures between 0 °C and 85 °C. Next a multiplexer is presented. It can multiplex 256 channels at a clock frequency of 128 MHz or has a data throughput of 256 MSample/s. In addition the bit period of the multiplexer varies less then 1.5% due to the influence of temperature or radiation, which proves the temperature and radiation tolerance.

  1. Characterization and optimization of a high-efficiency AlGaAs-On-Insulator-based wavelength converter for 64- and 256-QAM signals

    DEFF Research Database (Denmark)

    Da Ros, Francesco; Yankov, Metodi Plamenov; Porto da Silva, Edson

    2017-01-01

    In this paper, we demonstrate wavelength conversion of advanced modulation formats such as 10-GBd 64-QAM and 256-QAM with high conversion efficiency over a 29-nm spectral window by using four-wave mixing in an AlGaAs-On-Insulator (AlGaAsOI) nano-waveguide. A thorough characterization of the wavel......In this paper, we demonstrate wavelength conversion of advanced modulation formats such as 10-GBd 64-QAM and 256-QAM with high conversion efficiency over a 29-nm spectral window by using four-wave mixing in an AlGaAs-On-Insulator (AlGaAsOI) nano-waveguide. A thorough characterization...... with optical signal-to-noise ratio (OSNR) above 30 dB over a 29-nm bandwidth leading to error-free conversion of 64-QAM and 256-QAM with OSNR penalty below 1.0 dB and 2.0 dB respectively. The generated idlers exhibit an OSNR margin to the chosen forward error correction thresholds of >3 dB and >7 dB for 64-QAM...

  2. Matthew Hammond, ed., New Perspectives on Medieval Scotland 1093-1286. Studies in Celtic History, 32. Woodbridge: The Boydell Press, 2013. Pp. xvi, 256. ISBN 978-1-84383-853-1. £60.00.

    Directory of Open Access Journals (Sweden)

    Elizabeth Ewan

    2014-08-01

    Full Text Available Matthew Hammond, ed., New Perspectives on Medieval Scotland 1093-1286. Studies in Celtic History, 32. Woodbridge: The Boydell Press, 2013. Pp. xvi, 256. ISBN 978-1-84383-853-1. £60.00.

  3. MT3250BA: a 320×256-50µm snapshot microbolometer ROIC for high-resistance detector arrays

    Science.gov (United States)

    Eminoglu, Selim; Akin, Tayfun

    2013-06-01

    This paper reports the development of a new microbolometer readout integrated circuit (MT3250BA) designed for high-resistance detector arrays. MT3250BA is the first microbolometer readout integrated circuit (ROIC) product from Mikro-Tasarim Ltd., which is a fabless IC design house specialized in the development of monolithic CMOS imaging sensors and ROICs for hybrid photonic imaging sensors and microbolometers. MT3250BA has a format of 320 × 256 and a pixel pitch of 50 µm, developed with a system-on-chip architecture in mind, where all the timing and biasing for this ROIC are generated on-chip without requiring any external inputs. MT3250BA is a highly configurable ROIC, where many of its features can be programmed through a 3-wire serial interface allowing on-the-fly configuration of many ROIC features. MT3250BA has 2 analog video outputs and 1 analog reference output for pseudo-differential operation, and the ROIC can be programmed to operate in the 1 or 2-output modes. A unique feature of MT3250BA is that it performs snapshot readout operation; therefore, the image quality will only be limited by the thermal time constant of the detector pixels, but not by the scanning speed of the ROIC, as commonly found in the conventional microbolometer ROICs performing line-by-line (rolling-line) readout operation. The signal integration is performed at the pixel level in parallel for the whole array, and signal integration time can be programmed from 0.1 µs up to 100 ms in steps of 0.1 µs. The ROIC is designed to work with high-resistance detector arrays with pixel resistance values higher than 250 kΩ. The detector bias voltage can be programmed on-chip over a 2 V range with a resolution of 1 mV. The ROIC has a measured input referred noise of 260 µV rms at 300 K. The ROIC can be used to build a microbolometer infrared sensor with an NETD value below 100 mK using a microbolometer detector array fabrication technology with a high detector resistance value (≥ 250 K

  4. Whole-Organ CT Perfusion of the Pancreas: Impact of Iterative Reconstruction on Image Quality, Perfusion Parameters and Radiation Dose in 256-Slice CT-Preliminary Findings

    Science.gov (United States)

    Xie, Qian; Wu, Juan; Tang, Ying; Dou, Yafang; Hao, Sijie; Xu, Feijia; Feng, Xiaoyuan; Liang, Zonghui

    2013-01-01

    Background This study was performed to assess whether iterative reconstruction can reduce radiation dose while maintaining acceptable image quality, and to investigate whether perfusion parameters vary from conventional filtered back projection (FBP) at the low-tube-voltage (80-kVp) during whole-pancreas perfusion examination using a 256-slice CT. Methods 76 patients with known or suspected pancreatic mass underwent whole-pancreas perfusion by a 256-slice CT. High- and low-tube-voltage CT images were acquired. 120-kVp image data (protocol A) and 80-kVp image data (protocol B) were reconstructed with conventional FBP, and 80-kVp image data were reconstructed with iDose4 (protocol C) iterative reconstruction. The image noise; contrast-to-noise ratio (CNR) relative to muscle for the pancreas, liver, and aorta; and radiation dose of each protocol were assessed quantitatively. Overall image quality was assessed qualitatively. Among 76 patients, 23 were eventually proven to have a normal pancreas. Perfusion parameters of normal pancreas in each protocol including blood volume, blood flow, and permeability-surface area product were measured. Results In the quantitative study, protocol C reduced image noise by 36.8% compared to protocol B (Pperfusion values among three different protocols. Conclusion Low-tube-voltage and iDose4 iterative reconstruction can dramatically decrease the radiation dose with acceptable image quality during whole-pancreas CT perfusion and have no significant impact on the perfusion parameters of normal pancreas compared to the conventional FBP reconstruction using a 256-slice CT scanner. PMID:24303017

  5. Anti-Inflammatory and Cytoprotective Effects of TMC-256C1 from Marine-Derived Fungus Aspergillus sp. SF-6354 via up-Regulation of Heme Oxygenase-1 in Murine Hippocampal and Microglial Cell Lines

    Directory of Open Access Journals (Sweden)

    Dong-Cheol Kim

    2016-04-01

    Full Text Available In the course of searching for bioactive secondary metabolites from marine fungi, TMC-256C1 was isolated from an ethyl acetate extract of the marine-derived fungus Aspergillus sp. SF6354. TMC-256C1 displayed anti-neuroinflammatory effect in BV2 microglial cells induced by lipopolysaccharides (LPS as well as neuroprotective effect against glutamate-stimulated neurotoxicity in mouse hippocampal HT22 cells. TMC-256C1 was shown to develop a cellular resistance to oxidative damage caused by glutamate-induced cytotoxicity and reactive oxygen species (ROS generation in HT22 cells, and suppress the inflammation process in LPS-stimulated BV2 cells. Furthermore, the neuroprotective and anti-neuroinflammatory activities of TMC-256C1 were associated with upregulated expression of heme oxygenase (HO-1 and nuclear translocation of nuclear factor-E2-related factor 2 (Nrf2 in HT22 and BV2 cells. We also found that TMC-256C1 activated p38 mitogen-activated protein kinases (MAPK and phosphatidylinositol 3-kinase (PI3K/Akt signaling pathways in HT22 and BV2 cells. These results demonstrated that TMC-256C1 activates HO-1 protein expression, probably by increasing nuclear Nrf2 levels via the activation of the p38 MAPK and PI3K/Akt pathways.

  6. Technical Note: Evaluation of a 160-mm/256-row CT scanner for whole-heart quantitative myocardial perfusion imaging

    International Nuclear Information System (INIS)

    So, Aaron; Imai, Yasuhiro; Nett, Brian; Jackson, John; Nett, Liz; Hsieh, Jiang; Wisenberg, Gerald; Teefy, Patrick; Yadegari, Andrew; Islam, Ali; Lee, Ting-Yim

    2016-01-01

    Purpose: The authors investigated the performance of a recently introduced 160-mm/256-row CT system for low dose quantitative myocardial perfusion (MP) imaging of the whole heart. This platform is equipped with a gantry capable of rotating at 280 ms per full cycle, a second generation of adaptive statistical iterative reconstruction (ASiR-V) to correct for image noise arising from low tube voltage potential/tube current dynamic scanning, and image reconstruction algorithms to tackle beam-hardening, cone-beam, and partial-scan effects. Methods: Phantom studies were performed to investigate the effectiveness of image noise and artifact reduction with a GE Healthcare Revolution CT system for three acquisition protocols used in quantitative CT MP imaging: 100, 120, and 140 kVp/25 mAs. The heart chambers of an anthropomorphic chest phantom were filled with iodinated contrast solution at different concentrations (contrast levels) to simulate the circulation of contrast through the heart in quantitative CT MP imaging. To evaluate beam-hardening correction, the phantom was scanned at each contrast level to measure the changes in CT number (in Hounsfield unit or HU) in the water-filled region surrounding the heart chambers with respect to baseline. To evaluate cone-beam artifact correction, differences in mean water HU between the central and peripheral slices were compared. Partial-scan artifact correction was evaluated from the fluctuation of mean water HU in successive partial scans. To evaluate image noise reduction, a small hollow region adjacent to the heart chambers was filled with diluted contrast, and contrast-to-noise ratio in the region before and after noise correction with ASiR-V was compared. The quality of MP maps acquired with the CT system was also evaluated in porcine CT MP studies. Myocardial infarct was induced in a farm pig from a transient occlusion of the distal left anterior descending (LAD) artery with a catheter-based interventional procedure. MP

  7. Technical Note: Evaluation of a 160-mm/256-row CT scanner for whole-heart quantitative myocardial perfusion imaging.

    Science.gov (United States)

    So, Aaron; Imai, Yasuhiro; Nett, Brian; Jackson, John; Nett, Liz; Hsieh, Jiang; Wisenberg, Gerald; Teefy, Patrick; Yadegari, Andrew; Islam, Ali; Lee, Ting-Yim

    2016-08-01

    The authors investigated the performance of a recently introduced 160-mm/256-row CT system for low dose quantitative myocardial perfusion (MP) imaging of the whole heart. This platform is equipped with a gantry capable of rotating at 280 ms per full cycle, a second generation of adaptive statistical iterative reconstruction (ASiR-V) to correct for image noise arising from low tube voltage potential/tube current dynamic scanning, and image reconstruction algorithms to tackle beam-hardening, cone-beam, and partial-scan effects. Phantom studies were performed to investigate the effectiveness of image noise and artifact reduction with a GE Healthcare Revolution CT system for three acquisition protocols used in quantitative CT MP imaging: 100, 120, and 140 kVp/25 mAs. The heart chambers of an anthropomorphic chest phantom were filled with iodinated contrast solution at different concentrations (contrast levels) to simulate the circulation of contrast through the heart in quantitative CT MP imaging. To evaluate beam-hardening correction, the phantom was scanned at each contrast level to measure the changes in CT number (in Hounsfield unit or HU) in the water-filled region surrounding the heart chambers with respect to baseline. To evaluate cone-beam artifact correction, differences in mean water HU between the central and peripheral slices were compared. Partial-scan artifact correction was evaluated from the fluctuation of mean water HU in successive partial scans. To evaluate image noise reduction, a small hollow region adjacent to the heart chambers was filled with diluted contrast, and contrast-to-noise ratio in the region before and after noise correction with ASiR-V was compared. The quality of MP maps acquired with the CT system was also evaluated in porcine CT MP studies. Myocardial infarct was induced in a farm pig from a transient occlusion of the distal left anterior descending (LAD) artery with a catheter-based interventional procedure. MP maps were generated

  8. Transmission Transparency and Potential Convergence of Optical Network Solutions at the Physical Layer for Bit Rates from 2.5 Gbps to 256 Gbps

    Directory of Open Access Journals (Sweden)

    Rajdi Agalliu

    2017-01-01

    Full Text Available In this paper, we investigate optical network recommendations GPON and XG-PON with triple-play services in terms of physical reach, number of subscribers, transceiver design, modulation format and implementation cost. Despite of trends to increase the bit rate from 2.5 Gbps to 10 Gbps and beyond, TDM-PONs cannot cope with bandwidth requirements of future networks. TDM and WDM techniques can be combined, resulting in improved scalability. Longer physical reach can be achieved by deploying active network elements within the transmission path. We investigate these options by considering their potential coexistence at the physical layer. Subsequently, we analyse the upgrade of optical channels to 100 Gbps and 256 Gbps by using advanced modulation formats, which combine polarization division multiplexing with coherent detection and digital signal processing. We show that PDM-QPSK format is suitable for 100 Gbps systems and PDM-16QAM is more beneficial at 256 Gbps. Simulations are performed in the OptSim software environment.

  9. Quantitative assessment of right ventricular function and pulmonary regurgitation in surgically repaired tetralogy of Fallot using 256-slice CT: comparison with 3-Tesla MRI

    International Nuclear Information System (INIS)

    Yamasaki, Yuzo; Yonezawa, Masato; Matsuo, Yoshio; Kamitani, Takeshi; Higuchi, Ko; Honda, Hiroshi; Nagao, Michinobu; Kawanami, Satoshi; Yamamura, Kenichiro; Sakamoto, Ichiro; Shiokawa, Yuichi; Yabuuchi, Hidetake

    2014-01-01

    To compare 256-slice cardiac computed tomography (CCT) with cardiac magnetic resonance (CMR) imaging to assess right ventricular (RV) function and pulmonary regurgitant fraction (PRF) in patients with repaired tetralogy of Fallot (TOF). Thirty-three consecutive patients with repaired TOF underwent retrospective ECG-gated CCT and 3-Tesla CMR. RV and left ventricular (LV) end-diastolic volume (EDV), end-systolic volume (ESV), stroke volume (SV) and ejection fraction (EF) were measured using CCT and CMR. PRF-CCT (%) was defined as (RVSV - LVSV)/RVSV. PRF-CMR (%) was measured by the phase-contrast method. Repeated measurements were performed to determine intra- and interobserver variability. CCT measurements, including PRF, correlated highly with the CMR reference (r = 0.71-0.96). CCT overestimated RVEDV (mean difference, 17.1 ± 2.9 ml), RVESV (12.9 ± 2.1 ml) and RVSV (4.2 ± 2.0 ml), and underestimated RVEF (-2.6 ± 1.0 %) and PRF (-9.1 ± 2.0 %) compared with CMR. The limits of agreement between CCT and CMR were in a good range for all measurements. The variability in CCT measurements was lower than those in CMR. The estimated effective radiation dose was 7.6 ± 2.6 mSv. 256-slice CCT can assess RV function and PRF with relatively low dose radiation exposure in patients with repaired TOF, but overestimates RV volume and underestimates PRF. (orig.)

  10. Quantitative assessment of right ventricular function and pulmonary regurgitation in surgically repaired tetralogy of Fallot using 256-slice CT: comparison with 3-Tesla MRI

    Energy Technology Data Exchange (ETDEWEB)

    Yamasaki, Yuzo; Yonezawa, Masato; Matsuo, Yoshio; Kamitani, Takeshi; Higuchi, Ko; Honda, Hiroshi [Graduate School of Medical Sciences, Kyushu University, Department of Clinical Radiology, Higashi-ku, Fukuoka (Japan); Nagao, Michinobu; Kawanami, Satoshi [Graduate School of Medical Sciences, Kyushu University, Department of Molecular Imaging and Diagnosis, Higashi-ku, Fukuoka (Japan); Yamamura, Kenichiro [Graduate School of Medical Sciences, Kyushu University, Department of Pediatrics, Higashi-ku, Fukuoka (Japan); Sakamoto, Ichiro [Graduate School of Medical Sciences, Kyushu University, Department of Cardiovascular Medicine, Higashi-ku, Fukuoka (Japan); Shiokawa, Yuichi [Graduate School of Medical Sciences, Kyushu University, Department of Cardiovascular Surgery, Higashi-ku, Fukuoka (Japan); Yabuuchi, Hidetake [Graduate School of Medical Sciences, Kyushu University, Department of Health Sciences, Higashi-ku, Fukuoka (Japan)

    2014-12-15

    To compare 256-slice cardiac computed tomography (CCT) with cardiac magnetic resonance (CMR) imaging to assess right ventricular (RV) function and pulmonary regurgitant fraction (PRF) in patients with repaired tetralogy of Fallot (TOF). Thirty-three consecutive patients with repaired TOF underwent retrospective ECG-gated CCT and 3-Tesla CMR. RV and left ventricular (LV) end-diastolic volume (EDV), end-systolic volume (ESV), stroke volume (SV) and ejection fraction (EF) were measured using CCT and CMR. PRF-CCT (%) was defined as (RVSV - LVSV)/RVSV. PRF-CMR (%) was measured by the phase-contrast method. Repeated measurements were performed to determine intra- and interobserver variability. CCT measurements, including PRF, correlated highly with the CMR reference (r = 0.71-0.96). CCT overestimated RVEDV (mean difference, 17.1 ± 2.9 ml), RVESV (12.9 ± 2.1 ml) and RVSV (4.2 ± 2.0 ml), and underestimated RVEF (-2.6 ± 1.0 %) and PRF (-9.1 ± 2.0 %) compared with CMR. The limits of agreement between CCT and CMR were in a good range for all measurements. The variability in CCT measurements was lower than those in CMR. The estimated effective radiation dose was 7.6 ± 2.6 mSv. 256-slice CCT can assess RV function and PRF with relatively low dose radiation exposure in patients with repaired TOF, but overestimates RV volume and underestimates PRF. (orig.)

  11. Mutation c.256_257delAA in RAG1 Gene in Polish Children with Severe Combined Immunodeficiency: Diversity of Clinical Manifestations.

    Science.gov (United States)

    Szaflarska, Anna; Rutkowska-Zapała, Magdalena; Kotula, Monika; Gruca, Anna; Grabowska, Agnieszka; Lenart, Marzena; Surman, Marta; Trzyna, Elżbieta; Mordel, Anna; Pituch-Noworolska, Anna; Siedlar, Maciej

    2016-12-01

    Mutations in RAG1 gene may result in different types of severe combined immunodeficiencies. In this study, we compare clinical symptoms and laboratory findings in four children with identical mutation in RAG1 gene. All of analyzed patients presented symptoms of severe combined immunodeficiencies associated or not with Omenn syndrome (OS) features. In our patients two different types of variants in RAG1 gene were detected. The first of the mutation was the deletion of AA dinucleotide at position c.256_257 (p.Lys86ValfsTer33), the second gene variant was substitution c.2867T>C (p.Ile956Thr). In Patient 1 we detected that compound heterozygous mutations involved both of the mentioned variants. Whereas, in Patients 2, 3 and 4, we confirmed the presence of the dinucleotide deletion but in a homozygous state. In all described patients, sequence analysis of RAG2 gene did not reveal any nucleotide changes. Our data show that mutation c.256_257delAA in RAG1 gene seems to occur quite frequently in the polish patients with severe combined immunodeficiency and may result in classical OS as well as in severe combined immunodeficiency without clinical and laboratory features of OS when occurred in homozygous state. The same mutation but in heterozygous state, in combination with other mutation in RAG1 gene, may result in incomplete OS.

  12. 256-slice CT coronary angiography in atrial fibrillation: The impact of mean heart rate and heart rate variability on image quality

    Energy Technology Data Exchange (ETDEWEB)

    Chen, Liang-Kuang [Department of Radiology, Shin Kong Wu Ho-Su Memorial Hospital, Taipei, Taiwan (China); College of Medicine, Fu Jen Catholic University, Taipei, Taiwan (China); Hsu, Shih-Ming [Department of Biomedical Imaging and Radiological Science, China Medical University, Taichung, Taiwan (China); Mok, Greta S.P. [Department of Electrical and Electronics Engineering, Faculty of Science and Technology, University of Macau, Macau (China); Law, Wei-Yip; Lu, Kun-Mu [Department of Radiology, Shin Kong Wu Ho-Su Memorial Hospital, Taipei, Taiwan (China); Yang, Ching-Ching, E-mail: g39220003@yahoo.com.tw [Department of Radiological Technology, Tzu Chi College of Technology, 880, Sec.2, Chien-kuo Rd. Hualien 970, Taiwan (China); Wu, Tung-Hsin, E-mail: tung@ym.edu.tw [Department of Biomedical Imaging and Radiological Sciences, National Yang Ming University, 155 Li-Nong St., Sec. 2, Taipei 112, Taiwan (China)

    2011-08-21

    Objective: The aim of this study was to evaluate the image quality of 256-MDCT in atrial fibrillation and to compare the findings with those among patients in sinus rhythm. Materials: All reconstructed images were evaluated by two independent experienced readers blinded to patient information, heart rate, and ECG results to assess the diagnostic quality of images of the coronary artery segments using axial images, multi-planar reformations, maximum intensity projections, and volume rendering technique. Results: No statistical significance was detected in terms of the overall image quality between patients in sinus rhythm and with atrial fibrillation. Pearson's correlation analysis showed no significant association between image quality and mean heart rate no matter for patients in sinus rhythm or with atrial fibrillation. Similarly, there was no correlation between image quality and heart rate variability for either patients in sinus rhythm or with atrial fibrillation. Our results showed that the optimal reconstruction window depends on patient's HR, and the pattern for patients in atrial fibrillation is similar to that obtained from non-atrial fibrillation patients. Conclusion: This study shows the potential of using 256-MDCT coronary angiography in patients with atrial fibrillation. Our results suggest that when appropriate reconstruction timing window is applied, patients with atrial fibrillation do not have to be excluded from MDCT coronary angiographic examinations.

  13. Combination use of multiple interventional techniques for the treatment of prolapse of lumbar intervertebral disc:therapeutic observation in 256 cases

    International Nuclear Information System (INIS)

    Li Zhen; Ashaer; Gu Shumei

    2011-01-01

    Objective: To observe the therapeutic effect of combination use of multiple interventional techniques in treating lumbar intervertebral disc herniation. Methods: Combination use of ozone disc ablation, dissolution of disk with collagenase, windowing of fiber ring to reduce pressure within the disk and other endo-disc or extra-disc techniques was employed to treat 256 patients with lumbar intervertebral disc protrusion. The clinical results were analyzed and the technique was evaluated. Results: Combination use of multiple interventional techniques was completed for 437 diseased lumbar disks in 256 patients. The therapeutic efficacy was judged by Macnab criterion. Excellent effectiveness was obtained in 82.4% patients. And the response to treatment became better with time. The curative effect in patients with ruptured fiber ring was much better than that with no ruptured fiber ring. Conclusion: Combination use of multiple interventional techniques carries wide indications for the treatment of intervertebral disc protrusion and has excellent therapeutic efficacy. Collagenase has proteolytic effect on fiber ring, ozone possesses oxidation effect to the nucleus pulposus, and fiber ring windowing can reduce the pressure within the disk. All the above three techniques have their own distinguishing features. Based on imaging findings and the pressure within the disk, an optimal combination of theses techniques can surely bring satisfactory results. (authors)

  14. Complete Circular Genome Sequence of Successful ST8/SCCmecIV Community-Associated Methicillin-Resistant Staphylococcus aureus (OC8 in Russia: One-Megabase Genomic Inversion, IS256's Spread, and Evolution of Russia ST8-IV.

    Directory of Open Access Journals (Sweden)

    Tsai-Wen Wan

    Full Text Available ST8/SCCmecIV community-associated methicillin-resistant Staphylococcus aureus (CA-MRSA has been a common threat, with large USA300 epidemics in the United States. The global geographical structure of ST8/SCCmecIV has not yet been fully elucidated. We herein determined the complete circular genome sequence of ST8/SCCmecIVc strain OC8 from Siberian Russia. We found that 36.0% of the genome was inverted relative to USA300. Two IS256, oppositely oriented, at IS256-enriched hot spots were implicated with the one-megabase genomic inversion (MbIN and vSaβ split. The behavior of IS256 was flexible: its insertion site (att sequences on the genome and junction sequences of extrachromosomal circular DNA were all divergent, albeit with fixed sizes. A similar multi-IS256 system was detected, even in prevalent ST239 healthcare-associated MRSA in Russia, suggesting IS256's strong transmission potential and advantage in evolution. Regarding epidemiology, all ST8/SCCmecIVc strains from European, Siberian, and Far Eastern Russia, examined had MbIN, and geographical expansion accompanied divergent spa types and resistance to fluoroquinolones, chloramphenicol, and often rifampicin. Russia ST8/SCCmecIVc has been associated with life-threatening infections such as pneumonia and sepsis in both community and hospital settings. Regarding virulence, the OC8 genome carried a series of toxin and immune evasion genes, a truncated giant surface protein gene, and IS256 insertion adjacent to a pan-regulatory gene. These results suggest that unique single ST8/spa1(t008/SCCmecIVc CA-MRSA (clade, Russia ST8-IVc emerged in Russia, and this was followed by large geographical expansion, with MbIN as an epidemiological marker, and fluoroquinolone resistance, multiple virulence factors, and possibly a multi-IS256 system as selective advantages.

  15. Complete Circular Genome Sequence of Successful ST8/SCCmecIV Community-Associated Methicillin-Resistant Staphylococcus aureus (OC8) in Russia: One-Megabase Genomic Inversion, IS256's Spread, and Evolution of Russia ST8-IV.

    Science.gov (United States)

    Wan, Tsai-Wen; Khokhlova, Olga E; Iwao, Yasuhisa; Higuchi, Wataru; Hung, Wei-Chun; Reva, Ivan V; Singur, Olga A; Gostev, Vladimir V; Sidorenko, Sergey V; Peryanova, Olga V; Salmina, Alla B; Reva, Galina V; Teng, Lee-Jene; Yamamoto, Tatsuo

    2016-01-01

    ST8/SCCmecIV community-associated methicillin-resistant Staphylococcus aureus (CA-MRSA) has been a common threat, with large USA300 epidemics in the United States. The global geographical structure of ST8/SCCmecIV has not yet been fully elucidated. We herein determined the complete circular genome sequence of ST8/SCCmecIVc strain OC8 from Siberian Russia. We found that 36.0% of the genome was inverted relative to USA300. Two IS256, oppositely oriented, at IS256-enriched hot spots were implicated with the one-megabase genomic inversion (MbIN) and vSaβ split. The behavior of IS256 was flexible: its insertion site (att) sequences on the genome and junction sequences of extrachromosomal circular DNA were all divergent, albeit with fixed sizes. A similar multi-IS256 system was detected, even in prevalent ST239 healthcare-associated MRSA in Russia, suggesting IS256's strong transmission potential and advantage in evolution. Regarding epidemiology, all ST8/SCCmecIVc strains from European, Siberian, and Far Eastern Russia, examined had MbIN, and geographical expansion accompanied divergent spa types and resistance to fluoroquinolones, chloramphenicol, and often rifampicin. Russia ST8/SCCmecIVc has been associated with life-threatening infections such as pneumonia and sepsis in both community and hospital settings. Regarding virulence, the OC8 genome carried a series of toxin and immune evasion genes, a truncated giant surface protein gene, and IS256 insertion adjacent to a pan-regulatory gene. These results suggest that unique single ST8/spa1(t008)/SCCmecIVc CA-MRSA (clade, Russia ST8-IVc) emerged in Russia, and this was followed by large geographical expansion, with MbIN as an epidemiological marker, and fluoroquinolone resistance, multiple virulence factors, and possibly a multi-IS256 system as selective advantages.

  16. Evaluation of image quality and radiation dose at prospective ECG-triggered axial 256-slice multi-detector CT in infants with congenital heart disease

    Energy Technology Data Exchange (ETDEWEB)

    Huang, Mei-ping; Liang, Chang-hong; Zhao, Zhen-jun; Liu, Hui; Li, Jing-lei; Zhang, Jin-e; Cui, Yan-hai; Yang, Lin; Liu, Qi-shun [Guangdong Academy of Medical Sciences, Guangdong General Hospital, Department of Radiology, Guangzhou (China); Ivanc, Thomas B.; Vembar, Mani [Philips Healthcare, CT Clinical Science, Highland Heights, OH (United States)

    2011-07-15

    There are a limited number of reports on the technical and clinical feasibility of prospective electrocardiogram (ECG)-gated multi-detector computed tomography (MDCT) in infants with congenital heart disease (CHD). To evaluate image quality and radiation dose at weight-based low-dose prospectively gated 256-slice MDCT angiography in infants with CHD. From November 2009 to February 2010, 64 consecutive infants with CHD referred for pre-operative or post-operative CT were included. All were scanned on a 256-slice MDCT system utilizing a low-dose protocol (80 kVp and 60-120 mAs depending on weight: 60 mAs for {<=}3 kg, 80 mAs for 3.1-6 kg, 100 mAs for 6.1-10 kg, 120 mAs for 10.1-15 kg). No serious adverse events were recorded. A total of 174 cardiac deformities, confirmed by surgery or heart catheterization, were studied. The sensitivity of MDCT for cardiac deformities was 97.1%; specificity, 99.4%; accuracy, 95.9%. The mean heart rate during scan was 136.7 {+-} 14.9/min (range, 91-160) with a corresponding heart rate variability of 2.8 {+-} 2.2/min (range, 0-8). Mean scan length was 115.3 {+-} 11.7 mm (range, 93.6-143.3). Mean volume CT dose index, mean dose-length product and effective dose were 2.1 {+-} 0.4 mGy (range, 1.5-2.8), 24.7 {+-} 5.9 mGy.cm (range, 14.7-35.8) and 1.6 {+-} 0.3 mSv (range, 1.1-2.5), respectively. Diagnostic-quality images were achieved in all cases. Satisfactory diagnostic quality for visualization of all/proximal/distal coronary artery segments was achieved in 88.4/98.8/80.0% of the scans. Low-dose prospectively gated axial 256-slice CT angiography is a valuable tool in the routine clinical evaluation of infants with CHD, providing a comprehensive three-dimensional evaluation of the cardiac anatomy, including the coronary arteries. (orig.)

  17. Tumor growth reduction is regulated at the gene level in Walker 256 tumor-bearing rats supplemented with fish oil rich in EPA and DHA

    Energy Technology Data Exchange (ETDEWEB)

    Borghetti, G.; Yamazaki, R.K.; Coelho, I.; Pequito, D.C.T.; Schiessel, D.L.; Kryczyk, M.; Mamus, R.; Naliwaiko, K.; Fernandes, L.C. [Departamento de Fisiologia, Setor de Ciências Biológicas, Universidade Federal do Paraná, Curitiba, PR (Brazil)

    2013-08-23

    We investigated the effect of fish oil (FO) supplementation on tumor growth, cyclooxygenase 2 (COX-2), peroxisome proliferator-activated receptor gamma (PPARγ), and RelA gene and protein expression in Walker 256 tumor-bearing rats. Male Wistar rats (70 days old) were fed with regular chow (group W) or chow supplemented with 1 g/kg body weight FO daily (group WFO) until they reached 100 days of age. Both groups were then inoculated with a suspension of Walker 256 ascitic tumor cells (3×10{sup 7} cells/mL). After 14 days the rats were killed, total RNA was isolated from the tumor tissue, and relative mRNA expression was measured using the 2{sup -ΔΔCT} method. FO significantly decreased tumor growth (W=13.18±1.58 vs WFO=5.40±0.88 g, P<0.05). FO supplementation also resulted in a significant decrease in COX-2 (W=100.1±1.62 vs WFO=59.39±5.53, P<0.001) and PPARγ (W=100.4±1.04 vs WFO=88.22±1.46, P<0.05) protein expression. Relative mRNA expression was W=1.06±0.022 vs WFO=0.31±0.04 (P<0.001) for COX-2, W=1.08±0.02 vs WFO=0.52±0.08 (P<0.001) for PPARγ, and W=1.04±0.02 vs WFO=0.82±0.04 (P<0.05) for RelA. FO reduced tumor growth by attenuating inflammatory gene expression associated with carcinogenesis.

  18. Resistance exercise attenuates skeletal muscle oxidative stress, systemic pro-inflammatory state, and cachexia in Walker-256 tumor-bearing rats.

    Science.gov (United States)

    Padilha, Camila Souza; Borges, Fernando Henrique; Costa Mendes da Silva, Lilian Eslaine; Frajacomo, Fernando Tadeu Trevisan; Jordao, Alceu Afonso; Duarte, José Alberto; Cecchini, Rubens; Guarnier, Flávia Alessandra; Deminice, Rafael

    2017-09-01

    The aim of this study was to investigate the effects of resistance exercise training (RET) on oxidative stress, systemic inflammatory markers, and muscle wasting in Walker-256 tumor-bearing rats. Male (Wistar) rats were divided into 4 groups: sedentary controls (n = 9), tumor-bearing (n = 9), exercised (n = 9), and tumor-bearing exercised (n = 10). Exercised and tumor-bearing exercised rats were exposed to resistance exercise of climbing a ladder apparatus with weights tied to their tails for 6 weeks. The physical activity of control and tumor-bearing rats was confined to the space of the cage. After this period, tumor-bearing and tumor-bearing exercised animals were inoculated subcutaneously with Walker-256 tumor cells (11.0 × 10 7 cells in 0.5 mL of phosphate-buffered saline) while control and exercised rats were injected with vehicle. Following inoculation, rats maintained resistance exercise training (exercised and tumor-bearing exercised) or sedentary behavior (control and tumor-bearing) for 12 more days, after which they were euthanized. Results showed muscle wasting in the tumor-bearing group, with body weight loss, increased systemic leukocytes, and inflammatory interleukins as well as muscular oxidative stress and reduced mTOR signaling. In contrast, RET in the tumor-bearing exercised group was able to mitigate the reduced body weight and muscle wasting with the attenuation of muscle oxidative stress and systemic inflammatory markers. RET also prevented loss of muscle strength associated with tumor development. RET, however, did not prevent the muscle proteolysis signaling via FBXO32 gene messenger RNA expression in the tumor-bearing group. In conclusion, RET performed prior tumor implantation prevents cachexia development by attenuating tumor-induced systemic pro-inflammatory condition with muscle oxidative stress and muscle damage.

  19. Two novel variants of human medium chain acyl-CoA dehydrogenase (MCAD). K364R, a folding mutation, and R256T, a catalytic-site mutation resulting in a well-folded but totally inactive protein

    DEFF Research Database (Denmark)

    O'Reilly, Linda P; Andresen, Brage S; Engel, Paul C

    2005-01-01

    was again totally inactive. Neither mutant showed marked depletion of FAD. The pure K364R protein was considerably less thermostable than wild-type MCAD. Western blots indicated that, although the R256T mutant protein is less thermostable than normal MCAD, it is much more stable than K364R. Though......Two novel rare mutations, MCAD approximately 842G-->C (R256T) and MCAD approximately 1166A-->G (K364R), have been investigated to assess how far the biochemical properties of the mutant proteins correlate with the clinical phenotype of medium chain acyl-CoA dehydrogenase (MCAD) deficiency. When...... the gene for K364R was overexpressed in Escherichia coli, the synthesized mutant protein only exhibited activity when the gene for chaperonin GroELS was co-overexpressed. Levels of activity correlated with the amounts of native MCAD protein visible in western blots. The R256T mutant, by contrast, displayed...

  20. Bilateral downregulation of Nav1.8 in dorsal root ganglia of rats with bone cancer pain induced by inoculation with Walker 256 breast tumor cells

    International Nuclear Information System (INIS)

    Miao, Xue-Rong; Gao, Xiao-Fei; Wu, Jing-Xiang; Lu, Zhi-Jie; Huang, Zhang-Xiang; Li, Xiao-Qing; He, Cheng; Yu, Wei-Feng

    2010-01-01

    Rapid and effective treatment of cancer-induced bone pain remains a clinical challenge and patients with bone metastasis are more likely to experience severe pain. The voltage-gated sodium channel Nav1.8 plays a critical role in many aspects of nociceptor function. Therefore, we characterized a rat model of cancer pain and investigated the potential role of Nav1.8. Adult female Wistar rats were used for the study. Cancer pain was induced by inoculation of Walker 256 breast carcinosarcoma cells into the tibia. After surgery, mechanical and thermal hyperalgesia and ambulation scores were evaluated to identify pain-related behavior. We used real-time RT-PCR to determine Nav1.8 mRNA expression in bilateral L4/L5 dorsal root ganglia (DRG) at 16-19 days after surgery. Western blotting and immunofluorescence were used to compare the expression and distribution of Nav1.8 in L4/L5 DRG between tumor-bearing and sham rats. Antisense oligodeoxynucleotides (ODNs) against Nav1.8 were administered intrathecally at 14-16 days after surgery to knock down Nav1.8 protein expression and changes in pain-related behavior were observed. Tumor-bearing rats exhibited mechanical hyperalgesia and ambulatory-evoked pain from day 7 after inoculation of Walker 256 cells. In the advanced stage of cancer pain (days 16-19 after surgery), normalized Nav1.8 mRNA levels assessed by real-time RT-PCR were significantly lower in ipsilateral L4/L5 DRG of tumor-bearing rats compared with the sham group. Western-blot showed that the total expression of Nav1.8 protein significantly decreased bilaterally in DRG of tumor-bearing rats. Furthermore, as revealed by immunofluorescence, only the expression of Nav1.8 protein in small neurons down regulated significantly in bilateral DRG of cancer pain rats. After administration of antisense ODNs against Nav1.8, Nav1.8 protein expression decreased significantly and tumor-bearing rats showed alleviated mechanical hyperalgesia and ambulatory-evoked pain. These

  1. Optimization and In Vivo Profiling of a Refined Rat Model of Walker 256 Breast Cancer Cell-Induced Bone Pain Using Behavioral, Radiological, Histological, Immunohistochemical and Pharmacological Methods

    Directory of Open Access Journals (Sweden)

    Priyank Shenoy

    2017-07-01

    Full Text Available In the majority of patients with advanced breast cancer, there is metastatic spread to bones resulting in pain. Clinically available drug treatments for alleviation of breast cancer-induced bone pain (BCIBP often produce inadequate pain relief due to dose-limiting side-effects. A major impediment to the discovery of novel well-tolerated analgesic agents for the relief of pain due to bony metastases is the fact that most cancer-induced bone pain models in rodents relied on the systemic injection of cancer cells, causing widespread formation of cancer metastases and poor general animal health. Herein, we have established an optimized, clinically relevant Wistar Han female rat model of breast cancer induced bone pain which was characterized using behavioral assessments, radiology, histology, immunohistochemistry and pharmacological methods. In this model that is based on unilateral intra-tibial injection (ITI of Walker 256 carcinoma cells, animals maintained good health for at least 66 days post-ITI. The temporal development of hindpaw hypersensitivity depended on the initial number of Walker 256 cells inoculated in the tibiae. Hindpaw hypersensitivity resolved after approximately 25 days, in the continued presence of bone tumors as evidenced by ex vivo histology, micro-computed tomography scans and immunohistochemical assessments of tibiae. A possible role for the endogenous opioid system as an internal factor mediating the self-resolving nature of BCIBP was identified based upon the observation that naloxone, a non-selective opioid antagonist, caused the re-emergence of hindpaw hypersensitivity. Bolus dose injections of morphine, gabapentin, amitriptyline and meloxicam all alleviated hindpaw hypersensitivity in a dose-dependent manner. This is a first systematic pharmacological profiling of this model by testing standard analgesic drugs from four important diverse classes, which are used to treat cancer induced bone pain in the clinical setting

  2. Spastic paraplegia mutation N256S in the neuronal microtubule motor KIF5A disrupts axonal transport in a Drosophila HSP model.

    Directory of Open Access Journals (Sweden)

    Petra Füger

    Full Text Available Hereditary spastic paraplegias (HSPs comprise a group of genetically heterogeneous neurodegenerative disorders characterized by spastic weakness of the lower extremities. We have generated a Drosophila model for HSP type 10 (SPG10, caused by mutations in KIF5A. KIF5A encodes the heavy chain of kinesin-1, a neuronal microtubule motor. Our results imply that SPG10 is not caused by haploinsufficiency but by the loss of endogenous kinesin-1 function due to a selective dominant-negative action of mutant KIF5A on kinesin-1 complexes. We have not found any evidence for an additional, more generalized toxicity of mutant Kinesin heavy chain (Khc or the affected kinesin-1 complexes. Ectopic expression of Drosophila Khc carrying a human SPG10-associated mutation (N256S is sufficient to disturb axonal transport and to induce motoneuron disease in Drosophila. Neurofilaments, which have been recently implicated in SPG10 disease manifestation, are absent in arthropods. Impairments in the transport of kinesin-1 cargos different from neurofilaments are thus sufficient to cause HSP-like pathological changes such as axonal swellings, altered structure and function of synapses, behavioral deficits, and increased mortality.

  3. Flexible non-volatile optical memory thin-film transistor device with over 256 distinct levels based on an organic bicomponent blend.

    Science.gov (United States)

    Leydecker, Tim; Herder, Martin; Pavlica, Egon; Bratina, Gvido; Hecht, Stefan; Orgiu, Emanuele; Samorì, Paolo

    2016-09-01

    Organic nanomaterials are attracting a great deal of interest for use in flexible electronic applications such as logic circuits, displays and solar cells. These technologies have already demonstrated good performances, but flexible organic memories are yet to deliver on all their promise in terms of volatility, operational voltage, write/erase speed, as well as the number of distinct attainable levels. Here, we report a multilevel non-volatile flexible optical memory thin-film transistor based on a blend of a reference polymer semiconductor, namely poly(3-hexylthiophene), and a photochromic diarylethene, switched with ultraviolet and green light irradiation. A three-terminal device featuring over 256 (8 bit storage) distinct current levels was fabricated, the memory states of which could be switched with 3 ns laser pulses. We also report robustness over 70 write-erase cycles and non-volatility exceeding 500 days. The device was implemented on a flexible polyethylene terephthalate substrate, validating the concept for integration into wearable electronics and smart nanodevices.

  4. Coronary Plaque Characteristics Assessed by 256-Slice Coronary CT Angiography and Association with High-Sensitivity C-Reactive Protein in Symptomatic Patients with Type 2 Diabetes

    Directory of Open Access Journals (Sweden)

    Jinling Zhang

    2016-01-01

    Full Text Available Little is known regarding plaque distribution, composition, and the association with inflammation in type 2 diabetes mellitus (DM2. This study aimed to assess the relationship between coronary plaque subtypes and high-sensitivity C-reactive protein levels. Coronary CTA were performed in 98 symptomatic DM2 patients and 107 non-DM2 patients using a 256-slice CT. The extent and types of plaque as well as luminal narrowing were evaluated. Patients with DM2 were more likely to have significant stenosis (>50% with calcified plaques in at least one coronary segment (p<0.01; the prevalence rates of diffuse calcified plaques in the DM2 and non-DM2 groups were 31.6% and 4.7%, respectively (p<0.01. Plasma hs-CRP levels in DM2 with calcified plaques were higher compared with values obtained for the non-DM2 group (p<0.01. In conclusion, combination of coronary CTA and hs-CRP might improve risk stratification in symptomatic DM2 patients.

  5. Necroptosis mediates the antineoplastic effects of the soluble fraction of polysaccharide from red wine in Walker-256 tumor-bearing rats.

    Science.gov (United States)

    Stipp, Maria Carolina; Bezerra, Iglesias de Lacerda; Corso, Claudia Rita; Dos Reis Livero, Francislaine A; Lomba, Luiz Alexandre; Caillot, Adriana Rute Cordeiro; Zampronio, Aleksander Roberto; Queiroz-Telles, José Ederaldo; Klassen, Giseli; Ramos, Edneia A S; Sassaki, Guilherme Lanzi; Acco, Alexandra

    2017-03-15

    Polysaccharides are substances that modify the biological response to several stressors. The present study investigated the antitumor activity of the soluble fraction of polysaccharides (SFP), extracted from cabernet franc red wine, in Walker-256 tumor-bearing rats. The monosaccharide composition had a complex mixture, suggesting the presence of arabinoglactans, mannans, and pectins. Treatment with SFP (30 and 60mg/kg, oral) for 14days significantly reduced the tumor weight and volume compared with controls. Treatment with 60mg/kg SFP reduced blood monocytes and neutrophils, reduced the tumor activity of N-acetylglucosaminidase, myeloperoxidase, and nitric oxide, increased blood lymphocytes, and increased the levels of tumor necrosis factor α (TNF-α) in tumor tissue. Treatment with SFP also induced the expression of the cell necroptosis-related genes Rip1 and Rip3. The antineoplastic effect of SFP appears to be attributable to its action on the immune system by controlling the tumor microenvironment and stimulating TNF-α production, which may trigger the necroptosis pathway. Copyright © 2016 Elsevier Ltd. All rights reserved.

  6. Flexible non-volatile optical memory thin-film transistor device with over 256 distinct levels based on an organic bicomponent blend

    Science.gov (United States)

    Leydecker, Tim; Herder, Martin; Pavlica, Egon; Bratina, Gvido; Hecht, Stefan; Orgiu, Emanuele; Samorì, Paolo

    2016-09-01

    Organic nanomaterials are attracting a great deal of interest for use in flexible electronic applications such as logic circuits, displays and solar cells. These technologies have already demonstrated good performances, but flexible organic memories are yet to deliver on all their promise in terms of volatility, operational voltage, write/erase speed, as well as the number of distinct attainable levels. Here, we report a multilevel non-volatile flexible optical memory thin-film transistor based on a blend of a reference polymer semiconductor, namely poly(3-hexylthiophene), and a photochromic diarylethene, switched with ultraviolet and green light irradiation. A three-terminal device featuring over 256 (8 bit storage) distinct current levels was fabricated, the memory states of which could be switched with 3 ns laser pulses. We also report robustness over 70 write-erase cycles and non-volatility exceeding 500 days. The device was implemented on a flexible polyethylene terephthalate substrate, validating the concept for integration into wearable electronics and smart nanodevices.

  7. Walker 256 tumour cells increase substance P immunoreactivity locally and modify the properties of the blood-brain barrier during extravasation and brain invasion.

    Science.gov (United States)

    Lewis, Kate M; Harford-Wright, Elizabeth; Vink, Robert; Nimmo, Alan J; Ghabriel, Mounir N

    2013-01-01

    It is not yet known how tumour cells traverse the blood-brain barrier (BBB) to form brain metastases. Substance P (SP) release is a key component of neurogenic inflammation which has been recently shown to increase the permeability of the BBB following CNS insults, making it a possible candidate as a mediator of tumour cell extravasation into the brain. This study investigated the properties of the BBB in the early stages of tumour cell invasion into the brain, and the possible involvement of SP. Male Wistar rats were injected with Walker 256 breast carcinoma cells via the internal carotid artery and euthanised at 1, 3, 6 and 9 days post tumour inoculation. Culture medium-injected animals served as controls at 1 and 9 days. Evidence of tumour cell extravasation across the BBB was first observed at 3 days post-inoculation, which corresponded with significantly increased albumin (p p p p < 0.001). The increased SP immunoreactivity and altered BBB properties at 3 days post-inoculation that coincided with early tumour invasion may be indicative of a mechanism for tumour cell extravasation into the brain. Thus, extravasation of tumour cells into the brain to form cerebral metastases may be a SP-mediated process.

  8. Alterations caused by physical training in pulmonary edema and loss of muscle mass in rats with Walker-256 tumor Alterações promovidas pelo treinamento físico no edema pulmonar e perda de massa muscular em ratos portadores de tumor Walker-256

    Directory of Open Access Journals (Sweden)

    Rubens Cecchini

    2008-10-01

    Full Text Available Walker-256 tumor is a fast-growing tumor and has been studied under several metabolic aspects associated or not to cachexia. It was observed in our laboratory that animals with Walker-256 tumor, after spontaneous death (usually around the fifteenth day, showed significant pulmonary edema with fluid in the pleural cavity. Some studies have suggested that physical training improves the survival of animals with tumor and minimizes the effects of cachexia. The purpose of our work was to assess the pulmonary edema index as well as the cardiac and skeletal muscle mass, besides the survival of rats with Walker-256 tumor submitted previously to physical training through swimming (N. For this study male Wistar rats (200 to 220 g were used, submitted to physical training through swimming (1 hour; 5 days a week, four weeks. One day after the training, sedentary rats (C or trained ones (N were submitted to inoculation on the right flank of 8 x 107 Walker-256 tumor cells (T. Immediately after spontaneous death of these animals, the pulmonary edema index (PEI, cardiac and skeletal muscle mass (gastrocnemius and soleus were evaluated. Pulmonary edema was evaluated through the index calculated by the relation between lung and body weights of each animal, and multiplied by 100 (PP/PC x 100 (LEE et al., 2001. Muscle mass (MM index was calculated similarly. In normal animals the PEI is equal to 0,53±0,02 (n=20. In tumor-bearing rats after spontaneous death the PEI was significantly higher (2,62±0,31, n=18. After the physical training in rats without tumor, the PEI was 0,55±0,03 (n=5. Whereas in tumor-bearing rats previously trained, it was obtained a pulmonary edema index lower than that of the control group with tumor (1,46±0,16, n=5; pO tumor Walker-256 é um carcinoma de crescimento rápido e tem sido estudado sob vários aspectos metabólicos, associados ou não, à caquexia. Foi observado, em nosso laboratório, que em animais portadores de tumor Walker

  9. Diagnostic accuracy of low-dose 256-slice multi-detector coronary CT angiography using iterative reconstruction in patients with suspected coronary artery disease

    Energy Technology Data Exchange (ETDEWEB)

    Hou, Yang; Ma, Yue; Wang, Yuke; Yu, Mei; Guo, Qiyong [Shengjing Hospital of China Medical University, Department of Radiology, Shenyang (China); Fan, Weipeng [Central Hospital of Anshan, Department of Radiology, Anshan (China); Vembar, Mani [CT Clinical Science Philips Healthcare, Cleveland, OH (United States)

    2014-01-15

    To evaluate the accuracy of low-dose coronary CTA with iterative reconstruction (IR) in the diagnosis of coronary artery disease (CAD) in patients with suspected CAD. Ninety-six patients with suspected CAD underwent low-dose prospective electrocardiogram-gated coronary CTA, with images reconstructed using IR. Image quality (IQ) of coronary segments were graded on a 4-point scale (4, excellent; 1, non-diagnostic). With invasive coronary angiography (ICA) considered the ''gold standard'', the sensitivity, specificity, positive predictive value (PPV), negative predictive value (NPV) and accuracy of coronary CTA were calculated on segment-, vessel- and patient-based levels. The patient data were divided into two groups (Agatston scores of ≥ 400 and <400). The differences in diagnostic performance between the two groups were tested. Diagnostic image quality was found in 98.1 % (1,232/1,256) of segments. The sensitivity, specificity, PPV, NPV and accuracy were 90.8 %, 95.3 %, 81.8 %, 97.8 % and 94.3 % (segment-based) and 97.2 %, 83.3 %, 94.6 %, 90.9 % and 93.8 % (patient-based). Significant differences between the two groups were seen in specificity, PPV and accuracy (92.1 % vs. 97.9 %, 76.0 % vs. 86.7 %, 91.7 % vs. 96.6 %, P < 0.05; segment-based). The average effective dose was 1.30 ± 0.15 mSv. Low-dose prospective coronary CTA with IR can acquire satisfactory image quality and show high diagnostic accuracy in patients with suspected CAD; however, blooming continues to pose a challenge in severely calcified segments. (orig.)

  10. The hemolytic component of cancer anemia: effects of osmotic and metabolic stress on the erythrocytes of rats bearing multifocal inoculations of the Walker 256 tumor

    Directory of Open Access Journals (Sweden)

    Vido A.A.

    2000-01-01

    Full Text Available Cancer anemia is classified as an anemia of chronic diseases, although it is sometimes the first symptom of cancer. Cancer anemia includes a hemolytic component, important in the terminal stage when even transfused cells are rapidly destroyed. The presence of a chronic component and the terminal complications of the illness limit studies of the hemolytic component. A multifocal model of tumor growth was used here to simulate the terminal metastatic dissemination stage (several simultaneous inoculations of Walker 256 cells. The hemolytic component of anemia began 3-4 days after inoculation in 100% of the rats and progressed rapidly thereafter: Hb levels dropped from 14.9 ± 0.02 to 8.7 ± 0.06 from days 7 to 11 (~5 times the physiologically normal rate in rats in the absence of bleeding. The development of anemia was correlated (r2 = 0.86 with the development of other systemic effects such as anorexia. There was a significant decrease in the osmotic fragility of circulating erythrocytes: the NaCl concentration causing 50% lysis was reduced from 4.52 ± 0.06 to 4.10 ± 0.01 (P<0.01 on day 7, indicating a reduction in erythrocyte volume. However, with mild metabolic stress (4-h incubation at 37oC, the erythrocytes showed a greater increase in osmotic fragility than the controls, suggesting marked alteration of erythrocyte homeostasis. These effects may be due to primary plasma membrane alterations (transport and/or permeability and/or may be secondary to metabolic changes. This multifocal model is adequate for studying the hemolytic component of cancer anemia since it is rapid, highly reproducible and causes minimal animal suffering.

  11. Uncaria tomentosa exerts extensive anti-neoplastic effects against the Walker-256 tumour by modulating oxidative stress and not by alkaloid activity.

    Directory of Open Access Journals (Sweden)

    Arturo Alejandro Dreifuss

    Full Text Available This study aimed to compare the anti-neoplastic effects of an Uncaria tomentosa (UT brute hydroethanolic (BHE extract with those of two fractions derived from it. These fractions are choroformic (CHCl3 and n-butanolic (BuOH, rich in pentacyclic oxindole alkaloids (POA and antioxidant substances, respectively. The cancer model was the subcutaneous inoculation of Walker-256 tumour cells in the pelvic limb of male Wistar rat. Subsequently to the inoculation, gavage with BHE extract (50 mg.kg(-1 or its fractions (as per the yield of the fractioning process or vehicle (Control was performed during 14 days. Baseline values, corresponding to individuals without tumour or treatment with UT, were also included. After treatment, tumour volume and mass, plasma biochemistry, oxidative stress in liver and tumour, TNF-α level in liver and tumour homogenates, and survival rates were analysed. Both the BHE extract and its BuOH fraction successfully reduced tumour weight and volume, and modulated anti-oxidant systems. The hepatic TNF-α level indicated a greater effect from the BHE extract as compared to its BuOH fraction. Importantly, both the BHE extract and its BuOH fraction increased the survival time of the tumour-bearing animals. Inversely, the CHCl3 fraction was ineffective. These data represent an in vivo demonstration of the importance of the modulation of oxidative stress as part of the anti-neoplastic activity of UT, as well as constitute evidence of the lack of activity of isolated POAs in the primary tumour of this tumour lineage. These effects are possibly resulting from a synergic combination of substances, most of them with antioxidant properties.

  12. Uncaria tomentosa exerts extensive anti-neoplastic effects against the Walker-256 tumour by modulating oxidative stress and not by alkaloid activity.

    Science.gov (United States)

    Dreifuss, Arturo Alejandro; Bastos-Pereira, Amanda Leite; Fabossi, Isabella Aviles; Lívero, Francislaine Aparecida Dos Reis; Stolf, Aline Maria; Alves de Souza, Carlos Eduardo; Gomes, Liana de Oliveira; Constantin, Rodrigo Polimeni; Furman, Aline Emmer Ferreira; Strapasson, Regiane Lauriano Batista; Teixeira, Simone; Zampronio, Aleksander Roberto; Muscará, Marcelo Nicolás; Stefanello, Maria Elida Alves; Acco, Alexandra

    2013-01-01

    This study aimed to compare the anti-neoplastic effects of an Uncaria tomentosa (UT) brute hydroethanolic (BHE) extract with those of two fractions derived from it. These fractions are choroformic (CHCl3) and n-butanolic (BuOH), rich in pentacyclic oxindole alkaloids (POA) and antioxidant substances, respectively. The cancer model was the subcutaneous inoculation of Walker-256 tumour cells in the pelvic limb of male Wistar rat. Subsequently to the inoculation, gavage with BHE extract (50 mg.kg(-1)) or its fractions (as per the yield of the fractioning process) or vehicle (Control) was performed during 14 days. Baseline values, corresponding to individuals without tumour or treatment with UT, were also included. After treatment, tumour volume and mass, plasma biochemistry, oxidative stress in liver and tumour, TNF-α level in liver and tumour homogenates, and survival rates were analysed. Both the BHE extract and its BuOH fraction successfully reduced tumour weight and volume, and modulated anti-oxidant systems. The hepatic TNF-α level indicated a greater effect from the BHE extract as compared to its BuOH fraction. Importantly, both the BHE extract and its BuOH fraction increased the survival time of the tumour-bearing animals. Inversely, the CHCl3 fraction was ineffective. These data represent an in vivo demonstration of the importance of the modulation of oxidative stress as part of the anti-neoplastic activity of UT, as well as constitute evidence of the lack of activity of isolated POAs in the primary tumour of this tumour lineage. These effects are possibly resulting from a synergic combination of substances, most of them with antioxidant properties.

  13. Processing of A New Digital Orthoimage Map of The Martian Western Hemisphere Using Data Obtained From The Mars Orbiter Camera At A Resolution of 256 Pixel/deg

    Science.gov (United States)

    Wählisch, M.; Niedermaier, G.; van Gasselt, S.; Scholten, F.; Wewel, F.; Roatsch, T.; Matz, K.-D.; Jaumann, R.

    We present a new digital orthoimage map of Mars using data obtained from the CCD line scanner Mars Orbiter Camera (MOC) of the Mars Global Surveyor Mis- sion (MGS) [1,2]. The map covers the Mars surface from 0 to 180 West and from 60 South to 60 North with the MDIM2 resolution of 256 pixel/degree and size. Image data processing has been performed using multiple programs, developed by DLR, Technical University of Berlin [3], JPL, and the USGS. 4,339 Context and 183 Geodesy images [2] were included. After radiometric corrections, the images were Mars referenced [4], geometrically corrected [5] and orthoprojected using a global Martian Digital Terrain Model (DTM) with a resolution of 64 pixel/degree, developed at DLR and based on MGS Mars Orbiter Laser Altimeter (MOLA) data [6]. To elim- inate major differences in brightness between the individual images of the mosaics, high- and low-pass filter processing techniques were applied for each image. After filtering, the images were mosaicked without registering or using block adjustment techniques in order to improve the geometric quality. It turns out that the accuracy of the navigation data has such a good quality that the orthoimages fit very well to each other. When merging the MOC mosaic with the MOLA data using IHS- trans- formation, we recognized very good correspondence between these two datasets. We create a topographic image map of the Coprates region (MC­18) adding contour lines derived from the global DTM to the mosaic. These maps are used for geological and morphological interpretations in order to review and improve our current Viking-based knowledge about the Martian surface. References: [1] www.mssss.com, [2] Caplinger, M. and M. Malin, "The Mars Or- biter Camera Geodesy Campaign, JGR, in press, [3] Scholten, F., Vol XXXI, Part B2, Wien 1996, p.351-356, [4] naïf.jpl.nasa.gov, [5] R.L.Kirk. et al. (2001), "Geometric Calibration of the Mars Orbiter Cameras and Coalignment with Mars Orbiter Laser Altimeter

  14. Iterative model reconstruction: Improved image quality of low-tube-voltage prospective ECG-gated coronary CT angiography images at 256-slice CT

    Energy Technology Data Exchange (ETDEWEB)

    Oda, Seitaro, E-mail: seisei0430@nifty.com [Department of Cardiology, MedStar Washington Hospital Center, 110 Irving Street, NW, Washington, DC 20010 (United States); Department of Diagnostic Radiology, Faculty of Life Sciences, Kumamoto University, 1-1-1 Honjyo, Chuo-ku, Kumamoto, 860-8556 (Japan); Weissman, Gaby, E-mail: Gaby.Weissman@medstar.net [Department of Cardiology, MedStar Washington Hospital Center, 110 Irving Street, NW, Washington, DC 20010 (United States); Vembar, Mani, E-mail: mani.vembar@philips.com [CT Clinical Science, Philips Healthcare, c595 Miner Road, Cleveland, OH 44143 (United States); Weigold, Wm. Guy, E-mail: Guy.Weigold@MedStar.net [Department of Cardiology, MedStar Washington Hospital Center, 110 Irving Street, NW, Washington, DC 20010 (United States)

    2014-08-15

    Objectives: To investigate the effects of a new model-based type of iterative reconstruction (M-IR) technique, the iterative model reconstruction, on image quality of prospectively gated coronary CT angiography (CTA) acquired at low-tube-voltage. Methods: Thirty patients (16 men, 14 women; mean age 52.2 ± 13.2 years) underwent coronary CTA at 100-kVp on a 256-slice CT. Paired image sets were created using 3 types of reconstruction, i.e. filtered back projection (FBP), a hybrid type of iterative reconstruction (H-IR), and M-IR. Quantitative parameters including CT-attenuation, image noise, and contrast-to-noise ratio (CNR) were measured. The visual image quality, i.e. graininess, beam-hardening, vessel sharpness, and overall image quality, was scored on a 5-point scale. Lastly, coronary artery segments were evaluated using a 4-point scale to investigate the assessability of each segment. Results: There was no significant difference in coronary arterial CT attenuation among the 3 reconstruction methods. The mean image noise of FBP, H-IR, and M-IR images was 29.3 ± 9.6, 19.3 ± 6.9, and 12.9 ± 3.3 HU, respectively, there were significant differences for all comparison combinations among the 3 methods (p < 0.01). The CNR of M-IR was significantly better than of FBP and H-IR images (13.5 ± 5.0 [FBP], 20.9 ± 8.9 [H-IR] and 39.3 ± 13.9 [M-IR]; p < 0.01). The visual scores were significantly higher for M-IR than the other images (p < 0.01), and 95.3% of the coronary segments imaged with M-IR were of assessable quality compared with 76.7% of FBP- and 86.9% of H-IR images. Conclusions: M-IR can provide significantly improved qualitative and quantitative image quality in prospectively gated coronary CTA using a low-tube-voltage.

  15. Synthesis, radiolabeling and baboon SPECT imaging of 2{beta}-carbomethoxy-3{beta}-(3'-[{sup 123}I]iodophenyl)tropane ([{sup 123}I]YP256) as a serotonin transporter radiotracer

    Energy Technology Data Exchange (ETDEWEB)

    Bois, Frederic; Baldwin, Ronald M.; Amici, Louis; Al-Tikriti, Mohammed S. [Yale University, School of Medicine, VA Connecticut HCS (116A2), West Haven, CT 06516 (United States); Kula, Nora; Baldessarini, Ross [Department of Psychiatry and Neuroscience Program, Harvard Medical School, Mailman Research Center McLean Division of Massachusetts General Hospital, Belmont, MA 02478 (United States); Innis, Robert B.; Staley, Julie K. [Yale University, School of Medicine, VA Connecticut HCS (116A2), West Haven, CT 06516 (United States); Tamagnan, Gilles D. [Yale University, School of Medicine, VA Connecticut HCS (116A2), West Haven, CT 06516 (United States); Institute for Neurodegenerative Disorders, New Haven, CT 06510 (United States)], E-mail: gtamagnan@indd.org

    2008-01-15

    To develop a potential SPECT probe to evaluate the integrity of the serotoninergic system (5-HTT) whose dysfunction is linked to several disease conditions such as Parkinson's disease, Alzheimer's disease and depression, we report the synthesis, radiolabeling and in vivo baboon imaging of 2{beta}-carbomethoxy-3{beta}-(3'-[{sup 123}I]iodophenyl) tropane (YP256, ). The radiolabeling was performed by iododestannylation using sodium [{sup 123}I]iodide and peracetic acid. Although the ligand displayed high selectivity for 5-HTT over dopamine transporter in vitro, SPECT imaging in baboons did not reveal selective 5-HTT accumulation in brain in vivo.

  16. Individualized radiation dose control in 256-slice CT coronary angiography (CTCA) in retrospective ECG-triggered helical scans: Using a measure of body size to adjust tube current selection

    Energy Technology Data Exchange (ETDEWEB)

    Li, Jing-Lei, E-mail: lijinglei80@126.com [Department of Radiology, Guangdong Academy of Medical Sciences, Guangdong General Hospital, 106 Zhongshan Er Road, Guangzhou 510080 (China); Huang, Mei-Ping, E-mail: huang_meiping@yahoo.com.cn [Department of Radiology, Guangdong Academy of Medical Sciences, Guangdong General Hospital, 106 Zhongshan Er Road, Guangzhou 510080 (China); Liang, Chang-Hong, E-mail: cjr.lchh@vip.163.com [Department of Radiology, Guangdong Academy of Medical Sciences, Guangdong General Hospital, 106 Zhongshan Er Road, Guangzhou 510080 (China); Zhao, Zhen-Jun, E-mail: junabc2006@hotmail.com [Department of Radiology, Guangdong Academy of Medical Sciences, Guangdong General Hospital, 106 Zhongshan Er Road, Guangzhou 510080 (China); Liu, Hui, E-mail: liuhuijiujiu@gmail.com [Department of Radiology, Guangdong Academy of Medical Sciences, Guangdong General Hospital, 106 Zhongshan Er Road, Guangzhou 510080 (China); Cui, Yan-Hai, E-mail: yanhai_cui@126.com [Department of Radiology, Guangdong Academy of Medical Sciences, Guangdong General Hospital, 106 Zhongshan Er Road, Guangzhou 510080 (China); Liu, Qi-Shun, E-mail: liuqishun@yeah.net [Department of Radiology, Guangdong Academy of Medical Sciences, Guangdong General Hospital, 106 Zhongshan Er Road, Guangzhou 510080 (China); Zhang, Jin-E., E-mail: zhjine@yahoo.com.cn [Department of Radiology, Guangdong Academy of Medical Sciences, Guangdong General Hospital, 106 Zhongshan Er Road, Guangzhou 510080 (China); Yang, Lin, E-mail: yanglin001517@163.com [Department of Radiology, Guangdong Academy of Medical Sciences, Guangdong General Hospital, 106 Zhongshan Er Road, Guangzhou 510080 (China); Ivanc, Thomas B., E-mail: Thomas.ivanc@philips.com [CT Clinical Science, Philips Healthcare, Highland Heights, OH (United States); Yanof, Jeffrey H., E-mail: Jeffrey.yanof@philips.com [CT Clinical Science, Philips Healthcare, Highland Heights, OH (United States)

    2012-11-15

    Purpose: To reduce radiation dose for retrospective ECG-triggered helical 256-slice CTCA by determining an optimal body size index to prospectively adjust tube current. Methods: 102 consecutive patients with suspected CAD underwent retrospective ECG-triggered CTCA using 256-slice CT scanner. Six body size indexes including BMI, nipple level (NL) bust, thoracic anteroposterior diameter at NL, chest circumference (CC) at NL, left main and right coronary artery (RCA) origin level were measured and their correlation with noise was evaluated using linear regression. An equation was developed to use this index to adjust tube current. Additional 102 consecutive patients were scanned with the index-based mA s adjustment. A t-test for independent samples was used to compare radiation dose levels with and without the index-based mA s selection method. Results: Linear regression indicated that CC RCA had the best correlation with noise (R{sup 2} = 0.603). Effective radiation dose was reduced from 16.6 {+-} 0.9 to 9.8 {+-} 2.7 mSv (p < 0.01), i.e. 40.9% lower dose with the CC RCA-adapted tube current method. The image quality scores indicated no significant difference with and without the size-based mA s selection method. Conclusion: An accessible measure of body size, such as CC RCA, can be used to adapt tube current for individualized radiation dose control.

  17. Individualized radiation dose control in 256-slice CT coronary angiography (CTCA) in retrospective ECG-triggered helical scans: Using a measure of body size to adjust tube current selection

    International Nuclear Information System (INIS)

    Li, Jing-Lei; Huang, Mei-Ping; Liang, Chang-Hong; Zhao, Zhen-Jun; Liu, Hui; Cui, Yan-Hai; Liu, Qi-Shun; Zhang, Jin-E.; Yang, Lin; Ivanc, Thomas B.; Yanof, Jeffrey H.

    2012-01-01

    Purpose: To reduce radiation dose for retrospective ECG-triggered helical 256-slice CTCA by determining an optimal body size index to prospectively adjust tube current. Methods: 102 consecutive patients with suspected CAD underwent retrospective ECG-triggered CTCA using 256-slice CT scanner. Six body size indexes including BMI, nipple level (NL) bust, thoracic anteroposterior diameter at NL, chest circumference (CC) at NL, left main and right coronary artery (RCA) origin level were measured and their correlation with noise was evaluated using linear regression. An equation was developed to use this index to adjust tube current. Additional 102 consecutive patients were scanned with the index-based mA s adjustment. A t-test for independent samples was used to compare radiation dose levels with and without the index-based mA s selection method. Results: Linear regression indicated that CC RCA had the best correlation with noise (R 2 = 0.603). Effective radiation dose was reduced from 16.6 ± 0.9 to 9.8 ± 2.7 mSv (p < 0.01), i.e. 40.9% lower dose with the CC RCA-adapted tube current method. The image quality scores indicated no significant difference with and without the size-based mA s selection method. Conclusion: An accessible measure of body size, such as CC RCA, can be used to adapt tube current for individualized radiation dose control.

  18. Complete Circular Genome Sequence of Successful ST8/SCCmecIV Community-Associated Methicillin-Resistant Staphylococcus aureus (OC8) in Russia: One-Megabase Genomic Inversion, IS256’s Spread, and Evolution of Russia ST8-IV

    Science.gov (United States)

    Wan, Tsai-Wen; Higuchi, Wataru; Hung, Wei-Chun; Reva, Ivan V.; Singur, Olga A.; Gostev, Vladimir V.; Sidorenko, Sergey V.; Peryanova, Olga V.; Salmina, Alla B.; Reva, Galina V.; Teng, Lee-Jene; Yamamoto, Tatsuo

    2016-01-01

    ST8/SCCmecIV community-associated methicillin-resistant Staphylococcus aureus (CA-MRSA) has been a common threat, with large USA300 epidemics in the United States. The global geographical structure of ST8/SCCmecIV has not yet been fully elucidated. We herein determined the complete circular genome sequence of ST8/SCCmecIVc strain OC8 from Siberian Russia. We found that 36.0% of the genome was inverted relative to USA300. Two IS256, oppositely oriented, at IS256-enriched hot spots were implicated with the one-megabase genomic inversion (MbIN) and vSaβ split. The behavior of IS256 was flexible: its insertion site (att) sequences on the genome and junction sequences of extrachromosomal circular DNA were all divergent, albeit with fixed sizes. A similar multi-IS256 system was detected, even in prevalent ST239 healthcare-associated MRSA in Russia, suggesting IS256’s strong transmission potential and advantage in evolution. Regarding epidemiology, all ST8/SCCmecIVc strains from European, Siberian, and Far Eastern Russia, examined had MbIN, and geographical expansion accompanied divergent spa types and resistance to fluoroquinolones, chloramphenicol, and often rifampicin. Russia ST8/SCCmecIVc has been associated with life-threatening infections such as pneumonia and sepsis in both community and hospital settings. Regarding virulence, the OC8 genome carried a series of toxin and immune evasion genes, a truncated giant surface protein gene, and IS256 insertion adjacent to a pan-regulatory gene. These results suggest that unique single ST8/spa1(t008)/SCCmecIVc CA-MRSA (clade, Russia ST8-IVc) emerged in Russia, and this was followed by large geographical expansion, with MbIN as an epidemiological marker, and fluoroquinolone resistance, multiple virulence factors, and possibly a multi-IS256 system as selective advantages. PMID:27741255

  19. Characterization of Ni{sub 55.6}Mn{sub 11.4}Fe{sub 7.4}Ga{sub 25.6} high temperature shape memory alloy thin film

    Energy Technology Data Exchange (ETDEWEB)

    Wang, H.B.; Liu, C.; Lei, Y.C. [National Key Laboratory Precision Hot Processing of Metals, Harbin Institute of Technology, Harbin 150001 (China); Cai, W. [National Key Laboratory Precision Hot Processing of Metals, Harbin Institute of Technology, Harbin 150001 (China)], E-mail: weicai@hit.edu.cn

    2008-10-06

    The Ni{sub 55.6}Mn{sub 11.4}Fe{sub 7.4}Ga{sub 25.6} high temperature shape memory alloy thin film was deposited onto silicon substrates by using radio-frequency (R.F.) magnetron sputtering technique. Surface morphology, crystallographic structure, martensitic transformation and microstructure were systematically investigated by means of scanning electron microscopy (SEM), atomic force microscope (AFM), X-ray diffraction (XRD), differential scanning calorimetry (DSC) and transmission electron microscopy (TEM). The results show that the film has columnar structure and an excellent surface quality. The film has seven-layered modulated orthorhombic structure with typical self-accommodated morphology at room temperature. The martensitic transformation start temperature of the film is up to 439 K, much higher than room temperature, displaying the promising application as high temperature actuator material.

  20. Crystal structure of poly[μ2-aqua-aqua(μ2-4-nitro-2,5,6-trioxo-1,2,5,6-tetrahydropyridin-3-olatohemi-μ4-oxalato-barium(II

    Directory of Open Access Journals (Sweden)

    Rusul Alabada

    2015-05-01

    Full Text Available In the title coordination polymer, [Ba(C5HN2O6(C2O40.5(H2O2]n, the tenfold coordination of the Ba centre consists of four O atoms from the two 4-nitro-2,5,6-trioxo-1,2,5,6-tetrahydropyridin-3-olate (L anions, three O atoms of two oxalate anions and three water molecules. The Ba—O bond lengths fall in the range 2.698 (3–2.978 (3 Å. The L ligand chelates two Ba atoms related by a screw axis, leading to formation of fused five- and six-membered chelate rings. Due to the bridging function of the ligands and water molecules, the complex monomers are connected into polymeric two-dimensional layers parallel to the bc plane. Intermolecular O—H...O hydrogen bonds link these layers into a three-dimensional supramolecular framework.

  1. The Up-to-14-Year Survival and Complication Burden of 256 TiUnite Implants Supporting One-Piece Cast Abutment/Metal-Ceramic Implant-Supported Single Crowns.

    Science.gov (United States)

    Walton, Terry R

    To assess the estimated cumulative survival (ECS) and explore the technical and biologic complications of 256 TiUnite implants (Nobel Biocare) supporting one-piece cast abutment/metal-ceramic implant-supported single crowns (ISCs) in situ for up to 14 years. A prospective sequentially recruited cohort of 207 patients received 256 metal-ceramic ISCs on TiUnite implants between 2001 and 2014. All but 24 patients with 27 crowns were clinically evaluated between January 2014 and April 2015 in conjunction with or in addition to their tailored maintenance program. Radiographs were obtained, and any previously recorded treatments associated with the crowns were tabulated. The ECS and standard errors were calculated with the life table actuarial method and Greenwood's formula, respectively. The log rank test was applied to assess differences between anterior and posterior crowns. Complication incidence, severity, and economic burden, measured in time/cost accounting units (TAUs), were tallied and compared descriptively. Independent groups were compared with the Mann-Whitney U test and related groups with the Wilcoxon Signed Rank Test. The mean clinical service time of the crowns was 5.61 years (44 ≥ 10 years). The 14-year ECS was 95.95% ± 3.20% with no significant difference between anterior and posterior prostheses. Only seven implants lost marginal bone ≥ one thread from the time of crown insertion. There were 30 nonterminal complications (16 biologic, 14 mechanical). The associated economic burden was low (n = 35 TAUs). High gold-alloy one-piece cast abutment/metal-ceramic ISCs on TiUnite implants exhibited excellent longevity and few complications over 14 years.

  2. The effect of head size/shape, miscentering, and bowtie filter on peak patient tissue doses from modern brain perfusion 256-slice CT: How can we minimize the risk for deterministic effects?

    Energy Technology Data Exchange (ETDEWEB)

    Perisinakis, Kostas; Seimenis, Ioannis; Tzedakis, Antonis; Papadakis, Antonios E.; Damilakis, John [Department of Medical Physics, Faculty of Medicine, University of Crete, P.O. Box 2208, Heraklion 71003, Crete (Greece); Medical Diagnostic Center ' Ayios Therissos,' P.O. Box 28405, Nicosia 2033, Cyprus and Department of Medical Physics, Medical School, Democritus University of Thrace, Panepistimioupolis, Dragana 68100, Alexandroupolis (Greece); Department of Medical Physics, University Hospital of Heraklion, P.O. Box 1352, Heraklion 71110, Crete (Greece); Department of Medical Physics, Faculty of Medicine, University of Crete, P.O. Box 2208, Heraklion 71003, Crete (Greece)

    2013-01-15

    Purpose: To determine patient-specific absorbed peak doses to skin, eye lens, brain parenchyma, and cranial red bone marrow (RBM) of adult individuals subjected to low-dose brain perfusion CT studies on a 256-slice CT scanner, and investigate the effect of patient head size/shape, head position during the examination and bowtie filter used on peak tissue doses. Methods: The peak doses to eye lens, skin, brain, and RBM were measured in 106 individual-specific adult head phantoms subjected to the standard low-dose brain perfusion CT on a 256-slice CT scanner using a novel Monte Carlo simulation software dedicated for patient CT dosimetry. Peak tissue doses were compared to corresponding thresholds for induction of cataract, erythema, cerebrovascular disease, and depression of hematopoiesis, respectively. The effects of patient head size/shape, head position during acquisition and bowtie filter used on resulting peak patient tissue doses were investigated. The effect of eye-lens position in the scanned head region was also investigated. The effect of miscentering and use of narrow bowtie filter on image quality was assessed. Results: The mean peak doses to eye lens, skin, brain, and RBM were found to be 124, 120, 95, and 163 mGy, respectively. The effect of patient head size and shape on peak tissue doses was found to be minimal since maximum differences were less than 7%. Patient head miscentering and bowtie filter selection were found to have a considerable effect on peak tissue doses. The peak eye-lens dose saving achieved by elevating head by 4 cm with respect to isocenter and using a narrow wedge filter was found to approach 50%. When the eye lies outside of the primarily irradiated head region, the dose to eye lens was found to drop to less than 20% of the corresponding dose measured when the eye lens was located in the middle of the x-ray beam. Positioning head phantom off-isocenter by 4 cm and employing a narrow wedge filter results in a moderate reduction of

  3. The effect of head size∕shape, miscentering, and bowtie filter on peak patient tissue doses from modern brain perfusion 256-slice CT: how can we minimize the risk for deterministic effects?

    Science.gov (United States)

    Perisinakis, Kostas; Seimenis, Ioannis; Tzedakis, Antonis; Papadakis, Antonios E; Damilakis, John

    2013-01-01

    To determine patient-specific absorbed peak doses to skin, eye lens, brain parenchyma, and cranial red bone marrow (RBM) of adult individuals subjected to low-dose brain perfusion CT studies on a 256-slice CT scanner, and investigate the effect of patient head size∕shape, head position during the examination and bowtie filter used on peak tissue doses. The peak doses to eye lens, skin, brain, and RBM were measured in 106 individual-specific adult head phantoms subjected to the standard low-dose brain perfusion CT on a 256-slice CT scanner using a novel Monte Carlo simulation software dedicated for patient CT dosimetry. Peak tissue doses were compared to corresponding thresholds for induction of cataract, erythema, cerebrovascular disease, and depression of hematopoiesis, respectively. The effects of patient head size∕shape, head position during acquisition and bowtie filter used on resulting peak patient tissue doses were investigated. The effect of eye-lens position in the scanned head region was also investigated. The effect of miscentering and use of narrow bowtie filter on image quality was assessed. The mean peak doses to eye lens, skin, brain, and RBM were found to be 124, 120, 95, and 163 mGy, respectively. The effect of patient head size and shape on peak tissue doses was found to be minimal since maximum differences were less than 7%. Patient head miscentering and bowtie filter selection were found to have a considerable effect on peak tissue doses. The peak eye-lens dose saving achieved by elevating head by 4 cm with respect to isocenter and using a narrow wedge filter was found to approach 50%. When the eye lies outside of the primarily irradiated head region, the dose to eye lens was found to drop to less than 20% of the corresponding dose measured when the eye lens was located in the middle of the x-ray beam. Positioning head phantom off-isocenter by 4 cm and employing a narrow wedge filter results in a moderate reduction of signal-to-noise ratio

  4. Action of tacrolimus on Wistar rat kidneys implanted with Walker 256 carcinosarcoma Estudo da ação do tacrolimus em rins de ratos Wistar implantados com carcinossarcoma de Walker

    Directory of Open Access Journals (Sweden)

    Cristiano Machado Inácio

    2010-02-01

    Full Text Available PURPOSE: To evaluate the development of Walker 256 tumor in male Wistar rats treated with tacrolimus using an experimental kidney tumor model. METHODS: 40 male Wistar rats were divided into four groups: Tumor group (TU (n=10, Tacrolimus-Tumor group (TT (n=10, Tacrolimus group (TC (n=10 and Control group (C (n=10. Treatment with tacrolimus was performed in groups TT and TC. Under anesthesia, the right kidney of each animal of TU and TT was accessed through a supraumbilical incision and inoculated with a 0.1mL solution containing 2x10(6 tumor cells (Walker 256 carcinosarcoma tumor cells. Group TC was treated with a saline solution. All the animals of groups TC and TT were treated with tacrolimus (5mg/kg/day by gavage for 15 days. TU group animals received saline by gavage for 15 days. On the 15th postoperative day, all animals were submitted to euthanasia and blood sampling for analysis of serum creatinine (Cr and blood urea nitrogen (BUN. Abdominal gross examination was performed, the right kidney removed and prepared for histological analysis by hematoxylin-eosin staining. The resulting data were submitted to statistical analysis by ANOVA. RESULTS: Statistical significance was found when comparing creatinine level between groups TU, TT and TC -TT group culminated with a marked increased in creatinine levels (Cr=1.013 ± 0.3028 mg/mL, TU group (Cr=0.5670 ± 0.03536 mg/dL P=0.00256, TC group (Cr =0.711 ± 0.1653 mg/mL P= 0.02832. Statistical significance was found when comparing BUN levels in TT group (71.32 ± 17.14 mg/mL, compared with TU group (45.83 ± 5.046 mg/dL, P=0.000318. There were no statistically significant differences between groups TT and TC (61.23 ± 9.503 mg/mL P=0.7242. Histological analysis showed a poor evolution in TT group with multiple foci of hemorrhage and cortical invasion by the Walker tumor. CONCLUSION: The Tacrolimus-treated group developed a more aggressive tumor and a drug-related nephrotoxic effect.OBJETIVO: Avaliar

  5. 32 CFR 256.3 - Criteria.

    Science.gov (United States)

    2010-07-01

    ... height standards defined in AFM 86-8, 1 NavFac P-272 and P-80, 1 and TM 5-803-4 1 will be used for... Assistant Secretary of Defense (Installations and Logistics)—ID, Washington, DC 20301. (c) Accident... for the purpose of defining accident potential areas. Class A runways are those restricted to light...

  6. Publications | Page 256 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    IDRC works with developing-country researchers and institutions to build local capacity through funding, knowledge sharing, and training. Through books, articles, research publications, and studies, we aim to widen the impact of our investment and advance development research. We share the results of our funded ...

  7. 40 CFR 256.06 - Definitions.

    Science.gov (United States)

    2010-07-01

    ... resource recovery system or component thereof, any system, program or facility for resource conservation, and any facility for collection, source separation, storage, transportation, transfer, processing.... The Act means the Solid Waste Disposal Act, as amended by the Resource Conservation and Recovery Act...

  8. 17 CFR 256.00-1 - Preface.

    Science.gov (United States)

    2010-04-01

    ... regulation, (3) in provision of transportation, whether or not so regulated, or (4) in the ownership of... records to facilitate the preparation of reports and statements required by regulatory commissions and the... associate companies served. In this connection, each service company shall maintain a work order system for...

  9. 32 CFR 256.4 - Policy.

    Science.gov (United States)

    2010-07-01

    ... installations and neighboring civilian communities by means of a compatible land use planning and control... analysis and assessment of the future of the installation must be included. (1) Costs of establishing and... relocation or abandonment of a mission will be required, then no new construction shall be undertaken in...

  10. 30 CFR 256.63 - Service fees.

    Science.gov (United States)

    2010-07-01

    ... will be adjusted periodically according to the Implicit Price Deflator for Gross Domestic Product by... actual cost for any reason other than inflation, then a proposed rule containing the new fees will be...

  11. 49 CFR 256.3 - Definitions.

    Science.gov (United States)

    2010-10-01

    ...) Allowable project costs means those project costs for which Federal financial assistance may be expended... means the Advisory Council on Historic Preservation. (h) Demonstration funds means funds authorized for... terminal means an existing railroad passenger terminal which has been or may be modified as necessary to...

  12. 49 CFR 256.11 - Applications.

    Science.gov (United States)

    2010-10-01

    ... demonstration stage of the project, a brief description of the sources, use and total anticipated amount of such... Federal programs for the preservation or demonstration stages of the project, a brief description of the... accordance with appendix M of Office of Management and Budget Circular A-102, applicants shall use the pre...

  13. 42_256 - 261_Rafukka paper

    African Journals Online (AJOL)

    user pc

    2017-12-02

    Dec 2, 2017 ... ABSTRACT. Anthropometric test device (ATD) is surrogate worldwide in the evaluation of vehicle safety of U.S. population. This work is aimed at a dimensions of Nigerian female adults from reported in the literature. The comparison stature and 1.5% to 16.7% in the body w represent Igbo female because ...

  14. 17 CFR 256.01-7 - Records.

    Science.gov (United States)

    2010-04-01

    ... accounts and financial statements shall be maintained in accordance with Regulation S-X and Accounting... company. The service company is authorized to make such subdivisions, reclassification, or consolidations...

  15. 30 CFR 256.5 - Definitions.

    Science.gov (United States)

    2010-07-01

    ... States, and includes islands, transition and intertidal areas, salt marshes, wetlands, and beaches, which... artificial island or structure referred to in section 4(a)(1) of the Act; (3) Which is receiving, or in..., the contiguous zone, transitional and intertidal areas, salt marshes, and wetlands within the coastal...

  16. 30 CFR 256.12 - Supplemental sales.

    Science.gov (United States)

    2010-07-01

    ... the high bid was forfeited during the calendar year preceding the year of the supplemental sale in which they are reoffered or blocks for which high bids were forfeited in the same calendar year as the... Mexico Planning Areas. (e) The Director may disclose the classification of blocks in supplemental sales...

  17. 25 CFR 256.2 - Definitions.

    Science.gov (United States)

    2010-04-01

    ... ability to perform work in a particular vocation. Indian means any person who is a member of any of those... economical access to utilities and must be easy to enter and leave; and (ix) Aesthetics and access to school...

  18. Publications | Page 256 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Assessing the Impacts of Agricultural Biotechnologies: Canadian–Latin American Perspectives. The workshop on which this volume is based represents one of the first formal activities of the "Canada–Latin America Initiative on Biotechnology, the Environment and Sustainable Development" (CamBioTec). The decision by ...

  19. Publications | Page 256 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Managing Natural Resources for Development in Africa: A Resource Book ... Globalization, the information age, and the rise of the knowledge-based economy are significantly transforming the way we acquire, disseminate, and transform knowledge. And, as a ... As Peter Evans (2006, 2008) has argued, a key contemporary.

  20. 256 253 Profitability Analysis of Groundnut

    African Journals Online (AJOL)

    2008-12-02

    Dec 2, 2008 ... GR = Gross revenue (N /kg). TVC = Total variable costs (N /kg). The gross margin analysis was used under the assumption that fixed costs of production are negligible (Olukosi and Erhabor, 1988). Return on investment. The return on investment (ROI) was also used to assess the profitability of the ...

  1. 76 FR 256 - Informed Consent Elements

    Science.gov (United States)

    2011-01-04

    ... responsibility of the sponsors and investigators to determine if their clinical trial meets the definition of an... elements which align with various ethics codes and apply to all clinical investigations regulated by FDA... organizations for ethical research, patient advocacy organizations, health care attorneys, pharmacy and law...

  2. 30 CFR 256.53 - Additional bonds.

    Science.gov (United States)

    2010-07-01

    ... onshore oil and gas industry; (iv) Reliability in meeting obligations based on: (A) Credit rating(s); or... suppliers with whom you have dealt; and (v) Record of compliance with laws, regulations, and lease terms. (2...

  3. A workflow for multiclass determination of 256 pesticides in essential oils by liquid chromatography tandem mass spectrometry using evaporation and dilution approaches: Application to lavandin, lemon and cypress essential oils.

    Science.gov (United States)

    Fillatre, Yoann; Rondeau, David; Daguin, Antoine; Communal, Pierre-Yves

    2016-01-01

    This paper describes the determination of 256 multiclass pesticides in cypress and lemon essential oils (EOs) by the way of liquid chromatography-electrospray ionization tandem mass spectrometry (LC-ESI/MS/MS) analysis using the scheduled selected reaction monitoring mode (sSRM) available on a hybrid quadrupole linear ion trap (QLIT) mass spectrometer. The performance of a sample preparation of lemon and cypress EOs based on dilution or evaporation under nitrogen assisted by a controlled heating were assessed. The best limits of quantification (LOQs) were achieved with the evaporation under nitrogen method giving LOQs≤10µgL(-1) for 91% of the pesticides. In addition the very satisfactory results obtained for recovery, repeatability and linearity showed that for EOs of relatively low evaporation temperature, a sample preparation based on evaporation under nitrogen is well adapted and preferable to dilution. By compiling these results with those previously published by some of us on lavandin EO, we proposed a workflow dedicated to multiresidue determination of pesticides in various EOs by LC-ESI/sSRM. Among the steps involved in this workflow, the protocol related to mass spectrometry proposes an alternative confirmation method to the classical SRM ratio criteria based on a sSRM survey scan followed by an information-dependent acquisition using the sensitive enhanced product ion (EPI) scan to generate MS/MS spectra then compared to a reference. The submitted workflow was applied to the case of lemon EOs samples highlighting for the first time the simultaneous detection of 20 multiclass pesticides in one EO. Some pesticides showed very high concentration levels with amounts greatly exceeding the mgL(-1). Copyright © 2015 Elsevier B.V. All rights reserved.

  4. Diagnostic accuracy of 256-row multidetector CT coronary angiography with prospective ECG-gating combined with fourth-generation iterative reconstruction algorithm in the assessment of coronary artery bypass: evaluation of dose reduction and image quality.

    Science.gov (United States)

    Ippolito, Davide; Fior, Davide; Franzesi, Cammillo Talei; Riva, Luca; Casiraghi, Alessandra; Sironi, Sandro

    2017-12-01

    Effective radiation dose in coronary CT angiography (CTCA) for coronary artery bypass graft (CABG) evaluation is remarkably high because of long scan lengths. Prospective electrocardiographic gating with iterative reconstruction can reduce effective radiation dose. To evaluate the diagnostic performance of low-kV CT angiography protocol with prospective ecg-gating technique and iterative reconstruction (IR) algorithm in follow-up of CABG patients compared with standard retrospective protocol. Seventy-four non-obese patients with known coronary disease treated with artery bypass grafting were prospectively enrolled. All the patients underwent 256 MDCT (Brilliance iCT, Philips) CTCA using low-dose protocol (100 kV; 800 mAs; rotation time: 0.275 s) combined with prospective ECG-triggering acquisition and fourth-generation IR technique (iDose 4 ; Philips); all the lengths of the bypass graft were included in the evaluation. A control group of 42 similar patients was evaluated with a standard retrospective ECG-gated CTCA (100 kV; 800 mAs).On both CT examinations, ROIs were placed to calculate standard deviation of pixel values and intra-vessel density. Diagnostic quality was also evaluated using a 4-point quality scale. Despite the statistically significant reduction of radiation dose evaluated with DLP (study group mean DLP: 274 mGy cm; control group mean DLP: 1224 mGy cm; P value development of high-speed MDCT scans combined with modern IR allows an accurate evaluation of CABG with prospective ECG-gating protocols in a single breath hold, obtaining a significant reduction in radiation dose.

  5. Setting research priorities for maternal, newborn, child health and nutrition in India by engaging experts from 256 indigenous institutions contributing over 4000 research ideas: a CHNRI exercise by ICMR and INCLEN.

    Science.gov (United States)

    Arora, Narendra K; Mohapatra, Archisman; Gopalan, Hema S; Wazny, Kerri; Thavaraj, Vasantha; Rasaily, Reeta; Das, Manoj K; Maheshwari, Meenu; Bahl, Rajiv; Qazi, Shamim A; Black, Robert E; Rudan, Igor

    2017-06-01

    Health research in low- and middle- income countries (LMICs) is often driven by donor priorities rather than by the needs of the countries where the research takes place. This lack of alignment of donor's priorities with local research need may be one of the reasons why countries fail to achieve set goals for population health and nutrition. India has a high burden of morbidity and mortality in women, children and infants. In order to look forward toward the Sustainable Development Goals, the Indian Council of Medical Research (ICMR) and the INCLEN Trust International (INCLEN) employed the Child Health and Nutrition Research Initiative's (CHNRI) research priority setting method for maternal, neonatal, child health and nutrition with the timeline of 2016-2025. The exercise was the largest to-date use of the CHNRI methodology, both in terms of participants and ideas generated and also expanded on the methodology. CHNRI is a crowdsourcing-based exercise that involves using the collective intelligence of a group of stakeholders, usually researchers, to generate and score research options against a set of criteria. This paper reports on a large umbrella CHNRI that was divided into four theme-specific CHNRIs (maternal, newborn, child health and nutrition). A National Steering Group oversaw the exercise and four theme-specific Research Sub-Committees technically supported finalizing the scoring criteria and refinement of research ideas for the respective thematic areas. The exercise engaged participants from 256 institutions across India - 4003 research ideas were generated from 498 experts which were consolidated into 373 research options (maternal health: 122; newborn health: 56; child health: 101; nutrition: 94); 893 experts scored these against five criteria (answerability, relevance, equity, innovation and out-of-box thinking, investment on research). Relative weights to the criteria were assigned by 79 members from the Larger Reference Group. Given India's diversity

  6. 17 CFR 256.304 - Land and land rights.

    Science.gov (United States)

    2010-04-01

    ... included in the general tax levy, the amount thereof shall be charged to the appropriate tax account. (c... reference, purpose for which used, city, county and tax district in which situated, from whom purchased or... deed, and book and page number of record. (d) If at the time of acquisition of an interest in land such...

  7. 28 CFR 25.6 - Accessing records in the system.

    Science.gov (United States)

    2010-07-01

    ... through the FBI NICS Operations Center. FFLs may contact the NICS Operations Center by use of a toll-free telephone number, only during its regular business hours. In addition to telephone access, toll-free...; (ii) Assign a NICS Transaction Number (NTN) to a valid inquiry and provide the NTN to the FFL; (iii...

  8. Short communication: The effect of ultrasound at 256 KHz on ...

    African Journals Online (AJOL)

    The effect of ultrasound on the growth of M. aeruginosa confirmed to contain gas vacuoles and on a laboratory culture with no gas vacuoles was investigated. Both cultures were treated continuously for 9 d with an ultrasonic flow device. To evaluate the influence of ultrasound during the treatment, the chlorophyll-a ...

  9. 28 CFR 2.56 - Disclosure of Parole Commission file.

    Science.gov (United States)

    2010-07-01

    ... his parole file processed. (1) Requests that are only for a copy of the tape recording of a hearing... (priority processing). A requester may limit the scope of the request to a tape recording only (or to a tape... for the tape recording and the examiner's summary of a hearing qualifies for priority processing. (2...

  10. 256 Preservation and Conservation of Yoruba Cultural Artifacts: The ...

    African Journals Online (AJOL)

    User

    2012-01-24

    Jan 24, 2012 ... The history of libraries in West. Africa and by implication in Nigeria is however, not as old, comprehensive and deep as that of China, India, North Africa, Asia Minor and among the ancient Greeks. One of the oldest manuscripts of West African origin is. Preservation and Conservation of Yoruba Cultural ...

  11. Dicty_cDB: SSE256 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available vtnsll elfdldkdgklsvnevktallvdyiieaetclkkfvdsifkadsnkdnkitwdearqffv tsgsneaqakvfans...lsvnevktallvdyiieaetclkkfvdsifkadsnkdnkitwdearqffv tsgsneaqakvfansmfedvdsdddkcitreelreyaieyyeiypte*lfp*k*SQF

  12. 40 CFR 98.256 - Data reporting requirements.

    Science.gov (United States)

    2010-07-01

    ... contributed by methane used in Equation Y-4 of this subpart and the basis for its value. (f) For catalytic cracking units, traditional fluid coking units, and catalytic reforming units, owners and operators shall... cracking unit, thermal catalytic cracking unit, traditional fluid coking unit, or catalytic reforming unit...

  13. 42 CFR 403.256 - Loss ratio supporting data.

    Science.gov (United States)

    2010-10-01

    .... (iv) Assumed increases in the Medicare deductible. (v) Impact of inflation on reimbursement per... policy in the coming year. (viii) Expected impact on morbidity by policy duration of— (A) The process...

  14. (256-IJBCS-Article-H Yédomonhan)

    African Journals Online (AJOL)

    RHUMSIKI

    Laboratoire de Botanique et d'Ecologie Végétale, Faculté des Sciences et Techniques, Université d'Abomey-Calavi, 01 BP 4521 Cotonou, Bénin. * Auteur correspondant, E-mail : h.yedo@yahoo.fr ; Tél. ... Ainsi, une conscience collective sur l'apiculture moderne est apparue grâce à l'amélioration du revenu monétaire des ...

  15. 40 CFR 408.256 - Pretreatment standards for new sources.

    Science.gov (United States)

    2010-07-01

    ...: Pollutant or pollutant property Pretreatment standard BOD5 No limitation. TSS Do. pH Do. Oil and grease Do... subject to this subpart that introduces process wastewater pollutants into a publicly owned treatment...

  16. 40 CFR 421.256 - Pretreatment standards for new sources.

    Science.gov (United States)

    2010-07-01

    ... pounds) of mercury condensed Lead 1.162 0.540 Mercury 0.623 0.249 Silver 1.204 0.498 Zinc 4.233 1,743... pounds) of mercury condensed Lead 3.864 1.794 Mercury 2.070 0.828 Silver 4.002 1.656 Zinc 14.080 5.656... GUIDELINES AND STANDARDS NONFERROUS METALS MANUFACTURING POINT SOURCE CATEGORY Primary Precious Metals and...

  17. Testing 144- and 256-crystal BGO block detectors

    International Nuclear Information System (INIS)

    Rogers, J.G.; Nutt, R.; Andreaco, M.; Williams, C.W.

    1994-01-01

    New block detectors have been fabricated incorporating large numbers of small crystals. The authors evaluate and compare the performance of the new detectors with a standard 64-crystal block detector from Siemens-CTI. The new detectors demonstrate greatly improved imaging capability for 511 keV gamma rays. Future PET tomographs incorporating such detectors should produce substantially better volume images with little increase in tomograph manufacturing costs. The detectors will require a new type of automatic calibration procedure. Various such procedures have been tested and are discussed. A technique using higher energy gamma rays has shown special promise

  18. All projects related to | Page 256 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    2017-08-23

    How low- and middle-income countries support public science has a direct bearing on researchers' ability to generate knowledge, and affects how organizations adapt or apply such knowledge. End Date: August 23, 2017. Topic: INNOVATIONS, RESEARCH NETWORKS, Capacity building, PARTNERSHIP, INFORMATION ...

  19. 17 CFR 256.152 - Fuel stock expenses undistributed.

    Science.gov (United States)

    2010-04-01

    ... (CONTINUED) UNIFORM SYSTEM OF ACCOUNTS FOR MUTUAL SERVICE COMPANIES AND SUBSIDIARY SERVICE COMPANIES, PUBLIC... undistributed. The service company shall utilize this account, where appropriate, to include the cost of service... its interpretation, the logistics and handling of fuel, and other related support functions, as a...

  20. Slovak Republic Act of 1 April 1998 on the peaceful use of nuclear energy and on alterations and amendments to Act No. 174/1968 Zb. on State supervision of work safety as amended by Act of the National Council of the Slovak Republic No. 256/1994 Z.z

    International Nuclear Information System (INIS)

    1998-01-01

    provision; P40: List of executive regulations that shall remain in force. Part II. Amends and supplements in Act No. 256/1994 Coll.Acts. Part III. This act has been entered into effect on 1. July 1998

  1. Sud du Sahara | Page 256 | CRDI - Centre de recherches pour le ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    ... Democratic Republic of Congo : Feasibility Study and Advocacy. Langue English. Read more about Citoyens du monde : les répercussions des programmes de travail rémunéré et de travail bénévole à l'étranger. Langue French. Read more about Creating Global Citizens : Impact of Volunteer and Work Abroad Programs.

  2. Experimental Study of Nonlinear Phase Noise and its Impact on WDM Systems with DP-256QAM

    DEFF Research Database (Denmark)

    Yankov, Metodi Plamenov; Da Ros, Francesco; Porto da Silva, Edson

    2016-01-01

    A probabilistic method for mitigating the phase noise component of the non-linear interference in WDM systems with Raman amplification is experimentally demonstrated. The achieved gains increase with distance and are comparable to the gains of single-channel digital back-propagation....

  3. 40 CFR 256.31 - Recommendations for developing and implementing resource conservation and recovery programs.

    Science.gov (United States)

    2010-07-01

    ..., training, information development and dissemination, financial support programs, market studies and market... pertinent to contracting for resource recovery services or facilities. (2) Reporting of all laws and... transportation requirements, materials and energy specifications of user industries, minimum quantity...

  4. 32 CFR 256.8 - Land use compatibility guidelines for accident potential.

    Science.gov (United States)

    2010-07-01

    ... hotels ......do ......do Do. Mobile home parks or courts ......do ......do Do. Other residential ......do... further runway safety clearance limitations pertaining to the clear zone see AFM 86-6 TM 5-803-4 and...

  5. Investigation on steam oxidation behaviour of TP347H FG Part I Exposure at 256 bar

    DEFF Research Database (Denmark)

    Jianmin, J; Montgomery, Melanie; Larsen, OH

    2005-01-01

    with the aforementioned steel in coal-fired boilers and this paper focuses on the steam oxidation behaviour for specimens tested at various metal temperatures for exposure times of 7700, 23000 and 30000 hours as investigated by light optical and scanning electron microscopy. The oxide present on the specimens is a duplex...... oxide, where the outer layer consists of two sub-layers, an iron oxide layer and an iron-nickel oxide layer; the inner layer is chromium rich chromium-iron-nickel oxide. Microstructure examination showed that for all these samples the varying grain size of subsurface metal affected the oxide thickness......, but the subsequent growth of oxide from further exposure is slower due to the formation of a healing layer consisting of chromium rich oxide near original alloy grain boundaries. At a temperature region above 600C a thin oxide rich in chromium and manganese is formed. In addition precipitation of secondary carbides...

  6. Constellation Shaping for WDM systems using 256QAM/1024QAM with Probabilistic Optimization

    DEFF Research Database (Denmark)

    Yankov, Metodi Plamenov; Da Ros, Francesco; Porto da Silva, Edson

    2016-01-01

    In this paper, probabilistic shaping is numerically and experimentallyinvestigated for increasing the transmission reach of wavelength divisionmultiplexed (WDM) optical communication system employing quadrature amplitudemodulation (QAM). An optimized probability mass function (PMF) of the QAMsymb...

  7. PS2-56: Building the Virtual Data Warehouse Using Data from a Healthcare Billing System

    Science.gov (United States)

    Krajenta, Rick; Lamerato, Lois; Wells, Karen

    2012-01-01

    Background Healthcare utilization data, specifically diagnoses and procedures, can be processed through different administrative systems. Billing data are generated by the care provider while claims data are generated by the payer. These two sources can represent the data content differently and incorporating the data from these systems into the VDW has presented a unique set of challenges. We present options for reconciling these two data sources to create a VDW that includes all patients including those outside of the HMO member realm. Methods Henry Ford Health System (HFHS) captures patients, care providers, procedures, diagnoses and medical supply information through a proprietary system. Outpatient billing information is entered by clinic staff using an optical scanning device and clinic-specific forms. Other additional procedures and/or supplies are entered into the system using a transaction capture application. Ancillary services such as imaging and pathology are imported into the billing system from their proprietary information systems. The main function of this system is to generate bills for services performed. The data elements are standardized to contain required justification for reimbursement from all payer types. Standard codes sets, ICD9, HCPCS and CPT4, are required. The data can also be used to evaluate workload and staffing levels, project future needs and characterize trends in service demands. HFHS uses this data source to build VDW files. Results Major differences between claims and billing data exist. Claims data are based on health plan contract with bundled procedures, coverage exclusions and deductibles affecting content. Billing data are based solely on services provided. The potential for overwhelming amounts of data in billing sources is possible due to the level of detail; however, this same level of detail is a rich source for specific care components that would not otherwise be present in claims records. Conclusion Billing data are less likely to be compromised by contract restrictions, bundling of different procedures under one code or rejected payments. It is often more granular than claims-based data. Billing data is a reliable source for the VDW utilization data area because it is a more accurate representation of the delivery of health care.

  8. The effect of ultrasound at 256 KHz on Microcystis aeruginosa, with ...

    African Journals Online (AJOL)

    2012-10-31

    Oct 31, 2012 ... for 5 min inhibits the growth of the cyanobacterium Spirulina platensis for 3 d, while a sonication with 20 kHz showed no constant effect (Hao et al., 2004). Several mechanisms were discovered by which ultrasonic treatment affects the cells, of which the collapsing of gas vacu- oles during cavitation was ...

  9. The development of a radioimmunological assay for parathormone formed from the hypercalcemic Walker carcinosarcoma 256

    International Nuclear Information System (INIS)

    Weise, D.

    1981-01-01

    Specific antibodies to Walker Carcinosomal tissue could be produced by immunizing goats with a hypercalcemically active extract of this tumor tissue. These served the stablishment of a radioimmunoassay. The tracer used was 125-iodine labelled borine parathormone. Various parathormone standards were measured in this system. Here it was found that with this new system a specific assay had been developed which measures immunoreactive parathormone. Preliminary serum analyses indicated that endogenous human parathormone is also detected by this new radioimmunoassay. On the basis of comparative measurements with the old antibody directed towards human extractive parathormone and the new antibody for tumor parathormone only limited conclusions are possible. It could, however, be shown that the new antibody is an anti-parathormone-antibody. (orig./MG) [de

  10. 17 CFR 256.01-2 - Application to service companies doing business with nonassociate companies.

    Science.gov (United States)

    2010-04-01

    ... services or construction for associate companies at cost, it contemplates situations in which the service... deemed beneficial to the associate companies may be charged to associate companies subject to.... In computing charges to associate companies for any fiscal year, any net credit in this account must...

  11. 256 An International Multi-Disciplinary Journal, Ethiopia Vol. 4 (1 ...

    African Journals Online (AJOL)

    FIRST LADY

    instance, whereas pricing and regulation are the main areas of focus of economics, transport systems analysis .... because of the fact that psychological effects include frustration, anger and aggressive action detrimental to ..... A framework for risk assessment and decision-making strategies in dangerous good transportation.

  12. Status of Radiotherapy around the World: Radiotherapy in China. Chapter 25.6

    International Nuclear Information System (INIS)

    Zhu, Ci; Yin, Wei Bo; Chen, Bo; Zhang, Chun Li; Zhang, Hong Zhi; Li, Ye Xiong

    2017-01-01

    China’s experience of using radiotherapy to treat cancer began with the installation of the first superficial X ray machine at Peking Union Medical College Hospital in early 1920, followed by the first 200 kV deep X ray machine installed at the French Hospital in Shanghai in 1923, and the first Chinese radiotherapy department established at the Affiliated Hospital of Peking University in 1932. However, the field of radiotherapy in China was still in its infancy between the 1930s and 1960s, as all operating machines were imported from foreign countries, making radiotherapy very difficult to access for cancer patients. Progress was slow until the mid-1970s, when the first batch of megavoltage machines (cobalt-60 machines and linacs) was produced by Chinese manufacturers. Owing to the efforts of radiotherapy pioneers such as Wu Huanxing, Gu Xianzhi, Liu Taifu, and Yin Weibo, who brought radiotherapy to China and shaped how Chinese patients would be treated today, radiotherapy was installed as one of the mainstream modalities of cancer treatment. In 1986, the China Society for Radiation Oncology (CSTRO) was founded, indicating that a network advancing radiation oncology practice in China was taking shape. One year later, the first issue of the Chinese Journal of Radiation Oncology was published, offering a platform for the timely exchange and sharing of laboratory and clinical research outcomes among radiation oncology professions across the country. During the past two decades, with the introduction of the gamma knife and stereotactic radiotherapy, 3-D conformal radiotherapy, IMRT, IGRT and other advanced techniques, China experienced not only a big jump in its radiotherapy equipment and facilities, but also a dramatic growth in the excellence of radiation oncology specialist staff nationwide

  13. 32 CFR 256.5 - The air installation compatible use program.

    Science.gov (United States)

    2010-07-01

    ... due to noise characteristics and safety of flight; (2) Identification of present incompatible land...) Indication of types of desirable development for various land tracts; (5) Land value estimates for the zones... planning, acquisition and siting of noise generating items, such as engine test stands, full advantage is...

  14. Comparison Between Simulated and Experimental Results for a Balanced-Breech M256 Cannon System

    National Research Council Canada - National Science Library

    Wilkerson, Stephen

    2000-01-01

    Numerical simulations indicate that a mass-balanced system, with realistic tolerances and boundary conditions, would drastically reduce the motion of the gun tube during the projectile in-bore cycle...

  15. 24 CFR 25.6 - Violations creating grounds for administrative action.

    Science.gov (United States)

    2010-04-01

    ... or transactions to any person, including but not limited to an attorney, escrow agent, title company, consultant, mortgage broker, seller, builder or real estate agent, if that person has received any other... prohibitions of the Real Estate Settlement Procedures Act (12 U.S.C. 2601-2617); (s) Without regard to the date...

  16. : tous les projets | Page 256 | CRDI - Centre de recherches pour le ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Sujet: HEALTH SERVICES, HEALTH SYSTEM, OPERATIONS RESEARCH, INFORMATION MANAGEMENT, INFORMATION SYSTEMS. Région: Burkina Faso, Guinea-Bissau, Liberia, Mali, Sierra Leone, North of Sahara, South of Sahara. Programme: Santé des mères et des enfants. Financement total : CA$ 750,000.00.

  17. 25 CFR 256.13 - How do I apply for the Housing Improvement Program?

    Science.gov (United States)

    2010-04-01

    ... of your annual trust income statement from your Individual Indian Money (IIM) account, for royalty... membership card. (e) Fifth, you must provide proof of income from all permanent members of your household. (1..., including W-2's and all other attachments. (2) You must provide proof of all other income from all permanent...

  18. A 256 channel 8-Bit current digitizer ASIC for the Belle-II PXD

    Science.gov (United States)

    Knopf, J.; Fischer, P.; Kreidl, C.; Peric, I.

    2011-01-01

    The international DEPFET collaboration is developing a silicon pixel vertex detector (PXD), based on monolithic arrays of DEPFET transistors, for the future physics experiment Belle-II at the SuperKEKB particle accelerator in Japan. The matrix elements are read out in a 'rolling shutter mode', i.e. rows are selected consecutively and all columns are read out in each cycle of bond pads is used, allowing for flipping the chip onto the final all-silicon DEPFET sensor module. Several tests have been performed in order to prove the chip's operation and its quality in terms of noise. The results are presented.

  19. 30 CFR 256.57 - Using a third-party guarantee instead of a bond.

    Science.gov (United States)

    2010-07-01

    ... and your guarantor's other guarantees; and (iv) Your guarantor's unencumbered fixed assets in the... guarantor's ratio of current assets to current liabilities, taking into account liabilities under its... generally accepted accounting principles and contain no adverse opinion. (ii) Financial statements for...

  20. Performance of an Uncooled Camera Utilizing an SWIR InGaAs 256x256 FPA for Imaging in the 1.0 micrometer - 1.7 micrometer Spectral Band

    National Research Council Canada - National Science Library

    Barton, J

    1998-01-01

    .... The camera spectral sensitivity is established by the material properties of the detector array which is composed of photovoltaic detectors formed in an epitaxial layer of InGaAs with a composition...

  1. SU-F-T-256: 4D IMRT Planning Using An Early Prototype GPU-Enabled Eclipse Workstation

    International Nuclear Information System (INIS)

    Hagan, A; Modiri, A; Sawant, A; Svatos, M

    2016-01-01

    Purpose: True 4D IMRT planning, based on simultaneous spatiotemporal optimization has been shown to significantly improve plan quality in lung radiotherapy. However, the high computational complexity associated with such planning represents a significant barrier to widespread clinical deployment. We introduce an early prototype GPU-enabled Eclipse workstation for inverse planning. To our knowledge, this is the first GPUintegrated Eclipse system demonstrating the potential for clinical translation of GPU computing on a major commercially-available TPS. Methods: The prototype system comprised of four NVIDIA Tesla K80 GPUs, with a maximum processing capability of 8.5 Tflops per K80 card. The system architecture consisted of three key modules: (i) a GPU-based inverse planning module using a highly-parallelizable, swarm intelligence-based global optimization algorithm, (ii) a GPU-based open-source b-spline deformable image registration module, Elastix, and (iii) a CUDA-based data management module. For evaluation, aperture fluence weights in an IMRT plan were optimized over 9 beams,166 apertures and 10 respiratory phases (14940 variables) for a lung cancer case (GTV = 95 cc, right lower lobe, 15 mm cranio-caudal motion). Sensitivity of the planning time and memory expense to parameter variations was quantified. Results: GPU-based inverse planning was significantly accelerated compared to its CPU counterpart (36 vs 488 min, for 10 phases, 10 search agents and 10 iterations). The optimized IMRT plan significantly improved OAR sparing compared to the original internal target volume (ITV)-based clinical plan, while maintaining prescribed tumor coverage. The dose-sparing improvements were: Esophagus Dmax 50%, Heart Dmax 42% and Spinal cord Dmax 25%. Conclusion: Our early prototype system demonstrates that through massive parallelization, computationally intense tasks such as 4D treatment planning can be accomplished in clinically feasible timeframes. With further optimization, such systems are expected to enable the eventual clinical translation of higher-dimensional and complex treatment planning strategies to significantly improve plan quality. This work was partially supported through research funding from National Institutes of Health (R01CA169102) and Varian Medical Systems, Palo Alto, CA, USA.

  2. An Analysis of Children's Avoidance of Distraction within a Framework of Attention Processes. Technical Report No. 256.

    Science.gov (United States)

    Humphrey, Mary M.; Kleiman, Glenn M.

    A conceptual framework of attention can be organized around three functions of attention: determining how much capacity is to be deployed (attention allocation), for how long (attention maintenance), and to which potential information sources (attention direction). Within this framework, several critical distinctions can be made between processes…

  3. Stability of UOP IONSIV/256 IE-911 in SRS simulated salt solution at elevated temperature and subjected to radiation exposure

    International Nuclear Information System (INIS)

    Wilmarth, W.R.

    1999-01-01

    Use of Crystalline Silicotitanate (CST) to remove cesium represents one of the alternatives identified for High Level Waste pretreatment at the Savannah River Site. This report contains a description of the pluggage of the IONSIV(R) IE-911 column prior to a test with actual waste samples

  4. Dermatophytes and transmission risks to family: a retrospective study of a cohort of 256 adopted children from 1998 to 2012.

    Science.gov (United States)

    Dupont, Damien; Peyron, François; Picot, Stéphane; Wallon, Martine; Bienvenu, Anne-Lise

    2015-01-01

    In this 14-year retrospective study we analyzed samples collected from 101 adopted children originating from developing countries in search of dermatophytosis; a dermatophyte was isolated in 44 children. We demonstrated that dermatophytoses often have a silent clinical presentation (16%) and in approximately 20% of cases cause family member contamination. This study highlights the importance of the clinical examination of children and families as well as systematic sampling of children to avoid dermatophyte transmission to other family members. © 2014 Wiley Periodicals, Inc.

  5. SU-F-T-256: 4D IMRT Planning Using An Early Prototype GPU-Enabled Eclipse Workstation

    Energy Technology Data Exchange (ETDEWEB)

    Hagan, A; Modiri, A; Sawant, A [University of Maryland in Baltimore, Baltimore, MD (United States); Svatos, M [Varian Medical Systems, Palo Alto, CA (United States)

    2016-06-15

    Purpose: True 4D IMRT planning, based on simultaneous spatiotemporal optimization has been shown to significantly improve plan quality in lung radiotherapy. However, the high computational complexity associated with such planning represents a significant barrier to widespread clinical deployment. We introduce an early prototype GPU-enabled Eclipse workstation for inverse planning. To our knowledge, this is the first GPUintegrated Eclipse system demonstrating the potential for clinical translation of GPU computing on a major commercially-available TPS. Methods: The prototype system comprised of four NVIDIA Tesla K80 GPUs, with a maximum processing capability of 8.5 Tflops per K80 card. The system architecture consisted of three key modules: (i) a GPU-based inverse planning module using a highly-parallelizable, swarm intelligence-based global optimization algorithm, (ii) a GPU-based open-source b-spline deformable image registration module, Elastix, and (iii) a CUDA-based data management module. For evaluation, aperture fluence weights in an IMRT plan were optimized over 9 beams,166 apertures and 10 respiratory phases (14940 variables) for a lung cancer case (GTV = 95 cc, right lower lobe, 15 mm cranio-caudal motion). Sensitivity of the planning time and memory expense to parameter variations was quantified. Results: GPU-based inverse planning was significantly accelerated compared to its CPU counterpart (36 vs 488 min, for 10 phases, 10 search agents and 10 iterations). The optimized IMRT plan significantly improved OAR sparing compared to the original internal target volume (ITV)-based clinical plan, while maintaining prescribed tumor coverage. The dose-sparing improvements were: Esophagus Dmax 50%, Heart Dmax 42% and Spinal cord Dmax 25%. Conclusion: Our early prototype system demonstrates that through massive parallelization, computationally intense tasks such as 4D treatment planning can be accomplished in clinically feasible timeframes. With further optimization, such systems are expected to enable the eventual clinical translation of higher-dimensional and complex treatment planning strategies to significantly improve plan quality. This work was partially supported through research funding from National Institutes of Health (R01CA169102) and Varian Medical Systems, Palo Alto, CA, USA.

  6. Federal Student Loans: Better Oversight Could Improve Defaulted Loan Rehabilitation. Report to Congressional Requesters. GAO-14-256

    Science.gov (United States)

    Emrey-Arras, Melissa

    2014-01-01

    The Department of Education (Education) relies on collection agencies to assist borrowers in rehabilitating defaulted student loans, which allows borrowers who make nine on-time monthly payments within 10 months to have the default removed from their credit reports. Education works with 22 collection agencies to locate borrowers and explain…

  7. 256-Slice coronary computed tomographic angiography in patients with atrial fibrillation: optimal reconstruction phase and image quality

    Energy Technology Data Exchange (ETDEWEB)

    Oda, Seitaro; Yuki, Hideaki; Kidoh, Masafumi; Utsunomiya, Daisuke; Nakaura, Takeshi; Namimoto, Tomohiro; Yamashita, Yasuyuki [Kumamoto University, Department of Diagnostic Radiology, Faculty of Life Sciences, Chuou-ku, Kumamoto (Japan); Honda, Keiichi; Yoshimura, Akira; Katahira, Kazuhiro [Kumamoto Chuo Hospital, Department of Diagnostic Radiology, Minami-ku, Kumamoto (Japan); Noda, Katsuo; Oshima, Shuichi [Kumamoto Chuo Hospital, Department of Cardiology, Minami-ku, Kumamoto (Japan)

    2016-01-15

    To assess the optimal reconstruction phase and the image quality of coronary computed tomographic angiography (CCTA) in patients with atrial fibrillation (AF). We performed CCTA in 60 patients with AF and 60 controls with sinus rhythm. The images were reconstructed in multiple phases in all parts of the cardiac cycle, and the optimal reconstruction phase with the fewest motion artefacts was identified. The coronary artery segments were visually evaluated to investigate their assessability. In 46 (76.7 %) patients, the optimal reconstruction phase was end-diastole, whereas in 6 (10.0 %) patients it was end-systole or mid-diastole, and in 2 (3.3 %) patients it was another cardiac phase. In 53 (88.3 %) of the controls, the optimal reconstruction phase was mid-diastole, whereas it was end-systole in 4 (6.7 %), and in 3 (5.0 %) it was another cardiac phase. There was a significant difference between patients with AF and the controls in the optimal phase (p < 0.01) but not in the visual image quality score (p = 0.06). The optimal reconstruction phase in most patients with AF was the end-diastolic phase. The end-systolic phase tended to be optimal in AF patients with higher average heart rates. (orig.)

  8. 31 CFR 256.1 - What is Treasury's role in paying awards and settlements from the Judgment Fund?

    Science.gov (United States)

    2010-07-01

    ... agreements negotiated by the U.S. Department of Justice in settlement of claims arising under actual or... Fund awards only if there is an express statutory provision, contractual agreement or constitutional...

  9. 24 CFR 221.256 - Interest rate increase and payment of mortgage insurance premiums on mortgages under § 221.60 and...

    Science.gov (United States)

    2010-04-01

    ... 24 Housing and Urban Development 2 2010-04-01 2010-04-01 false Interest rate increase and payment... Interest rate increase and payment of mortgage insurance premiums on mortgages under § 221.60 and § 221.65... continuation of a below market interest rate, interest on such mortgage shall be computed by the mortgagee at...

  10. Efraín Kristal. Temptation of the Word. The Novels of Mario Vargas Llosa. Nashville: Vanderbilt University Press, 1998. 256 pp

    Directory of Open Access Journals (Sweden)

    Cecilia Esparza

    2013-09-01

    Full Text Available El estudio de Efraín Kiistal sobre las novelas de Mario VargasLlosa se centra en el análisis del proceso creativo del autor, en losdiálogos que entabla con otros trabajos literarios y en la transformaciónde la experiencia vital en sus textos ficcionales.

  11. SU-E-T-256: Radiation Dose Responses for Chemoradiation Therapy of Pancreatic Cancer: An Analysis of Compiled Clinical Data Using Biophysical Models.

    Science.gov (United States)

    Moraru, I; Tai, A; Erickson, B; Li, X

    2012-06-01

    We have analyzed recent clinical data obtained from chemoradiation of unresectable, locally advanced pancreatic cancer in order to examine possible benefits from radiotherapy (RT) dose escalation as well as to propose possible dose escalated fractionation schemes. A modified linear quadratic (LQ) model was used to fit clinical tumor response data from chemoradiation treatments using different fractionations. Biophysical radiosensitivy parameters, a and α/β, tumor potential doubling time, Td, and delay time for tumor doubling during treatment, Tk, were extracted from the fits and were used to calculate feasible fractionation schemes for dose escalations. Examination of published data from 20 institutions showed no clear indication of improved survival with raised radiation dose. However, an enhancement in tumor response was observed for higher irradiation doses, an important and promising clinical Result with respect to palliation and quality of life. The radiobiological parameter estimates obtained from the analysis are: α/β = 10 ± 3 Gy, a = 0.010 ± 0.003 Gŷ-1, Td = 56 ± 5 days and Tk = 7 ± 2 days. Possible dose escalation schemes are proposed based on the calculation of the biologically equivalent dose (BED) required for a 50% tumor response rate. From the point of view of tumor response, escalation of the administered radiation dose leads to a potential clinical benefit, which when combined with normal tissue complication analyses may Result in improved treatments for certain patients with advanced pancreatic cancer. Based on this analysis, a dose escalation trial with 2.25 Gy/fraction up to 69.75 Gy is being initiated for unresectable pancreatic cancer at our institution. Partially supported by MCW Cancer Center Meinerz Foundation. © 2012 American Association of Physicists in Medicine.

  12. The oxidation of 2,5,6-three methyl-2,6-di ethyl di hydro pyranol-5(L X X X V III)

    International Nuclear Information System (INIS)

    Nikitin, V.I.

    1961-01-01

    In this chapter of book author as a result of oxidation of 2,5,6,6-tetra methyl-2-ethyl di hydro pyranol-5 evolved acetone, methyl ethyl ketone, formic acid, acetic acid, oxalic acid and α-oxi methyl ethyl acetic acids

  13. 25 CFR 256.14 - What are the steps that must be taken to process my application for the Housing Improvement Program?

    Science.gov (United States)

    2010-04-01

    ... Children): Points (Maximum = 5): 1 0 2 1 3 2 4 3 5 4 6 or more 5 1 FPG means Federal Poverty Guidelines. (c.... At the option of your servicing housing office and when extenuating circumstances exist, your... must provide written confirmation that the information in your application is still accurate and that...

  14. Crystal structure of hexaaquanickel(II bis{2-[(5,6-dihydroxy-3-sulfonatoquinolin-1-ium-7-yloxy]acetate} dihydrate

    Directory of Open Access Journals (Sweden)

    Hai Le Thi Hong

    2015-09-01

    Full Text Available The asymmetric unit of the title compound, [Ni(H2O6](C11H8NO8S2·2H2O, features a half-hexaaquanickel(II complex cation with the NiII ion on an inversion center, one deprotonated 5,6-dihydroxy-3-sulfoquinolin-7-yloxyacetic acid (QOH molecule appearing in its zwitterionic form and one lattice water molecule. The sulfonate group is disordered over two positions with occupancy factors of 0.655 (5 and 0.345 (5. The hexaaquanickel(II cation interacts through hydrogen bonding with eight QOH molecules and two water molecules. The six-membered rings of quinoline show π–π stacking [centroid-to-centroid distances of 3.679 (2 Å and 3.714 (2 Å].

  15. Chemistry of the heaviest elements--one atom at a time

    International Nuclear Information System (INIS)

    Hoffman, Darleane C.; Lee, Diana M.

    2000-01-01

    In keeping with the goal of the Viewpoint series of the Journal of Chemical Education, this article gives a 75-year perspective of the chemistry of the heaviest elements, including a 50-year retrospective view of past developments, a summary of current research achievements and applications, and some predictions about exciting, new developments that might be envisioned within the next 25 years. A historical perspective of the importance of chemical separations in the discoveries of the transuranium elements from neptunium (Z=93) through mendelevium (Z=101) is given. The development of techniques for studying the chemical properties of mendelevium and still heavier elements on the basis of measuring the radioactive decay of a single atom (''atom-at-a-time'' chemistry) and combining the results of many separate experiments is reviewed. The influence of relativistic effects (expected to increase as Z 2 ) on chemical properties is discussed. The results from recent atom-at-a-time studies of the chemistry of the heaviest elements through seaborgium (Z=106) are summarized and show that their properties cannot be readily predicted based on simple extrapolation from the properties of their lighter homologues in the periodic table. The prospects for extending chemical studies to still heavier elements than seaborgium are considered and appear promising

  16. Adriana Astutti y Nora Domínguez (comps.), Promesas de tinta. Diez ensayos sobre Norah Lange : Rosario, Beatriz Viterbo, 2010, Ensayos Críticos, 256 páginas

    OpenAIRE

    Fernández, Nancy P.

    2011-01-01

    El libro que reúne diez ensayos dedicados a Norah Lange se inicia con el prólogo de Nora Domínguez, quien elige detenerse en la imagen de un cuadro, dibujado por la autora. A tono con los principios de la vanguardia histórica y el modelo europeo, Lange y su esposo, Oliverio Girondo, promueven un vínculo estrecho entre arte y vida tramando simultáneamente las escenas sociales de los brindis y homenajes, los géneros “literarios” de estas mismas puestas, la escritura y la experimentación visual,...

  17. SU-E-J-256: Predicting Metastasis-Free Survival of Rectal Cancer Patients Treated with Neoadjuvant Chemo-Radiotherapy by Data-Mining of CT Texture Features of Primary Lesions

    International Nuclear Information System (INIS)

    Zhong, H; Wang, J; Shen, L; Hu, W; Wan, J; Zhou, Z; Zhang, Z

    2015-01-01

    Purpose: The purpose of this study is to investigate the relationship between computed tomographic (CT) texture features of primary lesions and metastasis-free survival for rectal cancer patients; and to develop a datamining prediction model using texture features. Methods: A total of 220 rectal cancer patients treated with neoadjuvant chemo-radiotherapy (CRT) were enrolled in this study. All patients underwent CT scans before CRT. The primary lesions on the CT images were delineated by two experienced oncologists. The CT images were filtered by Laplacian of Gaussian (LoG) filters with different filter values (1.0–2.5: from fine to coarse). Both filtered and unfiltered images were analyzed using Gray-level Co-occurrence Matrix (GLCM) texture analysis with different directions (transversal, sagittal, and coronal). Totally, 270 texture features with different species, directions and filter values were extracted. Texture features were examined with Student’s t-test for selecting predictive features. Principal Component Analysis (PCA) was performed upon the selected features to reduce the feature collinearity. Artificial neural network (ANN) and logistic regression were applied to establish metastasis prediction models. Results: Forty-six of 220 patients developed metastasis with a follow-up time of more than 2 years. Sixtyseven texture features were significantly different in t-test (p<0.05) between patients with and without metastasis, and 12 of them were extremely significant (p<0.001). The Area-under-the-curve (AUC) of ANN was 0.72, and the concordance index (CI) of logistic regression was 0.71. The predictability of ANN was slightly better than logistic regression. Conclusion: CT texture features of primary lesions are related to metastasisfree survival of rectal cancer patients. Both ANN and logistic regression based models can be developed for prediction

  18. The discovery of 260Md and the decay properties of 258Fm, 258m,gMd and 259Md

    International Nuclear Information System (INIS)

    Lougheed, R.W.; Hulet, E.K.; Dougan, R.J.; Wild, J.F.; Dupzyk, R.J.; Henderson, C.M.; Moody, K.J.; Hahn, R.L.; Suemmerer, K.; Bethune, G.

    1986-01-01

    We have discovered a new neutron-rich isotope, 260 Md, from 18 O and 22 Ne bombardments of 254 Es. We observed a spontaneous-fission (SF) activity with a half-life of 32 days in electromagnetically separated fractions with mass number 260 from these bombardments and we measured the mass and kinetic energy distributions of this SF activity. The mass distribution was symmetric with the principal energy peak at a total kinetic energy (TKE) of 234 MeV, similar to previous observations for heavy fermium isotopes. Surprisingly, we also observed a smaller symmetric component with a TKE of 195 MeV. We interpret these two peaks in the TKE distribution as arising from two types of fission in the same nucleus, or bimodal fission. The observed fission activity may be either from the SF decay of 260 Md or from 260 Fm which would arise from electron-capture (EC) decay of 260 Md. We have eliminated the possible β - decay of 260 Md by measuring β - -SF time correlations for the decay of 260 Md and we plan to determine whether 260 Md decays by EC by measuring time correlations between fermium X-rays and SF events. We also measured various properties of the heavy fermium and mendelevium isotopes and obtained 1. more accurate cross-sections for the neutron-rich mendelevium isotopes which we use to predict the production rates of yet undiscovered nuclides, 2. improved half-life measurements for 258m,g Md and 259 Md, 3. confirmation of the EC decay of 258m Md by measurement of the fermium X-rays preceding the SF decay of 258 Fm and 4. very substantially improved mass and TKE distributions for the SF decay of 258 Fm and 259 Md. (orig.)

  19. ORF Alignment: EHA1 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available uery: 256 GGKFVYSTCSLNPIEDEAVVAELLRTFGDSIELIDARPLLPTLKFSEGVSEWKVFDKHFT 315 ... ... ... GGKFVYSTCSLNPIEDEAVVAELLRTFGDSIELIDARPLLPTLKFSEGVSEWKVFDKHFT Sbjct: 241 GGKFVYSTCSLNPIEDEAVVAELLRTFGDSIELIDARPLLPTLKFSEGVSEWKVFDKHFT 300 ...

  20. ORF Alignment: NC_002696 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available 78 ... Query: 256 LVTTPQEIALIDARRAAAMFEKTATPILGLIENMAFFADPSTGAPIPIFGEGGGVAEAAR 315 ... LVTTPQEIALIDAR...RAAAMFEKTATPILGLIENMAFFADPSTGAPIPIFGEGGGVAEAAR Sbjct: 139 LVTTPQEIALIDARRAAAMFEKTATPILGLIENMAFFADPSTGAPIPIFGEGGGVAEAAR 198 ...

  1. Pablo Rodríguez Jiménez. Cartas de Amor en tiempos de guerra. Rafael Uribe Uribe. Selección de textos y prólogo. Bogotá: Editorial Universidad del Rosario, Escuela de Ciencias Humanas, 2014. 256 páginas

    Directory of Open Access Journals (Sweden)

    Eulalia Hernández Ciro

    2015-07-01

    Full Text Available Conversar por escrito es lo que hacía Rafael Uribe Uribe con su esposa, Sixta Tulia Gaviria, a través de las cartas, retratos, telegramas y cables que intercambiaron durante varios años y que hoy podemos leer de corrido, gracias al libro Cartas de amor en tiempos de guerra..., compilado por el historiador Pablo Rodríguez Jiménez y publicado en el 2014 por la Editorial de la Universidad del Rosario, que agrupa conversas que, además de su riqueza literaria, son valioso material para la comprensión de la historia de nuestro país, no solo porque muestran el lado sensible y cotidiano de la vida de un hombre que ocupa un lugar privilegiado en la historia de Colombia, sino porque dejan entrever los discursos, las representaciones y las prácticas de la clase dirigente del país. Acercarse a esta correspondencia posibilita conocer asuntos concernientes a los roles femeninos y masculinos, a la educación de los hijos, a las relaciones sociales y públicas, a la vida doméstica, es decir, tanto las ideas y los sentimientos, como la geografía y la cultura material de una época.

  2. Remodelación del enlace e implantación de estación de peaje en sistema cerrado en el enlace de Vila-seca / Salou. Autopista AP-7 : la Jonquera-Salou. P.K.. 256+900

    OpenAIRE

    Vera Gonzalez, Robert Anthony

    2010-01-01

    En cumplimiento del Real Decreto 457/2006, de 7 de abril que recoge el convenio entre la Administración General del Estado y Autopistas, Concesionaria Española, S.A.U. para la modificación de determinados términos de la concesión de las autopistas Barcelona-La Jonquera, Barcelona-Tarragona, Montmeló-El Papiol y Zaragoza-Mediterráneo, la empresa concesionaria ACESA tiene el propósito de establecer un sistema de peaje cerrado para el tramo Martorell-Vilaseca/Salou. Dicho tramo se integrará ...

  3. Optical simulations for the S3 project - Super separator spectrometer - gamma-electron coincidence spectroscopy of a transfermium nucleus: the 251Md101

    International Nuclear Information System (INIS)

    Dechery, Fabien

    2012-01-01

    In analogy with the atomic closed shells giving rise to the stability and high ionisation energies of noble gases, nuclear physics also has its magic numbers of protons and neutrons which enhance nuclear structure stability. Knowledge of the structure of doubly-magic nuclei, both proton and neutron numbers, is crucial to parameterize theoretical models. The discovery of the next and ultimate magic numbers will provide a strong constraint on the many predictions. These two numbers are like the centre coordinates of an area of enhanced stability of the nuclear chart, well known as 'island of stability'. These superheavy nuclei only exist due to pure quantum shell effects. My thesis work deals with two distinct, but complementary, aspects of fundamental physics with the common goal of studying these extreme mass nuclei structure. The first part corresponds to the development of a next generation instrument for nuclear physics to allow synthesis and spectroscopy studies of superheavy nuclei: the Super Separator Spectrometer S 3 . This project will be installed at SPIRAL2 (GANIL) and has been approved by the French Research National Agency (ANR) within the EQUIPEX framework. It has been designed to take advantage of the high intensity heavy ion beam from the LINAC, giving access to a wide range of physical programs. The second part corresponds to the preparation, realisation and analysis of an experiment on 251-Mendelevium in which the very first prompt gamma-electron coincidence spectroscopy was performed for a transfermium nuclei. (author) [fr

  4. Novel Single Photon Counting Readout Circuits and APD Arrays with Capability from UV to IR Project

    Data.gov (United States)

    National Aeronautics and Space Administration — The overall goal of the proposed Phase I SBIR project is to develop and demonstrate 256x256 segmented readout integrated circuits (ROICs) that can read, digitize and...

  5. Platform Machining Evaluation

    Science.gov (United States)

    2006-09-21

    Technology Division (MST) Redstone Arsenal, Alabama Scott A. Hofacker, PE – Program Manager 256.842.7992 scott.hofacker@us.army.mil or Mike Cummings ( Tiburon ) 256.313.6496 mike.a.cummings@us.army.mil

  6. Carbon Ion Therapy

    DEFF Research Database (Denmark)

    Bassler, Niels; Hansen, David Christoffer; Herrmann, Rochus

    size and PTV position. Methods: Several treatment plans are produced with TRiP, using a 256x256x256 mm3 water phantom and SOBP optimization on physical dose. Box formed PTV volumes between 0.15 - 1010 cm3, and PTV positions ranging from 3 cm to 200 cm depth (relative...

  7. DOD Product Support Business Case Analysis Guidebook

    Science.gov (United States)

    2011-04-01

    Cargo Aircraft; Mike Tesi , 256-313-3745 10 Automatic Requirements Computation System Initial Provisioning (ARCSIP) CECOM; Ken Steinberg, LEO...Block III 256-313- 4988 PM Aviation Systems, PD Joint Cargo Aircraft Mike Tesi , 256- 313-3745 16 Computerized Optimization Model for

  8. Web‐Based Portal for Impact Evaluation Reveals Information Needs for Museums, Libraries and Archives. A review of: Williams, Dorothy A., Caroline Wavell, Graeme Baxter, Alan MacLennan, and Debbie Jobson. “Implementing Impact Evaluation in Professional Practice: A Study of Support Needs Within the Museum, Archive and Library Sector.” International Journal of Information Management 25.6 (Dec. 2005: 533‐48.

    Directory of Open Access Journals (Sweden)

    David Hook

    2007-03-01

    Full Text Available Objective – This study reports on research into the information and support needs of practitioners in the museum, archive, and library sectors, who are undergoing an impact evaluation.Design – Qualitative survey.Setting – Web‐based questionnaire.Subjects – Twenty‐one practitioners in the fields of museums, archives, and libraries.Methods – The study made use of a small scale web portal that provides impact evaluation research findings, toolkits, and examples of methods. The portal’s intent was to present to the users multiple views of the available information in order to overcome the problem of users not being able to identify their needs. A purposive sample group consisting of 50 practitioners from the museum, library, and archive fields was invited to participate in a questionnaire evaluating the website.Main Results – Despite a fairly low response rate (49% and poor distribution among the three sectors (museums, libraries, and archives, the results indicated a significant difference in the levels of knowledge and understanding of impact evaluation. Over half of the organizations surveyed had done some assessment of their institution’s economic impact, and there appears to be a rising trend towards doing impact studies for specific projects and developments. Nearly a quarter of the organizations had not undertaken any impact evaluation study previously. Practitioners already familiar with impact evaluation tended to look at broader range of fields for expertise, whereas those with less familiarity remained within their own sector. Practitioners with less experience preferred tools, guidance, and examples of methodologies as opposed to actual evidence of impact. The results also provided the authors with feedback on their web portal and how to organize the information therein.Conclusions – One of the findings of the study was that the overall reaction to impact evaluation support through research evidence, guidance, and other mechanisms was positive. For most practitioners, evaluation itself and the level of understanding of impact evaluation are at early stages. The primary goals for those undertaking impact evaluation were found to be professional and organizational learning, thus there is a need for practical help and guidance in these areas. Time limitation appeared to be a significant factor in the responses – particularly with smaller organizations – suggesting that their portal material would provide much‐needed assistance to such organizations. Finally, it was concluded that future emphasis should be placed on developing practical applications rather than pure research.

  9. Application of alpha spectrometry to the discovery of new elements by heavy-ion-beam bombardment

    International Nuclear Information System (INIS)

    Nitschke, J.M.

    1983-05-01

    Starting with polonium in 1898, α-spectrometry has played a decisive role in the discovery of new, heavy elements. For even-even nuclei, α-spectra have proved simple to interpret and exhibit systematic trends that allow extrapolation to unknown isotopes. The early discovery of the natural α-decay series led to the very powerful method of genetically linking the decay of new elements to the well-established α-emission of daughter and granddaughter nuclei. This technique has been used for all recent discoveries of new elements including Z = 109. Up to mendelevium (Z = 101), thin samples suitable for α-spectrometry were prepared by chemical methods. With the advent of heavy-ion accelerators new sample preparation methods emerged. These were based on the large momentum transfer associated with heavy-ion reactions, which produced energetic target recoils that, when ejected from the target, could be thermalized in He gas. Subsequent electrical deposition or a He-jet technique yielded samples that were not only thin enough for α-spectroscopy, but also for α- and #betta#-recoil experiments. Many variations of these methods have been developed and are discussed. For the synthesis of element 106 an aerosol-based recoil transport technique was devised. In the most recent experiments, α-spectrometry has been coupled with the magnetic analysis of the recoils. The time from production to analysis of an isotope has thereby been reduced to 10 - 6 s; while it was 10 - 1 to 10 0 s for He-jets and 10 1 to 10 3 s for rapid chemical separations. Experiments are now in progress to synthesize super heavy elements (SHE) and to analyze them with these latest techniques. Again, α-spectrometry will play a major role since the expected signature for the decay of a SHE is a sequence of α-decays followed by spontaneous fission

  10. Observations concerning the use of rMuIFN-γ-activated macrophages by intra- and peritumoral perfusion combined with laser therapy in animals with carcinosarcoma

    Science.gov (United States)

    Dima, Vasile F.; Vasiliu, Virgil V.; Laky, Dezideriu; Dima, Stefan V.

    1998-07-01

    Experiments were performed on five batches of inbred rats with Walker-256 carcinosarcoma receiving sole treatment photodynamic therapy (PDT), rMuIFN--gamma activated macrophages (AMO) or associated therapy (PDT+ AMO - A; PDT+ AMO - B) and the control batch (saline) consisting of animals with untreated Walker-256 tumors. These experimental observations demonstrate that `combined' photodynamic therapy with immunotherapy stimulates cell-mediated antitumoral activity, increased survival rates and reduces incidence of Walker-256 carcinosarcoma in rats.

  11. Kuritegevusehirm, sotsiaalkontroll ja kommunitarism : kas kriminaalõiguse suund suuremale ühiskondlikkusele? / Jaan Sootak

    Index Scriptorium Estoniae

    Sootak, Jaan, 1948-

    2000-01-01

    Positiivsest üldpreventsioonist, ubikviteedipreventsioonist, nulltolerantsist ja kommunitaristlikust karistusteooriast. Ilmunud ka: Sootak, Jaan. Kuri karjas : [artiklite kogumik]. Tartu, 2009, lk. 225-256

  12. ORF Alignment: NC_006085 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available RMIEELRRREIPVRFLSNNPTKDPDQYVDKLTRLGLPT 60 ... Query: 133 TFDYRKLQIAFDAIWFHKRAFLIQTNPDRFCPFPGGRGEPDCAAVTAAIEACTG...QQCKVS 192 ... TFDYRKLQIAFDAIWFHKRAFLIQTNPDRFCPFPGGRGEPDCAAVTAAIEACTGQQCKV...S Sbjct: 121 TFDYRKLQIAFDAIWFHKRAFLIQTNPDRFCPFPGGRGEPDCAAVTAAIEACTGQQCKVS 180 ... Query: 253 DVEHRPTWTLDRIDRL 268 ... DVEHRPTWTLDRIDRL Sbjct: 241 DVEHRPTWTLDRIDRL 256

  13. ORF Alignment: NC_003296 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available olanacearum] ... Length = 256 ... Query: 52 ... RNVTDWDEFSGRLEAVERVEVRPLVGGTITAV...HFKDGSIVRKGDPLFTIDPRPYAAEVAR 111 ... RNVTDWDEFSGRLEAVERVEVRPLVGGTITAVHFKDGSIVRKGDPLFTIDPRPYAAEVAR Sbj...ct: 1 ... RNVTDWDEFSGRLEAVERVEVRPLVGGTITAVHFKDGSIVRKGDPLFTIDPRPYAAEVAR 60 ... Query: 172 XXXXXYTRIVAPVAGRVSRAEITV

  14. Anjas univers

    DEFF Research Database (Denmark)

    Pedersen, Christine Pepke

    2017-01-01

    Anmeldelse af Anja C. Andersen, “En lille bog om Universet”, 256 sider, 165 kr. Lindhardt og Ringhof 2016 (fx saxo.com)......Anmeldelse af Anja C. Andersen, “En lille bog om Universet”, 256 sider, 165 kr. Lindhardt og Ringhof 2016 (fx saxo.com)...

  15. Facultative Sterol Uptake in an Ergosterol-Deficient Clinical Isolate of Candida glabrata Harboring a Missense Mutation in ERG11 and Exhibiting Cross-Resistance to Azoles and Amphotericin B

    NARCIS (Netherlands)

    Hull, Claire M.; Parker, Josie E.; Bader, Oliver; Weig, Michael; Gross, Uwe; Warrilow, Andrew G. S.; Kelly, Diane E.; Kelly, Steven L.

    We identified a clinical isolate of Candida glabrata (CG156) exhibiting flocculent growth and cross-resistance to fluconazole (FLC), voriconazole (VRC), and amphotericin B (AMB), with MICs of >256, >256, and 32 mu g ml(-1), respectively. Sterol analysis using gas chromatography-mass spectrometry

  16. Does Family Structure Matter in the Relationships between Youth Assets and Youth Alcohol, Drug and Tobacco Use?

    Science.gov (United States)

    Oman, Roy F.; Vesely, Sara K.; Tolma, Eleni; Aspy, Cheryl B.; Rodine, Sharon; Marshall, LaDonna

    2007-01-01

    This study investigated significant relationships between youth assets and youth alcohol, tobacco, and drug use that differ according to family structure (one- or two-parent households). Data were collected from a randomly sampled inner-city population (n=1,256 teenagers and 1,256 parents of the teenagers) using in-home, in-person interviews.…

  17. Role of magnetic susceptibility weighted imaging in evaluation of ...

    African Journals Online (AJOL)

    Mohamed Masoud Radwan

    tumors, aging and multiple sclerosis'' (MS).1. 2. Methods. Thirty patients with known or suspected brain lesions were subjected to MRI examination using 1.5 T closed-configura- tion GE Signa HDxT and Avanto Siemens, according to the following parameters: T1: TR of 550 ms, a TE of 15 ms, a 256 × 256 acquisition matrix ...

  18. Pati, Prof. Arun Kumar

    Indian Academy of Sciences (India)

    Specialization: Quantum Information Theory, Quantum Computing, Foundations of Quantum Theory Address: QIC Group, Physics Division, Harish Chandra Research Institute, Chhatnag Road, Jhusi, Allahabad 211 019, U.P.. Contact: Office: (0532) 227 4391. Mobile: 87566 12314. Fax: (0532) 256 9576, (0532) 256 7444

  19. Building a castle on sand: effects of mass privatization on capital market creation in transition economies

    Czech Academy of Sciences Publication Activity Database

    Fungáčová, Zuzana

    -, č. 256 (2005), s. 1-51 ISSN 1211-3298 R&D Projects: GA ČR GA402/05/1014 Institutional research plan: CEZ:AV0Z70850503 Keywords : mass privatization * emerging capital markets Subject RIV: AH - Economics http://www.cerge-ei.cz/pdf/wp/Wp256.pdf

  20. Satellite backhaul

    Indian Academy of Sciences (India)

    ... require 25 kbps; Internet connectivity of about 100 - 200 kbps. appropriate caching and mirror server at hub; can provide Internet connections to about 50 villages. RT requires a 128 / 256 kbps dedicated connection. To serve multiple RTs, a shared download of 2 Mbps will help. uplink channels can be 128 / 256 kbps SCPC.

  1. Body dimensions and coloration of the winter pelage of a Moravian population of sika deer, Cervus nippon

    Czech Academy of Sciences Publication Activity Database

    Heroldová, Marta; Zejda, J.

    2002-01-01

    Roč. 51, č. 3 (2002), s. 253-256 ISSN 0139-7893 R&D Projects: GA AV ČR IBS6093003 Institutional research plan: CEZ:AV0Z6093917 Keywords : sika deer * body dimensions * coloration Subject RIV: EG - Zoology Impact factor: 0.234, year: 2002 http://www.ivb.cz/folia/51/3/253-256.pdf

  2. Das, Dr Amitava

    Indian Academy of Sciences (India)

    Date of birth: 24 December 1959. Specialization: Molecular Reactions, Supramolecular Chemistry, Assembly Photo-included Processes Address: Director, Central Salt & Marine Chemicals Research Institute, GB Marg, Bhavnagar 364 002, Gujarat Contact: Office: (0278) 256 9496. Residence: (0278) 256 2610. Mobile: ...

  3. An efficient similarity measure technique for medical image registration

    Indian Academy of Sciences (India)

    The similarity measures are tested on the matrix laboratory (MATLAB) plat- form of version 7.0.4. Table 4 shows the comparison of computational time required by various image registration methods. Figures 5a and c of the size 256 × 256 pixels are considered for the calculation of computational time of various similarity ...

  4. Converged delivery of WiMAX and wireline services over an extended reach passive optical access network

    DEFF Research Database (Denmark)

    Osadchiy, Alexey Vladimirovich; Prince, Kamau; Tafur Monroy, Idelfonso

    2010-01-01

    In this paper we present long-reach fiber access links supporting transmission of Worldwide Interoperability for Microwave Access (WiMAX) compliant signals. We present bi-directional full-duplex transmission of 256-state quadrature amplitude modulation (256-QAM) modulated WiMAX-compliant signals ...

  5. Pan-African phylogeny of Mus (subgenus Nannomys) reveals one of the most successful mammal radiations in Africa

    Czech Academy of Sciences Publication Activity Database

    Bryja, Josef; Mikula, Ondřej; Šumbera, R.; Meheretu, Y.; Aghová, Tatiana; Lavrenchenko, L. A.; Mazoch, Vladimír; Oguge, N.; Mbau, J. S.; Welegerima, K.; Amundala, N.; Colyn, M.; Leirs, H.; Verheyen, E.

    2014-01-01

    Roč. 14, č. 256 (2014), s. 256 ISSN 1471-2148 R&D Projects: GA ČR GAP506/10/0983 Institutional support: RVO:68081766 Keywords : Biogeography * Tropical Africa * Molecular phylogeny * Pygmy mice * Plio-Pleistocene climatic fluctuations * Divergence timing * Muridae (Murinae) * Mus minutoides * Phylogeography * DNA barcoding Subject RIV: EG - Zoology Impact factor: 3.368, year: 2014

  6. Alternate Fuels Combustion Research

    Science.gov (United States)

    1983-10-01

    1000 200ooOZ HP Figure 2.5: Projected Trends in Pressure Ratios -19 - Uncmrtainty Band of Upper Lkmit 15W o:.". 0 o 120006 se 0 s 1000 00 oo 5 06* o...relations are:.’ Inefficiency -0.0173 (T10) - 2.912 for thrust level tests Inefficiency 0 . 0235 (T10) - 6.401 for power level tests 6.4 HYED3DCARMO1...0.0252 273 273 NO .n23j 0.0280 256 256 13 .0231 0.0247 257 257 14 . 0235 0.0236 257 256 8 .0228 0.0222 257 256 10 .0231 0.0211 254 255 NO .0231 0.0189 256

  7. Život i djelo Dmitrija Ivanoviča Mendeljejeva - povodom 100. obljetnice smrti

    Directory of Open Access Journals (Sweden)

    Vaščić, V.

    2007-04-01

    Full Text Available The life and activities of D. I. Mendeleyev are presented primarily in view of his role in the progress of chemistry. Born in Tobolsk in 1834 to a numerous and poor family, burdened by the family's bad luck and his ill health, he graduated natural sciences in 1855 at St. Petersburg and was awarded a gold medal for exceptional success. In 1855/56 he was teacher at a secondary school in Odessa. He obtained his MSc degree in 1856 in St. Petersburg where he was appointed lecturer in 1857. He was guest scientist 1859-1861 at the University in Heidelberg where he investigated the behavior of gases under various pressures and temperatures and discovered the criticaltemperature of liquefaction. He achieved his PhD degree in 1865 in St. Petersburg with a thesis on ethanol/water mixtures. Therein he had proven the existence of alcohol hydrates. His work later enabled the elaboration of modern conceptions on solvate formation in solutions. In 1865 he was elected professor at the University in St. Petersburg where he worked until 1890 when he was forced to retire. Preparing his textbook "Fundamentals of Chemistry" in 1869, he discovered that properties of chemical elements depend periodically on atomic weights. This enabled the elaboration of a periodic system as the base for classification in chemistry, as well as for further research and development of chemical science and technology. The international scientific community accepted Mendeleyev's system with distrust and it was generally acknowledged not before three "prophecies" of Mendeleyev were realized by the discovery of gallium (1875, scandium (1879 and germanium (1886. Later, in verification of his predictions, other elements - including transuranics - were discovered. Hence, in honor of the creator of the periodic system, the element of atomic number 101 was named mendelevium (1955. Mendeleyev was reactivated in 1892 as director of the Central Bureau for Measures and Weights where he worked until

  8. Imaging of the central nervous system with combined half-Fourier and rectangular pixel technique

    International Nuclear Information System (INIS)

    Runge, V.M.; Wood, M.L.; Wolf, C.R.; Carollo, B.R.

    1988-01-01

    The diagnostic value of a combined half-Fourier and rectangular pixel technique for T2-weighted imaging of the central nervous system (CNS) was assessed with results obtained in 45 patients. This technique presents a new approach to T2 screening of the CNS. Imaging time is cut by a factor of approximately four, with no compromise in signal-to-noise ratio and spatial resolution equivalent to a 256X128 matrix. Gradient moment nulling is essential in order to minimize flow artifacts. Lesion detection is equivalent to a 256X256 matrix in the worst case, that is, for detection of small punctate abnormalities (multiple sclerosis plaques)

  9. High speed display algorithm for 3D medical images using Multi Layer Range Image

    International Nuclear Information System (INIS)

    Ban, Hideyuki; Suzuki, Ryuuichi

    1993-01-01

    We propose high speed algorithm that display 3D voxel images obtained from medical imaging systems such as MRI. This algorithm convert voxel image data to 6 Multi Layer Range Image (MLRI) data, which is an augmentation of the range image data. To avoid the calculation for invisible voxels, the algorithm selects at most 3 MLRI data from 6 in accordance with the view direction. The proposed algorithm displays 256 x 256 x 256 voxel data within 0.6 seconds using 22 MIPS Workstation without a special hardware such as Graphics Engine. Real-time display will be possible on 100 MIPS class Workstation by our algorithm. (author)

  10. Prenatal Tests for Down Syndrome

    Science.gov (United States)

    PRENATAL TESTS FOR DOWN SYNDROME S HARE W ITH W OMEN PRENATAL TESTS FOR DOWN SYNDROME What Is Down Syndrome? ... suggests that you consult your health care provider. PRENATAL TESTS FOR DOWN SYNDROME 256 Volume 50, No. ...

  11. African Journal for the Psychological Study of Social Issues - Vol 9 ...

    African Journals Online (AJOL)

    Product's promotion patterns and their effects on consumers' purchase intentions, brand loyalty and attitude · EMAIL FULL TEXT EMAIL FULL TEXT · DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. NA Shenge, 249-256 ...

  12. 75 FR 33815 - National Institute of Mental Health; Notice of Meeting

    Science.gov (United States)

    2010-06-15

    ... and when applicable, the business or professional affiliation of the interested person. All written... Internet connection; (D) Minimum of Pentium 400 with 256 MB of RAM (recommended); E) Java Virtual Machine...

  13. 75 FR 82034 - National Institute of Mental Health; Notice of Meeting

    Science.gov (United States)

    2010-12-29

    ... and, when applicable, the business or professional affiliation of the interested person. All written... connection; (D) Minimum of Pentium 400 with 256 MB of RAM (Recommended); ( E) Java Virtual Machine enabled...

  14. 75 FR 60131 - National Institute of Mental Health; Notice of Meeting

    Science.gov (United States)

    2010-09-29

    ..., the business or professional affiliation of the interested person. All written comments received by... connection; (D) Minimum of Pentium 400 with 256 MB of RAM (Recommended); (E) Java Virtual Machine enabled...

  15. 78 FR 2276 - National Institute of Mental Health; Notice of Meeting

    Science.gov (United States)

    2013-01-10

    ..., telephone number and when applicable, the business or professional affiliation of the interested person. All... Pentium 400 with 256 MB of RAM (Recommended); (E) Java Virtual Machine enabled (Recommended) NIH has...

  16. Hinke Piersma en Jeroen Kemperman, Openstaande rekeningen. De gemeente Amsterdam en de gevolgen van roof en rechtsherstel, 1940-1950.

    Directory of Open Access Journals (Sweden)

    Regina Grüter

    2017-05-01

    Full Text Available Hinke Piersma en Jeroen Kemperman, Openstaande rekeningen. De gemeente Amsterdam en de gevolgen van roof en rechtsherstel, 1940-1950 (Amsterdam: Boom, 2015, 256 pp., isbn 978 908 953 661 7.

  17. 2003 Reson 8101ER Multibeam Sonar Data from Cruise OES-03-07/AHI-03-07, Data Set Name Saipan.

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Reson 8101ER multibeam Data were collected between 21 August and 13 September 2003 (JD 233-256) aboard NOAA Survey Launch Acoustic Habitat Investigator (AHI) at...

  18. Studies on supramolecular gel formation using DOSY NMR

    Czech Academy of Sciences Publication Activity Database

    Nonappa, N.; Šaman, David; Kolehmainen, E.

    2015-01-01

    Roč. 53, č. 4 (2015), s. 256-260 ISSN 0749-1581 Institutional support: RVO:61388963 Keywords : DOSY * VT NMR * gel * diffusion coefficients Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 1.226, year: 2015

  19. NODC Standard Product: Climatic Atlas of the Barents Sea 1998: Temperature, Salinity, Oxygen (NODC Accession 0000300)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — This NODC CD-ROM product (NODC-121) contains the time and space distribution of 74,256 ocean stations (temperature, salinity, and oxygen) occupied in the Barents Sea...

  20. Hubungan Acute Kidney Injury dan Skor Pelod pada Pasien Penyakit Kritis

    Directory of Open Access Journals (Sweden)

    Risa Vera

    2016-11-01

    Kesimpulan. Acute kidney injury dan skor PELOD memiliki hubungan positif, dan kontribusi AKI terhadap variasi skor PELOD 25,6% menjelaskan bahwa pasien penyakit kritis dengan skor PELOD rendah akan tetap memiliki prognosis yang buruk jika pasien tersebut mengalami AKI.

  1. Non-Invasive Detection of Lactate as a Biomarker of Response using Spectral Selective Multiple Quantum Editing Sequence (SS-SelMQC)

    Science.gov (United States)

    2013-11-01

    molecular signatures of specific biological processes in discreet anatomic structures using natural metabolites and stable (nonradioactive) isotopes (13C...256. Gated respiration was used to reduce respiratory artifacts . Analysis of breast cancer microarray datasets A compendium of four breast cancer

  2. Attosecond nanotechnology: NEMS of energy storage and nanostructural transformations in materials

    Energy Technology Data Exchange (ETDEWEB)

    Beznosyuk, Sergey A., E-mail: bsa1953@mail.ru; Maslova, Olga A., E-mail: maslova-o.a@mail.ru [Altai State University, Barnaul, 656049 (Russian Federation); Zhukovsky, Mark S., E-mail: zhukovsky@list.ru [Altai State Technical University, Barnaul, 656038 (Russian Federation)

    2015-10-27

    The attosecond technology of the nanoelectromechanical system (NEMS) energy storage as active center fast transformation of nanostructures in materials is considered. The self-organizing relaxation of the NEMS active center containing nanocube of 256-atoms limited by planes (100) in the FCC lattice matrix of 4d-transition metals (Ru, Rh, Pd) is described by the quantum NEMS-kinetics (NK) method. Typical for these metals change of the NEMS active center physicochemical characteristics during the time of relaxation is presented. There are three types of intermediate quasistationary states of the NEMS active center. Their forms are plainly distinguishable. The full relaxed NEMS active centers (Ru{sub 256}, Rh{sub 256}, Pd{sub 256}) accumulate next storage energies: E{sub Ru} = 2.27 eV/at, E{sub Rh} = 1.67 eV/at, E{sub Pd} = 3.02 eV/at.

  3. Movimientos tectónicos y sociedad: Memoria histórica y desafíos actuales de Haití

    OpenAIRE

    Larenas Álvarez, Angie A.

    2014-01-01

    Reseñas de: Dubois, Laurent, Haiti: The Aftershocks of History, Metropolitan Books, Nueva York, 2012, ps. 434 - Schuller, Mark, Killing with Kindness. Haiti, International Aid, and NGOs, Rutgers University Press, Nueva Jersey, 2012, ps. 256

  4. Review of Amanda E. Herbert, Female Alliances: Gender, Identity, and Friendship in Early Modern Britain

    Directory of Open Access Journals (Sweden)

    Angela Rehbein

    2015-03-01

    Full Text Available Review of Amanda E. Herbert, Female Alliances: Gender, Identity, and Friendship in Early Modern Britain. New Haven: Yale UP, 2014. xi, 256 pages: illustrations; 24 cm. ISBN 978-0-300-17740-4.

  5. Computational Equipment for Support of Air Force Sponsored Programs for the Design of Advanced and Miniaturized Explosive and Advanced Propellant Systems

    National Research Council Canada - National Science Library

    Stewart, D. S; Buckmaster, John D; Jackson, Thomas L

    2008-01-01

    This grant funded the acquisition of a 128 node/256 processor cluster computer that now supports the computational needs of the combined, Air Force-sponsored research groups of Prof. D. Scott Stewart (PI...

  6. Technological and dermatoglyphic analysis of the earliest ceramics: Pavlov (South Moravia) and Krems (Lower Austria)

    Czech Academy of Sciences Publication Activity Database

    Svoboda, Jiří; Neugebauer-Maresch, Ch.

    2004-01-01

    Roč. 45, - (2004), s. 256-259 ISSN 1211-7250 Institutional research plan: CEZ:AV0Z8001916 Keywords : Moravia, Austria * ceramic * analysis technological, dermatoglyphic Subject RIV: AC - Archeology, Anthropology, Ethnology

  7. Archeologický výzkum zaniklého těžebního areálu u kostela sv. Václava v Pněvicích (okr. Kutná Hora)

    Czech Academy of Sciences Publication Activity Database

    Končelová, Markéta; Velímský, Filip

    2012-01-01

    Roč. 12, prosinec (2012), s. 253-256 ISSN 1801-5972 Institutional research plan: CEZ:AV0Z80020508 Keywords : Kutná Hora * archaeology * Middle Ages * silver mining Subject RIV: AC - Archeology, Anthropology, Ethnology

  8. Sõlmes alumiiniummaja = Aluminium House in a Knot

    Index Scriptorium Estoniae

    2008-01-01

    Alumiiniumplaatidega kaetud sõlmekujulise plaaniga eramu (256 m2). Arhitektid: Peeter Pere, Urmas Muru. Projektbüroo: Muru & Pere. Konsultant Katrin Kaevats. Valmis: 2007. 2 plaani, 4 värv. välisvaadet, sisevaade

  9. „Diderot miloval mystifikace“, a co Milan Kundera?

    Czech Academy of Sciences Publication Activity Database

    Jungmannová, Lenka

    2017-01-01

    Roč. 65, č. 2 (2017), s. 235-256 ISSN 0009-0468 Institutional support: RVO:68378068 Keywords : Czech drama * Kundera, Milan * Steigerwald, Karel Subject RIV: AJ - Letters, Mass-media, Audiovision OBOR OECD: Specific literatures

  10. Food for Thought: Cross-Classification and Category Organization in a Complex Real-World Domain.

    Science.gov (United States)

    Ross, Brian H.; Murphy, Gregory L.

    1999-01-01

    Seven studies involving 256 undergraduates examined how people represent, access, and make inferences about the real-world category domain, foods. Results give a detailed picture of the use of cross-classification in a complex domain. (SLD)

  11. Das Genre 'Studentenroman' und die Rezeption von Karl Hans Strobls Werk

    Czech Academy of Sciences Publication Activity Database

    Trnková, Vendula

    2015-01-01

    Roč. 23, 1/2 (2015), s. 241-256 ISSN 1803-456X Institutional support: RVO:68378068 Keywords : Student novel * Reception of Karl Hans Strobl’s novels Subject RIV: AJ - Letters, Mass-media, Audiovision

  12. Krajina jako prostředí k rekreaci - na příkladu Šuamvy

    Czech Academy of Sciences Publication Activity Database

    Kušová, Drahomíra; Těšitel, Jan; Bartoš, Michael

    2001-01-01

    Roč. 35, č. 5 (2001), s. 253-256 ISSN 0044-4863 Institutional research plan: CEZ:AV0Z6087904 Keywords : tourism * leisure time activities * sociological survey Subject RIV: AO - Sociology, Demography

  13. 77 FR 52336 - National Institute of Mental Health Notice of Meeting

    Science.gov (United States)

    2012-08-29

    ... connection; (D) Minimum of Pentium 400 with 256 MB of RAM (Recommended); (E) Java Virtual Machine enabled... . Dated: August 23, 2012. Carolyn A. Baum, Program Analyst, Office of Federal Advisory Committee Policy...

  14. 77 FR 64117 - National Institute of Mental Health; Notice of Workshop

    Science.gov (United States)

    2012-10-18

    ... connection; (D) Minimum of Pentium 400 with 256 MB of RAM (Recommended); (E) Java Virtual Machine enabled... available on the Web site: http://www.iacc.hhs.gov . Dated: October 11, 2012. Carolyn A. Baum, Program...

  15. 77 FR 68134 - National Institute of Mental Health; Notice of Meeting

    Science.gov (United States)

    2012-11-15

    ... Pentium 400 with 256 MB of RAM (Recommended); (E) Java Virtual Machine enabled (Recommended). Individuals... . Dated: November 8, 2012. Carolyn A. Baum, Program Analyst, Office of Federal Advisory Committee Policy...

  16. 77 FR 43849 - National Institute of Mental Health; Notice of Meeting

    Science.gov (United States)

    2012-07-26

    ... 256 MB of RAM (Recommended); (E) Java Virtual Machine enabled (Recommended). Accommodations Statement...: July 20, 2012. Carolyn A. Baum, Program Analyst, Office of Federal Advisory Committee Policy. [FR Doc...

  17. 77 FR 68135 - National Institute of Mental Health; Notice of Meeting

    Science.gov (United States)

    2012-11-15

    ... better Internet connection; (D) Minimum of Pentium 400 with 256 MB of RAM (Recommended); (E) Java Virtual... the Web site: http://www.iacc.hhs.gov . Dated: November 8, 2012. Carolyn A. Baum, Program Analyst...

  18. Mysids (Crustacea) from the salt pans of Mumbai, India, with a description of a new species

    Digital Repository Service at National Institute of Oceanography (India)

    Biju, A.; Panampunnayil, S.U.

    on Marine Science, University of Tokyo 256–273. Quintero C, de Roa EZ. 1973. Notas bioecologicas sobre Metamysidopsis insularis Brattegard (Crusatacea-Mysidacea) en una laguna litoral de Venezuela. Acta Biologica Venezuelica 8: 245-278. Ramamoorthy K...

  19. The Conference from the Prague Perspective

    Czech Academy of Sciences Publication Activity Database

    Hrubec, Marek

    2017-01-01

    Roč. 43, č. 3 (2017), s. 256-257 ISSN 0191-4537 Institutional support: RVO:67985955 Keywords : Critical Theory * Conference Philosophy and Social Science * Prague Subject RIV: AA - Philosophy ; Religion

  20. A Medipix2-based imaging system for digital mammography with silicon pixel detectors

    CERN Document Server

    Bisogni, M G; Fantacci, M E; Mettivier, G; Montesi, M C; Novelli, M; Quattrocchi, M; Rosso, V; Russo, P; Stefanini, A

    2004-01-01

    In this paper we present the first tests of a digital imaging system based on a silicon pixel detector bump-bonded to an integrated circuit operating in single photon counting mode. The X-rays sensor is a 300 mu m thick silicon, 14 by 14 mm/sup 2/, upon which a matrix of 256 * 256 pixels has been built. The read-out chip, named MEDIPIX2, has been developed at CERN within the MEDIPIX2 Collaboration and it is composed by a matrix of 256 * 256 cells, 55 * 55 mu m/sup 2/. The spatial resolution properties of the system have been assessed by measuring the square wave resolution function (SWRF) and first images of a standard mammographic phantom were acquired using a radiographic tube in the clinical irradiation condition. (5 refs).

  1. Particle Flow Modelling in Slurry-Fed Stirred Vessels

    Czech Academy of Sciences Publication Activity Database

    Scargiali, F.; Grisafi, F.; Čermáková, Jiřina; Machoň, V.; Brucato, A.

    2004-01-01

    Roč. 27, č. 3 (2004), s. 249-256 ISSN 0930-7516 Institutional research plan: CEZ:AV0Z4072921 Keywords : solids * dispersion Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 0.791, year: 2004

  2. Skalní architektura v České republice

    Czech Academy of Sciences Publication Activity Database

    Bahenský, František

    2002-01-01

    Roč. 89, č. 3 (2002), s. 239-256 ISSN 0009-0794 Institutional research plan: CEZ:AV0Z9058907 Keywords : the rock architecture * dwellings * out-buildings Subject RIV: AC - Archeology, Anthropology, Ethnology

  3. O ČEZu, UNESCU a Ikee. Psaní iniciálových zkratkových slov a tendence k jejich skloňování

    Czech Academy of Sciences Publication Activity Database

    Dufek, Ondřej

    2016-01-01

    Roč. 99, č. 5 (2016), s. 256-268 ISSN 0027-8203 R&D Projects: GA MŠk(CZ) LM2010013 Institutional support: RVO:68378092 Keywords : initialism * acronym * declension * orthography Subject RIV: AI - Linguistics

  4. Jak se laser uplatnil v holografii?

    Czech Academy of Sciences Publication Activity Database

    Miler, Miroslav

    2010-01-01

    Roč. 60, 4-5 (2010), s. 251-256 ISSN 0009-0700 Institutional research plan: CEZ:AV0Z20670512 Keywords : holography * lasers * coherence Subject RIV: JA - Electronics ; Optoelectronics, Electrical Engineering

  5. Die Wahrheit des Holocaust

    Directory of Open Access Journals (Sweden)

    Michael Stolleis

    2003-01-01

    Full Text Available Rezensiertes Werk: Raul Hilberg, Die Quellen des Holocaust. Entschlüsseln und Interpretieren. Deutsch von Udo Rennert, Frankfurt am Main: S. Fischer 2002, 256 S., ISBN 3-10-033626-7

  6. Evaluation of Multimodal Imaging Biomarkers of Prostate Cancer

    Science.gov (United States)

    2016-11-01

    temporal characterization of physiological , cellular and molecular events leading to CRPC growth in a given animal. In recent years, however, there...the following imaging parameters (Varian 7T MRI system , TR = 2s, TE = 40ms, echo train length = 8, echo spacing = 10ms, matrix = 256 x 256, FOV...its back (rather than the usual stomach position) enabled us to avoid the use of respiratory gating in the scans, thereby reducing scan durations. It

  7. Impact of physical activity levels and diet on central obesity among ...

    African Journals Online (AJOL)

    The prevalence of central obesity was found to be 31.2%. The prevalence of central obesity was significantly higher (p=0.031) among females (41.5%) compared to men (25.6%) and also increased with age (p<0.0001). The prevalence of obesity significantly decreased (p = 0.018) from 70.7% via 25.6% to 3.4% as the level ...

  8. Digital image processing for two-phase flow

    Energy Technology Data Exchange (ETDEWEB)

    Lee, Jae Young; Lim, Jae Yun [Cheju National University, Cheju (Korea, Republic of); No, Hee Cheon [Korea Advanced Institute of Science and Technology, Taejon (Korea, Republic of)

    1992-07-01

    A photographic method to measure the key parameters of two-phase flow is realized by using a digital image processing technique. The 8 bit gray level and 256 x 256 pixels are used to generates the image data which is treated to get the parameters of two-phase flow. It is observed that the key parameters could be identified by treating data obtained by the digital image processing technique.

  9. Bioapatite made from chicken femur bone

    Czech Academy of Sciences Publication Activity Database

    Šupová, Monika; Martynková, G.S.; Sucharda, Zbyněk

    2011-01-01

    Roč. 55, č. 3 (2011), s. 256-260 ISSN 0862-5468 R&D Projects: GA ČR(CZ) GA106/09/1000 Institutional research plan: CEZ:AV0Z30460519 Keywords : bioapatite * biocomposite * hydroxyapatite Subject RIV: BO - Biophysics Impact factor: 0.382, year: 2011 http://www.ceramics-silikaty.cz/2011/2011_03_256.htm

  10. Cost-effectiveness of ceftriaxone in the treatment of community ...

    African Journals Online (AJOL)

    1998-03-03

    Mar 3, 1998 ... 87.1%. 90.0%. 87.3%. 90.5%. 92.9%. Success rate. 49. 56. 19. 37. 21. 70. 256. 85.9%. 2 - 3 and 5.0. 256. 20. 276. :> x. :>. :> ca. 0 ca ct:I. ~. 5. ~. Y. ~ .... is observed between the two third-generation cephalosporins, ceftriaxone and cefotaxime. The difference between the other two treatment regimens does ...

  11. Characterization and Enhanced Processing of Soluble, Oligomeric gp140 Envelope Glycoproteins Derived from Human Immunodeficiency Virus Type-1 Primary Isolates

    Science.gov (United States)

    2001-05-01

    virus, rabies virus) and DNA vaccines engineered to express HIV-1 proteins are known to elicit CTL response (18, 256, 269). Though DNA has been shown...34953. 51. Cheng-Mayer, C., D. Seto, M. Tateno, and J. A. Levy 1988. Biological features of HIV that correlate with virulence in the host Science...243-55. 157 256. Schnell, M. J., H. D. Foley, C. A. Siler, J. P. McGettigan, B. Dietzschold, and R. J. Pomerantz 2000. Recombinant rabies virus

  12. Automated synthesis and verification of configurable DRAM blocks for ASIC's

    Science.gov (United States)

    Pakkurti, M.; Eldin, A. G.; Kwatra, S. C.; Jamali, M.

    1993-01-01

    A highly flexible embedded DRAM compiler is developed which can generate DRAM blocks in the range of 256 bits to 256 Kbits. The compiler is capable of automatically verifying the functionality of the generated DRAM modules. The fully automated verification capability is a key feature that ensures the reliability of the generated blocks. The compiler's architecture, algorithms, verification techniques and the implementation methodology are presented.

  13. A Parallel Algorithm for Connected Component Labelling of Gray-scale Images on Homogeneous Multicore Architectures

    International Nuclear Information System (INIS)

    Niknam, Mehdi; Thulasiraman, Parimala; Camorlinga, Sergio

    2010-01-01

    Connected component labelling is an essential step in image processing. We provide a parallel version of Suzuki's sequential connected component algorithm in order to speed up the labelling process. Also, we modify the algorithm to enable labelling gray-scale images. Due to the data dependencies in the algorithm we used a method similar to pipeline to exploit parallelism. The parallel algorithm method achieved a speedup of 2.5 for image size of 256 x 256 pixels using 4 processing threads.

  14. An interactive raster-scan graphic terminal

    International Nuclear Information System (INIS)

    Lussignol, Yves.

    1980-02-01

    A raster-scan graphic terminal has been realized using a microprocessor MOTOROLA 6800. This system allows to show two-dimensional plots (256 x 256 pixels) as maps of intensity with eight different levels of brightness. A command language directed by a MENU was performed to help the physicist during the acquisition, the data reduction and analysis of multiparameter experiments. An electrostatic plotter is connected to this system [fr

  15. Radiation Test Results for Common CubeSat Microcontrollers and Microprocessors

    Science.gov (United States)

    Guertin, Steven M.; Amrbar, Mehran; Vartanian, Sergeh

    2015-01-01

    SEL, SEU, and TID results are presented for microcontrollers and microprocessors of interest for small satellite systems such as the TI MSP430F1611, MSP430F1612 and MSP430FR5739, Microchip PIC24F256GA110 and dsPIC33FJ256GP710, Atmel AT91SAM9G20, and Intel Atom E620T, and the Qualcomm Snapdragon APQ8064.

  16. Two novel compound heterozygous mutations in the BCKDHB gene that cause the intermittent form of maple syrup urine disease.

    Science.gov (United States)

    Guo, Yi; Liming, Liu; Jiang, Li

    2015-12-01

    Intermittent maple syrup urine disease (MSUD) is a potentially life-threatening metabolic disorder caused by a deficiency of branched chain α-ketoacid dehydrogenase (BCKD) complex. In contrast to classic MSUD, children with the intermittent form usually have an atypical clinical manifestation. Here, we describe the presenting symptoms and clinical course of a Chinese boy with intermittent MSUD. Mutation analysis identified two previously unreported mutations in exon 7 of the BCKDHB gene: c.767A > G (p.Y256C) and c.768C > G (p.Y256X); the parents were each heterozygous for one of these mutations. In silico analysis predicted Y256C probably affects protein structure; Y256X leads to a premature stop codon. This case demonstrates intermittent MSUD should be suspected in cases with symptoms of recurrent encephalopathy, especially ataxia or marked drowsiness, which usually present after the neonatal period and in conjunction with infection. symmetrical basal ganglia damage but normal myelination in the posterior limb will assist differential diagnosis; alloisoleucine is a useful diagnostic marker and mutation analysis may be of prognostic value. These novel mutations Y256C and Y256X result in the clinical manifestation of a variant form of MSUD, expanding the mutation spectrum of this disease.

  17. Improvement on detectability of early ischemic changes for acute stroke using nonenhanced computed tomography: Effect of matrix size

    Energy Technology Data Exchange (ETDEWEB)

    Ogura, Akio, E-mail: a-ogura@mbox.kyoto-inet.or.jp [Department of Radiology, Kyoto City Hospital (Japan); Graduate School of Medical Science, Kanazawa University (Japan); Hayakawa, Katsumi [Department of Radiology, Kyoto City Hospital (Japan); Miyati, Tosiaki [Graduate School of Medical Science, Kanazawa University (Japan); Maeda, Fumie [Department of Radiology, Kyoto City Hospital (Japan)

    2010-11-15

    Purpose: It has recently been reported that intravenous recombinant tissue plasminogen activator improves the clinical outcome after acute stroke. Computed tomography (CT) is the standard imaging method used to determine the indication for thrombolysis. However, detection of early ischemic change often results in an increase in local radiation exposure. Therefore, the effects of decreased matrix size and use of a noise reduction filter were evaluated. Materials and methods: The low contrast resolution was compared for different matrix sizes and imaging filters using a contrast-detail phantom. In addition, early ischemic change in clinical images with matrix sizes of 256 x 256 and 128 x 128 processed using three imaging filters (Gaussian, smoothing, and unsharp mask) from 11 patients within 3 h of stroke onset was evaluated by seven radiologists in a blind manner. Results: The use of images with a matrix size of 256 x 256 and processed with the Gaussian filter increased the detection of early signs of acute stroke. Conclusions: This study was performed to determine whether the converted matrix size and use of imaging filters could improve the detectability of early ischemic change on CT images in acute stroke. To reduce the dose of radiation exposure for patients, it was effective to use an optimal noise reduction filter and reasonable matrix size. In particular, changing the matrix size to 256 x 256 was the most effective for detection of early ischemic change in examinations using clinical images.

  18. Productivity, Physicochemical Changes, and Antioxidant Activity of Shiitake Culinary-Medicinal Mushroom Lentinus edodes (Agaricomycetes) Cultivated on Lignocellulosic Residues.

    Science.gov (United States)

    Gaitán-Hernández, Rigoberto; Zavaleta, Marco Antonio Barradas; Aquino-Bolaños, Elia Nora

    2017-01-01

    The effects of substrate and strain on productivity, physicochemical characteristics, and compounds with antioxidant activity were evaluated in basidiomes of the shiitake mushroom, Lentinus edodes. Strains IE-245 and IE-256 and the substrates oak wood shavings (OW), sorghum stubble (SS), and sugar cane bagasse (SC) were used. Productivity was evaluated by measuring biological efficiency (BE), production rate (PR), and yield. Total sugars, total soluble solids, pH, titratable acidity, color parameters, total phenolics, flavonoids, ascorbic acid, and antioxidant activity of the basidiomes were measured. BE, PR and yield were higher with the combination IE-256/SS, at 103.71%, 1.32%, and 34.57%, respectively. The largest amount of total sugars (17.61 mg glucose · g-1 dry weight) was found with combination IE-256/SS. Variation was observed in basidiome color; the lowest luminosity (L*) value (darkest color) was found in the IE-256 strain on the OW substrate (L* = 30.45), whereas that of the IE-245 strain on the SC substrate was the lightest in color (L* = 57.00). The largest amounts of total phenolics were recorded in the IE-256 strain on the OW (6.50 mg gallic acid equivalents [GAE] · g-1 dry weight) and the SS substrates (5.85 mg GAE · g-1 dry weight). The best antioxidant activity was obtained with IE-256-0.80, 0.65, and 0.59 μmol Trolox equivalents · g dry weight-1-on the OW, SC, and SS substrates, respectively. Based on the values of BE, PR, and yield, IE-256/SS was the most productive. Substrate and strain, and their interactions, influenced the physicochemical characteristics of the basidiomes and the amounts of compounds with antioxidant activity they contained.

  19. Screening of in vitro antimicrobial activity of plants used in traditional Indonesian medicine.

    Science.gov (United States)

    Romulo, Andreas; Zuhud, Ervizal A M; Rondevaldova, Johana; Kokoska, Ladislav

    2018-12-01

    In many regions of Indonesia, there are numerous traditional herbal preparations for treatment of infectious diseases. However, their antimicrobial potential has been poorly studied by modern laboratory methods. This study investigates in vitro antimicrobial activity of 49 ethanol extracts from 37 plant species used in Indonesian traditional medicine for treatment against Candida albicans, Enterococcus faecalis, Escherichia coli, Pseudomonas aeruginosa and Staphylococcus aureus. The plants were collected from the Biopharmaca collection garden, Bogor, Indonesia. The plant material was dried, finely grounded, extracted using ethanol, concentrated, and the dried residue was dissolved in 100% DMSO. Antimicrobial activity was determined in terms of a minimum inhibitory concentration (MIC) using a broth microdilution method in 96-well microplates. The extract of Orthosiphon aristatus (Blume) Miq. (Lamiaceae) leaf produced the strongest antimicrobial effect, inhibiting the growth of C. albicans (MIC 128 μg/mL), S. aureus (MIC 256 μg/mL), E. faecalis (MIC 256 μg/mL) and P. aeruginosa (MIC 256 μg/mL). The leaf extract of Woodfordia floribunda Salisb. (Lythraceae) also exhibited significant effect against C. albicans (MIC 128 μg/mL), S. aureus (MIC 256 μg/mL) and E. faecalis (MIC 256 μg/mL). Rotheca serrata (L.) Steane & Mabb. (Lamiaceae) leaf extract inhibited the growth of S. aureus (MIC 256 µg/mL) and C. albicans (MIC 256 µg/mL). The leaf extract of O. aristatus and W. floribunda exhibited a significant anti-candidal effect. Therefore, both of these plants can serve as prospective source materials for the development of new anti-candidal agents.

  20. Role of multiple phosphorylation sites in the COOH-terminal tail of aquaporin-2 for water transport: evidence against channel gating

    DEFF Research Database (Denmark)

    Moeller, Hanne B; Macaulay, Nanna; Knepper, Mark A

    2009-01-01

    demonstrated that lack of phosphorylation at S256, S261, S264, or S269 had no effect on AQP2 unit water transport. Similarly, no effect on AQP2 unit water transport was observed for the 264D and 269D forms, indicating that phosphorylation of the COOH-terminal tail of AQP2 is not involved in gating......Arginine vasopressin (AVP)-regulated phosphorylation of the water channel aquaporin-2 (AQP2) at serine 256 (S256) is essential for its accumulation in the apical plasma membrane of collecting duct principal cells. In this study, we examined the role of additional AVP-regulated phosphorylation sites...... in the COOH-terminal tail of AQP2 on protein function. When expressed in Xenopus laevis oocytes, prevention of AQP2 phosphorylation at S256A (S256A-AQP2) reduced osmotic water permeability threefold compared with wild-type (WT) AQP2-injected oocytes. In contrast, prevention of AQP2 single phosphorylation at S...

  1. Concentração inibitória mínima (CIM de oito antimicrobianos frente isolados de Streptococcus suis

    Directory of Open Access Journals (Sweden)

    Felipe Masiero Salvarani

    2008-02-01

    Full Text Available The minimun inhibitory concentration (MIC was determined toward amoxicilin, ampicilin, penicillin, ceftiofur, florfenicol, lincomycin, trimethoprim-sulfadiazine and tetracycline for 75 strains of Streptococcus suis. The MIC was performed on sheep blood agar plates containing concentrations varying from 0,25 to 256 µg/ml of the antibiotic described above. The amoxicilin in the concentrations of 1 and 2 µg/ml, florfenicol in the concentration of 1 µg/ml and trimethoprim-sulfadiazine in the concentrations of 2 e 8 µg/ml, were the antibiotics that presented minor resistance. In contrast, the ampicilin, tetracycline, ceftiofur and lincomycin, presented MIC of 64 and 128 µg/ml, 64 and 128 µg/ml, 128 and 256 µg/ml and >;256 µg/ml, respectively. The results of this study show that the amoxicilin and florfenicol are the antibiotics of choice for the treatment of diseases by S. suis in swine.

  2. High-frequency signal paths in the TMR-86.1 experimental tomography apparatus

    International Nuclear Information System (INIS)

    Obrcian, J.; Jellus, V.; Weis, J.; Frollo, I.

    1990-01-01

    The NMR-based TMR-86.1 tomography apparatus, developed at the Institute of Measurement and Measuring Instrumentation, Slovak Academy of Sciences in Bratislava, Czechoslovakia, enables imaging of the inner structure of biological samples and human limbs no more than 110 mm in diameter, using a measuring matrix containing at most 128x128 elements. The imaged matrix can possess a maximum of 256x256 image elements with 256 brightness steps. The signal paths of the high-frequency excitation-imaging complex of the apparatus are described. Some functional blocks of the apparatus can be used without substantial modifications for the imaging of larger objects such as the human body. From the point of view of the high-frequency pulses for nonselective excitation (so-called 180deg-pulses), the excitation pulse power will have to be increased to at least 1 kW. (author). 5 figs, 7 refs

  3. A 16-detector alpha spectrometer using 1 multichannel analyzer

    International Nuclear Information System (INIS)

    Phillips, W.G.

    1978-01-01

    An alpha spectrometer containing 16 independent detectors and utilizing one 4096-channel multichannel analyzer (MCA) was constructed from commerically available modules. The spectrometer was designed specifically for the counting of low levels of radioactivity in environmental samples. Gated analog routing allows spectral data acquisition into 256 channel regions of the MCA memory as if each region were an independent 256-channel MCA. External live-time clocks and 50-Mhz analog-to-digital converters control timing and acquisition on each unit of eight detectors. Spectral data output is to magnetic tape in units of 256 channels each with a unique tagword. These tapes are then read and processed, and final reports are generated, by a large Control Data 6000 series computer

  4. Improved Impossible Differential Attacks on Large-Block Rijndael

    DEFF Research Database (Denmark)

    Wang, Qingju; Gu, Dawu; Rijmen, Vincent

    2012-01-01

    . The improvement can lead to 10-round attack on Rijndael-256 as well. With 2198.1 chosen plaintexts, an attack is demonstrated on 9-round Rijndael-224 with 2 195.2 encryptions and 2140.4 bytes memory. Increasing the data complexity to 2216 plaintexts, the time complexity can be reduced to 2130 encryptions...... and the memory requirements to 2 93.6 bytes. For 9-round Rijndael-256, we provide an attack requiring 2229.3 chosen plaintexts, 2194 encryptions, and 2 139.6 bytes memory. Alternatively, with 2245.3 plaintexts, an attack with a reduced time of 2127.1 encryptions and a memory complexity of 290.9 bytes can...... be mounted. With 2244.2 chosen plaintexts, we can attack 10-round Rijndael-256 with 2253.9 encryptions and 2186.8 bytes of memory....

  5. Two Families of Monogenic $S_4$ Quartic Number Fields

    OpenAIRE

    Smith, Hanson

    2018-01-01

    Consider the integral polynomials $f_{a,b}(x)=x^4+ax+b$ and $g_{c,d}(x)=x^4+cx^3+d$. Suppose $f_{a,b}(x)$ and $g_{c,d}(x)$ are irreducible, $b\\mid a$, and the integers $b$, $d$, $256d-27c^4$, and $\\dfrac{256b^3-27a^4}{\\gcd(256b^3,27a^4)}$ are all square-free. Using the Montes algorithm, we show that a root of $f_{a,b}(x)$ or $g_{c,d}(x)$ defines a monogenic extension of $\\mathbb{Q}$ and serves a generator for a power basis of the ring of integers. In fact, we show monogeneity for slightly mor...

  6. Particle simulation on a distributed memory highly parallel processor

    International Nuclear Information System (INIS)

    Sato, Hiroyuki; Ikesaka, Morio

    1990-01-01

    This paper describes parallel molecular dynamics simulation of atoms governed by local force interaction. The space in the model is divided into cubic subspaces and mapped to the processor array of the CAP-256, a distributed memory, highly parallel processor developed at Fujitsu Labs. We developed a new technique to avoid redundant calculation of forces between atoms in different processors. Experiments showed the communication overhead was less than 5%, and the idle time due to load imbalance was less than 11% for two model problems which contain 11,532 and 46,128 argon atoms. From the software simulation, the CAP-II which is under development is estimated to be about 45 times faster than CAP-256 and will be able to run the same problem about 40 times faster than Fujitsu's M-380 mainframe when 256 processors are used. (author)

  7. Ornithinibacillus salinisoli sp. nov., a moderately halophilic bacterium isolated from a saline-alkali soil.

    Science.gov (United States)

    Gan, Longzhan; Zhang, Heming; Long, Xiufeng; Tian, Jiewei; Wang, Zhikuan; Zhang, Yuqin; Dai, Yumei; Tian, Yongqiang

    2018-03-01

    A taxonomic study was performed on strain LCB256 T , which was isolated from a saline-alkali soil sample taken from northwestern China. Cells of strain LCB256 T were Gram-stain-positive, aerobic, rod-shaped and grew at 3-17 % (w/v) NaCl (optimum 10-15 %), 10-52 °C (optimum 25-30 °C) and pH 7.0-9.0 (optimum 8.0). Phylogenetic analysis based on 16S rRNA gene sequences indicated that strain LCB256 T was most closely related to the two genera of Ornithinibacillus and Oceanobacillus, showing highest sequence similarity to Oceanobacillus limi KCTC 13823 T (97.8 %) and Ornithinibacillus bavariensis WSBC 24001 T (97.2 %). The peptidoglycan amino acid type was found to be A4β and the major respiratory quinone was determined to be MK-7. The polar lipid profile of strain LCB256 T contained diphosphatidylglycerol, phosphatidylglycerol, one unidentified phospholipid and two unidentified aminolipids. The dominant cellular fatty acids were anteiso-C15 : 0 and iso-C15 : 0. The G+C content of genomic DNA was 39.3 mol%. DNA-DNA relatedness values between strain LCB256 T and Ornithinibacillus halophilus KCTC 13822 T and Oceanobacillus limi KCTC 13823 T were 46.2 and 34.8 %, respectively. Based on this polyphasic taxonomic study, a novel species of the genus Ornithinibacillus, Ornithinibacillussalinisoli sp. nov. is proposed. The type strain is LCB256 T (=CGMCC 1.15809 T =KCTC 33862 T ).

  8. Rainfall-threshold conditions for landslides in a humid-tropical system

    Science.gov (United States)

    Larsen, Matthew C.; Simon, Andrew

    1993-01-01

    Landslides are triggered by factors such as heavy rainfall, seismic activity, and construction on hillslopes. The leading cause of landslides in Puerto Rico is intense and/or prolonged rainfall. A rainfall threshold for rainfall-triggered landsliding is delimited by 256 storms that occurred between 1959 and 1991 in the central mountains of Puerto Rico, where mean annual rainfall is close to or in excess of 2,000 mm. Forty one of the 256 storms produced intense and/or prolonged rainfall that resulted in tens to hundreds of landslides. A threshold fitted to the lower boundary of the field defined by landslide-triggering storms is expressed as

  9. An analytical model for perpetual network codes in packet erasure channels

    DEFF Research Database (Denmark)

    Pahlevani, Peyman; Crisostomo, Sergio; Roetter, Daniel Enrique Lucani

    2016-01-01

    is highly dependent on a parameter called the width (ωω), which represents the number of consecutive non-zero coding coefficient present in each coded packet after a pivot element. We provide a mathematical analysis based on the width of the coding vector for the number of transmitted packets and validate...... it with simulation results. The simulations show that for ω=5ω=5, generation size g=256g=256, and low erasure probability on the link, a destination can receive up to 70%70% overhead in average. Moreover, increasing the width, the overhead contracts, and for ω≥60ω≥60 it becomes negligible....

  10. The slewing mirror telescope of the Ultra Fast Flash Observatory Pathfinder

    DEFF Research Database (Denmark)

    Jeong, S.; Ahmad, S.; Barrillon, P.

    2012-01-01

    the Russian Lomonosov satellite in November 2012 by Soyuz-2 rocket. Once the UFFO Burst Alert & Trigger Telescope (UBAT) detects the GRBs, Slewing mirror (SM) will slew to bring new GRB into the SMT’s field of view rather than slewing the entire spacecraft. SMT can give a UV/Optical counterpart position...... is the reflecting telescope with 10cm Ritchey-Chretien type and 256 x 256 pixilated Intensified Charge-Coupled Device (ICCD). In this paper, we discuss the overall design of UFFO-P SMT instrument and payloads development status.© (2012) COPYRIGHT Society of Photo-Optical Instrumentation Engineers (SPIE...

  11. Design of a 16 kbit superconducting latching/SFQ hybrid RAM

    International Nuclear Information System (INIS)

    Nagasawa, Shuichi; Hasegawa, Haruhiro; Hashimoto, Tatsunori; Suzuki, Hideo; Miyahara, Kazunori; Enomoto, Youichi

    1999-01-01

    We have designed a 16 kbit superconducting latching/SFQ hybrid (SLASH) RAM, which enables high-frequency clock operation up to 10 GHz. The 16 kbit SLASH RAM consists of four 4x4 matrix arrays of 256 bit RAM blocks, block decoders, latching block drivers, latching block senses, impedance matched lines and the powering circuits. The 256 bit RAM block is composed of a 16x16 matrix array of vortex transitional memory cells, latching drivers, SFQ NOR decoders and latching sense circuits. We have also designed and implemented an SFQ NOR decoder that is composed of magnetically coupled multi-input OR gates and RSFQ inverters. (author)

  12. Increase of the assistancial productivity of the nuclear magnetic resonance equipment TOMIKON BMT 1100

    International Nuclear Information System (INIS)

    Rodriguez, A.; Carbonell, G.; Hernandez, C.

    1992-01-01

    In the present work a revision of the physical parameters which take part in the obtained of the Nuclear Magnetic Resonance (NMR) is carried put. Image is obtained introducing changes on them given in the disminution of the matrix size from 256 x 256 to 128 pixels with the corresponding disminution of FOV in dependence of the analized region, showing theoretical and practically its great importance of the number of possible examination with the resulting augment of the productivity of the method and the possibility to carried out studies on little cooperative patients mantaining an adequate quality and diagnostic information of the images

  13. The Temperature Dependence of the Debye-Waller Factor of Magnesium

    DEFF Research Database (Denmark)

    Sledziewska-Blocka, D.; Lebech, Bente

    1976-01-01

    The temperature dependence of the average Debye-Waller factor for magnesium was measured by means of neutron diffraction spectrometry. The experimental results obtained in the temperature range from 5 to 256 K are compared with theoretical calculations, using the harmonic and quasi-harmonic appro......The temperature dependence of the average Debye-Waller factor for magnesium was measured by means of neutron diffraction spectrometry. The experimental results obtained in the temperature range from 5 to 256 K are compared with theoretical calculations, using the harmonic and quasi...

  14. Use of Programmable Logic Controllers to Automate Control and Monitoring of U.S. Army Wastewater Treatment Systems

    Science.gov (United States)

    1991-07-01

    F) PL, ILD, ID (a), P1. (b), Self-doc. PL, LD, !/O, FL, LD, xref PL, LD, IO symbolic I/0 PI, i/O Gracet Rt prgramming VDE UL UL, CSA 24 255 256 257...UL VDE UL M 293 294 68 DIUM Pr,..grammable iuntro11ers - 256 to 1023 1/0 (Q-untinued) Company COMPUTMER CONTROL CONTROL DIVELBISS EATON DYNAMICS...Pittsburgh, PA 15208 94 MTS Systems Corp. TAC Sensors Division Houston, TX 77120 Research Triangle Park, NC 27709 (713/240-4160) (919/677- 0100

  15. Low-complexity Joint Sub-carrier Phase Noise Compensation for Digital Multi-carrier Systems

    DEFF Research Database (Denmark)

    Yankov, Metodi Plamenov; Barletta, Luca; Zibar, Darko

    2017-01-01

    Joint sub-carrier phase noise processing is proposed which recovers the SNR penalty related to decreased sub-carrier baudrate w.r.t. single carrier systems. The method enables digital sub-banding to be safely employed for nonlinear mitigation for modulation formats of up to 256-QAM.......Joint sub-carrier phase noise processing is proposed which recovers the SNR penalty related to decreased sub-carrier baudrate w.r.t. single carrier systems. The method enables digital sub-banding to be safely employed for nonlinear mitigation for modulation formats of up to 256-QAM....

  16. Software of the mini-computer TPA-1 saving system of events measured on the HPD automation

    International Nuclear Information System (INIS)

    Zhenei, M.

    1977-01-01

    Described is the event recovery system for events measured by the HPD automatic scanner. The system contains a raster display, 256x256, with built-in the INTEL 8080 microprocessor, the TRA/1 minicomputer, and two storage disks of 512 kilobytes. Designing the recovery system on the basis of the minicomputer becomes possible due to that the recovery program is written on the ASSEMBLER lanquage and owing to that no high accuracy is required for recognizing tracks. Discussed is the software of this recovery system designed on the basis of the OS/8 operational system. The software enables the operator to participate in recognizing images of complicated events

  17. The charge pump PLL clock generator designed for the 1.56 ns bin size time-to-digital converter pixel array of the Timepix3 readout ASIC

    CERN Document Server

    Fu, Y et al.

    2014-01-01

    Timepix3 is a newly developed pixel readout chip which is expected to be operated in a wide range of gaseous and silicon detectors. It is made of 256×256 pixels organized in a square pixel-array with 55 µm pitch. Oscillators running at 640 MHz are distributed across the pixel-array and allow for a highly accurate measurement of the arrival time of a hit. This paper concentrates on a low-jitter phase locked loop (PLL) that is located in the chip periphery. This PLL provides a control voltage which regulates the actual frequency of the individual oscillators, allowing for compensation of process, voltage, and temperature variations.

  18. WET SOLIDS FLOW ENHANCEMENT; SEMIANNUAL

    International Nuclear Information System (INIS)

    Hugo S. Caram; Natalie Foster

    1997-01-01

    The objective was to visualize the flow of granular materials in flat bottomed silo. This was done by for dry materials introducing mustard seeds and poppy seeds as tracer particles and imaging them using Nuclear Magnetic Resonance. The region sampled was a cylinder 25 mm in diameter and 40 mm in length. Eight slices containing 128*128 to 256*256 pixels were generated for each image. The size of the silo was limited by the size of the high resolution NMR imager available. Cross-sections of 150mm flat bottomed silos, with the tracer layers immobilized by a gel, showed similar qualitative patterns for both dry and wet granular solids

  19. Multiplicity of TEM-derived beta-lactamases from Klebsiella pneumoniae strains isolated at the same hospital and relationships between the responsible plasmids.

    OpenAIRE

    Chanal, C M; Sirot, D L; Petit, A; Labia, R; Morand, A; Sirot, J L; Cluzel, R A

    1989-01-01

    Five plasmid-mediated beta-lactamases conferring high-level resistance to ceftazidime were isolated from Klebsiella pneumoniae strains in the same hospital. These enzymes had isoelectric points ranging from 5.3 to 6.5 (CAZ-1, 5.55; CAZ-2, 6.0; CAZ-3, 5.3; CAZ-6, 6.5; and CAZ-7, 6.3). All isolates and their Escherichia coli transconjugants were highly resistant to amoxicillin (MICs, greater than 4,096 micrograms/ml), piperacillin (64 to 256 micrograms/ml), cephalothin (32 to 256 micrograms/ml)...

  20. Generic and Automated Runtime Program Repair

    Science.gov (United States)

    2012-09-01

    features a 600 MHz ARM Cortex-A8 CPU and 256 MB of mobile DDR memory, as appropriate. 4.3.1. Embedded Software: Fault Localization Results Our...the memory usage when performing repairs for each combination of program and representation. Our Nokia smartphones have 256+768 MB of RAM plus swap. In...devices. Pre- vious approaches report results on repairs conducted on server machines with 8 GB [64] to 16 GB of ram [17]. By contrast, the Nokia N900

  1. Optical Information Science

    Science.gov (United States)

    2011-09-01

    costs and cable size. The PS3’s 256 MB of main XDR RAM runs at 3.2 Ghz for 25.6 Gbps (versus the GPU running at 550 MHz, and its GDDR3 memory...picoboards, which are tiny 1GHz computers with 1 GB RAM , a 1 GHz processor, 16 GByte CF drive, USB 2.0 and 10/100 Ethernet. They are small enough to...Xiaotong; Wang, Jingcun “Design of optical interconnection network adapter based on DDR DIMM bus for cluster system”, Computer Engineering, v 33, n

  2. Study of hard X-ray dose enhancement effects for some kinds of semiconductor devices

    CERN Document Server

    Guo Hong Xia; Chen Yu Sheng; Zhou Hui; He Chao Hui; Xie Ya Ning; Huang Yu Ying; He Wei; Hu Tian Dou

    2002-01-01

    Experimental results of X-ray dose enhancement effects are given for CMOS4069 and floating gate ROMs irradiated in Beijing Synchrotron Radiation Facility and in cobalt source. Shift of threshold voltage vs. total dose for CMOS4069 and the errors vs. total dose for 28f256 and 29c256 have been tested on line and the equivalent relation of total dose damage under the same accumulated dose is provided comparing the response of devices irradiated by X-ray and gamma-ray source. These results can be provided for X-ray radiation hardening technology as an effective evaluation data

  3. Photodynamic therapy with photofrin II derivative in the treatment of carcinosarcoma of rats with diabetes mellitus

    Science.gov (United States)

    Dima, Vasile F.; Vasiliu, Virgil V.; Ionescu, Mircea D.; Laky, Dezideriu

    1995-03-01

    Four batches of Wistar rats with Walker-256 carcinosarcoma were used to test the effects of PDT upon `in vivo' tumor growth. Ten days after tumor transplantation, rats from batch I(DM) were exposed to Photofrin II (20 mg/kg), given i.p. 24 h before exposure to laser (632.8 nm; 10 mw; He-Ne laser), five doses given at 4 days intervals; batch II and batch III received sole treatment (DM or PDT). The control batch IV included animals with untreated Walker-256 tumors. The animals were followed up 42 days.

  4. Rebound Attacks on the Reduced Grøstl Hash Function

    DEFF Research Database (Denmark)

    Mendel, Florian; Rechberger, C.; Schlaffer, Martin

    2010-01-01

    -512 has not been analyzed yet. In this paper, we show the first cryptanalytic attacks on reduced-round versions of the Grøstl hash functions. These results are obtained by several extensions of the rebound attack. We present a collision attack on 4/10 rounds of the Grøstl-256 hash function and 5....../14 rounds of the Grøstl- 512 hash functions. Additionally, we give the best collision attack for reduced-round (7/10 and 7/14) versions of the compression function of Grøstl-256 and Grøstl-512....

  5. Capacity-Approaching Superposition Coding for Optical Fiber Links

    DEFF Research Database (Denmark)

    Estaran Tolosa, Jose Manuel; Zibar, Darko; Tafur Monroy, Idelfonso

    2014-01-01

    shaping of the signal's waveform. The output constellations in SCM-PSM exhibit nonbijective quasi-Gaussian statistical distributions that asymptotically reach the Shannon capacity limit, showing up to 0.7 dB sensitivity improvement for 256-ary SCM-PSM with respect to 256-ary quadrature amplitude...... white Gaussian noise channel. Thereafter, successful demodulation and decoding after dispersion-unmanaged transmission over 240-km standard single mode fiber of dual-polarization 6-Gbaud 16-, 32- and 64-ary SCM-PSM is experimentally demonstrated....

  6. Retroreflector field tracker. [noncontact optical position sensor for space application

    Science.gov (United States)

    Wargocki, F. E.; Ray, A. J.; Hall, G. E.

    1984-01-01

    An electrooptical position-measuring instrument, the Retroreflector Field Tracker or RFT, is described. It is part of the Dynamic Augmentation Experiment - a part of the payload of Space Shuttle flight 41-D in Summer 1984. The tracker measures and outputs the position of 23 reflective targets placed on a 32-m solar array to provide data for determination of the dynamics of the lightweight structure. The sensor uses a 256 x 256 pixel CID detector; the processor electronics include three Z-80 microprocessors. A pulsed laser diode illuminator is used.

  7. Positron emission tomographic images and expectation maximization: A VLSI architecture for multiple iterations per second

    International Nuclear Information System (INIS)

    Jones, W.F.; Byars, L.G.; Casey, M.E.

    1988-01-01

    A digital electronic architecture for parallel processing of the expectation maximization (EM) algorithm for Positron Emission tomography (PET) image reconstruction is proposed. Rapid (0.2 second) EM iterations on high resolution (256 x 256) images are supported. Arrays of two very large scale integration (VLSI) chips perform forward and back projection calculations. A description of the architecture is given, including data flow and partitioning relevant to EM and parallel processing. EM images shown are produced with software simulating the proposed hardware reconstruction algorithm. Projected cost of the system is estimated to be small in comparison to the cost of current PET scanners

  8. Antimicrobial and cytotoxic activity of Marrubium alysson and Retama raetam grown in Tunisia.

    Science.gov (United States)

    Hayet, Edziri; Samia, Ammar; Patrick, Groh; Ali, Mahjoub Mohamed; Maha, Mastouri; Laurent, Gutmann; Mighri, Zine; Mahjoub, Laouni

    2007-05-15

    Antibacterial and antifungal activities of extracts obtained from M. alysson, R. raetam were tested using a solid medium technique. We showed that the petroleum ether extract of M. alysson had a Minimum Inhibitory Concentration (MIC) varied from 128 to 2000 microg mL(-1) against different Enterobacteriaceae and antifungal activity against Candida glabrata, Candida albicans, Candida parapsilosis and Candida kreusei with a MIC of 256 microg mL(-1). The ethyl acetate extract of R. raetam showed the best activity against Gram positive organisms with MICs of 128 to 256 microg mL(-1) against methicillin resistant Staphylococcus aureus but low activity against the different Candida species.

  9. checkCIF/PLATON report Datablock: shelx

    Indian Academy of Sciences (India)

    Calculated. Reported. Volume. 1216.4(3). 1216.4(3). Space group. P 21 21 21. P 21 21 21. Hall group. P 2ac 2ab. P 2ac 2ab. Moiety formula C18 H11.27 Se0.36. C18 H11.27 Se0.36. Sum formula. C18 H11.27 Se0.36. C18 H11.27 Se0.36. Mr. 256.21. 256.17. Dx,g cm-3. 1.399. 1.399. Z. 4. 4. Mu (mm-1). 1.788. 1.786. F000.

  10. Advanced On-Board Signal Procesor GaAs Memory.

    Science.gov (United States)

    1983-11-01

    forgetting voltage was VW =2.4-2.5 V. One important parameter Influencing memory cycle times is the minimum pulse width that can write or change the...MRDC41083-29FTR-7 Copy No. 25 0 4 ADVANCED ON-BOARD SIGNAL k) PROCESSOR GaAs MEMORY , FINAL TECHNICAL REPORT FOR THE PERIOD January 21, 1981 through...on the design and fabrication of a 256 bit static memory chip. The development of operational 256 bit memory arrays has been used on three mask sets

  11. Modeling of alpha-particle-induced soft error rate in DRAM

    International Nuclear Information System (INIS)

    Shin, H.

    1999-01-01

    Alpha-particle-induced soft error in 256M DRAM was numerically investigated. A unified model for alpha-particle-induced charge collection and a soft-error-rate simulator (SERS) was developed. The author investigated the soft error rate of 256M DRAM and identified the bit-bar mode as one of dominant modes for soft error. In addition, for the first time, it was found that trench-oxide depth has a significant influence on soft error rate, and it should be determined by the tradeoff between soft error rate and cell-to-cell isolation characteristics

  12. PSI nuclear energy research progress report 1989

    International Nuclear Information System (INIS)

    Alder, H.P.; Wiedemann, K.H.

    1989-01-01

    This report gives on overview on the PSI's nuclear energy research in the field of reactor physics and systems, thermal-hydraulics, materials technology and nuclear processes, waste management program and LWR safety program. It contains also papers dealing with reactor safety, high temperature materials, decontamination, radioactive waste management and materials testing. 74 figs., 20 tabs., 256 refs

  13. Alfred Lameli, Roland Kehrein, Stefan Rabanus (eds): Language and Space. An Internatuinal Handbook of Linguistic Variation. Volume 2. Language Mapping. Part , I, II. Berlin - New York 2010: De Gruyer Mouton, I, 668 s., II, 446 s. (ISBN 978-3-11-019609-2, e-ISBN 978-3-11-021916-6)

    Czech Academy of Sciences Publication Activity Database

    Šipková, Milena

    2015-01-01

    Roč. 7, - (2015), s. 247-256. ISBN 978-83-7654-182-2. ISSN 1898-9276 R&D Projects: GA ČR(CZ) GAP406/11/1786 Keywords : language/linguistic maps * language/linguistic atlases * computerization of language mapping Subject RIV: AI - Linguistics

  14. Rutherford backscatering spectroscopy of optically silver doped amorphous chalcogenides

    Czech Academy of Sciences Publication Activity Database

    Wágner, T.; Krbal, M.; Vlček, M.; Frumar, M.; Peřina, Vratislav; Macková, Anna; Hnatowicz, Vladimír; Kasap, S. O.

    2003-01-01

    Roč. 53, č. 1 (2003), s. A247-A256 ISSN 0011-4626 R&D Projects: GA AV ČR KSK1010104 Keywords : backscatering * Ag2-Ge-S * films Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 0.263, year: 2003

  15. Relationship between Phenotypic and Genotypic Florfenicol Resistance in Escherichia coli

    OpenAIRE

    Singer, Randall S.; Patterson, Sheila K.; Meier, Anne E.; Gibson, Jessica K.; Lee, Hannah L.; Maddox, Carol W.

    2004-01-01

    This study evaluated the relationship between florfenicol resistance and flo genotypes in 1,987 Escherichia coli isolates from cattle. The flo gene was detected in 164 isolates, all of which expressed resistance to florfenicol at MICs of ≥256 μg/ml. The florfenicol MICs for all isolates that lacked flo were ≤16 μg/ml.

  16. Relationship between Phenotypic and Genotypic Florfenicol Resistance in Escherichia coli

    Science.gov (United States)

    Singer, Randall S.; Patterson, Sheila K.; Meier, Anne E.; Gibson, Jessica K.; Lee, Hannah L.; Maddox, Carol W.

    2004-01-01

    This study evaluated the relationship between florfenicol resistance and flo genotypes in 1,987 Escherichia coli isolates from cattle. The flo gene was detected in 164 isolates, all of which expressed resistance to florfenicol at MICs of ≥256 μg/ml. The florfenicol MICs for all isolates that lacked flo were ≤16 μg/ml. PMID:15388477

  17. TURFBLIGHT: An Interactive Turfgrass Management Model for Teaching.

    Science.gov (United States)

    Danneberger, T. K.

    1988-01-01

    Explains a discipline that requires students to become problem solvers in agronomic and pest areas using computer-simulated models. Describes the seven programing areas. The program is written in BASIC totaling 182K bytes for use with MS-DOS 2.0 or an IBM PC requiring 256 K RAM, color monitor, and card. Lists availability. (RT)

  18. The genetics of phytate content and morphological traits in Brassica rapa

    NARCIS (Netherlands)

    Jianjun Zhao, Jianjun

    2007-01-01

    In this thesis molecular genetic studies on Brassica rapa are described based on a collection of 256 accessions and 6 segregating populations. In chapter 2 and 3 the genetic variation and population structure are characterized in a set of genotypes from different geographical origins representing

  19. Education and Social Selection in Ancient China: Semantics, Conceptual Transformation and Social Change

    Science.gov (United States)

    Wu, Meiyao

    2015-01-01

    This paper investigates the transformation in the Zhou dynasty China (1046-256 BC) of the concept of education in relation to the process of social selection, which concerns the distribution both of knowledge and of social ranks. An approach in terms of historical semantics, mainly influenced by Luhmannian sociological theory with some reference…

  20. Serological Evidence Of Rabies Virus Infection Of Slaughter Camels ...

    African Journals Online (AJOL)

    A survey of antibodies against rabies virus was carried out in camels imported for slaughter at Maiduguri municipal abattoir in Borno State, Nigeria. Out of the 256 camel sera tested, 18 (7%) had complement-fixing antibody against rabies virus antigen. Significant difference (P<0.05) in antibody prevalence was observed ...

  1. The Design of a Device for the Generation of a Strong Magnetic Field in an Air Gap Using Permanent Magnets

    Czech Academy of Sciences Publication Activity Database

    Žežulka, Václav; Straka, Pavel

    2017-01-01

    Roč. 22, č. 2 (2017), s. 250-256 ISSN 1226-1750 Institutional support: RVO:67985891 Keywords : magnet ic field * permanent magnet s * NdFeB magnet s * Halbach arrays Subject RIV: BM - Solid Matter Physics ; Magnet ism OBOR OECD: Condensed matter physics (including formerly solid state physics, supercond.) Impact factor: 0.713, year: 2016

  2. Oxidation of aniline with strong and weak oxidants

    Czech Academy of Sciences Publication Activity Database

    Sapurina, I. Yu.; Stejskal, Jaroslav

    2012-01-01

    Roč. 82, č. 2 (2012), s. 256-275 ISSN 1070-3632 R&D Projects: GA AV ČR IAA400500905 Institutional research plan: CEZ:AV0Z40500505 Keywords : polyaniline * conducting polymer * oxidant Subject RIV: CD - Macromolecular Chemistry Impact factor: 0.432, year: 2012

  3. Cloning and expression analysis of a partial LEAFY homologue from ...

    African Journals Online (AJOL)

    A partial homologue of LEAFY, designated as AcLFY (Genebank accession no HQ433335), was isolated from pineapple (Ananas comosus L. cv. Comte de Paris) by PCR. The conserved cDNA fragment of AcLFY is 256 bp in length and contained an open reading frame of 248 bp, which encodes 82 amino acids protein.

  4. 22 CFR 62.1 - Purpose.

    Science.gov (United States)

    2010-04-01

    ... DEPARTMENT OF STATE PUBLIC DIPLOMACY AND EXCHANGES EXCHANGE VISITOR PROGRAM General Provisions § 62.1 Purpose... of 1961 (the “Act”), as amended, Public Law 87-256, 22 U.S.C. 2451, et seq. (1988). The purpose of... Department of State facilitates activities specified in the Act, in part, by designating public and private...

  5. Sharks caught in the protective gill nets off KwaZulu-Natal, South ...

    African Journals Online (AJOL)

    Between 1978 and 1999, a total of 5 626 dusky sharks Carcharhinus obscurus, constituting 20% of the total shark catch, was caught in the protective nets off KwaZulu-Natal, South Africa. The mean annual catch was 256 sharks (SD = 107.5, range 129–571). There was no significant linear trend in catch rate with time.

  6. BEHAVIOR AND PREY OF NESTING RED-SHOULDERED HAWKS IN SOUTHWESTERN OHIO

    Science.gov (United States)

    We used direct observations to quantify prey types, prey delivery rate, and adult and nestling behavior at nests of Red-shouldered Hawks (Buteo lineatus) in suburban southwestern Ohio. Twenty-one nests were observed for a total of 256 hr in 1997-2001. Small mammals made up the ...

  7. Frequency of ipsilateral femoral neck fractures in patients with ...

    African Journals Online (AJOL)

    Background: Ipsilateral associated femoral neck and shaft fractures are reported to occur in 2.5-6% of all femoral shaft fractures. Objective: To establish the frequency of ipsilateral femoral neck fractures amongst all patients presenting with femoral shaft fractures in Mulago Hospital. Methodology: This was a descriptive ...

  8. Antioxidant, antibacterial and cell toxicity effects of polyphenols ...

    African Journals Online (AJOL)

    In this work and for the first time, significant concentrations of total polyphenols and flavonoids from Vitis vinifera L. grape seed extracts were obtained (256.15 ± 17.40 mg GAE/gdm and 14.08 ± 0.64 mg CE/gdm, respectively).The LC/MS analysis revealed richness in procyanidins. For antioxidant, antimicrobial and ...

  9. Investigating Time and Spectral Dependence in Neutron Radiation Environments for Semiconductor Damage Studies

    Science.gov (United States)

    2014-09-18

    Benton, R. Sauer , and L. Kimerling, “Interstitial defect reactions in silicon,” Appl. Phys. Lett., vol. 51, pp. 256–258, 1987. 13. J. Srour, C. Marshall...vol. 55, no. 6, pp. 3055–3059, December 2008. 13. “MCNPX user’s manual , version 2.7.0,” Los Alamos National Laboratory, Albu- querque, NM, Tech

  10. Changes in remnant and high-density lipoproteins associated with hormone therapy and progression of coronary artery disease in postmenopausal women

    Science.gov (United States)

    The effect of hormone therapy (HT) on the plasma concentration of remnant lipoprotein cholesterol (RLP-C) and high density lipoprotein (HDL) subpopulations and the contribution of HT-related changes in these lipoproteins to the progression of coronary heart disease (CHD) were examined in 256 postmen...

  11. Mechanical performance of hemp fiber polypropylene composites at different operating temperatures

    Science.gov (United States)

    Mehdi Tajvidi; Nazanin Motie; Ghonche Rassam; Robert H. Falk; Colin Felton

    2010-01-01

    In order to quantify the effect of temperature on the mechanical properties of hemp fiber polypropylene composites, formulations containing 25% and 40% (by weight) hemp fiber were produced and tested at three representative temperatures of 256, 296, and 336 K. Flexural, tensile, and impact tests, as well as dynamic mechanical analysis, were performed and the reduction...

  12. The Children's Empathy Quotient and Systemizing Quotient: Sex Differences in Typical Development and in Autism Spectrum Conditions

    Science.gov (United States)

    Auyeung, Bonnie; Wheelwright, Sally; Allison, Carrie; Atkinson, Matthew; Samarawickrema, Nelum; Baron-Cohen, Simon

    2009-01-01

    Children's versions of the Empathy Quotient (EQ-C) and Systemizing Quotient (SQ-C) were developed and administered to n = 1,256 parents of typically developing children, aged 4-11 years. Both measures showed good test-retest reliability and high internal consistency. As predicted, girls scored significantly higher on the EQ-C, and boys scored…

  13. Stabilization of Au nanoparticles prepared by laser ablation in chloroform with free-base porphyrin molecules

    Czech Academy of Sciences Publication Activity Database

    Šišková, Karolína; Pfleger, Jiří; Procházka, M.

    2010-01-01

    Roč. 256, č. 9 (2010), s. 2979-2987 ISSN 0169-4332 R&D Projects: GA AV ČR KAN100500652; GA ČR GA203/07/0717 Institutional research plan: CEZ:AV0Z40500505 Keywords : Au nanoparticles * laser ablation * chloroform Subject RIV: CD - Macromolecular Chemistry Impact factor: 1.795, year: 2010

  14. Prevalence of helminthiasis among school children in some rural ...

    African Journals Online (AJOL)

    These included Ascaris lumbricoides (8.2%), hookworm (5.1%) and Trichuris trichiura (3.9%). Multiple infections were however observed in individuals. Of the 338 stool samples examined, 256 were infected giving a prevalence of 75.7%. The prevalence of STHs was significantly higher in males than females in age group 5 ...

  15. Use and Perception of Technology: Sex and Generational Differences in a Community Sample

    Science.gov (United States)

    Van Volkom, Michele; Stapley, Janice C.; Malter, Johnna

    2013-01-01

    A community sample of 431 adults (175 men and 256 women) ages 18 to 91 across three generations (young adults, adults, and older adults) were recruited for the current study. Participants completed a demographic and technology use questionnaire that ascertained their attitudes toward, and use of, various types of technology--such as cellular…

  16. Mode of Action and Synergy of Ceftazidime and Baicalein against ...

    African Journals Online (AJOL)

    Purpose: To investigate the antibacterial activity of baicalein used alone, or in combination with ceftazidime, against Streptococcus pyogenes. ... Results: The MIC of ceftazidime and baicalein against all the S. pyogenes strains were 0.50 and >. 256.0 µg/ml, respectively. .... shaking water bath for 4 h. The cell pellets were.

  17. Virulence, serotype and phylogenetic groups of diarrhoeagenic ...

    African Journals Online (AJOL)

    EAEC (36%) and both EPEC and ATEC (25.6%) are the most detected pathovars (p<0.05). STEC (5.1%), NFEC (7.7) and DAEC (7.7) are less represented. Serogroups are overall diversified (89%), however, serogroups O157, O103 and O86, previously known to be associated with virulence were revealed. Most of the E.

  18. Water Flow through Xylem: An Investigation of a Fluid Dynamics Principle Applied to Plants

    Science.gov (United States)

    Rice, Stanley A.; McArthur, John

    2004-01-01

    A study was conducted to prove that a large blood or xylem vessel could conduct 256 times more fluid than a vessel or a pipe that is four times smaller. The result of this study proved that if arteriosclerosis causes an artery to loose half its effective diameter, the blood flow would be reduced by fifteen-sixteenths.

  19. Risk evaluation of the climatic change impact on secondary Norway spruce stands as exemplified by the Křtiny Training Forest Enterprise

    Czech Academy of Sciences Publication Activity Database

    Čermák, P.; Jankovský, L.; Cudlín, Pavel

    2004-01-01

    Roč. 50, č. 6 (2004), s. 256-262 ISSN 1212-4834 R&D Projects: GA MŠk OC E27.001 Institutional research plan: CEZ:AV0Z6087904 Keywords : climatic change * Norway spruce * risk assessment Subject RIV: GK - Forest ry

  20. Landscape-scale Ips typographus attack dynamics: from monitoring plots to GIS-based disturbance models

    Czech Academy of Sciences Publication Activity Database

    Jakuš, R.; Zajíčková, L.; Cudlín, Pavel; Blaženec, M.; Turčani, M.; Ježík, M.; Střelcová, K.; Lieutier, F.; Schlyter, F.

    2011-01-01

    Roč. 4, - (2011), s. 256-261 ISSN 1971-7458 R&D Projects: GA MŠk OC10022 Institutional research plan: CEZ:AV0Z60870520 Keywords : Spruce * Ips typographus * Attack * Drought * Host Subject RIV: GK - Forest ry Impact factor: 0.507, year: 2011 http://www.sisef.it/iforest/pdf/?id=ifor0589-004

  1. Book Review: Sleep Smart. Get a Life | Brink | South African Journal ...

    African Journals Online (AJOL)

    Book Title: Sleep Smart. Get a Life. Book Author: Christiaan Geldenhuys. Pp. xvi + 256. R130. Rollerbird Press. 2003. ISBN 1-919780-54-8. Full Text: EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT · DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT · http://dx.doi.org/10.4102/sajpsychiatry.v10i2.144 · AJOL African ...

  2. Hungarosoma bokori Verhoeff, 1928 (Diplopoda: Chordeumatida): new insights into its taxonomy, systematics, molecular genetics, biogeography and ecology

    Czech Academy of Sciences Publication Activity Database

    Mock, A.; Tajovský, Karel; Žurovcová, Martina; Jarošová, Andrea; Kocourek, P.; Gruber, J.; Angyal, D.; Spelda, J.

    2016-01-01

    Roč. 4178, č. 2 (2016), s. 234-256 ISSN 1175-5326 Institutional support: RVO:60077344 Keywords : Hungarosomatidae * redescription * gonopods * distribution * cytochrome oxidase 1 gene * DNA barcoding Subject RIV: EG - Zoology Impact factor: 0.972, year: 2016

  3. African Health Sciences: Contact

    African Journals Online (AJOL)

    Principal Contact. Dr James Tumwine Editor-in-Chief. Makerere University Medical School P. O. Box 7072 Kampala Uganda. Phone: 256-41-530020/1. Email: kabaleimc@gmail.com. Support Contact. Pauline Salamula Email: paulinesalamula@gmail.com. ISSN: 1680-6905. AJOL African Journals Online. HOW TO USE ...

  4. Application of an Imaging Fourier-Transform Spectrometer for the Means of Combustion Diagnostics

    Science.gov (United States)

    2012-06-14

    16 InSb Indium Antimonide ...spectra. The Telops MWIR IFTS pairs a Michelson interferometer with a 320x256, Sterling-Cooled Indium Antimonide (InSb) focal plane array (FPA). The...black aluminum in an attempt to provide a uniform background to the scene. The ratio of fuel to air being burned was adjustable and three separate

  5. Non-Destructive Evaluation of Aircraft Structural Components and Composite Materials at DSTO Using Sonic Thermography

    Science.gov (United States)

    2011-02-01

    256 Indium Antimonide (InSb) detector elements with a sensitivity of 20 mK in the operating wavelength band of 3-5 µm. The detectors are operated in...DSTO RESEARCH LIBRARY THESAURUS Nondestructive tests, thermography, fatigue tests, crack propagation, Aluminum alloys, acoustics 19. ABSTRACT This

  6. Prevalence of Fasciolopsis on Cattle Slaughtered at Eke Market ...

    African Journals Online (AJOL)

    Post –mortem examination of the liver and other organs of the slaughtered cattle was also done for Fasciola species. Of the 256 cattle slaughtered at the Eke Market abattoir between May 2011 and April 2012, 93(37.89%) were found to be positive with F. hepatica, 60(23.44%) were infected with F. gigantica. The prevalence ...

  7. Antibodies against Shigella flexneri adhesion molecule outer ...

    African Journals Online (AJOL)

    Milliana et al. Trop J Pharm Res, February 2017; 16(2): 256. Outer membrane proteins (OMPs) include proteins that mediate the attachment of bacteria to the host cell more closely than do pili [6,7]. A 49.8. kDa Shigella dysenteriae hemagglutinin pili protein that serves as an adhesion protein was found previously [8]. Oral.

  8. Prevalence of antibodies to Toxoplasma gondii in dogs from northeastern Portugal

    Science.gov (United States)

    Prevalence of antibodies to Toxoplasma gondii was investigated in 673 domestic dogs from northeastern Portugal, by using the modified agglutination test (MAT) with 1:20 as cut-off for seropositivity; antibodies were found in 256 dogs (38.0%). Differences between seroprevalence levels in males (36.7%...

  9. Genetic loci associated with chronic obstructive pulmonary disease overlap with loci for lung function and pulmonary fibrosis

    NARCIS (Netherlands)

    Hobbs, Brian D; de Jong, Kim; Lamontagne, Maxime; Bossé, Yohan; Shrine, Nick; Artigas, María Soler; Wain, Louise V; Hall, Ian P; Jackson, Victoria E; Wyss, Annah B; London, Stephanie J; North, Kari E; Franceschini, Nora; Strachan, David P; Beaty, Terri H; Hokanson, John E; Crapo, James D; Castaldi, Peter J; Chase, Robert P; Bartz, Traci M; Heckbert, Susan R; Psaty, Bruce M; Gharib, Sina A; Zanen, Pieter; Lammers, Jan W; Oudkerk, Matthijs; Groen, H J; Locantore, Nicholas; Tal-Singer, Ruth; Rennard, Stephen I; Vestbo, Jørgen; Timens, Wim; Paré, Peter D; Latourelle, Jeanne C; Dupuis, Josée; O'Connor, George T; Wilk, Jemma B; Kim, Woo Jin; Lee, Mi Kyeong; Oh, Yeon-Mok; Vonk, Judith M; de Koning, Harry J; Leng, Shuguang; Belinsky, Steven A; Tesfaigzi, Yohannes; Manichaikul, Ani; Wang, Xin-Qun; Rich, Stephen S; Barr, R Graham; Sparrow, David; Litonjua, Augusto A; Bakke, Per; Gulsvik, Amund; Lahousse, Lies; Brusselle, Guy G; Stricker, Bruno H; Uitterlinden, André G; Ampleford, Elizabeth J; Bleecker, Eugene R; Woodruff, Prescott G; Meyers, Deborah A; Qiao, Dandi; Lomas, David A; Yim, Jae-Joon; Kim, Deog Kyeom; Hawrylkiewicz, Iwona; Sliwinski, Pawel; Hardin, Megan; Fingerlin, Tasha E; Schwartz, David A; Postma, Dirkje S; MacNee, William; Tobin, Martin D; Silverman, Edwin K; Boezen, H Marike; Cho, Michael H

    Chronic obstructive pulmonary disease (COPD) is a leading cause of mortality worldwide. We performed a genetic association study in 15,256 cases and 47,936 controls, with replication of select top results (P < 5 × 10(-6)) in 9,498 cases and 9,748 controls. In the combined meta-analysis, we

  10. PDD Symptoms in ADHD, an Independent Familial Trait?

    NARCIS (Netherlands)

    Nijmeijer, J. S.; Hoekstra, P. J.; Minderaa, R. B.; Buitelaar, J. K.; Altink, M. E.; Buschgens, C. J. M.; Fliers, E. A.; Rommelse, N. N. J.; Sergeant, J. A.; Hartman, C. A.

    The aims of this study were to investigate whether subtle PDD symptoms in the context of ADHD are transmitted in families independent of ADHD, and whether PDD symptom familiality is influenced by gender and age. The sample consisted of 256 sibling pairs with at least one child with ADHD and 147

  11. Parallel Human and Animal Models of Blast- and Concussion-Induced Tinnitus and Related Traumatic Brain Injury (TBI)

    Science.gov (United States)

    2013-01-01

    ADHD : attention deficit hyperactivity disorder 59 CANS: central...2006), attention deficit hyperactivity disorder ( ADHD ) (Li et al., 256 2010), developmental and adult-onset stuttering (Chang et al., 2010 ), bipolar...548 children with attention - deficit / hyperactivity disorder : A diffusion tensor imaging study. 549 Neuro-Endocrinol. Lett., 31, 747-753.

  12. 76 FR 53678 - Calleguas Municipal Water District Notice of Surrender of Exemption (Conduit)

    Science.gov (United States)

    2011-08-29

    ... Municipal Water District Notice of Surrender of Exemption (Conduit) Pursuant to section 4.95(a) of the Commission's regulations,\\1\\ Calleguas Municipal Water District filed with the Commission a petition to... Municipal Water District, 87 FERC ] 62,256 (1999). \\3\\ See filing of July 11, 2011 by Calleguas Municipal...

  13. Identification of Biological and Pharmaceutical Mast Cell- and Basophil-Related Targets

    Czech Academy of Sciences Publication Activity Database

    Klein, O.; Ngo-Nyekel, F.; Stefanache, T.; Torres, R.; Salomonsson, M.; Hallgren, J.; Radinger, M.; Bambousková, Monika; Campbell, M.; Cohen-Mor, S.; Dema, B.; Rose, C.G.; Abrink, M.; Charles, N.; Ainooson, G.; Paivandy, A.; Pavlova, V.G.; Serrano-Candelas, E.; Yu, Y.; Hellman, L.; Jensen, B.M.; Van Anrooij, B.; Grootens, J.; Gura, H.K.; Stylianou, M.; Tobio, A.; Blank, U.; Ohrvik, H.; Maurer, M.

    2016-01-01

    Roč. 83, č. 6 (2016), s. 465-472 ISSN 0300-9475 Institutional support: RVO:68378050 Keywords : tyrosine kinase inhibitors * fc-epsilon-ri * in-vivo * inflammatory diseases * dependent activation * midostaurin pkc412 * mediator release * murine basophils * animal-models * mouse models Subject RIV: EB - Genetics ; Molecular Biology OBOR OECD: Immunology Impact factor: 2.256, year: 2016

  14. International Journal of Arts and Humanities(IJAH) Ethiopia

    African Journals Online (AJOL)

    Nneka Umera-Okeke

    Her cultural values, life ethics and mores have become so bastardized .... of Copernicus and Immanuel Kant in the history of philosophy” (256). Instrumentalism ... (149). His suggestion that Ethics, knowledge and even human persons be instrumentalized entails wholesome relativization of almost everything. When ethics.

  15. Decorative a-C:H coatings

    Czech Academy of Sciences Publication Activity Database

    Černý, F.; Jech, V.; Štěpánek, I.; Macková, Anna; Konvičková, S.

    roč. 256, 3 s. 1 (2009), s77-s81 ISSN 0169-4332 Institutional research plan: CEZ:AV0Z10480505 Keywords : a-C:H films * decorative coatings * adhesion Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 1.616, year: 2009

  16. ORIGINAL ARTICLE

    African Journals Online (AJOL)

    The immune status of children under 15 years in the Southwestern region of Nigeria against measles virus was determined using the neutralization test with a view to assessing the herd immunity to the virus in these communities. A total of 256 serum samples collected from children were tested by the beta method of ...

  17. Risk factors for overweight and diabetes mellitus in residential psychiatric patients

    NARCIS (Netherlands)

    Mookhoek, Evert J.; De Vries, Willem A.; Hovens, Johannes E.J.M.; Brouwers, Jacobus R.B.J.; Loonen, Anton J.M.

    2011-01-01

    Objective: To investigate the prevalence of and risk factors for overweight and diabetes mellitus in long-stay psychiatric inpatients. Method: Statistical analysis of data collected from medical, laboratory, and pharmacy files. Results: 80% of the 256 patients were suffering from schizophrenia or

  18. Tepuis. Geomorfologie pískovcového fenoménu vlhkých tropů

    Czech Academy of Sciences Publication Activity Database

    Mikuláš, Radek

    2003-01-01

    Roč. 82, č. 5 (2003), s. 256-262 ISSN 0042-4544 R&D Projects: GA AV ČR IAA3013302 Institutional research plan: CEZ:AV0Z3013912 Keywords : geomofphology * sandstone phenomen Subject RIV: DB - Geology ; Mineralogy http://www.vesmir.cz/clanek.php3?CID=1763

  19. Book Review | Ojong | African Review of Economics and Finance

    African Journals Online (AJOL)

    Microcredit's Real Revolution (La vraie révolution du microcrédit) Jean-Michel Servet. Odile Jacob, Paris, 2015, 256 pp. ISBN: 978 2 73813246 8. Full Text: EMAIL FULL TEXT EMAIL FULL TEXT · DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT · AJOL African Journals Online. HOW TO USE AJOL... for Researchers · for ...

  20. The Leporid Datum: a late Miocene biotic marker

    Czech Academy of Sciences Publication Activity Database

    Flynn, L. J.; Winkler, A. J.; Erbaeva, M.; Alexeeva, N.; Anders, U.; Angelone, Ch.; Čermák, Stanislav; Fladerer, F. A.; Kraatz, B.; Ruedas, L. A.; Ruf, I.; Tomida, Y.; Veitschegger, K.; Zhang, Z.

    2014-01-01

    Roč. 44, 3/4 (2014), s. 164-176 ISSN 0305-1838 R&D Projects: GA ČR GA205/09/0184 Institutional support: RVO:67985831 Keywords : dispersal * immigration * late Neogene * molecular tree * palaeoecology Subject RIV: EG - Zoology Impact factor: 4.256, year: 2014

  1. 76 FR 11161 - Fisheries of the Exclusive Economic Zone Off Alaska; Sablefish Managed Under the Individual...

    Science.gov (United States)

    2011-03-01

    ... DEPARTMENT OF COMMERCE National Oceanic and Atmospheric Administration 50 CFR Part 679 [Docket Nos. 0910131362-0087-02 and 0910131363-0087-02] RIN 0648-XA256 Fisheries of the Exclusive Economic Zone Off Alaska; Sablefish Managed Under the Individual Fishing Quota Program AGENCY: National Marine Fisheries Service (NMFS...

  2. Knowledge, perception and practice of injection safety and ...

    African Journals Online (AJOL)

    Only 25.6% (20/78) with previous needle prick injury had postexposure prophylaxis. All doctors and laboratory scientists always use gloves compared to 94.8% (91/96) nurses while handling patients or materials. Following the intervention, a significantly high number became aware of post-exposure prophylaxis and color ...

  3. Polypyrrole prepared in the presence of methyl orange and ethyl orange: nanotubes versus globules in conductivity enhancement

    Czech Academy of Sciences Publication Activity Database

    Li, Yu; Bober, Patrycja; Trchová, Miroslava; Stejskal, Jaroslav

    2017-01-01

    Roč. 5, č. 17 (2017), s. 4236-4245 ISSN 2050-7526 R&D Projects: GA ČR(CZ) GA16-02787S Institutional support: RVO:61389013 Keywords : polypyrrole * nanotubes * conducting polymer Subject RIV: CD - Macromolecular Chemistry OBOR OECD: Polymer science Impact factor: 5.256, year: 2016

  4. Journal of Chemical Sciences | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    Home; Journals; Journal of Chemical Sciences; Volume 121; Issue 3. Issue front cover thumbnail. Volume 121, Issue 3. May 2009, pages 235-369. pp 235-256 Perspective Article. Quest for new materials: Inorganic chemistry plays a crucial role · J Gopalakrishnan Rohini Mani · More Details Abstract Fulltext PDF. There is an ...

  5. Book Reviews •• Boekbesprekings

    African Journals Online (AJOL)

    On Writing, Reading, and Dyslexia. Semmelweis Lecture, sponsored by the American-Hungarian Medical Association,. November 1968. By A. Linksz, M.D. Pp. viii + 256. $9;75. New York and London: Grune & Stratton. 1973. The author, of Hungarian descent, is a Professor of Ophthal- mology who has become fascinated ...

  6. Understanding Collagen Organization in Breast Tumors to Predict and Prevent Metastasis

    Science.gov (United States)

    2015-11-01

    Dschietzig et al., “The pregnancy hormone relaxin binds to and acti- vates the human glucocorticoid receptor,” Ann. N. Y. Acad. Sci. 1041, 256–271...more fibrous, such as pancreatic cancer. Conclusions In summary, we have identified the F/B, a simple and easily automated, intensity-based

  7. Peptide Microarray Analysis of the Cross-talk Between O-GlcNAcylation and Tyrosine Phosphorylation

    NARCIS (Netherlands)

    Shi, Jie; Tomašič, Tihomir; Sharif, Suhela; Brouwer, Arwin J; Anderluh, Marko; Ruijtenbeek, Rob; Pieters, Roland J

    2017-01-01

    O-GlcNAcylation of proteins regulates important cellular processes. A few reports noted that O-GlcNAcylation exhibits cross-talk with tyrosine phosphorylation. With an activity-based microarray analysis of 256 tyrosine kinase peptide substrates, we found that phosphorylation of 6 peptides by Jak2

  8. Placental Vascular Tree as Biomarker of Autism/ASD Risk

    Science.gov (United States)

    2013-09-01

    The International Federation of Placental Associates (IFPA 2013), Whistler , CA, September 11-14, 2013 1. Chorionic vascular structure and...compromise and inflammation. Am J Obstet Gynecol. 2008 Sep; 199(3):256.e1-9. 4. James GBW, Brown H, editors. Scaling in Biology. Santa Fe Institute

  9. Teacher Candidates' Learning Strategies and Academic Self-Efficacy Levels: Is There a Relation between the Two?

    Science.gov (United States)

    Akçaoglu, Mustafa Öztürk

    2016-01-01

    The current study aimed to identify teacher candidates' learning strategies and academic self-efficacy levels. Furthermore, the correlations between these variables and gender and departments were looked into. The study was mainly descriptive and correlational. The sample of the study consisted of 256 teacher candidates enrolled at a faculty of…

  10. Fe-Zn intermetallic phases prepared by diffusion annealing and spark-plasma sintering

    Czech Academy of Sciences Publication Activity Database

    Pokorný, P.; Cinert, Jakub; Pala, Zdeněk

    2016-01-01

    Roč. 50, č. 2 (2016), s. 253-256 ISSN 1580-2949 R&D Projects: GA ČR GB14-36566G Institutional support: RVO:61389021 Keywords : Fe-Zn intermetallics * spark-plasma sintering * diffusion annealing * phase composition * hardness Subject RIV: JK - Corrosion ; Surface Treatment of Materials Impact factor: 0.436, year: 2016

  11. Economics of cutting wood parts with a laser under optical image analyzer control

    Science.gov (United States)

    Henry E. Huber; Charles W. McMillin; Arthur Rasher

    1982-01-01

    A financial analysis using discounted cash-flow techniques was used to determine the economic feasibility of a new laser lumber processing system for use in a furniture rough mill. The projected cost of the system was $790,000 which would replace conventional crosscut and ripsaws costing $256,856. A financial analysis was made assuming only a 5 percent yield increase...

  12. Thermal Properties of Alkyl-Triethylammonium bis{(Trifluoromethyl)Sulfonyl}Imide Ionic Liquids

    Czech Academy of Sciences Publication Activity Database

    Machanová, Karolina; Wagner, Zdeněk; Andresová, Adéla; Rotrekl, Jan; Boisset, A.; Jacquemin, J.; Bendová, Magdalena

    2015-01-01

    Roč. 44, 3-4 (2015), s. 790-810 ISSN 0095-9782 Institutional support: RVO:67985858 Keywords : ionic liquids * differential scanning calorimetry * mathematical gnostics Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 1.256, year: 2015

  13. All-organic liquid crystalline radicals with a spin unit in the outer position of a bent-core system

    Czech Academy of Sciences Publication Activity Database

    Bajzíková, A.; Kohout, M.; Tarábek, Ján; Svoboda, J.; Novotná, Vladimíra; Vejpravová, Jana; Pociecha, D.; Gorecka, E.

    2016-01-01

    Roč. 4, č. 48 (2016), s. 11540-11547 ISSN 2050-7526 R&D Projects: GA ČR GA15-02843S Institutional support: RVO:61388963 ; RVO:68378271 Keywords : mesogenic cores * ester groups * rigid core Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 5.256, year: 2016

  14. Factors Associated with Middle School Students' Perceptions of the Quality of School-Based Sexual Health Education

    Science.gov (United States)

    Byers, E. Sandra; Sears, Heather A.; Foster, Lyndsay R.

    2013-01-01

    This paper examines factors associated with middle school students' perceptions of the quality of the sexual health education (SHE) they received at school. Participants were 478 predominately White young people (256 girls, 222 boys) in grades 6-8 who completed a survey assessing their demographic characteristics; dating and sexual experience; and…

  15. Development of Shyness: Relations with Children's Fearfulness, Sex, and Maternal Behavior

    Science.gov (United States)

    Eggum, Natalie D.; Eisenberg, Nancy; Spinrad, Tracy L.; Reiser, Mark; Gaertner, Bridget M.; Sallquist, Julie; Smith, Cynthia L.

    2009-01-01

    The relations of childhood fearfulness (observed and adult reported) and adult-reported shyness at 18 (n = 256) and 30 (n = 230) months of age were assessed. Fear was positively related to shyness concurrently and longitudinally, but slightly more consistently at 18 months. The moderating roles of observed maternal sensitivity and children's sex…

  16. The effects of wildfire and environmental amenities on property values in northwest Montana, USA

    Science.gov (United States)

    Kyle M. Stetler; Tyron J. Venn; David E. Calkin

    2010-01-01

    This study employed the hedonic price framework to examine the effects of 256 wildfires and environmental amenities on home values in northwest Montana between June 1996 and January 2007. The study revealed environmental amenities, including proximity to lakes, national forests, Glacier National Park and golf courses, have large positive effects on property values in...

  17. 77 FR 12305 - Agency Information Collection Request; 30-Day Public Comment Request

    Science.gov (United States)

    2012-02-29

    ... collection of follow-up data from a self-administered questionnaire, which will be analyzed to determine... Leadership Training (PCLT)/ Youth and TeenPEP. Control Group Youth. Total 3,932* 2,439* (2,012) (1,286... Control Group Youth. Princeton Center for Participating 427 1 36/60 256 Leadership Training (PCLT)/ Youth...

  18. Direct measurement of free radicals in the brain cortex and the blood serum after nociceptive stimulation in rats

    Czech Academy of Sciences Publication Activity Database

    Rokyta, R.; Stopka, Pavel; Holeček, V.; Křikavá, K.; Pekárková, I.

    2004-01-01

    Roč. 25, č. 4 (2004), s. 252-256 ISSN 0172-780X R&D Projects: GA ČR GA203/01/0944 Institutional research plan: CEZ:AV0Z4032918 Keywords : EPR method * free radicals * pain Subject RIV: CA - Inorganic Chemistry Impact factor: 1.048, year: 2004

  19. Yadav et al., Afr J Tradit Complement Altern Med. (2014) 11(2):249 ...

    African Journals Online (AJOL)

    cadewumi

    Yadav et al., Afr J Tradit Complement Altern Med. (2014) 11(2):249-256 ..... In recent years the popularity of complementary medicine has increased. Much interest has been focused on exploring ... delayed the induction of glucose intolerance and euglycemia in high fructose diet fed rats. Diabegon treatment inhibits the ...

  20. Journal of Development and Communication Studies Vol. 4. No. 2 ...

    African Journals Online (AJOL)

    Thomas Gill

    of odourless fufu`( X =4.61) and high quality garri ( X =4.43) had the highest mean adoption indices among programme ... Some technologies related to snacks production from mixture of high quality cassava flour. (HQCF) and ... Complementary feeding-enriched 1.19 .32 2.56 .70 4.17* .82 3.27* .48 2.86. Increased ...

  1. Confocal microscopy reveals Myzitiras and Vthela morphotypes as new signatures of malignancy progression

    Czech Academy of Sciences Publication Activity Database

    Veselý, Pavel; Rösel, D.; Paňková, D.; Tolde, O.; Blase, C.; Matoušková, E.; Folk, P.; Brábek, J.; Bereiter-Hahn, J.

    2009-01-01

    Roč. 31, č. 3 (2009), s. 102-106 ISSN 0161-0457 R&D Projects: GA MŠk(CZ) LC06061 Institutional research plan: CEZ:AV0Z50520514 Keywords : dynamic morphology * cinemicroscopy * breast carcinoma * malignancy progression Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 1.256, year: 2009

  2. Linear and non-linear response of late Neogene glacial cycles to obliquity forcing and implications for the Milankovitch theory

    NARCIS (Netherlands)

    Lourens, L.J.; Becker, J.; Bintanja, R.; Hilgen, F.J.; Tuenter, E.; Wal, R.S.W. van de; Ziegler, M.

    2010-01-01

    Constraints are given for the geometry and time lags of the prominent obliquity-paced glacial stages 100, 98 and 96, which mark a major phase in Northern Hemisphere (NH) glaciations during the late Pliocene (2.56–2.4 Ma ago). For this purpose a high-resolution benthic δ18O record was constructed

  3. Influence of Labeling on Ratings of Infants: A Prematurity Prejudice.

    Science.gov (United States)

    Miller, Michael D.; Ottinger, Donald R.

    Two full term and two preterm infants were videotaped while being administered six items from the Brazelton Scale. Infants were assigned alternately the labels "preterm" and "fullterm" and shown to a group of 256 undergraduate students. It was hypothesized that: (1) subjects who view infants labeled as preterm would rate them lower on objective…

  4. Effect of spatial noise of medical grade Liquid Crystal Displays (LCD) on the detection of micro-calcification

    Science.gov (United States)

    Roehrig, Hans; Fan, Jiahua; Dallas, William J.; Krupinski, Elizabeth A.; Johnson, Jeffrey

    2009-08-01

    This presentation describes work in progress that is the result of an NIH SBIR Phase 1 project that addresses the wide- spread concern for the large number of breast-cancers and cancer victims [1,2]. The primary goal of the project is to increase the detection rate of microcalcifications as a result of the decrease of spatial noise of the LCDs used to display the mammograms [3,4]. Noise reduction is to be accomplished with the aid of a high performance CCD camera and subsequent application of local-mean equalization and error diffusion [5,6]. A second goal of the project is the actual detection of breast cancer. Contrary to the approach to mammography, where the mammograms typically have a pixel matrix of approximately 1900 x 2300 pixels, otherwise known as FFDM or Full-Field Digital Mammograms, we will only use sections of mammograms with a pixel matrix of 256 x 256 pixels. This is because at this time, reduction of spatial noise on an LCD can only be done on relatively small areas like 256 x 256 pixels. In addition, judging the efficacy for detection of breast cancer will be done using two methods: One is a conventional ROC study [7], the other is a vision model developed over several years starting at the Sarnoff Research Center and continuing at the Siemens Corporate Research in Princeton NJ [8].

  5. An Examination of Science High School Students' Motivation towards Learning Biology and Their Attitude towards Biology Lessons

    Science.gov (United States)

    Kisoglu, Mustafa

    2018-01-01

    The purpose of this study is to examine motivation of science high school students towards learning biology and their attitude towards biology lessons. The sample of the study consists of 564 high school students (308 females, 256 males) studying at two science high schools in Aksaray, Turkey. In the study, the relational scanning method, which is…

  6. Fernando Bouza Álvarez, «Dásele licencia y privilegio». Don Quijote y la aprobación de libros en el Siglo de Oro

    Directory of Open Access Journals (Sweden)

    Gonzalo Pontón

    2013-05-01

    Full Text Available Review of Fernando Bouza Álvarez, «Dásele licencia y privilegio». Don Quijote y la aprobación de libros en el Siglo de Oro, Akal, Madrid, 2012, 256 pp. ISBN: 978-84-460-3228-1.

  7. Growth and characterization of Yb.sup.3+./sup.-doped YAlO.sub.3./sub. fiber single crystals grown by the modified micro-pulling-down method

    Czech Academy of Sciences Publication Activity Database

    Shim, J. B.; Yoshikawa, A.; Nikl, Martin; Solovieva, Natalia; Pejchal, Jan; Yoon, D. H.; Fukuda, T.

    2003-01-01

    Roč. 256, - (2003), s. 298-304 ISSN 0022-0248 R&D Projects: GA AV ČR IAA1010305 Institutional research plan: CEZ:AV0Z1010914 Keywords : charge transfer luminescence * micro-pulling-down method * yttrium aluminate * Yb 3+ doping Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 1.414, year: 2003

  8. A migration-driven model for the historical spread of leprosy in medieval Eastern and Central Europe

    Czech Academy of Sciences Publication Activity Database

    Donoghue, H. D.; Taylor, G. M.; Marcsik, A.; Molnár, E.; Pálfi, G.; Pap, I.; Teschler-Nicola, M.; Pinhasi, R.; Erdal, Y. S.; Velemínský, P.; Likovský, Jakub; Belcastro, M. G.; Mariotti, V.; Riga, A.; Rubini, M.; Zaio, P.; Besra, G. S.; Lee, O. Y.-C.; Wu, H. H.T.; Minnikin, D. E.; Bull, I. D.; O'Grady, J.; Spigelman, M.

    2015-01-01

    Roč. 31, April (2015), s. 250-256 ISSN 1567-1348 Institutional support: RVO:67985912 Keywords : ancient DNA * genotyping * human migrations * lipid biomarkers * Mycobacterium leprae * Mycobacterium tuberculosis Subject RIV: AC - Archeology, Anthropology, Ethnology Impact factor: 2.591, year: 2015

  9. Zirconium doped titania:destruction of warfare agents and photocatalytic degradation of orange 2 dye

    Czech Academy of Sciences Publication Activity Database

    Štengl, Václav; Bakardjieva, Snejana; Murafa, Nataliya; Opluštil, F.

    2008-01-01

    Roč. 1, č. 1 (2008), s. 1-7 ISSN 1875-1806 R&D Projects: GA MPO 1H-PK2/56 Institutional research plan: CEZ:AV0Z40320502 Keywords : anatase * mustard gas * soman Subject RIV: CA - Inorganic Chemistry

  10. Biologically induced formation of realgar deposits in soil

    Czech Academy of Sciences Publication Activity Database

    Drahota, P.; Mikutta, C.; Falteisek, L.; Duchoslav, V.; Klementová, Mariana

    2017-01-01

    Roč. 218, DEC (2017), s. 237-256 ISSN 0016-7037 Institutional support: RVO:61388980 Keywords : Arsenic speciation * Microbial communities * Realgar * Sulfur isotopes * Wetland soil * X-ray absorption spectroscopy Subject RIV: CA - Inorganic Chemistry OBOR OECD: Inorganic and nuclear chemistry Impact factor: 4.609, year: 2016

  11. immunological arthritis Prevalence of biochemical and abnormalities ...

    African Journals Online (AJOL)

    1991-02-02

    Feb 2, 1991 ... Tile prevalence of biochemical and immunological abnormali- ties was studied in a group of 256 patients with rheumatoid arthritis (104 coloureds, 100 whites and 52 blacks). The most common biochemical abnormalities detected were a reduction in the serum creatinine value (43,4%), raised globulins (39 ...

  12. Journal of Chemical Sciences | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    Volume 121, Issue 3. May 2009, pages 235-369. pp 235-256 Perspective Article. Quest for new materials: Inorganic chemistry plays a crucial role ... Synthesis and structural characterization of a novel peroxo bridged dinuclear cobalt(III) complex of succinimide showing three varieties of hydrogen bonding interactions.

  13. Mixed infection of black currant (Ribes Nigrum L.) plants with blackcurrant reversion associated virus and rhabdovirus-like particles with symptoms of black currant reversion disease

    Czech Academy of Sciences Publication Activity Database

    Přibylová, Jaroslava; Špak, Josef; Kubelková, Darina

    2002-01-01

    Roč. 46, - (2002), s. 253-256 ISSN 0001-723X R&D Projects: GA ČR GA522/02/0040 Institutional research plan: CEZ:AV0Z5051902 Keywords : plant diseases * viruses * black currant Subject RIV: EE - Microbiology, Virology Impact factor: 0.660, year: 2002

  14. Relationships between Feeding Problems, Behavioral Characteristics and Nutritional Quality in Children with ASD

    Science.gov (United States)

    Johnson, Cynthia R.; Turner, Kylan; Stewart, Patricia A.; Schmidt, Brianne; Shui, Amy; Macklin, Eric; Reynolds, Anne; James, Jill; Johnson, Susan L.; Manning Courtney, Patty; Hyman, Susan L.

    2014-01-01

    Many children with autism spectrum disorders (ASD) have co-occurring feeding problems. However, there is limited knowledge about how these feeding habits are related to other behavioral characteristics ubiquitous in ASD. In a relatively large sample of 256 children with ASD, ages 2-11, we examined the relationships between feeding and mealtime…

  15. Growth response of downy birch (Betula pubescens) to moisture treatment at an cut-over peat bog in the Šumava Mts., Czech Republic

    Czech Academy of Sciences Publication Activity Database

    Lanta, Vojtěch; Hazuková, I.

    2005-01-01

    Roč. 42, - (2005), s. 247-256 ISSN 0003-3847 R&D Projects: GA ČR GD206/03/H034 Institutional research plan: CEZ:AV0Z6005908 Keywords : Betula pubescens * cut-over peatland * increment Subject RIV: EF - Botanics Impact factor: 0.315, year: 2005

  16. South African Medical Journal - Vol 90, No 3 (2000)

    African Journals Online (AJOL)

    Randomised controlled trial of the efficacy of misoprostol used as a cervical ripening agent prior to termination of pregnancy in the first trimester · EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. Eric T M de Jonge, Rachel Jewkes, Jonathan Levin, Helen Rees, 256-261 ...

  17. Kinetics of the photochromic reaction in a polymer containing azobenzene groups

    Czech Academy of Sciences Publication Activity Database

    Mancheva, I.; Zhivkov, I.; Nešpůrek, Stanislav

    2005-01-01

    Roč. 7, č. 1 (2005), s. 253-256 ISSN 1454-4164 R&D Projects: GA MŠk 1P04OCD14.30 Grant - others:Bulgarian Ministry of Education and Science(BG) x-1322 Keywords : photochromism * azobenzene * relaxation properties Subject RIV: BG - Nuclear, Atomic and Molecular Physics, Colliders Impact factor: 1.138, year: 2005

  18. Combining Decision Diagrams and SAT Procedures for Efficient Symbolic Model Checking

    DEFF Research Database (Denmark)

    Williams, Poul Frederick; Biere, Armin; Clarke, Edmund M.

    2000-01-01

    , combined with BDDs and SAT-solvers to perform satisfiability checking. As a result we are able to model check systems for which standard BDD-based methods fail. For example, we model check a liveness property of a 256 bit shift-and-add multiplier and we are able to find a previously undetected bug...

  19. Implementing CBM: SQL-Tutor after Fifteen Years

    Science.gov (United States)

    Mitrovic, Antonija; Ohlsson, Stellan

    2016-01-01

    SQL-Tutor is the first constraint-based tutor. The initial conference papers about the system were published in 1998 (Mitrovic 1998a, 1998b, 1998c), with an "IJAIED" paper published in 1999 (Mitrovic and Ohlsson, "International Journal Artificial Intelligence in Education," 10(3-4), 238-256, 1999). We published another…

  20. Culturally Competent Diabetes Self-Management Education for Mexican Americans: The Starr County Border Health Initiative.

    Science.gov (United States)

    Brown, Sharon A.; Garcia, Alexandra A.; Kouzekanani, Kamiar; Hanis, Craig L.

    2002-01-01

    In a culturally competent diabetes self-management intervention in Starr County, Texas, bilingual Mexican American nurses, dieticians, and community workers provided weekly instruction on nutrition, self-monitoring, exercise and other self-care topics. A biweekly support group promoted behavior change. Interviews and examinations with 256 Mexican…