WorldWideScience

Sample records for mendelevium 254

  1. Chemical properties of mendelevium

    International Nuclear Information System (INIS)

    Hulet, E.K.

    1980-01-01

    The isotope 256 Md is nearly always employed for chemical studies of this element. This nuclide can be made by bombardment of fractions of a microgram of 254 Es with intense alpha-particle beams which will produce about 10 6 atoms of 256 Md with a half-life of 77 minutes. Even with the most intense ion beams and the largest available quantities of target isotope, about 10 6 atoms at a time is all the Md that can be produced for chemical studies. This lack of sufficient sample size coupled with the very short lifetimes of the few atoms produced has severly restricted the gathering and broadening of our knowledge concerning the properties of Md and the heavier elements. To illustrate, the literature contains a mere eleven references to the chemical studies of Md, and none of these deal with bulk properties associated with element found in solid phases. Some of these findings are: Md was found to be more volatile than other actinide metals which lead to the belief that it is divalent in the metallic state; separation of Md from the other actinides can be accomplished either by reduction of Md to the divalent state or by chromatographic separations with Md remaining in the tripositive state; extraction of Md with bis(2-ethylhexyl)phosphoric acid is much poorer than the extraction of the neighboring tripositive actinides; attempts to oxidize Md wih sodium bismuthate failed to show any evidence of Md 4+ ; standard reduction potential of Md 3+ was found to be close to -0.1 volt; Md 3+ can be reduced to Md(Hg) by sodium amalgams and by electrolysis; the electrochemical behavior of Md is very similar to that of Fm and can be summarized in the equation, Md 2+ + 2e - = Md(Hg), and E 0 = 1.5 V

  2. Symposium commemorating the 25th anniversary of the discovery of mendelevium

    Energy Technology Data Exchange (ETDEWEB)

    Seaborg, G.T. (ed.)

    1980-01-01

    The Symposium honoring the 25th Anniversary of the discovery of mendelevium was held at the Lawrence Berkeley Laboratory on March 28, 1980. The following three papers were presented: Chemical Properties of Mendelevium; Nuclear Properties of Mendelevium; and Radioactive Decay of Md Isotopes. Besides these papers there were introductory remarks, reminiscences, and concluding remarks.

  3. Studies on some physico-chemical properties of the monovalent mendelevium

    International Nuclear Information System (INIS)

    Kamenskaya, A.N.; Mikheev, N.B.; Novichenko, V.L.

    1979-01-01

    It was established that Md 3+ reduced by Yb 2+ or Eu 2+ co-crystallizes with NaCl in water-ethanol solutions. The co-crystallization coefficient is independent of the relative quantities of the solid and liquid phase, of the concentration of the reducing agent in the concentration range from 1 to 8 mg/ml, and of the concentration of the chloride ion in the solution. Basing on the knowledge of anomalous mixed crystals and on the thermodynamical analysis of the formation of truly isomorphical solid solutions and anomalous mixed crystals, it was shown that mendelevium co-crystallizing with NaCl is in its monovalent state. Besides, it was concluded that up to 1.5 M chloride concentration the monovalent mendelevium does not form stable chloride complexes in water-ethanol solutions. (author)

  4. Chemical properties of mendelevium

    Energy Technology Data Exchange (ETDEWEB)

    Hulet, E.K.

    1980-11-01

    Even with the most intense ion beams and the largest available quantities of target isotope, about 10/sup 6/ atoms at a time is all the Md that can be produced for chemical studies. This lack of sufficient sample size coupled with the very short lifetimes of the few atoms produced has severely restricted the gathering and the broadness of our knowledge concerning the properties of Md and the heavier elements. To illustrate, the literature contains a mere eleven references to the chemical studies of Md, and none of these deal with bulk properties associated with the element bound in solid phases. Some of these findings are: Md was found to be more volatile than other actinide metals which lead to the belief that it is divalent in the metallic state; separation of Md from the other actinides can be accomplished either by reduction of Md/sup 3 +/ to the divalent state or by chromatographic separations with Md remaining in the tripositive state; extraction of Md/sup 2 +/ with bis(2-ethylhexyl)phosphoric acid is much poorer than the extraction of the neighboring tripositive actinides; attempts to oxidize Md/sup 3 +/ with sodium bismuthate failed to show any evidence for Md/sup 4 +/; reduction potential of Md/sup 3 +/ was found to be close to -0.1 volt; Md/sup 3 +/ can be reduced to Md(Hg) by sodium amalgams and by electrolysis; the electrochemical behavior of Md is very similar to that of Fm and can be summarized in the equation, Md/sup 2 +/ + 2e/sup -/ = Md(Hg) and E/sup 0/ = -1.50 V.; and Md cannot be reduced to a monovalent ion with Sm/sup 2 +/.

  5. Chemical properties of mendelevium

    International Nuclear Information System (INIS)

    Hulet, E.K.

    1980-11-01

    Even with the most intense ion beams and the largest available quantities of target isotope, about 10 6 atoms at a time is all the Md that can be produced for chemical studies. This lack of sufficient sample size coupled with the very short lifetimes of the few atoms produced has severely restricted the gathering and the broadness of our knowledge concerning the properties of Md and the heavier elements. To illustrate, the literature contains a mere eleven references to the chemical studies of Md, and none of these deal with bulk properties associated with the element bound in solid phases. Some of these findings are: Md was found to be more volatile than other actinide metals which lead to the belief that it is divalent in the metallic state; separation of Md from the other actinides can be accomplished either by reduction of Md 3+ to the divalent state or by chromatographic separations with Md remaining in the tripositive state; extraction of Md 2+ with bis(2-ethylhexyl)phosphoric acid is much poorer than the extraction of the neighboring tripositive actinides; attempts to oxidize Md 3+ with sodium bismuthate failed to show any evidence for Md 4+ ; reduction potential of Md 3+ was found to be close to -0.1 volt; Md 3+ can be reduced to Md(Hg) by sodium amalgams and by electrolysis; the electrochemical behavior of Md is very similar to that of Fm and can be summarized in the equation, Md 2+ + 2e - = Md(Hg) and E 0 = -1.50 V.; and Md cannot be reduced to a monovalent ion with Sm 2+

  6. 7 CFR 254.1 - General purpose.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 4 2010-01-01 2010-01-01 false General purpose. 254.1 Section 254.1 Agriculture... GENERAL REGULATIONS AND POLICIES-FOOD DISTRIBUTION ADMINISTRATION OF THE FOOD DISTRIBUTION PROGRAM FOR INDIAN HOUSEHOLDS IN OKLAHOMA § 254.1 General purpose. This part sets the requirement under which...

  7. 14 CFR 254.2 - Applicability.

    Science.gov (United States)

    2010-01-01

    ... 14 Aeronautics and Space 4 2010-01-01 2010-01-01 false Applicability. 254.2 Section 254.2 Aeronautics and Space OFFICE OF THE SECRETARY, DEPARTMENT OF TRANSPORTATION (AVIATION PROCEEDINGS) ECONOMIC REGULATIONS DOMESTIC BAGGAGE LIABILITY § 254.2 Applicability. This part applies to any air carrier that...

  8. 14 CFR 254.4 - Carrier liability.

    Science.gov (United States)

    2010-01-01

    ... 14 Aeronautics and Space 4 2010-01-01 2010-01-01 false Carrier liability. 254.4 Section 254.4... REGULATIONS DOMESTIC BAGGAGE LIABILITY § 254.4 Carrier liability. On any flight segment using large aircraft... large aircraft, an air carrier shall not limit its liability for provable direct or consequential...

  9. 20 CFR 632.254 - Program startup.

    Science.gov (United States)

    2010-04-01

    ... 20 Employees' Benefits 3 2010-04-01 2010-04-01 false Program startup. 632.254 Section 632.254 Employees' Benefits EMPLOYMENT AND TRAINING ADMINISTRATION, DEPARTMENT OF LABOR INDIAN AND NATIVE AMERICAN EMPLOYMENT AND TRAINING PROGRAMS Summer Youth Employment and Training Programs § 632.254 Program startup...

  10. 27 CFR 44.254 - Shipping containers.

    Science.gov (United States)

    2010-04-01

    ... 27 Alcohol, Tobacco Products and Firearms 2 2010-04-01 2010-04-01 false Shipping containers. 44.254 Section 44.254 Alcohol, Tobacco Products and Firearms ALCOHOL AND TOBACCO TAX AND TRADE BUREAU... Requirements § 44.254 Shipping containers. Each shipping case, crate, or other container, in which cigars are...

  11. 36 CFR 254.6 - Segregative effect.

    Science.gov (United States)

    2010-07-01

    ... 36 Parks, Forests, and Public Property 2 2010-07-01 2010-07-01 false Segregative effect. 254.6... ADJUSTMENTS Land Exchanges § 254.6 Segregative effect. (a) If a proposal is made to exchange Federal lands... segregative effect terminates as follows: (1) Automatically, upon issuance of a patent or other document of...

  12. 36 CFR 254.10 - Bargaining; arbitration.

    Science.gov (United States)

    2010-07-01

    ... 36 Parks, Forests, and Public Property 2 2010-07-01 2010-07-01 false Bargaining; arbitration. 254... LANDOWNERSHIP ADJUSTMENTS Land Exchanges § 254.10 Bargaining; arbitration. (a) Unless the parties to an exchange... exchange, the appraisal(s), at the initiative of either party, must be submitted to arbitration, unless, in...

  13. 21 CFR 558.254 - Famphur.

    Science.gov (United States)

    2010-04-01

    ... Animal Feeds § 558.254 Famphur. (a) Approvals. Type A medicated articles: 13.2 and 33.3 percent to 000061... or exposure to cholinesterase-inhibiting drugs, pesticides, or chemicals. (c) Related tolerances. See...

  14. 48 CFR 53.303-DD-254 - Department of Defense DD Form 254, Contract Security Classification Specification.

    Science.gov (United States)

    2010-10-01

    ... Illustrations of Forms 53.303-DD-254 Department of Defense DD Form 254, Contract Security Classification... 48 Federal Acquisition Regulations System 2 2010-10-01 2010-10-01 false Department of Defense DD Form 254, Contract Security Classification Specification. 53.303-DD-254 Section 53.303-DD-254 Federal...

  15. 36 CFR 254.15 - Title standards.

    Science.gov (United States)

    2010-07-01

    ...) Conveyances of lands from the United States are made by patent, quitclaim deed, or deed and without express or implied warranties, except as to hazardous substances pursuant to § 254.3 of this subpart. (c) Title... of the existing use(s) authorized under the terms of the grant, permit, easement, or lease. The non...

  16. A multidetector scintillation camera with 254 channels

    DEFF Research Database (Denmark)

    Sveinsdottir, E; Larsen, B; Rommer, P

    1977-01-01

    A computer-based scintillation camera has been designed for both dynamic and static radionuclide studies. The detecting head has 254 independent sodium iodide crystals, each with a photomultiplier and amplifier. In dynamic measurements simultaneous events can be recorded, and 1 million total coun...

  17. 14 CFR 254.5 - Notice requirement.

    Science.gov (United States)

    2010-01-01

    ... REGULATIONS DOMESTIC BAGGAGE LIABILITY § 254.5 Notice requirement. In any flight segment using large aircraft... large aircraft, an air carrier shall provide to passengers, by conspicuous written material included on or with its ticket, either: (a) Notice of any monetary limitation on its baggage liability to...

  18. 14 CFR 254.1 - Purpose.

    Science.gov (United States)

    2010-01-01

    ... of air carrier liability for loss, damage, or delay in the carriage of passenger baggage and requires air carriers to provide certain types of notice to passengers. ... REGULATIONS DOMESTIC BAGGAGE LIABILITY § 254.1 Purpose. The purpose of this part is to establish rules for the...

  19. A multidetector scintillation camera with 254 channels

    DEFF Research Database (Denmark)

    Sveinsdottir, E; Larsen, B; Rommer, P

    1977-01-01

    A computer-based scintillation camera has been designed for both dynamic and static radionuclide studies. The detecting head has 254 independent sodium iodide crystals, each with a photomultiplier and amplifier. In dynamic measurements simultaneous events can be recorded, and 1 million total counts...

  20. Uretritis masculina Estudio prospectivo de 254 casos

    Directory of Open Access Journals (Sweden)

    Federico Diaz G.

    1983-06-01

    Full Text Available La uretritis no gonocócica (UNG fue la forma predominante (78,0% en una serie de 254 hombres con síndrome de uretritis, estudiados prospectivamente en 1982. La Trichomonas vaginalis estuvo presente en el 4.0% de los casos de UNG. Con base en la comparación entre los pacientes de uretritis gonocócica (UG y los de UNO, puede proponerse un perfil de los segundo que oriente al médico en su sospecha diagnóstica: mayor probabilidad de no hallar secreción uretral o de que Ésta sea escasa y de las modalidades acuosa, mucoide o mixta; también mayor probabilidad de un período de incubación por encima de 9 días y de una evolución superior a un mes. A pesar de tales indicios hay mucha superposición clínica entre las dos formas de uretritis por lo que sigue siendo valedera la recomendación de recurrir al Gram como procedimiento confiable y económico para establecer el diagnóstico diferencial. Se llama la atención hacia la necesidad de disponer de datos sobre uretritis en otros grupos socioeconómicos y de investigar aspectos como la frecuencia en nuestro medio del síndrome de uretritis postgonocócica (U PG.

  1. 19 CFR 10.254 - Certificate of Origin.

    Science.gov (United States)

    2010-04-01

    ... Eradication Act Extension of Atpa Benefits to Tuna and Certain Other Non-Textile Articles § 10.254 Certificate... article described in § 10.253(a) being exported from an ATPDEA beneficiary country to the United States...

  2. 40 CFR 25.4 - Information, notification, and consultation responsibilities.

    Science.gov (United States)

    2010-07-01

    ... DRINKING WATER ACT, AND THE CLEAN WATER ACT § 25.4 Information, notification, and consultation... portions if the list is subdivided, shall receive timely and periodic notification of the availability of...

  3. Susceptibility to Stress Corrosion Cracking of 254SMO SS

    Directory of Open Access Journals (Sweden)

    De Micheli Lorenzo

    2002-01-01

    Full Text Available The susceptibility to stress corrosion cracking (SCC of solubilized and sensitized 254SMO SS was studied in sodium chloride, and sodium fluoride solutions at 80 °C and sulfuric acid solutions in presence of sodium chloride at 25 °C. The influence of salt concentration, pH values and the addition of thiosulfate was examined. The susceptibility to SCC was evaluated by Slow Strain Rate Tests (SSRT, at 1.5 x 10-6 s-1 strain rate. The behavior of 254SMO was compared to those of AISI 316L SS and Hastelloy C276. 254SMO showed an excellent resistance to SCC in all conditions, except in the more acidic solutions (pH <= 1 where, in the sensitized conditions, intergranular stress corrosion cracking occurred.

  4. 36 CFR 254.33 - Road rights-of-way.

    Science.gov (United States)

    2010-07-01

    ... parcels subject to conveyance under this subpart are limited to those which are substantially surrounded by lands not owned by the United States. (b) Forest Service officials shall consider public road... Section 254.33 Parks, Forests, and Public Property FOREST SERVICE, DEPARTMENT OF AGRICULTURE LANDOWNERSHIP...

  5. 28 CFR 25.4 - Record source categories.

    Science.gov (United States)

    2010-07-01

    ... check has been or will be contributed voluntarily by Federal, state, local, and international criminal....4 Judicial Administration DEPARTMENT OF JUSTICE DEPARTMENT OF JUSTICE INFORMATION SYSTEMS The National Instant Criminal Background Check System § 25.4 Record source categories. It is anticipated that...

  6. 16 CFR 254.2 - Deceptive trade or business names.

    Science.gov (United States)

    2010-01-01

    ... PRIVATE VOCATIONAL AND DISTANCE EDUCATION SCHOOLS § 254.2 Deceptive trade or business names. (a) It is... misleads or deceives prospective students as to the nature of the school, its accreditation, programs of... school. (c) If an industry member conducts its instruction by correspondence, or other form of distance...

  7. 16 CFR 254.0 - Scope and application.

    Science.gov (United States)

    2010-01-01

    ... secondary schools or institutions of higher education offering at least a 2-year program of accredited... AND DISTANCE EDUCATION SCHOOLS § 254.0 Scope and application. (a) The Guides in this part apply to..., marketing, and sale of courses or programs of instruction offered by private vocational or distance...

  8. 7 CFR 1220.254 - Patents, copyrights, inventions, and publications.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 10 2010-01-01 2010-01-01 false Patents, copyrights, inventions, and publications... Miscellaneous § 1220.254 Patents, copyrights, inventions, and publications. (a) Any patents, copyrights..., franchising, or other uses of such patents, copyrights, inventions, or publications, inure to the benefit of...

  9. Photodegradation and ecotoxicology of acyclovir in water under UV254and UV254/H2O2processes.

    Science.gov (United States)

    Russo, Danilo; Siciliano, Antonietta; Guida, Marco; Galdiero, Emilia; Amoresano, Angela; Andreozzi, Roberto; Reis, Nuno M; Li Puma, Gianluca; Marotta, Raffaele

    2017-10-01

    The photochemical and ecotoxicological fate of acyclovir (ACY) through UV 254 direct photolysis and in the presence of hydroxyl radicals (UV 254 /H 2 O 2 process) were investigated in a microcapillary film (MCF) array photoreactor, which provided ultrarapid and accurate photochemical reaction kinetics. The UVC phototransformation of ACY was found to be unaffected by pH in the range from 4.5 to 8.0 and resembled an apparent autocatalytic reaction. The proposed mechanism included the formation of a photochemical intermediate (ϕ ACY  = (1.62 ± 0.07)·10 -3  mol ein -1 ) that further reacted with ACY to form by-products (k' = (5.64 ± 0.03)·10 -3  M -1  s -1 ). The photolysis of ACY in the presence of hydrogen peroxide accelerated the removal of ACY as a result of formation of hydroxyl radicals. The kinetic constant for the reaction of OH radicals with ACY (k OH/ACY ) determined with the kinetic modeling method was (1.23 ± 0.07)·10 9  M -1  s -1 and with the competition kinetics method was (2.30 ± 0.11)·10 9  M -1  s -1 with competition kinetics. The acute and chronic effects of the treated aqueous mixtures on different living organisms (Vibrio fischeri, Raphidocelis subcapitata, D. magna) revealed significantly lower toxicity for the samples treated with UV 254 /H 2 O 2 in comparison to those collected during UV 254 treatment. This result suggests that the addition of moderate quantity of hydrogen peroxide (30-150 mg L -1 ) might be a useful strategy to reduce the ecotoxicity of UV 254 based sanitary engineered systems for water reclamation. Copyright © 2017 Elsevier Ltd. All rights reserved.

  10. 47 CFR 1.254 - Nature of the hearing; burden of proof.

    Science.gov (United States)

    2010-10-01

    ... 47 Telecommunication 1 2010-10-01 2010-10-01 false Nature of the hearing; burden of proof. 1.254 Section 1.254 Telecommunication FEDERAL COMMUNICATIONS COMMISSION GENERAL PRACTICE AND PROCEDURE Hearing Proceedings Hearing and Intermediate Decision § 1.254 Nature of the hearing; burden of proof. Any hearing upon...

  11. 17 CFR 230.254 - Solicitation of interest document for use prior to an offering statement.

    Science.gov (United States)

    2010-04-01

    ... subject to the antifraud provisions of the federal securities laws. No solicitation or acceptance of money... document for use prior to an offering statement. 230.254 Section 230.254 Commodity and Securities Exchanges...-Conditional Small Issues Exemption § 230.254 Solicitation of interest document for use prior to an offering...

  12. 37 CFR 254.3 - Compulsory license fees for coin-operated phonorecord players.

    Science.gov (United States)

    2010-07-01

    ... coin-operated phonorecord players. 254.3 Section 254.3 Patents, Trademarks, and Copyrights COPYRIGHT... ROYALTY RATE FOR COIN-OPERATED PHONORECORD PLAYERS § 254.3 Compulsory license fees for coin-operated phonorecord players. (a) Commencing January 1, 1982, the annual compulsory license fee for a coin-operated...

  13. 3C 254: the alignment effect and unification schemes

    Science.gov (United States)

    Bremer, M. N.

    1997-01-01

    3C 254 is a radio-loud quasar at z=0.734. Optical line and continuum emission from the underlying galaxy is clearly extended and aligned with the radio axis; the object shows the so-called `alignment effect' which is often seen in powerful radio galaxies. This is the clearest case yet of the continuum alignment effect in a radio-loud quasar. The object is one of the most lobe-dominated 3C quasars; the significance of the aligned emission in this source is discussed in terms of orientation-based unification schemes for radio-loud quasars and radio galaxies. 3C 254 is a very asymmetric radio source and it is shown that the radio structure on the side with the shortest nucleus-hotspot distance is interacting with the emission-line gas surrounding the quasar. It is also shown that the quasar is surrounded by an overdensity of faint objects, consistent with a cluster or group of galaxies around the object.

  14. Human Factors evaluation of LCS 254 and 255

    International Nuclear Information System (INIS)

    Goffe, L.; Held, J.E.

    1993-01-01

    This report includes the results of the Human Factors evaluation of the local control stations (LCS) 254 and 255 performed by Savannah River Technology Center (SRTC) Human Factors. Recommendations are included in order that the panel designs will be upgraded to comply with human engineering design guidelines. Figures 1 and 2 are included as examples of recommended changes. Also, consideration was given to including the proposed engineering changes which are currently on-going for LCS 255. Appendix A identifies the human engineering requirements from NUREG-0700 which were used in the evaluation process, and the areas of the design which do not comply with the guidelines. Those areas of the panel design which fail to comply with the human engineering guidelines are label location, label content, location aids, panel layout, and control display integration. Each of these design deficiencies and proposed corrections are described in this report

  15. 75 FR 6319 - Proposed Amendment of Low Altitude Area Navigation Route T-254; Houston, TX

    Science.gov (United States)

    2010-02-09

    ... Amendment of Low Altitude Area Navigation Route T-254; Houston, TX AGENCY: Federal Aviation Administration... altitude Area Navigation (RNAV) route T-254 in the Houston, TX, terminal area by eliminating the segment... safety and the efficient use of the navigable airspace in the Houston, TX, terminal area. DATES: Comments...

  16. 75 FR 18047 - Amendment of Low Altitude Area Navigation Route T-254; Houston, TX

    Science.gov (United States)

    2010-04-09

    ...-254; Houston, TX AGENCY: Federal Aviation Administration (FAA), DOT. ACTION: Final rule. SUMMARY: This action amends low altitude Area Navigation (RNAV) route T-254 in the Houston, TX, terminal area by... Houston, TX, terminal area. DATES: Effective Dates: 0901 UTC, June 3, 2010. The Director of the Federal...

  17. 48 CFR 53.303-254-53.303-347 - Illustration of agency forms.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 2 2010-10-01 2010-10-01 false Illustration of agency... FEDERAL ACQUISITION REGULATION (CONTINUED) CLAUSES AND FORMS FORMS Illustrations of Forms 53.303-254—53.303-347 Illustration of agency forms. Editorial Note: The forms appearing in sections 53.303-DD-254...

  18. 37 CFR 2.54 - Requirements for drawings submitted on paper.

    Science.gov (United States)

    2010-07-01

    ... submitted on paper. 2.54 Section 2.54 Patents, Trademarks, and Copyrights UNITED STATES PATENT AND TRADEMARK... drawings submitted on paper. The drawing must meet the requirements of § 2.52. In addition, in a paper submission, the drawing should: (a) Be on non-shiny white paper that is separate from the application; (b) Be...

  19. cdc-25.4, a Caenorhabditis elegans Ortholog of cdc25, Is Required for Male Mating Behavior

    Directory of Open Access Journals (Sweden)

    Sangmi Oh

    2016-12-01

    Full Text Available Cell division cycle 25 (cdc25 is an evolutionarily conserved phosphatase that promotes cell cycle progression. Among the four cdc25 orthologs in Caenorhabditis elegans, we found that cdc-25.4 mutant males failed to produce outcrossed progeny. This was not caused by defects in sperm development, but by defects in male mating behavior. The cdc-25.4 mutant males showed various defects during male mating, including contact response, backing, turning, and vulva location. Aberrant turning behavior was the most prominent defect in the cdc-25.4 mutant males. We also found that cdc-25.4 is expressed in many neuronal cells throughout development. The turning defect in cdc-25.4 mutant males was recovered by cdc-25.4 transgenic expression in neuronal cells, suggesting that cdc-25.4 functions in neurons for male mating. However, the neuronal morphology of cdc-25.4 mutant males appeared to be normal, as examined with several neuronal markers. Also, RNAi depletion of wee-1.3, a C. elegans ortholog of Wee1/Myt1 kinase, failed to suppress the mating defects of cdc-25.4 mutant males. These findings suggest that, for successful male mating, cdc-25.4 does not target cell cycles that are required for neuronal differentiation and development. Rather, cdc-25.4 likely regulates noncanonical substrates in neuronal cells.

  20. Degradation of highly consumed fluoroquinolones, penicillins and cephalosporins in distilled water and simulated hospital wastewater by UV254and UV254/persulfate processes.

    Science.gov (United States)

    Serna-Galvis, Efraím A; Ferraro, Franklin; Silva-Agredo, Javier; Torres-Palma, Ricardo A

    2017-10-01

    In this work, three penicillins (ampicillin "AMP", oxacillin "OXA" and cloxacillin "CLO"), two cephalosporins (cephalexin "CPX" and cephadroxyl "CPD") and three fluoroquinolones (levofloxacin "LEV", norfloxacin "NOR" and ciprofloxacin "CIP") were initially treated by UV 254 and persulfate activated by UV 254 (UV/PS). Significant differences in degradation kinetics under UV 254 irradiation were found. Photodegradation followed the order: OXA > CPX > CPD > CLO > CIP > NOR > AMP ≫ LEV. Then, in order to study the participation of direct photolysis and reactive oxygen species (ROS) in photodegradation a model antibiotic of each class (OXA, CPX and CIP) was considered. OXA and CPX were mainly degraded by direct photolysis, whereas the CIP removal involved ROS and photolysis. On the other hand, the persulfate addition (UV/PS process) improved the removals due to sulfate radical formation, especially, in the case of antibiotics with lower photodegradation levels (i.e. LEV, AMP and NOR). Computational calculations on the representative antibiotics were applied to determine the regions susceptible to electrophilic attacks by degrading agents. The functional groups of OXA and CPX followed the reactivity order: thioether ≫ β-lactam ring > benzene ring. For CIP, the piperazyl moiety presented higher reactivity than the quinolone ring. Also, the antimicrobial activity (AA) evolution during the treatments was tested. In the cases of CPX and CIP, both UV 254 and UV/PS removed the AA; which were associated with structural changes in their reactive moieties: β-lactam ring and piperazyl ring, respectively. However, in the case of OXA only the UV/PS system decreased AA, which was attributed to transformations in its penicillin electron-rich nucleus (thioether + β-lactam). Finally, the applicability of UV 254 and UV/PS was assessed using synthetic hospital wastewater (HWW). The processes comparison showed that for practical purposes, OXA and CIP in HWW should

  1. Effect of temperature and relative humidity on ultraviolet (UV 254) inactivation of airborne porcine respiratory and reproductive syndrome virus.

    Science.gov (United States)

    Cutler, Timothy D; Wang, Chong; Hoff, Steven J; Zimmerman, Jeffrey J

    2012-09-14

    The objective of this research was to estimate the effects of temperature and relative humidity on the inactivation of airborne porcine reproductive and respiratory syndrome (PRRS) virus by ultraviolet light (UV(254)). Aerosols of PRRS virus were exposed to one of four doses of UV(254) under nine combinations of temperature (n=3) and relative humidity (n=3). Inactivation constants (k), defined as the absolute value of the slope of the linear relationship between the survival fraction of the microbial population and the UV(254) exposure dose, were estimated using the random coefficient model. The associated UV(254) half-life dose for each combination of environmental factors was determined as (log(10)2/k) and expressed as UV(254) mJ per unit volume. The effects of UV(254) dose, temperature, and relative humidity were all statistically significant, as were the interactions between UV(254) dose × temperature and UV(254) dose × relative humidity. PRRS virus was more susceptible to ultraviolet as temperature decreased; most susceptible to ultraviolet inactivation at relative humidity between 25% and 79%, less susceptible at relative humidity ≤ 24%, and least susceptible at ≥ 80% relative humidity. The current study allows for calculating the dose of UV(254) required to inactivate airborne PRRS virus under various laboratory and field conditions using the inactivation constants and UV(254) half-life doses reported therein. Copyright © 2012 Elsevier B.V. All rights reserved.

  2. Ground-State Band and Deformation of the Z = 102 Isotope N 254

    International Nuclear Information System (INIS)

    Reiter, P.; Khoo, T.L.; Lister, C.J.; Seweryniak, D.; Ahmad, I.; Alcorta, M.; Carpenter, M.P.; Cizewski, J.A.; Davids, C.N.; Gervais, G.; Greene, J.P.; Henning, W.F.; Janssens, R.V.; Lauritsen, T.; Siem, S.; Sonzogni, A.A.; Sullivan, D.; Uusitalo, J.; Wiedenhoever, I.; Amzal, N.; Butler, P.A.; Chewter, A.J.; Greenlees, P.T.; Herzberg, R.; Jones, G.D.; Cizewski, J.A.; Ding, K.Y.; Fotiades, N.; Fox, J.D.; Korten, W.; Leino, M.; Vetter, K.; Siem, S.

    1999-01-01

    The ground-state band of the Z=102 isotope 254 No has been identified up to spin 14, indicating that the nucleus is deformed. The deduced quadrupole deformation, β=0.27 , is in agreement with theoretical predictions. These observations confirm that the shell-correction energy responsible for the stability of transfermium nuclei is partly derived from deformation. The survival of 254 No up to spin 14 means that its fission barrier persists at least up to that spin. copyright 1999 The American Physical Society

  3. Cold valleys in the radioactive decay of 248−254Cf isotopes

    Indian Academy of Sciences (India)

    Abstract. Based on the concept of cold valley in cold fission and fusion, we have in- vestigated the cluster decay process in 248−254Cf isotopes. In addition to alpha particle minima, other deep minima occur for S, Ar and Ca clusters. It is found that inclusion of proximity potential does not change the position of minima but ...

  4. 6 CFR 25.4 - Designation of qualified anti-terrorism technologies.

    Science.gov (United States)

    2010-01-01

    ... 6 Domestic Security 1 2010-01-01 2010-01-01 false Designation of qualified anti-terrorism... REGULATIONS TO SUPPORT ANTI-TERRORISM BY FOSTERING EFFECTIVE TECHNOLOGIES § 25.4 Designation of qualified anti-terrorism technologies. (a) General. The Under Secretary may Designate as a Qualified Anti-Terrorism...

  5. Cold valleys in the radioactive decay of 248-254 Cf isotopes

    Indian Academy of Sciences (India)

    Based on the concept of cold valley in cold fission and fusion, we have investigated the cluster decay process in 248-254Cf isotopes. In addition to alpha particle minima, other deep minima occur for S, Ar and Ca clusters. It is found that inclusion of proximity potential does not change the position of minima but minima ...

  6. 16 CFR 254.6 - Deceptive use of diplomas, degrees, or certificates.

    Science.gov (United States)

    2010-01-01

    ... 16 Commercial Practices 1 2010-01-01 2010-01-01 false Deceptive use of diplomas, degrees, or... GUIDES FOR PRIVATE VOCATIONAL AND DISTANCE EDUCATION SCHOOLS § 254.6 Deceptive use of diplomas, degrees, or certificates. (a) It is deceptive for an industry member to issue a degree, diploma, certificate...

  7. 37 CFR 254.2 - Definition of coin-operated phonorecord player.

    Science.gov (United States)

    2010-07-01

    ... 37 Patents, Trademarks, and Copyrights 1 2010-07-01 2010-07-01 false Definition of coin-operated... CONGRESS COPYRIGHT ARBITRATION ROYALTY PANEL RULES AND PROCEDURES ADJUSTMENT OF ROYALTY RATE FOR COIN-OPERATED PHONORECORD PLAYERS § 254.2 Definition of coin-operated phonorecord player. As used in this part...

  8. Removal of UV 254 nm matter and nutrients from a photobioreactor-wetland system.

    Science.gov (United States)

    Wu, Yonghong; He, Jiangzhou; Hu, Zhengyi; Yang, Linzhang; Zhang, Naiming

    2011-10-30

    The output of organic pollutants and excessive nutrients in intensive agricultural areas has frequently occurred, which easily lead to pollution events such as harmful algal blooms in downstream aquatic ecosystems. A photobioreactor-wetland system was applied to remove UV(254 nm) matter and dissolved nutrients discharged from an intensive agricultural area in the Kunming region of western China. The photobioreactor-wetland system was composed of two main components: an autotrophic photobioreactor with replanted macrophytes and a constructed wetland. The results showed that there was a significant correlation between UV(245)(nm) absorbance and chemical oxygen demand (COD) concentration in the effluent of the agricultural ecosystem. When the hydraulic load of the photobioreactor-wetland system was 500 m(3)day(-1), the UV(254 nm) absorbance was dramatically reduced, and dissolved nutrients such as TDP, NO(3)-N and NH(4)-N were effectively removed. The overall average removal efficiencies were as follows in relatively steady-state conditions: UV(254 nm) matter (66%), TDP (71%), NO(3)-N (75%) and NH(4)-N (65%). Simpson's diversity index of zoobenthos indicated that the system could increase the zoobenthic diversity and improve the growth conditions of the zoobenthos habitat. The results also showed that the photobioreactor-wetland system could remove the UV(254 nm) matter and dissolved nutrients, providing a promising bio-measure for reducing the risk of pollution event occurrences in downstream surface waters. Copyright © 2010 Elsevier B.V. All rights reserved.

  9. 30 CFR 254.26 - What information must I include in the “Worst case discharge scenario” appendix?

    Science.gov (United States)

    2010-07-01

    ... case discharge scenarioâ appendix? 254.26 Section 254.26 Mineral Resources MINERALS MANAGEMENT SERVICE... and environmental importance, if any, specified in the appropriate Area Contingency Plan(s). (d) A...) and owner, quantity, and capabilities of the equipment. You also must include the effective daily...

  10. Coulomb dissociation of {sup 8}B at 254 A MeV

    Energy Technology Data Exchange (ETDEWEB)

    Suemmerer, K.; Boue, F.; Baumann, T.; Geissel, H.; Hellstroem, M.; Koczon, P.; Schwab, E.; Schwab, W.; Senger, P.; Surowiecz, A. [Gesellschaft fuer Schwerionenforschung (GSI), Darmstadt (Germany); Iwasa, N.; Ozawa, A. [Gesellschaft fuer Schwerionenforschung (GSI), Darmstadt (Germany)]|[RIKEN Institute of Physical and Chemical Research, Saitama (Japan); Surowka, G. [Gesellschaft fuer Schwerionenforschung (GSI), Darmstadt (Germany)]|[Jagiellonian Univ., Krakow (Poland). Inst. of Physics; Blank, B.; Czajkowski, S.; Marchand, C.; Pravikoff, M.S. [Centre d`Etudes Nucleaires de Bordeaux-Gradignan, 33 (France); Foerster, A.; Lauer, F.; Oeschler, H.; Speer, J.; Sturm, C.; Uhlig, F.; Wagner, A. [Technische Univ. Darmstadt (Germany); Gai, M. [Connecticut Univ., Storrs, CT (United States). Dept. of Physics; Grosse, E. [Inst. fuer Kern- und Hadronenphysik, Forschungszentrum Rossendorf, Dresden (Germany); Kohlmeyer, B. [Philipps Univ., Marburg (Germany). Fachbereich Physik; Kulessa, R.; Walus, W. [Jagiellonian Univ., Krakow (Poland). Inst. of Physics; Motobayashi, T. [Rikkyo Univ., Tokyo (Japan). Dept. of Physics; Teranishi, T. [RIKEN Institute of Physical and Chemical Research, Saitama (Japan)

    1998-06-01

    As an alternative method for determining the astrophysical S-factor for the {sup 7}Be(p,{gamma}){sup 8}B reaction we have measured the Coulomb dissociation of {sup 8}B at 254 A MeV. From our preliminary results, we obtain good agreement with both the accepted direct-reaction measurements and the low-energy Coulomb dissociation study of Iwasa et al. performed at about 50 A MeV. (orig.)

  11. Release of substances from the human blood lymphocytes after UV irradiation (254 nm)

    International Nuclear Information System (INIS)

    Samojlova, K.A.; Mironova, A.P.; Artsishevskaya, R.A.

    1984-01-01

    Irradiation of lymphocyte suspension by non-lethal UV doses (254 nm) increases by 11-15% the release of substances from the certain physicochemical properties of which ape similar to the properties of glycoproteins. Simultaneuously in solution surrounding the cells photochemical changes in proteins are recorded. which might be albumins. The data obtained are considered from the viewpoint of initial mechanisms of UV-radiation healing effect when it is applied to human body surface and during blood transfusion, which has been irradiated by UV

  12. Release of substances from the human blood lymphocytes after UV irradiation (254 nm)

    Energy Technology Data Exchange (ETDEWEB)

    Samojlova, K.A.; Mironova, A.P.; Artsishevskaya, R.A. (AN SSSR, Leningrad. Inst. Tsitologii)

    1984-01-01

    Irradiation of lymphocyte suspension by non-lethal UV doses (254 nm) increases by 11-15% the release of substances from the certain physicochemical properties of which are similar to the properties of glycoproteins. Simultaneuously in solution surrounding the cells photochemical changes in proteins are recorded. which might be albumins. The data obtained are considered from the viewpoint of initial mechanisms of UV-radiation healing effect when it is applied to human body surface and during blood transfusion, which has been irradiated by UV.

  13. Release of cell coat glycoproteins from the human blood lymphocytes after UV irradiation (254 nm)

    Energy Technology Data Exchange (ETDEWEB)

    Artsishevskaya, R.A.; Mironova, A.P.; Samojlova, K.A. (AN SSSR, Leningrad. Inst. Tsitologii)

    1984-01-01

    Irradiation of the human peripheric blood lymphocytes by UV rays (254 nm) in nonlethal doses is accompanied by the decrease (8-13%) of sorption by them of man's life time of alcyane blue dya which selectively is bound by glycoproteins, glycolipides and acid mucopolysaccharides of cellular surface. As simultaneously the yield from substance cells by some properties similar to glycoproteins is intensified by 9-15%, an assumption is made that from the surface of UV-irradiated lymphocites glycoproteins are disorbed. This effect is discussed in connection with possible primary mechanisms of medical-sanitation effect of UV irradiation.

  14. Understanding the different rotational behaviors of $^{252}$No and $^{254}$No in terms of high-order deformation

    CERN Document Server

    Liu, H L; Walker, P M

    2012-01-01

    Total Routhian surface calculations have been performed to investigate rapidly rotating transfermium nuclei, the heaviest nuclei accessible by detailed spectroscopy experiments. The observed fast alignment in $^{252}$No and slow alignment in $^{254}$No are well reproduced by the calculations incorporating high-order deformations. The different rotational behaviors of $^{252}$No and $^{254}$No can be understood for the first time in terms of $\\beta_6$ deformation that decreases the energies of the $\

  15. A comparison of mammalian cell sensitivity to either 254 nm or artificial 'solar' simulated radiation

    International Nuclear Information System (INIS)

    Gill, R.F.; Coohill, T.P.

    1987-01-01

    The sensitivity of six mammalian cell strains to either germicidal (254 nm) or artificial ''solar'' simulated radiation was tested. The solar simulator used had an output similar, in some respects, to natural sunlight. Cellular capacity for Herpes simplex virus production was used as the assay procedure. The tested cells were a strain of African green monkey kidney cells and five human skin fibroblast cell strains. The latter included a ''normal'' cell strain, and four photosensitive cell strains; three of which were strains of xeroderma pigmentosum cells, and one strain of Bloom's syndrome cells. When comparing the D 10 values, the different cell strains varied by a factor of six in response to germicidal radiation, but only by a factor of two to artificial ''solar'' simulated radiation. The relative sensitivity of the cells to either type of radiation also varied from 1.7 to 10.9. Large variations in response occurred even among the xeroderma pigmentosum cell strains. These responses suggest that mammalian cell sensitivity to 254 nm radiation may not be a true indicator of a cell's responses to natural sunlight. (author)

  16. Kinetics and mechanism investigation on the destruction of oxytetracycline by UV-254nm activation of persulfate.

    Science.gov (United States)

    Liu, Yiqing; He, Xuexiang; Fu, Yongsheng; Dionysiou, Dionysios D

    2016-03-15

    Oxytetracycline (OTC), an important broad-spectrum antibiotic, has been detected extensively in various environmental systems, which may have a detrimental impact on ecosystem and human health through the development of drug resistant bacteria and pathogens. In this study, the degradation of OTC was evaluated by UV-254nm activated persulfate (PS). The observed UV fluence based pseudo first-order rate constant (kobs) was found to be the highest at near neutral pH conditions (pH 5.5-8.5). Presence of various natural water constituents had different effects on OTC degradation, with a significant enhancement in the presence of bicarbonate or Cu(2+). Limited elimination of total organic carbon (TOC) and PS was observed during the mineralization of OTC. Transformation byproducts in the presence and absence of hydroxyl radical scavenging agent tert-butanol (t-BuOH) were identified using ultra-high definition accurate-mass quadrupole time-of-flight liquid chromatography/mass spectrometer (LC-QTOF/MS). Potential OTC degradation mechanism was subsequently proposed revealing four different reaction pathways by SO4(-) reaction including hydroxylation (+16Da), demethylation (-14Da), decarbonylation (-28Da) and dehydration (-18Da). This study suggests that UV-254nm/PS is a promising treatment technology for the control of water pollution caused by emerging contaminants such as OTC. Copyright © 2015 Elsevier B.V. All rights reserved.

  17. Repair of near (365 nm)- and far (254 nm)- UV damage to bacteriophage of Escherichia coli

    International Nuclear Information System (INIS)

    Tyrrell, R.M.

    1979-01-01

    Intact bacteriophages were irradiated at 365 nm or 254 nm and then analyzed for DNA photoproducts or injected into their bacterial host to test susceptibility of the damage to both phage and host-cell mediated repair systems. Both thymine dimers and single-strand breaks were induced in the phage DNA by 365 nm radiation. The dimers appeared to be the major lethal lesion in both repair deficient bacteriophage T4 and bacteriophage lambda after 254 nm or 365 nm irradiation. Damage induced in T4 by either wavelength was equally susceptible to x-gene reactivation. v-gene reactivation acted on a larger fraction of the near-UV damage. The host-cell mediated photo-reactivation system was only slightly less effective for near-UV damage but host-cell reactivation (survival of phage lambda on uvr + and uvr - host) was effective against a far smaller section of near-UV damage than far-UV damage. Weigle-reactivation (far-UV induced) of near-UV damage to phage lambda was not observed. The results suggested that unless the near-UV damaged phage DNA is repaired immediately after injection, the lesions rapidly lose their susceptibility to repair with a consequent loss of activity of the phage particles. (author)

  18. Printed wax masks for 254 nm deep-UV pattering of PMMA-based microfluidics

    KAUST Repository

    Fan, Yiqiang

    2012-01-13

    This paper reports a new technique for masking deep-UV exposure of poly(methyl methacrylate) (PMMA) using a printed wax mask. This technique provides an inexpensive and bulk fabrication method for PMMA structures. The technique involves the direct printing of the mask onto a polymer sheet using a commercial wax printer. The wax layer was then transferred to a PMMA substrate using a thermal laminator, exposed using deep-UV (with a wavelength of 254 nm), developed in an IPA:water solution, and completed by bonding on a PMMA cap layer. A sample microfluidic device fabricated with this method is also presented, with the microchannel as narrow as 50 μm. The whole process is easy to perform without the requirement for any microfabrication facilities. © 2012 IOP Publishing Ltd.

  19. Stability of trans-fermium elements at high spin: Measuring the fission barrier of 254No

    International Nuclear Information System (INIS)

    Henning, Greg

    2012-01-01

    Super heavy nuclei provide opportunities to study nuclear structure near three simultaneous limits: in charge Z, spin I and excitation energy E*. These nuclei exist only because of a fission barrier, created by shell effects. It is therefore important to determine the fission barrier and its spin dependence B f (I), which gives information on the shell energy E(shell)(I). Theoretical calculations predict different fission barrier heights from B f (I = 0) = 6.8 MeV for a macro-microscopic model to 8.7 MeV for Density Functional Theory calculations using the Gogny or Skyrme interactions. Hence, a measurement of B f provides a test for theories.To investigate the fission barrier, an established method is to measure the rise of fission with excitation energy, characterized by the ratio of decay widths Γ(fission)/Γ(total), using transfer reactions. However, for heavy elements such as 254 No, there is no suitable target for a transfer reaction. We therefore rely on the complementary decay widths ratio Γ γ /Γ(fission) and its spin dependence, deduced from the entry distribution (I, E*).Measurements of the gamma-ray multiplicity and total energy for 254 No have been performed with beam energies of 219 and 223 MeV in the reaction 208 Pb( 48 Ca,2n) at ATLAS (Argonne Tandem Linac Accelerator System). The 254 No gamma rays were detected using the Gammasphere array as a calorimeter - as well as the usual high resolution γ-ray detector. Coincidences with evaporation residues at the Fragment Mass Analyzer focal plane separated 254 No gamma rays from those from fission fragments, which are ≥ 10 6 more intense. From this measurement, the entry distribution - i.e. the initial distribution of I and E* - is constructed. Each point (I,E*) of the entry distribution is a point where gamma decay wins over fission and, therefore, gives information on the fission barrier. The measured entry distributions show an increase in the maximum spin and excitation energy from 219 to 223 Me

  20. Alimentation impact of treatments of 254 oropharyngeal cancers (1998-2003).

    Science.gov (United States)

    Buiret, Guillaume; Daveau, Clémentine; Landry, Guillaume; Colin, Carole; Pignat, Jean-Christian; Poupart, Marc

    2011-01-01

    Objective. To analyze the functional impact of the various possible treatments of oropharyngeal squamous cell carcinomas to find the main prognostic factors of dysphagia induced by these treatments. Patients. Clinical data from 254 patients treated for squamous cell carcinoma of the oropharynx between 1998 and 2003 were retrospectively analyzed. A multivariate model enabled us to evaluate the role of each potentially harmful factor on swallowing. Main Outcome Measures. The significant factors influencing the consumption of liquid, pasty, and normal food were the same: the initial T stage and the type of treatment. Conclusion. Whatever the possible and selected treatment was, the impact on the functional capacities, and thus, the quality of life of the patients was considerable. Even though we could not significantly demonstrate exclusive radiotherapy caused more long-term undesirable effects than surgery followed by radiotherapy, our daily practice has shown that we should favour the latter.

  1. Kinetics and mechanism investigation on the destruction of oxytetracycline by UV-254 nm activation of persulfate

    Energy Technology Data Exchange (ETDEWEB)

    Liu, Yiqing [Faculty of Geosciences and Environmental Engineering, Southwest Jiaotong University, Chengdu 611756 (China); Environmental Engineering and Science Program, University of Cincinnati, Cincinnati, OH 45221-0012 (United States); He, Xuexiang [Environmental Engineering and Science Program, University of Cincinnati, Cincinnati, OH 45221-0012 (United States); Fu, Yongsheng [Faculty of Geosciences and Environmental Engineering, Southwest Jiaotong University, Chengdu 611756 (China); Dionysiou, Dionysios D., E-mail: dionysios.d.dionysiou@uc.edu [Environmental Engineering and Science Program, University of Cincinnati, Cincinnati, OH 45221-0012 (United States)

    2016-03-15

    Highlights: • The most effective destruction of OTC by UV/PS was achieved at near neutral pH. • Deprotonated HOTC{sup −} had the highest second-order rate constant with SO{sub 4}·{sup −}. • Presence of HCO{sub 3}{sup −} or Cu{sup 2+} enhanced the removal of OTC in UV/PS system. • Total organic carbon was degraded slowly during the mineralization of OTC. • Studies on the degradation mechanism revealed four different reaction pathways. - Abstract: Oxytetracycline (OTC), an important broad-spectrum antibiotic, has been detected extensively in various environmental systems, which may have a detrimental impact on ecosystem and human health through the development of drug resistant bacteria and pathogens. In this study, the degradation of OTC was evaluated by UV-254 nm activated persulfate (PS). The observed UV fluence based pseudo first-order rate constant (k{sub obs}) was found to be the highest at near neutral pH conditions (pH 5.5–8.5). Presence of various natural water constituents had different effects on OTC degradation, with a significant enhancement in the presence of bicarbonate or Cu{sup 2+}. Limited elimination of total organic carbon (TOC) and PS was observed during the mineralization of OTC. Transformation byproducts in the presence and absence of hydroxyl radical scavenging agent tert-butanol (t-BuOH) were identified using ultra-high definition accurate-mass quadrupole time-of-flight liquid chromatography/mass spectrometer (LC-QTOF/MS). Potential OTC degradation mechanism was subsequently proposed revealing four different reaction pathways by SO{sub 4}·{sup −} reaction including hydroxylation (+16 Da), demethylation (−14 Da), decarbonylation (−28 Da) and dehydration (−18 Da). This study suggests that UV-254 nm/PS is a promising treatment technology for the control of water pollution caused by emerging contaminants such as OTC.

  2. Identification of intermediates, acute toxicity removal, and kinetics investigation to the Ametryn treatment by direct photolysis (UV254), UV254/H2O2, Fenton, and photo-Fenton processes.

    Science.gov (United States)

    de Oliveira, Dirce Martins; Cavalcante, Rodrigo Pereira; da Silva, Lucas de Melo; Sans, Carme; Esplugas, Santiago; de Oliveira, Silvio Cesar; Junior, Amilcar Machulek

    2018-02-09

    This paper reports the degradation of 10 mg L -1 Ametryn solution with different advanced oxidation processes and by ultraviolet (UV 254 ) irradiation alone with the main objective of reducing acute toxicity and increase biodegradability. The investigated factors included Fe 2+ and H 2 O 2 concentrations. The effectiveness of the UV 254 and UV 254 /H 2 O 2 processes were investigated using a low-pressure mercury UV lamp (254 nm). Photo-Fenton process was explored using a blacklight blue lamp (BLB, λ = 365 nm). The UV 254 irradiation process achieved complete degradation of Ametryn solution after 60 min. The degradation time of Ametryn was greatly improved by the addition of H 2 O 2 . It is worth pointing out that a high rate of Ametryn removal was attained even at low concentrations of H 2 O 2 . The kinetic constant of the reaction between Ametryn and HO ● for UV 254 /H 2 O 2 was 3.53 × 10 8  L mol -1  s -1 . The complete Ametryn degradation by the Fenton and photo-Fenton processes was observed following 10 min of reaction for various combinations of Fe 2+ and H 2 O 2 under investigation. Working with the highest concentration (150 mg L -1 H 2 O 2 and 10 mg L -1 Fe 2+ ), around 30 and 70% of TOC removal were reached within 120 min of treatment by Fenton and photo-Fenton processes, respectively. Although it did not obtain complete mineralization, the intermediates formed in the degradation processes were hydroxylated and did not promote acute toxicity of Vibrio fischeri. Furthermore, a substantial improvement of biodegradability was obtained for all studied processes.

  3. Induction of sister-chromatid exchanges in ICR 2A frog cells exposed to 254 nm UV wavelengths

    International Nuclear Information System (INIS)

    Chao, C.C.K.; Rosenstein, B.S.

    1985-01-01

    Exposure of ICR 2A frog cells to 254 nm UV induced the formation of sister-chromatid exchanges (SCEs) in a fluence-dependent manner. Cells were also exposed to the UV produced by a fluorescent sunlamp that was filtered through 8C Mylar in order to simulate the mid-UV (290-320 nm) portion of sunlight reaching the earth's surface. In this instance, SCEs were induced in a linear fashion at low fluences but reached a plateau at a low level of induced SCEs. In addition, pretreatment of cells with the solar UV followed by exposure to 254 nm UV resulted in a significantly lower level of SCEs than in cells exposed to 254 nm UV alone. (author)

  4. Corrective Action Plan for Corrective Action Unit 254: Area 25 R-MAD Decontamination Facility Nevada Test Site, Nevada

    International Nuclear Information System (INIS)

    Obi, C.M.

    2000-01-01

    The Area 25 Reactor Maintenance, Assembly, and Disassembly Decontamination Facility is identified in the Federal Facility Agreement and Consent Order (FFACO) as Corrective Action Unit (CAU) 254. CAU 254 is located in Area 25 of the Nevada Test Site and consists of a single Corrective Action Site CAS 25-23-06. CAU 254 will be closed, in accordance with the FFACO of 1996. CAU 254 was used primarily to perform radiological decontamination and consists of Building 3126, two outdoor decontamination pads, and surrounding soil within an existing perimeter fence. The site was used to decontaminate nuclear rocket test-car hardware and tooling from the early 1960s through the early 1970s, and to decontaminate a military tank in the early 1980s. The site characterization results indicate that, in places, the surficial soil and building materials exceed clean-up criteria for organic compounds, metals, and radionuclides. Closure activities are expected to generate waste streams consisting of nonhazardous construction waste. petroleum hydrocarbon waste, hazardous waste, low-level radioactive waste, and mixed waste. Some of the wastes exceed land disposal restriction limits and will require off-site treatment before disposal. The recommended corrective action was revised to Alternative 3- ''Unrestricted Release Decontamination, Verification Survey, and Dismantle Building 3126,'' in an addendum to the Correction Action Decision Document

  5. Critical pitting temperature for Type 254 SMO stainless steel in chloride solutions

    International Nuclear Information System (INIS)

    Abd El Meguid, E.A.; Abd El Latif, A.A.

    2007-01-01

    The variation with time of the open circuit potential of high molybdenum containing stainless steel (Type 254 SMO) was measured in 4% sodium chloride solution in the temperatures range 30-100 deg. C. The plot of steady state potentials as function of temperature showed an inflection at 50 deg. C, attributed to the decrease of oxygen solubility in test solution above 50 deg. C. Potentiodynamic cycling anodic polarization technique was used to determine the critical pitting potential (E pit ) and the critical protection potential (E prot ) of the steel in 4-30% NaCl solutions at temperatures between 30 and 100 deg. C. By plotting the two values versus solution temperature, the corresponding critical pitting (CPT) and the critical protection (CPrT) temperatures were determined. Both parameters decreased with increasing chloride content. Above the CPT, E pit and E prot decreased linearly with log[Cl - ]. The addition of bromide ions to the solution shifted both E pit and E prot towards positive values. In 4% NaCl, E pit increased linearly with pH in the range 1-10. The combined effect of chloride ion concentration and pH on the morphology of the pits was examined by scanning electron microscopy (SEM) following potentiodynamic cycling anodic polarization

  6. A prospective study on time to recovery in 254 injured novice runners.

    Directory of Open Access Journals (Sweden)

    Rasmus Oestergaard Nielsen

    Full Text Available Describe the diagnoses and the time to recovery of running-related injuries in novice runners.Prospective cohort study on injured runners.This paper is a secondary data analysis of a 933-person cohort study (DANO-RUN aimed at characterizing risk factors for injury in novice runners. Among those sustaining running-related injuries, the types of injuries and time to recovery is described in the present paper. All injured runners were diagnosed after a thorough clinical examination and then followed prospectively during their recovery. If they recovered completely from injury, time to recovery of each injury was registered.A total of 254 runners were injured. The proportion of runners diagnosed with medial tibial stress syndrome was 15%, 10% for patellofemoral pain, 9% for medial meniscal injury, 7% for Achilles tendinopathy and 5% for plantar fasciitis. Among the 220 runners (87% recovering from their injury, the median time to recovery was 71 days (minimum  = 9 days, maximum  = 617 days.Medial tibial stress syndrome was the most common injury followed by patellofemoral pain, medial meniscal injury and Achilles tendinopathy. Half of the injured runners were unable to run 2×500 meters without pain after 10 weeks. Almost 5% of the injured runners received surgical treatment.

  7. Four-year prognosis of 254 patients after acute myocardial infarction

    International Nuclear Information System (INIS)

    Nishimura, Tohru; Taya, Makoto; Sasaki, Akira; Shimoyama, Katsuya; Mizuno, Haruyoshi; Tahara, Yorio; Ono, Akifumi; Okada, Michio; Ishikawa, Kyozo

    1994-01-01

    The present study was undertaken to determine whether left ventricular diastolic function can be used as a measure for assessing prognosis of patients with acute myocardial infarction. The subjects were 254 patients who had Tc-99m gated blood pool scintigraphy within one month after the onset of myocardial infarction and could be followed up for the subsequent 4 years. The following indices for left ventricular diastolic function were calculated from the time activity curve of the left ventricle: time to peak filling, time to peak filling/t, peak filling rate, peak filling rate/t, 1/3 filling rate/t, and time per beat. On the basis of the morphology of the time activity curve and the primary differential curve, left ventricular diastolic function was visually assessed as normal (Group 0, n=30), slightly decreased (Group 1, n=98), moderately decreased (Group 2, n=81) and severely decreased (Group 3, n=45). The incidences of cardiac failure and cardiac death were remarkably increased when left ventricular ejection fraction (LVEF) was less than 30%. The incidence of cardiac failure tended to be increased in patients with severer diastolic function; it was remarkably high in Group 3. Cardiac failure was more often associated with more decreased diastolic function, even if LVEF was 40% or more. These findings suggest that left ventricular diastolic function may be helpful for assessing prognosis of acute myocardial infarction. (N.K.)

  8. Nuclear structure data from in beam and decay studies around 254No

    International Nuclear Information System (INIS)

    Jones, P.

    2005-01-01

    The study of trans-fermium nuclei, the heaviest nuclei for which in-beam spectroscopy studies are possible has provided over recent years a rich tapestry of data. These have enhanced the mean field theories important for the prediction of nuclear properties at the limits of the nuclear chart. Developments in spectrometer and data-acquisition techniques at the Department of Physics, University of Jyvaskyla have further enhanced the studies. Utilising the RITU gas-filled spectrometer, the GREAT focal plane spectrometer, the identification recoils and their subsequent decay modes (alpha-, fission-, and gamma-ray decay) have been studied. The JUROGAM gamma-ray array of 43 Compton-suppressed HPGe detectors has been employed in the in-beam spectroscopy of the trans-fermium region. In-beam gamma-ray spectroscopy studies of trans-fermium nuclei 253 No, 254 No, 250 Fm, 251 Md, 253 No and 255 Lr have been performed, as well as detailed focal plane spectroscopy. Selected highlights of the work will be presented

  9. Electrochemical and SEM study on Type 254 SMO stainless steel in chloride solutions

    International Nuclear Information System (INIS)

    Abd El Meguid, E.A.; Abd El Latif, A.A.

    2004-01-01

    An investigation was conducted to examine the critical crevice potential (E crev ) and the critical protection potential (E prot ) for Type 254 SMO stainless steel in 4% NaCl solution by using potentiodynamic cyclic anodic polarization (PCAP) technique at temperature ranging from 30 to 90 deg. C. The critical crevice temperature (CCT) and the critical crevice protection temperature (T prot ) were determined by plotting the values of breakdown potential and E prot versus solution temperature, respectively. The values of CCT and T prot were recorded at the abrupt transition with increasing the temperature from transpassive corrosion to crevice corrosion and were found to be at 55 and 52 deg. C, respectively. Above CCT (70 deg. C) the following points were recorded. The E crev and E prot decreased linearly with log [Cl - ]. The addition of bromide ions to chloride ions at a fixed halide content of 4% increased both E crev and E prot . The E crev value in 4% NaCl increased linearly with increasing pH in the range 1-10. The addition of 0.5 M bicarbonate ions to 4% NaCl completely removed the crevices effect while increasing the addition of sulphate ions to 4% NaCl increased both of E crev and E prot . The morphology of the crevice corrosion produced on the steel surface was examined by scanning electron microscope (SEM) after PCAP treatment under different test conditions

  10. Induction of micronuclei by 2-hydroxypyridine in water and elimination of solution genotoxicity by UVC (254 nm) photolysis

    Energy Technology Data Exchange (ETDEWEB)

    Skoutelis, Charalambos G. [Department of Environmental and Natural Resources Management, University of Ioannina, Seferi 2, Agrinio 30100 (Greece); Vlastos, Dimitris, E-mail: dvlastos@cc.uoi.gr [Department of Environmental and Natural Resources Management, University of Ioannina, Seferi 2, Agrinio 30100 (Greece); Kortsinidou, Marianna C.; Theodoridis, Ioannis T.; Papadaki, Maria I. [Department of Environmental and Natural Resources Management, University of Ioannina, Seferi 2, Agrinio 30100 (Greece)

    2011-12-15

    Highlights: Black-Right-Pointing-Pointer 2-Hydroxypyridine (2-HPY) is the major metabolite of 2-halogenated pyridines photolysis. Black-Right-Pointing-Pointer We examine the genotoxicity of 2-HPY in cultured human lymphocytes applying the micronucleus assay. Black-Right-Pointing-Pointer 2-HPY was found to be genotoxic. Black-Right-Pointing-Pointer Aqueous solutions of 2-HPY were irradiated by UV at 254 nm. Black-Right-Pointing-Pointer Solution genotoxicity can be completely removed after prolonged phototreatment. - Abstract: 2-Hydroxypyridine (2-HPY) is a major first-stage product formed upon the photolytic destruction of 2-halogenated pyridines. Genotoxicity of 2-HPY in water was studied as a function of concentration. Aqueous solutions of 2-HPY were irradiated by ultraviolet (UV) at 254 nm. 2-HPY concentration, solution total organic carbon (TOC) concentration and solution genotoxicity were measured as a function of treatment time and their profile as a function of time is presented in this work. 2-HPY was found to be genotoxic at all concentrations in the range of 5-400 {mu}g ml{sup -1}. 2-HPY mineralises completely upon prolonged UV irradiation. All untreated and irradiated solution samples, taken at different photo-treatment times, were tested in cultured human lymphocytes applying the cytokinesis block micronucleus (CBMN) assay. The genotoxicity of the solution was reduced near to the control level after prolonged UV irradiation.

  11. Closure Report for Corrective Action Unit 254: Area 25, R-MAD Decontamination Facility, Nevada Test Site, Nevada

    Energy Technology Data Exchange (ETDEWEB)

    G. N. Doyle

    2002-02-01

    Corrective Action Unit (CAU) 254 is located in Area 25 of the Nevada Test Site (NTS), approximately 100 kilometers (km) (62 miles) northwest of Las Vegas, Nevada. The site is located within the Reactor Maintenance, Assembly and Disassembly (R-MAD) compound and consists of Building 3126, two outdoor decontamination pads, and surrounding areas within an existing fenced area measuring approximately 50 x 37 meters (160 x 120 feet). The site was used from the early 1960s to the early 1970s as part of the Nuclear Rocket Development Station program to decontaminate test-car hardware and tooling. The site was reactivated in the early 1980s to decontaminate a radiologically contaminated military tank. This Closure Report (CR) describes the closure activities performed to allow un-restricted release of the R-MAD Decontamination Facility.

  12. Comparative ultraviolet action spectra (254-320 nm) of five wild-type eukaryotic microorganisms and Escherichia coli

    International Nuclear Information System (INIS)

    Calkins, J.; Wheeler, J.S.; Keller, C.I.; Colley, E.; Hazle, J.D.

    1988-01-01

    The action spectra of five eukaryotic organisms and the prokaryote, Escherichia coli, were examined over the wavelength range, 254-320 nm. Both the repair competent and three repair defective strains (E. coli, Caenorhabditis elegans, Saccharomyces) were examined. Tetrahymena pyriformis action spectra were performed with and without the excision repair inhibitor caffeine present. Others have observed that lethality, mutation, and the production of pyrimidine dimers show much the same wavelength dependence as DNA absorption. The results presented here demonstrate several action spectra which deviate from the DNA absorption spectra. Ultraviolet sensitization ratios (repair competent/repair defective) were also examined and were shown to change over the wavelength range. These findings suggest that DNA may not be the only important chromophore leading to cell death in the uv wavelength range studied. Since uv-B is of major importance in solar uv damage, these findings may also yield important implications for solar uv studies

  13. Comparative ultraviolet action spectra (254-320 nm) of five wild-type eukaryotic microorganisms and Escherichia coli

    Energy Technology Data Exchange (ETDEWEB)

    Calkins, J.; Wheeler, J.S.; Keller, C.I.; Colley, E.; Hazle, J.D.

    1988-05-01

    The action spectra of five eukaryotic organisms and the prokaryote, Escherichia coli, were examined over the wavelength range, 254-320 nm. Both the repair competent and three repair defective strains (E. coli, Caenorhabditis elegans, Saccharomyces) were examined. Tetrahymena pyriformis action spectra were performed with and without the excision repair inhibitor caffeine present. Others have observed that lethality, mutation, and the production of pyrimidine dimers show much the same wavelength dependence as DNA absorption. The results presented here demonstrate several action spectra which deviate from the DNA absorption spectra. Ultraviolet sensitization ratios (repair competent/repair defective) were also examined and were shown to change over the wavelength range. These findings suggest that DNA may not be the only important chromophore leading to cell death in the uv wavelength range studied. Since uv-B is of major importance in solar uv damage, these findings may also yield important implications for solar uv studies.

  14. Induction of micronuclei by 2-hydroxypyridine in water and elimination of solution genotoxicity by UVC (254 nm) photolysis.

    Science.gov (United States)

    Skoutelis, Charalambos G; Vlastos, Dimitris; Kortsinidou, Marianna C; Theodoridis, Ioannis T; Papadaki, Maria I

    2011-12-15

    2-Hydroxypyridine (2-HPY) is a major first-stage product formed upon the photolytic destruction of 2-halogenated pyridines. Genotoxicity of 2-HPY in water was studied as a function of concentration. Aqueous solutions of 2-HPY were irradiated by ultraviolet (UV) at 254 nm. 2-HPY concentration, solution total organic carbon (TOC) concentration and solution genotoxicity were measured as a function of treatment time and their profile as a function of time is presented in this work. 2-HPY was found to be genotoxic at all concentrations in the range of 5-400 μg ml(-1). 2-HPY mineralises completely upon prolonged UV irradiation. All untreated and irradiated solution samples, taken at different photo-treatment times, were tested in cultured human lymphocytes applying the cytokinesis block micronucleus (CBMN) assay. The genotoxicity of the solution was reduced near to the control level after prolonged UV irradiation. Copyright © 2011 Elsevier B.V. All rights reserved.

  15. A clinico-radiological study on 254 cases of pontine high signals on magnetic resonance imaging in relation to brain stem semiology

    Energy Technology Data Exchange (ETDEWEB)

    Watanabe, Masaki; Takahashi, Akira (Nagoya Univ. (Japan). Faculty of Medicine); Arahata, Yutaka; Motegi, Yoshimasa; Furuse, Masahiro

    1993-11-01

    A total of 254 patients who were proved to have pontine high intensity areas on T[sub 2]-weighted magnetic resonance imaging (MRI) were analyzed in relation to brain stem semiology. A comparative study on MRI and MR angiography was made between 254 patients with pontine high signals and 276 control cases showing no abnormality either on T[sub 1] or T[sub 2]-weighted images. Of the 254 patients, 62 had transient subjective complaints such as vertigo-dizziness. Supratentorial high signals, basilar artery tortuousness and vertebral artery asymmetry on MR angiography were seen more frequently in patients with pontine high signals than in the controls. In conclusion, pontine high signals may result from diffuse arteriosclerosis and MR angiography is considered to be a useful screening method. (author).

  16. Corrective Action Decision Document for Corrective Action Unit 254: Area 25 R-MAD Decontamination Facility, Nevada Test Site, Nevada

    International Nuclear Information System (INIS)

    2000-01-01

    This Corrective Action Decision Document identifies and rationalizes the US Department of Energy, Nevada Operations Office's selection of a recommended corrective action alternative (CAA) appropriate to facilitate the closure of Corrective Action Unit (CAU) 254, R-MAD Decontamination Facility, under the Federal Facility Agreement and Consent Order. Located in Area 25 at the Nevada Test Site in Nevada, CAU 254 is comprised of Corrective Action Site (CAS) 25-23-06, Decontamination Facility. A corrective action investigation for this CAS as conducted in January 2000 as set forth in the related Corrective Action Investigation Plan. Samples were collected from various media throughout the CAS and sent to an off-site laboratory for analysis. The laboratory results indicated the following: radiation dose rates inside the Decontamination Facility, Building 3126, and in the storage yard exceeded the average general dose rate; scanning and static total surface contamination surveys indicated that portions of the locker and shower room floor, decontamination bay floor, loft floor, east and west decon pads, north and south decontamination bay interior walls, exterior west and south walls, and loft walls were above preliminary action levels (PALs). The investigation-derived contaminants of concern (COCs) included: polychlorinated biphenyls, radionuclides (strontium-90, niobium-94, cesium-137, uranium-234 and -235), total volatile and semivolatile organic compounds, total petroleum hydrocarbons, and total Resource Conservation and Recovery Act (Metals). During the investigation, two corrective action objectives (CAOs) were identified to prevent or mitigate human exposure to COCs. Based on these CAOs, a review of existing data, future use, and current operations at the Nevada Test Site, three CAAs were developed for consideration: Alternative 1 - No Further Action; Alternative 2 - Unrestricted Release Decontamination and Verification Survey; and Alternative 3 - Unrestricted

  17. Corrective Action Decision Document for Corrective Action Unit 254: Area 25 R-MAD Decontamination Facility, Nevada Test Site, Nevada

    Energy Technology Data Exchange (ETDEWEB)

    U.S. Department of Energy, Nevada Operations Office

    2000-06-01

    This Corrective Action Decision Document identifies and rationalizes the US Department of Energy, Nevada Operations Office's selection of a recommended corrective action alternative (CAA) appropriate to facilitate the closure of Corrective Action Unit (CAU) 254, R-MAD Decontamination Facility, under the Federal Facility Agreement and Consent Order. Located in Area 25 at the Nevada Test Site in Nevada, CAU 254 is comprised of Corrective Action Site (CAS) 25-23-06, Decontamination Facility. A corrective action investigation for this CAS as conducted in January 2000 as set forth in the related Corrective Action Investigation Plan. Samples were collected from various media throughout the CAS and sent to an off-site laboratory for analysis. The laboratory results indicated the following: radiation dose rates inside the Decontamination Facility, Building 3126, and in the storage yard exceeded the average general dose rate; scanning and static total surface contamination surveys indicated that portions of the locker and shower room floor, decontamination bay floor, loft floor, east and west decon pads, north and south decontamination bay interior walls, exterior west and south walls, and loft walls were above preliminary action levels (PALs). The investigation-derived contaminants of concern (COCs) included: polychlorinated biphenyls, radionuclides (strontium-90, niobium-94, cesium-137, uranium-234 and -235), total volatile and semivolatile organic compounds, total petroleum hydrocarbons, and total Resource Conservation and Recovery Act (Metals). During the investigation, two corrective action objectives (CAOs) were identified to prevent or mitigate human exposure to COCs. Based on these CAOs, a review of existing data, future use, and current operations at the Nevada Test Site, three CAAs were developed for consideration: Alternative 1 - No Further Action; Alternative 2 - Unrestricted Release Decontamination and Verification Survey; and Alternative 3 - Unrestricted

  18. Comparison of the disinfection effects of vacuum-UV (VUV) and UV light on Bacillus subtilis spores in aqueous suspensions at 172, 222 and 254 nm.

    Science.gov (United States)

    Wang, Ding; Oppenländer, Thomas; El-Din, Mohamed Gamal; Bolton, James R

    2010-01-01

    The efficacy of UV and vacuum-UV (VUV) disinfection of Bacillus subtilis spores in aqueous suspensions at wavelengths of 172, 222 and 254 nm was evaluated. A Xe(2)* excilamp, a KrCl* excilamp and a low-pressure mercury lamp were used as almost monochromatic light sources at these three wavelengths. The first-order inactivation rate constants at 172, 222 and 254 nm were 0.0023, 0.122 and 0.069 cm(2) mJ(-1), respectively. Therefore, a 2 log reduction of B. subtilis spores was reached with fluences (UV doses) of 870, 21.6 and 40.4 mJ cm(-2) at these individual wavelengths. Consequently, for the inactivation of B. subtilis spores, VUV exposure at 172 nm is much less efficient than exposure at the other two wavelengths, while exposure at 222 nm is more efficient than that at 254 nm, which is probably because triplet energy transfer from DPA to thymine bases at 222 nm is higher than that at 254 nm. This research indicated quantitatively that VUV light is not practicable for microorganism disinfection in water and wastewater treatment. However, in comparison with other advanced oxidation processes (e.g. UV/TiO(2), UV/H(2)O(2) or O(3)/H(2)O(2)) the VUV-initiated photolysis of water is likely more efficient in generating hydroxyl radicals and more effective for the inactivation of microorganisms.

  19. Destruction of cyanobacterial toxin cylindrospermopsin by hydroxyl radicals and sulfate radicals using UV-254 nm activation of hydrogen peroxide, persulfate and peroxymonosulfate

    Science.gov (United States)

    Abstract: With increasing worldwide incidence of toxic cyanobacterial blooms in bodies of water, cylindrospermopsin (CYN) has become a significant concern to public health and water management officials. In this study, the removal of CYN by UV-254 nm-mediated advanced oxidation ...

  20. Added value of interpreter experience in occult and suspect hip fractures: a retrospective analysis of 254 patients.

    Science.gov (United States)

    Collin, David; Göthlin, Jan H; Nilsson, Martin; Hellström, Mikael; Geijer, Mats

    2016-06-01

    The influence of experience in categorizing suspect and occult fractures on radiography compared to MRI and clinical outcome has not been studied. The aim of this study is to evaluate the importance of experience in diagnosing normal or suspect hip radiographs compared to MRI. Primarily reported normal or suspect radiography in 254 patients with low-energy hip trauma and subsequent MRI was re-evaluated by two experienced reviewers. Primary readings and review were compared. The prevalence of fractures among normal and suspect radiographic studies was assessed. Clinical outcome was used as reference. At review of radiography, 44 fractures (17 %) were found. Significantly more fractures were found among suspect cases than among normal cases. At MRI, all 44 fractures were confirmed, and further 64 fractures were detected (25 %). MRI detected all fractures with no missed fractures revealed at follow-up. There were a significantly higher proportion of fractures at MRI among the suspect radiographic diagnoses for both the primary report and at review than among occult cases. The more experienced reviewers classified radiography examinations with higher accuracy than primary reporting general radiologists. There was almost complete agreement on MRI diagnoses.

  1. Photooxidation of self-assembled monolayers by exposure to light of wavelength 254 nm: a static SIMS study.

    Science.gov (United States)

    Brewer, Nicholas J; Janusz, Stefan; Critchley, Kevin; Evans, Stephen D; Leggett, Graham J

    2005-06-09

    Self-assembled monolayers (SAMs) of alkanethiols have been photooxidized by exposure to light from a lamp emitting light with a wavelength of 254 nm. The data confirm that SAM oxidation on exposure to UV light sources occurs in the absence of ozone, but also suggest that the mechanism is different from that observed in previous studies using broad-spectrum arc lamps. In particular, for monolayers on both gold and silver, carboxylic acid-terminated SAMs oxidize significantly faster than methyl-terminated SAMs, in contrast to earlier observations for monolayers exposed to light from a mercury arc lamp. The difference in rates of photooxidation for the two classes of monolayer is significantly greater on silver than on gold. These data support our recent suggestion that while methyl-terminated SAMs are able to pack much more closely on silver than on gold, carboxylic acid-terminated thiols are not able to adopt the same close-packed structures, and their rates of photooxidation on silver are similar to, or slightly greater than, those measured for the same adsorbates on gold. Surface potential measurements were made for carboxylic acid- and methyl-terminated SAMs using a Kelvin probe apparatus. It was found that the work functions of carboxylic acid-terminated SAMs are significantly greater than those of methyl-terminated monolayers. It is concluded that these data are consistent with the oxidation reaction being initiated by "hot" electrons generated following the interaction of photons with the metallic substrate.

  2. International travel in the immunocompromised patient: a cross-sectional survey of travel advice in 254 consecutive patients.

    Science.gov (United States)

    Bialy, C; Horne, K; Dendle, C; Kanellis, J; Littlejohn, G; Ratnam, I; Woolley, I

    2015-06-01

    Our primary aim was to determine the rate of overseas travel in immunocompromised individuals attending appropriate clinics at an Australian tertiary care hospital. We also aimed to characterise health-seeking behaviour prior to travel and investigated sources of pre-travel advice, compared travel patterns and activities between three specific immunosuppressed groups, and examined pre-immunosuppression patient serology. We implemented a cross-sectional survey of patients between February and August 2012. This survey was implemented among three outpatient populations at Monash Medical Centre, an Australian tertiary care hospital. We recruited 254 immunosuppressed adults from three patient populations: human immunodeficiency virus-positive individuals, renal transplant patients and rheumatology patients requiring immunosuppressive therapy. No clinical intervention was performed. In the 10 years preceding the survey, 153 (60.2%) participants reported international travel. Of these, 105 (68.6%) were immunosuppressed at the time of travel. These patients were 47.6% male and 60% Australian born. Forty per cent were visiting friends and relatives as part of their travel. Fifty-four per cent of those immunocompromised at the time of travel were going to high-risk destinations. Pathology files indicated that serological screening was frequently not performed prior to immunosuppression in the renal transplant and rheumatology groups. Immunocompromised patients often travel to high-risk destinations with limited or inadequate pre-travel preparations. Doctors caring for the immunocompromised should be aware of travel risks, suitable vaccination protocols and when to refer to specialist travel clinics. © 2015 Royal Australasian College of Physicians.

  3. Determination of the total mercury in contaminated soils by direct solid sampling atomic absorption spectrometry using an AMA-254 device and radiochemical neutron activation analysis

    Czech Academy of Sciences Publication Activity Database

    Sysalová, J.; Kučera, Jan; Fikrle, Marek; Drtinová, B.

    2013-01-01

    Roč. 110, SEP (2013), s. 691-694 ISSN 0026-265X R&D Projects: GA ČR GAP503/12/0682; GA ČR(CZ) GBP108/12/G108 Institutional support: RVO:61389005 Keywords : Mercury * contaminated soils * AMA-254 * RNAA Subject RIV: BG - Nuclear, Atomic and Molecular Physics, Colliders Impact factor: 3.583, year: 2013

  4. Surface modification of Sylgard 184 polydimethylsiloxane by 254 nm excimer radiation and characterization by contact angle goniometry, infrared spectroscopy, atomic force and scanning electron microscopy

    Energy Technology Data Exchange (ETDEWEB)

    Waddell, Emanuel A. [University of Alabama in Huntsville, Huntsville, AL (United States)], E-mail: ewaddell@chemistry.uah.edu; Shreeves, Stephen [University of Alabama in Huntsville, Huntsville, AL (United States); Carrell, Holly; Perry, Christopher [Oakwood College, Huntsville, AL (United States); Reid, Branden A. [Morgan State University, Baltimore, MD (United States); McKee, James [University of Alabama in Birmingham, Birmingham, AL (United States)

    2008-06-30

    The modification of polydimethylsiloxane (PDMS) by narrow band 254 nm excimer radiation under a nitrogen atmosphere was characterized by contact angle goniometry, attenuated total reflectance infrared spectroscopy, atomic force and scanning electron microscopy. UV irradiation results in the formation of the carboxylic acids that influences the wettability of the surface. Continued exposure results in the formation of an inorganic surface (SiO{sub x} (1 < x < 2)) which hinders the ability to continually increase the wettability. The continuity of this inorganic layer is disrupted by the formation of surface cracks. These results have implications in the fabrication and chemical modification of microfluidic or micro-electro-mechanical systems.

  5. Surface modification of Sylgard 184 polydimethylsiloxane by 254 nm excimer radiation and characterization by contact angle goniometry, infrared spectroscopy, atomic force and scanning electron microscopy

    Science.gov (United States)

    Waddell, Emanuel A.; Shreeves, Stephen; Carrell, Holly; Perry, Christopher; Reid, Branden A.; McKee, James

    2008-06-01

    The modification of polydimethylsiloxane (PDMS) by narrow band 254 nm excimer radiation under a nitrogen atmosphere was characterized by contact angle goniometry, attenuated total reflectance infrared spectroscopy, atomic force and scanning electron microscopy. UV irradiation results in the formation of the carboxylic acids that influences the wettability of the surface. Continued exposure results in the formation of an inorganic surface (SiO x (1 < x < 2)) which hinders the ability to continually increase the wettability. The continuity of this inorganic layer is disrupted by the formation of surface cracks. These results have implications in the fabrication and chemical modification of microfluidic or micro-electro-mechanical systems.

  6. Prospects of heavy and superheavy element production via inelastic nucleus-nucleus collisions – from 238U+238U to18O+254Es

    Directory of Open Access Journals (Sweden)

    Schädel Matthias

    2016-01-01

    Full Text Available Multi-nucleon transfer reactions, frequently termed deep-inelastic, between heavy-ion projectiles and actinide targets provide prospects to synthesize unknown isotopes of heavy actinides and superheavy elements with neutron numbers beyond present limits. The 238U on 238U reaction, which revealed essential aspects of those nuclear reactions leading to surviving heavy nuclides, mainly produced in 3n and 4n evaporation channels, is discussed in detail. Positions and widths of isotope distributions are compared. It is shown, as a general rule, that cross sections peak at irradiation energies about 10% above the Coulomb barrier. Heavy target nuclei are essential for maximizing cross sections. Experimental results from the 238U on 248Cm reaction, including empirical extrapolations, are compared with theoretical model calculations predicting relatively high cross sections for neutron-rich nuclei. Experiments to test the validity of such predictions are proposed. Comparisons between rather symmetric heavy-ion reactions like 238U on 248Cm (or heavier targets up to 254Es with very asymmetric ones like 18O on 254Es reveal that the ones with 238U as a projectile have the highest potential in the superheavy element region while the latter ones can be advantageous for the synthesis of heavy actinide isotopes. Concepts for highly efficient recoil separators designed for transfer products are presented.

  7. Lethal effect of short-wave (254 nm) UV-radiation on cells of Chlamidomonas reinhardii strains with different carotenoid content

    International Nuclear Information System (INIS)

    Kamchatova, I.E.; Chunaev, A.S.; Bronnikov, V.A.

    1987-01-01

    In experiments on related Chlamidomonas reinhardii strains of similar mating type a study was made of sensitivity of cells with different carotenoid content to UV-radiation of 254 nm. Mutants having a lower, as opposed to the wild type strain, content of carotenoids exhibited an increased radiosensitivity. A carotenoid-free mutant was found to possess a higher sensitivity to UV-radiation which was typical of the strain with the impaired excision repair system. The studied subclone of the UV-radiosensitive strain CC-888 was unable to photoreactivate the UV-induced damages which was typical of the wild-type strain. The content of carotenoids in cells of this subnuclone exceeded that in cells of mutants with the reduced pigmentation

  8. ONKALO pose experiment. Geophysical logging and imaging of drillholes ONK-PP223, ONK-PP226, ONK-PP254 and ONK-PP259...261

    International Nuclear Information System (INIS)

    Tarvainen, A.-M.

    2011-08-01

    Suomen Malmi Oy conducted geophysical drillhole logging as well as optical and acoustic imaging of shallow drillholes ONK-PP223, ONK-PP226, ONK-PP254, ONKPP259, ONK-PP260 and ONK-PP261 at ONKALO in the investigation niche ONKTKU- 3 (POSE) between December 2009 and June 2010. The survey is a part of Posiva Oy's detailed investigation program for the final disposal of spent nuclear fuel. The assignment included the field work and data processing. The report describes field operation, equipment as well as processing procedures and shows the obtained results and an analysis of their quality in the appendices. The raw and processed data are delivered digitally in WellCAD, PDF and Excel format. (orig.)

  9. The Study of the Development of Dependent Possessive Pronouns in 2.5-4 Year-Old Typically Normal Persian-Speaking Children

    Directory of Open Access Journals (Sweden)

    Shoeleh Sharifypour

    2015-12-01

    Full Text Available Background: Pronoun error is one of the most common errors in many speech and language disorders. Therefore, knowing about the development procedure of dependent possessive pronouns (as a subgroup of pronouns, leads to build an accurate profile for evaluation and treatment of many disorders. The goal of the present study was to examine the development of dependent possessive pronouns in 2.5-4 years old Persian-speaking children. Methods: In this cross sectional descriptive-analytic study, 177 typically normal Persian speaking children in age range of 2.5-4 years old (94 girls and 83 boys who were selected by stratified sampling method from 10 kindergartens of Kerman were examined. There were 3 age groups (2.5-3, 3-3.5 and 3.5-4 years old. The instrument used in this study was a researcher-made task consistent of 18 questions about some parts of body to examine the development of dependent possessive pronouns. For descriptive report central tendencies and indices of dispersion were used and for statistics relations Spearman’s correlation test, Mann-Whitney test, Kruskal-Wallis test and Cochran’s test were used. Results: The order of correct use of dependent possessive pronouns was from singular to plural and the order of person was 3rd person, 1st person and then 2nd person. There was a correlation between age and correct use of dependent possessive pronouns (P0.05, but children’s performance in 3 age groups were different (P<0.05 and correct use of 6 types of dependent possessive pronouns were significantly different (P<0.05. Conclusion: The correct use of dependent possessive pronouns increased with age, and by the age of 4, the children mastered in more than 90% of dependent possessive pronouns.

  10. Damage to uracil- and adenine-containing bases, nucleosides, nucleotides and polynucleotides: quantum yields on irradiation at 193 and 254 nm

    International Nuclear Information System (INIS)

    Gurzadyan, G.G.; Goerner, H.

    1994-01-01

    Photoreactions, such as base release and decomposition of the base moeity, induced by either 20 ns laser pulses at 193 nm or continuous 254 nm irradiation, were studied for a series of uracil and adenine derivatives in neutral aqueous solution. The quantum yield of chromophore loss (Φ cl ) depends significantly on the nature of the nucleic acid constituent and the saturating gas (Ar, N 2 O or O 2 ). In the case of polynucleotides the destruction of nucleotides was measured by high-performance liquid chromatography after hydrolysis; the quantum yields (Φ dn ) are comparable to those of chromophore loss or larger. The Φ cl and Φ dn of 0.04-0.1 for poly(U) and poly(dU), obtained for both wavelengths of irradiation, are due to processes originating from the lowest excited singlet state, i.e. formation of photohydrates and photodimers, and a second part from photoionization using λ irr = 193 nm. Irradiation at 193 nm effectively splits pyrimidine dimers and thus reverts them into monomers. (author)

  11. Validation of an RPHPTLC-Densitometric Method Using Silica Gel 60 RP18WF254 for Simultaneous Determination of Nicotinamide in Selected Pharmaceutical Formulations

    Directory of Open Access Journals (Sweden)

    Małgorzata Dołowy

    2015-01-01

    Full Text Available This research study describes the applicability of silica gel 60 RPW18F254 plates for the development and validation of new, simple, economic, accurate, and precise RPHPTLC-densitometric method suitable for the quantification of nicotinamide (as Vitamin PP in three marketed preparations. The mobile phase used was methanol-water in volume composition 3 : 7. Detection wavelength was 200 nm. The proposed method was validated according to ICH guidelines and also based on Ferenczi-Fodor and Konieczka reports. Results were found to be linear over a range of 1.00 to 2.00 μg/spot. Limit of detection (LOD and limit of quantification (LOQ were 0.15 μg/spot and 0.45 μg/spot, respectively. The percent content of nicotinamide in the investigated preparations was found to be 99.2% (Product 1, 99.3% (Product 2, and 99.4% (Product 3. Developed method is accurate and precise (CV<3% and may be successfully applied for the quality control of pharmaceutical formulations containing nicotinamide in the presence of its derivatives, such as N,N-diethylnicotinamide, N-methylnicotinamide, and nicotinic acid.

  12. The minimal domain of adipose triglyceride lipase (ATGL ranges until leucine 254 and can be activated and inhibited by CGI-58 and G0S2, respectively.

    Directory of Open Access Journals (Sweden)

    Irina Cornaciu

    Full Text Available Adipose triglyceride lipase (ATGL is the rate-limiting enzyme of lipolysis. ATGL specifically hydrolyzes triacylglycerols (TGs, thereby generating diacylglycerols and free fatty acids. ATGL's enzymatic activity is co-activated by the protein comparative gene identification-58 (CGI-58 and inhibited by the protein G0/G1 switch gene 2 (G0S2. The enzyme is predicted to act through a catalytic dyad (Ser47, Asp166 located within the conserved patatin domain (Ile10-Leu178. Yet, neither an experimentally determined 3D structure nor a model of ATGL is currently available, which would help to understand how CGI-58 and G0S2 modulate ATGL's activity. In this study we determined the minimal active domain of ATGL. This minimal fragment of ATGL could still be activated and inhibited by CGI-58 and G0S2, respectively. Furthermore, we show that this minimal domain is sufficient for protein-protein interaction of ATGL with its regulatory proteins. Based on these data, we generated a 3D homology model for the minimal domain. It strengthens our experimental finding that amino acids between Leu178 and Leu254 are essential for the formation of a stable protein domain related to the patatin fold. Our data provide insights into the structure-function relationship of ATGL and indicate higher structural similarities in the N-terminal halves of mammalian patatin-like phospholipase domain containing proteins, (PNPLA1, -2,- 3 and -5 than originally anticipated.

  13. Use of mussel casts from archaeological sites as paleoecological indicators: An example from CA-MRN-254, Marin County, Alta California

    Science.gov (United States)

    McGann, Mary; Starratt, Scott W.; Powell, Charles L.; Bieling, David G

    2016-01-01

    Archaeological investigations at prehistoric site CA-MRN-254 at the Dominican University of California in Marin County, California, revealed evidence of Native American occupation spanning the past 1,800 years. A dominant source of food for the inhabitants in the San Francisco Bay area was the intertidal, quiet-water dwelling blue mussel (Mytilus trossulus), although rare occurrences of the open coast-dwelling California mussel (Mytilus californianus) suggest that this species was also utilized sporadically. On rare occasions, cultural horizons at this site contain abundant sediment-filled casts of the smaller mussel Modiolus sp. These casts were formed soon after death when the shells filled with sediment and were roasted along with living bivalve shellfish for consumption. Thin sections of these mussel casts display sedimentological and microbiological constituents that shed light on the paleoenvironmental conditions when they were alive. Fine-grained sediment and pelletal muds comprising these casts suggest that the mussels were collected in a low energy, inner bay environment. The rare presence of the diatoms Triceratium dubium and Thalassionema nitzschioides indicate more normal marine (35 psu) and possibly warmer conditions than presently exist in San Francisco Bay. Radiocarbon dating of charcoal associated with the mussel casts containing these diatoms correlates with a 600-year period of warming from ca. A.D. 700–1300, known as the Medieval Climatic Anomaly. Results of this mussel cast study demonstrate that they have great potential for providing paleoenvironmental information at this and other archaeological sites.

  14. Fibroblasts derived from patients with dysplastic nevus syndrome are not more sensitive towards 254-nm and 312-nm ultraviolet light than fibroblasts from normal donors.

    Science.gov (United States)

    Thielmann, H W; Edler, L; Brucker, A; Jung, E G

    1991-01-01

    DNA repair capacity of 18 fibroblast strains from patients with dysplastic nevus syndrome, 5 of them with malignant melanoma, was investigated and their colony-forming ability (D0) after UV exposure was determined as a measurement of this. Seventeen fibroblast strains from normal donors served as controls. The dose/response experiments included up to 11 dose levels and two UV wavelength ranges: UV-C (using a low-pressure mercury lamp emitting predominantly 254-nm light) and UV-B (artificial "sunlamp" radiation centering around 312-nm light). The exponential segments of the dose/response curves were analysed by linear regression and the negative reciprocals of the regression coefficients, D0, were calculated for each cell strain and each wavelength range. When comparing D0 values of individual cell strains from patients with and without melanomas with the mean value for all normal donors, only 4 out of 18 showed increased sensitivity towards UV-B. This difference, however, was not statistically significant. On the contrary, weighted-mean D0 values for fibroblast strains from patients with and without melanoma were found to be slightly but significantly higher than those for normal donors (significance level: 5%), indicating that cell strains from these patients were less sensitive to UV light (UV-C and UV-B) of both wavelength. This result, which on the basis of current literature data is somewhat unexpected, holds true within the limits of experimental accuracy of +/- 12%.

  15. Photo-removal of sulfamethoxazole (SMX) by photolytic and photocatalytic processes in a batch reactor under UV-C radiation ({lambda}{sub max} = 254 nm)

    Energy Technology Data Exchange (ETDEWEB)

    Nasuhoglu, Deniz; Yargeau, Viviane [Department of Chemical Engineering, McGill University, 3610 University Street, Montreal, Quebec, H3A 2B2 (Canada); Berk, Dimitrios, E-mail: dimitrios.berk@mcgill.ca [Department of Chemical Engineering, McGill University, 3610 University Street, Montreal, Quebec, H3A 2B2 (Canada)

    2011-02-15

    In this study, photolytic and photocatalytic removal of the antibiotic sulfamethoxazole (SMX) under UVC radiation ({lambda} = 254 nm) was investigated. The light intensity distribution inside the batch photoreactor was characterized by azoxybenzene actinometry. The intensity of incident radiation was found to be a strong function of position inside the reactor. 12 mg L{sup -1} of SMX was completely removed within 10 min of irradiation under UVC photolysis, compared to 30 min under TiO{sub 2} photocatalysis. COD measurement was used as an indication of the mineralization efficiency of both processes and higher COD removal with photocatalysis was shown. After 6 h of reaction with photolysis and photocatalysis, 24% and 87% removal of COD was observed, respectively. Two of the intermediate photo-products were identified as sulfanilic acid and 3-amino-5-methylisoxazole by direct comparison of the HPLC chromatograms of standards to those of treated solutions. Ecotoxicity of treated and untreated solutions of SMX towards Daphnia magna was also investigated. It was found that a 3:1 ratio of sample to standard freshwater and a high initial concentration of 60 mg L{sup -1} of SMX were used to obtain reliable and reproducible results. The photo-products formed during photocatalytic and photolytic processes were shown to be generally more toxic than the parent compound.

  16. PROSTAT SPESİFİK ANTİJEN 2.5-4 NG/ML ARALIĞINDA PSAD VE PROSTAT BİYOPSİ SONUÇLARININ DEĞERLENDİRİLMESİ Evaluation of PSAD and Prostate Biopsy Results in Prostat Specific Antigen Between 2.5-4 ng/mL

    OpenAIRE

    CEYLAN, Yasin; GÜNLÜSOY, Bülent; ŞEFİK, Ertugrul; AYDOĞDU, Özgü; DEĞİRMENCİ, Tansu; TOPÇU, Yusuf Kadir

    2018-01-01

    ÖZETAmaç: Bu çalışmanın amacı; PSA 2.5- 4 ng/ml arasında olan hastaların verilerini ve bu aralıktakanser saptama oranını değerlendirmektir.Gereç ve Yöntemler: Ocak 2011-Aralık 2014 tarihleri arasında hastanemizde Prostat Kanseri(PCa) şüphesi olan ve total PSA değeri 2.5-4 ng/ml olan 83 hastadan alınan prostat biyopsisonuçları retrospektif olarak değerlendirildi. PSA yüksekliği ve/veya anormal rektal muayenebulgusu ile kliniğimize başvuran her hastaya transrektal ultrason eşliğinde prostat biy...

  17. W-reactivation and W-mutagenesis in bacteriophages lambda and T7: comparison of action of ultraviolet irradiation (254nm) and furocouma photosensitization

    International Nuclear Information System (INIS)

    Zavil'gel'skij, G.B.; Belogurov, A.A.; Kryuger, D.N.

    1982-01-01

    When treating bacteriophage lambda with 8-methoxypsoralen (8-MOP) and light (lambda>320 nm), two types of photoproducts are formed in DNA: monoadducts and diadducts or interstrand linkings. If a wild-type strain of Escherichia coli is used as horst, W-reactivation and W-mutagenesis (clear-mutation), approximately equal in magnitude to those of UV-irradiated phage lambda, are observed in the bacteriophage lambda treated with 8-MOP plus light. If mutant strains E coli uvrA - , recA - and lexA - are used as host W-reactivation and W-mutagenesis practically do not occur in phage lambda. Using the method of ''reirradiation'', it is shown that clear-mutations in 8-MOP plus light treated phage lambda are induced in the process of W-mutagenesis mainly due to the formation of diadducts (interstrand linking) in DNA. In the phage monoadducts of derived furocoumarins also have a mutageneous character but their mutagenesis effectiveness (mutation probability calculating on one photo product) is significantly inferior to that of diadducts (approximately 15-20 times). It has been demonstrated in the experiments on the determination of W-mutagenesis of phage lambda photosensitized with angelisine - an angular derivative of furocoumarins - that mainly formi monoadducts in DNA. It is also shown that W-reactivation and W-mutagenesis effects are observed when sowing UV-irradiated (254 nm) phage lambda on E coli uvrA - and wild-type strains treated with 8-MOP plus light. As to bacteriophage T7 treated with 8-MOP plus light, W-reactivation is not observed even on a wild strain E coli. Preliminary infection of cells with phage T7 that has been strongly inactivated using photosensitizer 8-MOP decreases repair's effectiveness of interstrand linkings in DNA of phage lambda [ru

  18. DNA repair synthesis following irradiation with 254-nm and 312-nm ultraviolet light is not diminished in fibroblasts from patients with dysplastic nevus syndrome.

    Science.gov (United States)

    Thielmann, H W; Popanda, O; Edler, L; Böing, A; Jung, E G

    1995-01-01

    The DNA excision repair capacity of 23 primary fibroblast lines from patients with dysplastic nevus syndrome was investigated and DNA repair synthesis ("unscheduled DNA synthesis") was determined after UV exposure. Seventeen fibroblast lines from normal donors served as controls. The dose/response experiments included up to ten dose levels and two wavelength ranges: UV-C (using a low-pressure mercury lamp emitting predominantly 254-nm light) and UV-B (artificial "sunlamp" radiation centering around 312-nm light). For each dose level, silver grains over fibroblast nuclei were counted by visual inspection. Twelve cell lines were also evaluated for both UV wavelength ranges using a new semi-automatic image analyzing system. This system included components for rapid sequential identification of both fibroblast nuclei and silver grains sited above them. Silver grains over 100 nuclei were determined for each UV dose level. Dose/response curves were established and analyzed by linear regression. As a quantitative term for assessing DNA excision repair capacity of a cell line we calculated the linear increase (G0) in the number of grains per nucleus, when the UV dose was multiplied by the factor e (i.e. 2.72). The sensitivity of grain detection and resolution of overlapping grains was approximately threefold better in visual than in automatic counting, especially when there were more than 70 grains over nuclei. The time required for visual counting, however, was tenfold that of automatic counting. The variance-weighted mean G0v.w of all fibroblast lines from patients with dysplastic nevus syndrome was found to be 79.1 (+/- 1.8- grains/nucleus, that of fibroblast lines from normal donors was 74.2 (+/- 1.7) grains/nucleus. This difference revealed a slightly better repair capability for cell lines from patients but was at the borderline of detection and, therefore, should not be overinterpreted. From the experimental accuracy achieved by determination of the variance

  19. Effect of Key Parameters on the Photocatalytic Oxidation of Toluene at Low Concentrations in Air under 254 + 185 nm UV Irradiation

    Energy Technology Data Exchange (ETDEWEB)

    Quici, Natalia; Vera, Maria L.; Choi, Hyeok; Puma, Gianluca Li; Dionysiou, Dionysios D.; Litter, Marta I.; Destaillats, Hugo

    2009-07-01

    The effect of key experimental parameters on the removal of toluene under 254 + 185 nm irradiation was investigated using a benchtop photocatalytic flow reactor. Toluenewas introduced at low concentrations between 10 and 500 ppbv, typical of indoorenvironments, and reacted on TiO2-coated Raschig rings. Two different TiO2-coated rings were prepared: in one case, by dip-coating using a P25 aqueous suspension and, on the other, using an organic/inorganic sol-gel method that produced thin films of mesoporous anatase. Flow rates in the photoreactor varied between 4 L min-1 and 125 mL min-1, leading to residence times in the range 100 ms< tau< 2 s. For these conditions, toluene removal efficiencies were between 30 and 90percent, indicating that the system did not achieve total conversion in any case. For each air flow rate, the conversion oftoluene was significantly higher when the reactor length was 10 cm, as compared with 5 cm; however, only marginal increases in conversions were achieved in the two reactor lengths at equal residence time and different concentration of toluene, suggesting that that the reactor is effectively behaving as an ideal reactor and that the reaction is first-order in the concentration of toluene. Experiments were carried out between 0 and 66percent relative humidity (RH), the fastest reaction rate being observed at moderately low humidity conditions (10percent RH), with respect to both dry air and higher humidity levels. Formaldehyde was formed as a partial oxidation byproduct at low and at high residence times (240 and 960 ms), although higher formaldehyde molar yields (up to 20percent) were observed at low tau (240 ms) and moderate humidity conditions (10 and 33percent), suggesting that both tau and RH can be optimized toreduce the formation of harmful intermediates. Toluene removal efficiency increased with the TiO2 thickness (i.e., mass) until a maximum value of 500 nm, beyond which the removal efficiency decreased. This should be

  20. A abordagem sociotécnica na investigação e na prevenção de acidentes aéreos: o caso do vôo RG-254

    Directory of Open Access Journals (Sweden)

    Vitor Alexandre de Freitas Cardoso

    Full Text Available Este artigo apresenta estudo de caso do acidente ocorrido com o vôo RG-254 da Varig, em setembro de 1989. Partindo de informações de investigações oficiais, publicações, material audiovisual, entrevistas com envolvidos no acidente e especialistas em segurança de vôo, os autores re-analisam o acidente com enfoque sociotécnico referenciado na teoria ator-rede e no conceito de acidente "normal". O texto apresenta novo entendimento para a investigação de acidentes na aviação criticando a tradicional repartição de causas entre os chamados fatores "humanos", "técnicos" e "operacionais" e sugere aplicação do conceito de multicausalidade que não se restringe à mera listagem de "fatores contribuintes", mas que analisa as relações entre atores-redes envolvidos no sistema de aviação em que ocorreu o acidente. O acidente do RG-254 é descrito como sintoma do rompimento de relações entre os atores que atuam no sistema.

  1. 36 CFR 254.30 - Purpose.

    Science.gov (United States)

    2010-07-01

    ..., commonly called the Small Tracts Act, by conveying, through sale, exchange, or interchange, three categories of tracts of land: Parcels encroached on, road rights-of-way, and mineral survey fractions...

  2. 36 CFR 254.31 - Definitions.

    Science.gov (United States)

    2010-07-01

    ... color of title, or who owns land abutting or underlying a road right-of-way, or who owns land... of value of lands involved in an interchange where elements of value, such as physical..., or buildings. Interchange is a land transfer in which the Secretary and another person exchange lands...

  3. 36 CFR 254.9 - Appraisals.

    Science.gov (United States)

    2010-07-01

    ... information; location, zoning, and present use; an analysis of highest and best use; and at least a 5-year... Acquisition Conference 1992 (Washington, DC, 1992), ISBN 0-16-038050-2 when appraising the values of the... appraiser(s) shall provide to the authorized officer appraisals estimating the market value of Federal and...

  4. 254-IJBCS-Article-Prof. Msafiri Jackson

    African Journals Online (AJOL)

    Dr Gatsing

    hours, as some people avoid traffic jam by delaying their return trips from offices till night hours could explain the observed low. SPM levels. Range of six hourly average SPM concentration obtained in this study for. Kinondoni municipality in Dar es Salaam City is lower than ranges obtained in previous studies conducted in ...

  5. Publications | Page 254 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Madagascar, the world's fourth largest island, is home to an astonishing range of life forms found nowhere else on the planet. Much of this biodiversity is highly vulnerable to climate change. So too are ... Blood on the Stone Ian Smillie in his own words. Below, Ian Smillie traces his involvement in the struggle to halt conflict ...

  6. Publications | Page 254 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Finding India's missing middle. The middle is missing in India's labour markets and Dipak Mazumdar knows why. In truth, it was never really there, says the University of Toronto professor. Most Indians not working in agriculture rely on the country's large “.

  7. Evidence Based Education Request Desk. EBE #254

    Science.gov (United States)

    Regional Educational Laboratory Southeast, 2008

    2008-01-01

    This response looks specifically at the research related to teacher certification, alternative certification, and student achievement in science or mathematics. The research findings are inconclusive, and there is a need for more experimental and quasi-experimental studies to further define causality. (Contains 1 footnote.)

  8. 36 CFR 254.2 - Definitions.

    Science.gov (United States)

    2010-07-01

    ... lands as of a specific date(s), supported by the presentation and analysis of relevant market... competitive and open market under all conditions requisite to a fair sale, where the buyer and seller each...

  9. 36 CFR 254.3 - Requirements.

    Science.gov (United States)

    2010-07-01

    ...; consolidation of split estates; expansion of communities; accommodation of existing or planned land use... required to exchange any Federal lands. Land exchanges are discretionary, voluntary real estate...

  10. Publications | Page 254 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    As more women participate in the workplace, inequality may be increasing, rather than decreasing. Speaking at IDRC's head office in ... Below, Ian Smillie traces his involvement in the struggle to halt conflict diamonds, which have fuelled African wars that cost millions of lives. He describes the campaign in his new book, .

  11. 30 CFR 254.6 - Definitions.

    Science.gov (United States)

    2010-07-01

    ... not limited to petroleum, fuel oil, sludge, oil refuse, and oil mixed with wastes other than dredged... title 13, United States Code, and oils of vegetable origin, including oils from the seeds, nuts, and...

  12. 一般国道254号新座市野火止交差点及び一般国道299号飯能市栄町地区における総合的な交通安全対策の検討

    OpenAIRE

    久保田, 尚; 山, 進

    2007-01-01

    Situation of traffic safety in Saitama prefecture is very serious because the number of traffic accident fatalities in Saitama prefecture is 4th in Japan (2006). In response, workshop was held to discuss traffic safety measures in collaboration with local government, road users and university students. Target areas were Nobidome crossing, Niiza city (National Route 254) and Sakae town, Hanno city (National Route 299).In the workshop of Sakae town, the road users demanded that road space for b...

  13. Daniel Gallego Hernández (Ed.. Enfoques actuales en traducción económica e institucional. Actas del Congreso Internacional de Traducción Económica, Comercial, Financiera e Institucional. Suiça: Editorial Peter Lang, 2015. 254 p.

    Directory of Open Access Journals (Sweden)

    Miguel Tolosa Igualada

    2016-05-01

    Full Text Available http://dx.doi.org/10.5007/2175-7968.2016v36n2p291 Daniel Gallego Hernández (Ed.. Enfoques actuales en traducción económica e institucional. Actas del Congreso Internacional de Traducción Económica, Comercial, Financiera e Institucional. Suiça: Editorial Peter Lang, 2015. 254 p.

  14. Daniel Gallego Hernández (Ed.). Enfoques actuales en traducción económica e institucional. Actas del Congreso Internacional de Traducción Económica, Comercial, Financiera e Institucional. Suiça: Editorial Peter Lang, 2015. 254 p.

    OpenAIRE

    Miguel Tolosa Igualada

    2016-01-01

    Daniel Gallego-Hernández (ed.). Current Approaches to Business and Institutional Translation. Proceedings of the International Conference on Economic, Business, Financial and Institutional Translation / Enfoques actuales en traducción económica e institucional. Actas del Congreso Internacional de Traducción Económica, Comercial, Financiera e Institucional. Suíça: Peter Lang, 2015, 254 páginas. ISBN 978-3-0343-1656-9.

  15. Degradation kinetics and mechanism of β-lactam antibiotics by the activation of H{sub 2}O{sub 2} and Na{sub 2}S{sub 2}O{sub 8} under UV-254 nm irradiation

    Energy Technology Data Exchange (ETDEWEB)

    He, Xuexiang [Environmental Engineering and Science Program, University of Cincinnati, Cincinnati, OH 45221-0012 (United States); Department of Civil and Environmental Engineering and Nireas-International Water Research Centre, School of Engineering, University of Cyprus, PO Box 20537, 1678 Nicosia (Cyprus); Mezyk, Stephen P. [Department of Chemistry and Biochemistry, California State University Long Beach, 1250 Bellflower Blvd., Long Beach, CA 90840 (United States); Michael, Irene; Fatta-Kassinos, Despo [Department of Civil and Environmental Engineering and Nireas-International Water Research Centre, School of Engineering, University of Cyprus, PO Box 20537, 1678 Nicosia (Cyprus); Dionysiou, Dionysios D., E-mail: dionysios.d.dionysiou@uc.edu [Environmental Engineering and Science Program, University of Cincinnati, Cincinnati, OH 45221-0012 (United States); Department of Civil and Environmental Engineering and Nireas-International Water Research Centre, School of Engineering, University of Cyprus, PO Box 20537, 1678 Nicosia (Cyprus)

    2014-08-30

    Graphical abstract: - Highlights: • Removal efficiency was comparable at different UV fluence rates but same fluence. • Reducing pH to 3 or 2 did not inhibit the removal of nitrobenzene by UV/S{sub 2}O{sub 8}{sup 2−}. • 1.84 × 10{sup −14} M [HO{sup •} ]{sub ss} and 3.10 × 10{sup −13} M [SO{sub 4}{sup •} {sup −}]{sub ss} in UV/S{sub 2}O{sub 8}{sup 2−} were estimated. • HO{sup •} reacted faster with the β-lactams than SO{sub 4}{sup •} {sup −} but sharing similar byproducts. • Transformation pathways included hydroxylation, hydrolysis and decarboxylation. - Abstract: The extensive production and usage of antibiotics have led to an increasing occurrence of antibiotic residuals in various aquatic compartments, presenting a significant threat to both ecosystem and human health. This study investigated the degradation of selected β-lactam antibiotics (penicillins: ampicillin, penicillin V, and piperacillin; cephalosporin: cephalothin) by UV-254 nm activated H{sub 2}O{sub 2} and S{sub 2}O{sub 8}{sup 2−} photochemical processes. The UV irradiation alone resulted in various degrees of direct photolysis of the antibiotics; while the addition of the oxidants improved significantly the removal efficiency. The steady-state radical concentrations were estimated, revealing a non-negligible contribution of hydroxyl radicals in the UV/S{sub 2}O{sub 8}{sup 2−} system. Mineralization of the β-lactams could be achieved at high UV fluence, with a slow formation of SO{sub 4}{sup 2−} and a much lower elimination of total organic carbon (TOC). The transformation mechanisms were also investigated showing the main reaction pathways of hydroxylation (+16 Da) at the aromatic ring and/or the sulfur atom, hydrolysis (+18 Da) at the β-lactam ring and decarboxylation (–44 Da) for the three penicillins. Oxidation of amine group was also observed for ampicillin. This study suggests that UV/H{sub 2}O{sub 2} and UV/S{sub 2}O{sub 8}{sup 2−} advanced

  16. The discovery of 260Md and the decay properties of 258Fm, 258m,gMd and 259Md

    International Nuclear Information System (INIS)

    Lougheed, R.W.; Hulet, E.K.; Dougan, R.J.; Wild, J.F.; Dupzyk, R.J.; Henderson, C.M.; Moody, K.J.; Hahn, R.L.; Suemmerer, K.; Bethune, G.

    1986-01-01

    We have discovered a new neutron-rich isotope, 260 Md, from 18 O and 22 Ne bombardments of 254 Es. We observed a spontaneous-fission (SF) activity with a half-life of 32 days in electromagnetically separated fractions with mass number 260 from these bombardments and we measured the mass and kinetic energy distributions of this SF activity. The mass distribution was symmetric with the principal energy peak at a total kinetic energy (TKE) of 234 MeV, similar to previous observations for heavy fermium isotopes. Surprisingly, we also observed a smaller symmetric component with a TKE of 195 MeV. We interpret these two peaks in the TKE distribution as arising from two types of fission in the same nucleus, or bimodal fission. The observed fission activity may be either from the SF decay of 260 Md or from 260 Fm which would arise from electron-capture (EC) decay of 260 Md. We have eliminated the possible β - decay of 260 Md by measuring β - -SF time correlations for the decay of 260 Md and we plan to determine whether 260 Md decays by EC by measuring time correlations between fermium X-rays and SF events. We also measured various properties of the heavy fermium and mendelevium isotopes and obtained 1. more accurate cross-sections for the neutron-rich mendelevium isotopes which we use to predict the production rates of yet undiscovered nuclides, 2. improved half-life measurements for 258m,g Md and 259 Md, 3. confirmation of the EC decay of 258m Md by measurement of the fermium X-rays preceding the SF decay of 258 Fm and 4. very substantially improved mass and TKE distributions for the SF decay of 258 Fm and 259 Md. (orig.)

  17. 18 CFR 367.2540 - Account 254, Other regulatory liabilities.

    Science.gov (United States)

    2010-04-01

    ... company can furnish full information as to the nature and amount of each regulatory liability included in... REGULATORY COMMISSION, DEPARTMENT OF ENERGY REGULATIONS UNDER THE PUBLIC UTILITY HOLDING COMPANY ACT OF 2005, FEDERAL POWER ACT AND NATURAL GAS ACT UNIFORM SYSTEM OF ACCOUNTS FOR CENTRALIZED SERVICE COMPANIES SUBJECT...

  18. 29 CFR 1910.254 - Arc welding and cutting.

    Science.gov (United States)

    2010-07-01

    ... rated load with rated temperature rises where the temperature of the cooling air does not exceed 40 °C... personnel or by metal objects, i.e., vehicles, crane hooks, etc. Protection may be obtained by use of: Dead... contact with persons, conducting objects, fuel or compressed gas tanks. (8) Electric shock. Cables with...

  19. Dicty_cDB: VHP254 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available GTTTGCTGGTAAAATAGATTTCCCAATGTCGGTAATATCNTACCTCGTTTA sequence update 2002.10.25 Translated Amino Acid sequence kccstinptfm...VDIIVKQYHLLNNFDEFTNRSALFAGRKQTIQDLQSRTQCIALFAGKID FPMSVISYLV Frame B: kccstinptfmink*KRREKKMNVKEMDFNDLSNKSNQ

  20. 40 CFR 52.254 - Organic solvent usage.

    Science.gov (United States)

    2010-07-01

    ... contrivances designed for processing continuous web, strip, or wire that emit organic materials in the course... applying any photochemically reactive solvent, as defined in paragraph (k) of this section, or material containing such photochemically reactive solvent, unless said discharge has been reduced by at least 85...

  1. 24 CFR 92.254 - Qualification as affordable housing: Homeownership.

    Science.gov (United States)

    2010-04-01

    ... residents, percentage of owner-occupants) in relation to housing and incomes in the housing market area. An... public facilities and services. If a participating jurisdiction in preparing a neighborhood revitalization strategy under § 91.215(e)(2) of its consolidated plan or Empowerment Zone or Enterprise Community...

  2. 36 CFR 254.20 - Purpose and scope.

    Science.gov (United States)

    2010-07-01

    ..., needed by a community, may be sold under the Townsite Act, for fair market value if those lands would serve indigenous community objectives that outweigh the public objectives and values of retaining the... projects that would change the character of the local community. ...

  3. All projects related to | Page 254 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    2012-02-10

    Violent conflict related to drug trafficking in Mexico has had a profound impact on the quality of life and health of affected communities. Start Date: February 10, 2012. End Date: May 10, 2014. Topic: NARCOTICS, VICTIMS, VIOLENCE, DRUG TRAFFIC, VULNERABLE GROUPS, JUDICIAL SYSTEM. Region: Mexico, North ...

  4. Dicty_cDB: VFM254 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available (All Frames) Frame A: ---xxxxxxxxxxxxxxxxvxxxxxxxrxxxxxxxxxxxxxxxkvxxxxxkxxfxxvxnx xmvvlxxittfkrnplsi*ssd*ev...vckflskpslvrllhxklkvlitlrmlkpksktkk vfhqinnvsfspvnnwrmvvlslittfkrnplsi*fsd*evvckfl*klslvkplhsklk vvttlrm*kqkfktkkvshq Frame B: ---xxx...xxxxxxxxxxxxwxxxxxxsxgxxxxxxcxxxxxxxxryxxxxxxxxfxw*xix x

  5. 40 CFR 180.254 - Carbofuran; tolerances for residues.

    Science.gov (United States)

    2010-07-01

    ... (of which no more than 1 ppm is carbamates) 2 12/31/09 Coffee, bean, green 0.1 12/31/09 Corn, field..., raisin (of which no more than 1.0 ppm is carbamate 2.0 12/31/09 Grape, raisin, waste (of which no more...

  6. 40 CFR 408.254 - Pretreatment standards for existing sources.

    Science.gov (United States)

    2010-07-01

    .... pH Do. Oil and grease Do. [40 FR 55792, Dec. 1, 1975, as amended at 60 FR 33947, June 29, 1995] .... Any existing source subject to this subpart that introduces process wastewater pollutants into a...

  7. 7 CFR 764.254 - Rates and terms.

    Science.gov (United States)

    2010-01-01

    ... at regular interest rates. (3) The interest rate charged will be the lower rate in effect at the time... livestock produced for sale will not be considered adequate security for such loans. (2) The Agency...: (i) Must have adequate security at the time the balloon installment comes due. Crops, livestock other...

  8. 7 CFR 1710.254 - Alternative sources of power.

    Science.gov (United States)

    2010-01-01

    ... service, the short-term and long-term financial viability of the supplier, and the financial risk to the borrower and its creditors. The applicant will keep RUS fully informed on these evaluations and provide...

  9. Csapody, Tamás. 2014. Bortól Szombathelyig - Tanulmányok a bori munkaszolgálatról és a bori munkaszolgálatosok részleges névlistája ('From Bor to Szombathely- Studies on the Forced Labor Service at Bor Camp and the Partial List of the Forced Laborers in Bor'. Budapest: Zrinyi Kadó. 254 pp. ; Csapody, Tamás. 2015. A Cservenkai tömeggyilkosság ('The Mass Murder at Cservenka'. Budapest: Zsidó Tudományok Szabadegyeteme Alapítvány. 150 pp.

    Directory of Open Access Journals (Sweden)

    Julia Bock

    2016-10-01

    Full Text Available Csapody, Tamás. 2014. Bortól Szombathelyig - Tanulmányok a bori munkaszolgálatról és a bori munkaszolgálatosok részleges névlistája ('From Bor to Szombathely- Studies on the Forced Labor Service at Bor Camp and the Partial List of the Forced Laborers in Bor'. Budapest: Zrinyi Kadó. 254 pp. ; Csapody, Tamás. 2015. A Cservenkai tömeggyilkosság ('The Mass Murder at Cservenka'. Budapest: Zsidó Tudományok Szabadegyeteme Alapítvány. 150 pp. (e-book; a shorter version is accessible at: http://zsido.com/konyvek/a-cservenkai-tomeggyilkossag/.

  10. Cold valleys in the radioactive decay of 248− 254Cf isotopes

    Indian Academy of Sciences (India)

    Computed half-lives for alpha decay agree with experimental values within two orders of magnitude. The most probable clusters from these parents are predicted to be 46Ar, 48,50Ca which indicate the role of doubly or near doubly magic clusters in cluster radioactivity. Odd A clusters are found to be favorable for emission ...

  11. TASK 2.5.4 DEVELOPMENT OF AN ENERGY SAVINGS CALCULATOR

    Energy Technology Data Exchange (ETDEWEB)

    Miller, William A [ORNL; New, Joshua Ryan [ORNL; Desjarlais, Andre Omer [ORNL; Huang, Joe [Lawrence Berkeley National Laboratory (LBNL); Erdem, Ender [Lawrence Berkeley National Laboratory (LBNL); Ronnen, Levinson [Lawrence Berkeley National Laboratory (LBNL)

    2010-03-01

    California s major energy utilities and the California Energy Commission (CEC) are seeking to allocate capital that yields the greatest return on investment for energy infrastructure that meets any part of the need for reliable supplies of energy. The utilities are keenly interested in knowing the amount of electrical energy savings that would occur if cool roof color materials are adopted in the building market. To meet this need the Oak Ridge National Laboratory and the Lawrence Berkeley National Laboratory (LBNL) have been collaborating on a Public Interest Energy Research (PIER) project to develop an industry-consensus energy-savings calculator. The task was coordinated with an ongoing effort supported by the DOE to develop one calculator to achieve both the DOE and the EPA objectives for deployment of cool roof products. Recent emphasis on domestic building energy use has made the work a top priority by the Department of Energy s (DOE) Building Technologies Program. The Roof Savings Calculator (RSC) tool is designed to help building owners, manufacturers, distributors, contractors and practitioners easily run complex simulations. The latest web technologies and usability design were employed to provide an easy input interface to an annual simulation of hour-by-hour, whole-building performance using the world-class simulation tools DOE-2.1E and AtticSim. Building defaults were assigned based on the best available statistical evidence and can provide energy and cost savings after the user selects nothing more than the building location. A key goal for the tool is to promote the energy benefits of cool color tile, metal and asphalt shingle roof products and other energy saving systems. The RSC tool focuses on applications for the roof and attic; however, the code conducts a whole building simulation that puts the energy and heat flows of the roof and attic into the perspective of the whole house. An annual simulation runs in about 30 sec. In addition to cool reflective roofs, the RSC tool will simulate high- medium- and low-slope roofs, and has a custom selection for the user whose house has a unique inclination. There is an option for above sheathing ventilation, which is prevalent in tile and stone-coated metal roof assemblies. The tool also accommodates the effects of radiant barriers and low-emittance surfaces in the inclined air space above the sheathing. The practitioner can select to have air-conditioning ducts either in the conditioned space or in the attic. If in the attic, the user can select one of three air leakage options. Option 1 is an inspected duct having 4% leakage and code level of duct insulation; option 2 is a poorly insulated duct having 14% air leakage; and option 3 is a custom leakage rate specified by the user. The practitioner can setup multiple layers of ceiling insulation. AtticSim is benchmarked against the field data acquired for Ft. Irwin located near Barstow, CA, first as a standalone simulation program and then again integrated within the DOE-2.1E program. The standalone benchmark was very useful to determining how well AtticSim replicates the building physics of an attic. The coupled benchmark was useful to verify that the DOE-2.1E/AtticSim code is modeling correctly the dynamic relationship between the attic and the occupied space below, as well as the interactions between the attic and the HVAC system, in particular when the ducts are located in the attic.

  12. 40 CFR 97.254 - Compliance with CAIR SO2 emissions limitation.

    Science.gov (United States)

    2010-07-01

    ... compliance account pursuant to subpart GGG of this part or subpart D of part 73 of this chapter, in the order... in the compliance account pursuant to subpart GGG of this part or subpart D of part 73 of this... recorded in the compliance account pursuant to subpart GGG of this part or subpart D of part 73 of this...

  13. 40 CFR 96.254 - Compliance with CAIR SO2 emissions limitation.

    Science.gov (United States)

    2010-07-01

    ... compliance account pursuant to subpart GGG of this part or subpart D of part 73 of this chapter, in the order... in the compliance account pursuant to subpart GGG of this part or subpart D of part 73 of this... recorded in the compliance account pursuant to subpart GGG of this part or subpart D of part 73 of this...

  14. S. Afr. J. Anim. Sci. II , 247- 254 ( I 981 ) PRACTICAL IMPLICATIONS ...

    African Journals Online (AJOL)

    J. agric. Sci. Camb.,93,607. CRONJE, K.G., l9l3.Ondersoek na die invloed van verskillende drogingstegnieke op die samestelling van gedroogde groenvoer en kuilvoer. M.Sc. Tesis Universiteit van Stellenbosch-. DANLEY, M.M. & VETTER, R.L., l9l l. Changes in carbohydrate and nitrogen fractionsand digestibilityof orages:.

  15. Bibliography of Ground-Water References for All 254 Counties in Texas, 1886-2001

    Science.gov (United States)

    2005-01-01

    1759): TEXAS BOARD OF WATER ENGINEERS MISCELLANEOUS PUBLI- CATION 173, 1937. A FEW NOTES REGARDING GROUND WATER IN BROWNSVILLE- SAN BENITO -LA FERIA...EL PASO, TEXAS: USGS OPEN-FILE REPORT (UNNUMBERED), 1957. PRELIMINARY GEOHYDROLOGICAL STUDY OF THE JUAREZ VALLEY AND SURROUNDING AREAS, STATE OF... JUAREZ , MEXICO, MEXICO AREA: USGS OPEN-FILE REPORT (UNNUMBERED), 1967. USE OF WELLS TO LOWER THE WATER TABLE ALONG RELOCATED CHANNEL OF RIO GRANDE IN

  16. 16 CFR 254.3 - Misrepresentation of extent or nature of accreditation or approval.

    Science.gov (United States)

    2010-01-01

    ... those courses or programs, and making reference to the accreditation of the school, should clearly and... member to misrepresent that its courses are recommended by vocational counselors, high schools, colleges... are being trained. Note to paragraph (c): The Commission's Guides Concerning Use of Endorsements and...

  17. 40 CFR 421.254 - Standards of performance for new sources.

    Science.gov (United States)

    2010-07-01

    ....364 0.169 Mercury 0.195 0.078 Silver 0.377 0.156 Zinc 1.326 0.546 Gold 0.130 Oil and Grease 13.000 13... average mg/troy ounce of gold refined electrolytically Lead 5.544 2.574 Mercury 2.970 1.188 Silver 5.742 2.376 Zinc 20.200 8.316 Gold 1.980 Oil and Grease 198.000 198.000 Total suspended solids 297.000 237.600...

  18. The Impact of Baby Boomer Retirements on Teacher Labor Markets. Chicago Fed Letter. Number 254

    Science.gov (United States)

    Aaronson, Daniel; Meckel, Katherine

    2008-01-01

    This article explores the future of teacher labor markets. The authors find that teacher hiring needs will rise over the coming decade largely because of retirements. However, this increase will not be significantly different from that of past decades. (Contains 7 notes and 3 figures.)

  19. : tous les projets | Page 254 | CRDI - Centre de recherches pour le ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    L'élevage du mouton joue un rôle de premier plan pour ce qui est d'assurer la subsistance des ménages vivant en milieu rural au Mali et dans d'autres pays semi-arides d'Afrique de l'Ouest. Date de début : 1 mars 2011. End Date: 1 août 2014. Région: Mali. Programme: Fonds canadien de recherche sur la sécurité ...

  20. Cold valleys in the radioactive decay of 248−254Cf isotopes

    Indian Academy of Sciences (India)

    C46, 1939 (1992). [31] M Balasubramaniam and R K Gupta, Phys. Rev. C60, 064316 (1999). [32] D N Basu, Phys. Rev. C66, 027601 (2002). [33] P Moller, J R Nix, W D Myers and W Swiatecki, At. Data Nucl. Data Tables 59, 185. (1995). [34] S Wang, D Snowden-Ifft, P B Price, K J Moody and E K Hulet, Phys Rev. C39, 1647.

  1. Kuue kuuga on EAS toetanud uusi ideid 2,54 miljardi krooniga / Ülari Alamets

    Index Scriptorium Estoniae

    Alamets, Ülari, 1967-

    2009-01-01

    Ettevõtluse Arendamise Sihtasutus on enam arendanud tehnoloogia arenduskeskuseid, ettevõtete tootearendusprojekte, investeeringuid külakeskkonda ning kohalike avalike teenuste arendamist. Lisa: Põlvamaa suuremad projektid

  2. 40 CFR 98.254 - Monitoring and QA/QC requirements.

    Science.gov (United States)

    2010-07-01

    ... 2007) Standard Test Methods for Instrumental Determination of Carbon, Hydrogen, and Nitrogen in... Methods for Instrumental Determination of Carbon, Hydrogen, and Nitrogen in Laboratory Samples of Coal...

  3. 16 CFR 254.4 - Misrepresentation of facilities, services, qualifications of staff, status, and employment...

    Science.gov (United States)

    2010-01-01

    ... member to misrepresent, directly or indirectly, in advertising, promotional materials, or in any other... its advertising, promotional materials, or in any other manner, to misrepresent, directly or by implication, whether through the use of text, images, endorsements, or by other means, the availability of...

  4. Spectroscopy of odd-proton nuclei in the region of 254No

    International Nuclear Information System (INIS)

    Ketelhut, S.; Greenlees, P. T.; Eeckhaudt, S.; Jones, P.; Julin, R.; Juutinen, S.; Kettunen, H.; Leino, M.; Leppaenen, A.-P.; Nieminen, P.; Nyman, M.; Perkowski, J.; Rahkila, P.; Saren, J.; Scholey, C.; Uusitalo, J.; Chatillon, A.; Bouchez, E.; Clement, E.; Goergen, A.

    2008-01-01

    Two rotational bands have been found in the transfermium nuclei 251 Md and 255 Lr, the latter being the heaviest nucleus so far studied in-beam. Both are assigned to a [521]1/2 - Nilsson state by comparison to theory. The experiments have been carried out in the Accelerator Laboratory of the University of Jyvaeskylae (JYFL), where the array of germanium detectors JUROGAM was used in conjunction with the recoil-seperator RITU and the focal-plane setup GREAT for gamma-spectroscopic studies

  5. 30 CFR 254.7 - How do I submit my response plan to the MMS?

    Science.gov (United States)

    2010-07-01

    ... 30 Mineral Resources 2 2010-07-01 2010-07-01 false How do I submit my response plan to the MMS... do I submit my response plan to the MMS? You must submit the number of copies of your response plan that the appropriate MMS regional office requires. If you prefer to use improved information technology...

  6. Sterilization effect of 254 nm UV-C irradiation against cynaobacteria Microcystis aeruginosa

    Science.gov (United States)

    Harmful algal bloom (HAB) produced by several cyanobacterial species is a significant threat to many aquatic ecosystems around the world. Recently frequent occurrence of serious algal bloom in Lake Taihu, Lake Dianchi, and Lake Chaohu has become a serious concern in China. Although various methods a...

  7. Civic Education and Peacebuilding: Examples from Iraq and Sudan. Special Report 254

    Science.gov (United States)

    Levine, Daniel H.; Bishai, Linda S.

    2010-01-01

    Between 2006 and 2010, the United States Institute of Peace developed several civic education programs for Iraq and Sudan as part of broader efforts to promote postconflict stability and development and help prevent a return to violence. This report describes those programs after first examining the conceptual bases for civic education and how…

  8. Textural parameters distribution in sediments surface of the Uruguay river background between km 221 and 254

    International Nuclear Information System (INIS)

    Capeluto, W.; Campos, T. de los

    2010-01-01

    The aim of this paper is to analyze the distribution of textural statistical parameters and spatial variation in the morphology of the sediment areas. The geology of the area comprises alluvial and alluvial deposits of variable thicknesses overlying deposits of Fray Bent os, Salto and Guichon formations that occasionally emerge in the river bed

  9. SU-F-T-254: Dose Volume Histogram (DVH) Analysis of Breath Hold Vs Free Breathing Techniques for Esophageal Tumors

    Energy Technology Data Exchange (ETDEWEB)

    Badkul, R; Doke, K; Pokhrel, D; Aguilera, N; Lominska, C [University of Kansas Medical Center, Kansas City, KS (United States)

    2016-06-15

    Purpose: Lung and heart doses and associated toxicity are of concern in radiotherapy for esophageal cancer. This study evaluates the dosimetry of deep-inspiration-breath-hold (DIBH) technique as compared to freebreathing( FB) using 3D-conformal treatment(3D-CRT) of esophageal cancer. Methods: Eight patients were planned with FB and DIBH CT scans. DIBH scans were acquired using Varian RPM system. FB and DIBH CTs were contoured per RTOG-1010 to create the planning target volume(PTV) as well as organs at risk volumes(OAR). Two sets of gross target volumes(GTV) with 5cm length were contoured for each patient: proximal at the level of the carina and distal at the level of gastroesophageal junction and were enlarged with appropriate margin to generate Clinical Target Volume and PTV. 3D-CRT plans were created on Eclipse planning system for 45Gy to cover 95% of PTV in 25 fractions for both proximal and distal tumors on FB and DIBH scans. For distal tumors celiac nodes were covered electively. DVH parameters for lung and heart OARs were generated and analyzed. Results: All DIBH DVH parameters were normalized to FB plan values. Average of heart-mean and heart-V40 was 0.70 and 0.66 for proximal lesions. For distal lesions ratios were 1.21 and 2.22 respectively. For DIBH total lung volume increased by 2.43 times versus FB scan. Average of lung-mean, V30, V20, V10, V5 are 0.82, 0.92, 0.76, 0.77 and 0.79 for proximal lesions and 1.17,0.66,0.87,0.93 and 1.03 for distal lesions. Heart doses were lower for breath-hold proximal lesions but higher for distal lesions as compared to free-breathing plans. Lung doses were lower for both proximal and distal breath-hold lesions except mean lung dose and V5 for distal lesions. Conclusion: This study showed improvement of OAR doses for esophageal lesions at mid-thoracic level utilizing DIBH vs FB technique but did not show consistent OAR sparing with DIBH for distal lesions.

  10. No 2965, No 254. Report on new energy technologies and carbon dioxide sequestration: scientifical and technical aspects

    International Nuclear Information System (INIS)

    Bataille, Ch.; Birraux, C.

    2006-03-01

    The abatement of CO 2 emissions is a huge technical and economical challenge. Fossil fuels, which represent 88% of the world primary energy consumption, are the main source of the 25 billions of CO 2 released each year in the atmosphere. The mastery of CO 2 emissions cannot come from a single technology but must result from the simultaneous implementation of several means, like the development of carbon-free energies and the mastery of fossil fuel emissions. The opportunities of progress are numerous and compatible with the economic development. This document presents, first, the different greenhouse gases, the CO 2 emissions per country and the main sources of CO 2 emissions (power and heat generation, transports). Then it presents different ways of abatement of CO 2 emissions: clean coal technologies, gas combined cycles, CO 2 sequestration, reduction of fuel consumption in transports, development of carbon-free energies: wind power, solar photovoltaic for decentralized power generation, nuclear energy for a competitive power generation and for CO 2 abatement, biofuels of 2. generation and fuel cells. The conclusion stresses on the investments needed for the renewal and increase of energy capacities, and on the necessary visibility and moderation of emission abatement mechanisms (carbon trading and CO 2 prices). (J.S.)

  11. 30 CFR 254.54 - Spill prevention for facilities located in State waters seaward of the coast line.

    Science.gov (United States)

    2010-07-01

    ... SERVICE, DEPARTMENT OF THE INTERIOR OFFSHORE OIL-SPILL RESPONSE REQUIREMENTS FOR FACILITIES LOCATED... of the steps you are taking to prevent spills of oil or mitigate a substantial threat of such a...

  12. 75 FR 21299 - Determination of Regulatory Review Period for Purposes of Patent Extension; VIMPAT-NDA 22-254

    Science.gov (United States)

    2010-04-23

    ... product and continues until FDA grants permission to market the drug product. Although only a portion of a... 35 U.S.C. 156(g)(1)(B). FDA recently approved for marketing the human drug product VIMPAT (lacosamide... VIMPAT represented the first permitted commercial marketing or use of the product. Thereafter, the Patent...

  13. Final Environmental Assessment for the Closure of the Garland ANG Station 254th Combat Communications Group Garland, Texas

    Science.gov (United States)

    2009-07-01

    State Historic Preservation Officer, the Executive Director of the Texas Historical Commission ( THC ). Our review staff, led by William McWhorter...the THC concurs with the determination of no adverse effect for the above mentioned project. Thank you for your cooperation in the federal review...data. 4.14 Hai!’ardoiiS Materials TECP letter in appendix Describe stont, gc , handling,_ use, disposal_, Containlnatt.’d sitt’S arid status of

  14. Inactivation of avirulent Yersinia pestis in Butterfield's phosphate buffer and frankfurters by UVC (254 nm) and gamma radiation.

    Science.gov (United States)

    Sommers, Christopher H; Cooke, Peter H

    2009-04-01

    Yersinia pestis is the causative agent of plague. Although rare, pharyngeal plague in humans has been associated with consumption or handling of meat prepared from infected animals. The risks of contracting plague from consumption of deliberately contaminated food are currently unknown. Gamma radiation is a penetrating form of electromagnetic radiation, and UVC radiation is used for decontamination of liquids or food surfaces. Gamma radiation D10-values (the radiation dose needed to inactivate 1 log unit pathogen) were 0.23 (+/-0.01) and 0.31 (+/-0.03) kGy for avirulent Y. pestis inoculated into Butterfield's phosphate buffer and onto frankfurter surfaces, respectively, at 0 degree C. A UVC radiation dose of 0.25 J/cm2 inactivated avirulent Y. pestis suspended in Butterfield's phosphate buffer. UVC radiation doses of 0.5 to 4.0 J/cm2 inactivated 0.97 to 1.20 log units of the Y. pestis surface inoculated onto frankfurters. A low gamma radiation dose of 1.6 kGy could provide a 5-log reduction and a UVC radiation dose of 1 to 4 J/cm2 would provide a 1-log reduction of Y. pestis surface inoculated onto frankfurters. Y. pestis was capable of growth on frankfurters during refrigerated storage (10 degrees C). Gamma radiation of frankfurters inhibited the growth of Y. pestis during refrigerated storage, and UVC radiation delayed the growth of Y. pestis.

  15. SU-F-T-254: Dose Volume Histogram (DVH) Analysis of Breath Hold Vs Free Breathing Techniques for Esophageal Tumors

    International Nuclear Information System (INIS)

    Badkul, R; Doke, K; Pokhrel, D; Aguilera, N; Lominska, C

    2016-01-01

    Purpose: Lung and heart doses and associated toxicity are of concern in radiotherapy for esophageal cancer. This study evaluates the dosimetry of deep-inspiration-breath-hold (DIBH) technique as compared to freebreathing( FB) using 3D-conformal treatment(3D-CRT) of esophageal cancer. Methods: Eight patients were planned with FB and DIBH CT scans. DIBH scans were acquired using Varian RPM system. FB and DIBH CTs were contoured per RTOG-1010 to create the planning target volume(PTV) as well as organs at risk volumes(OAR). Two sets of gross target volumes(GTV) with 5cm length were contoured for each patient: proximal at the level of the carina and distal at the level of gastroesophageal junction and were enlarged with appropriate margin to generate Clinical Target Volume and PTV. 3D-CRT plans were created on Eclipse planning system for 45Gy to cover 95% of PTV in 25 fractions for both proximal and distal tumors on FB and DIBH scans. For distal tumors celiac nodes were covered electively. DVH parameters for lung and heart OARs were generated and analyzed. Results: All DIBH DVH parameters were normalized to FB plan values. Average of heart-mean and heart-V40 was 0.70 and 0.66 for proximal lesions. For distal lesions ratios were 1.21 and 2.22 respectively. For DIBH total lung volume increased by 2.43 times versus FB scan. Average of lung-mean, V30, V20, V10, V5 are 0.82, 0.92, 0.76, 0.77 and 0.79 for proximal lesions and 1.17,0.66,0.87,0.93 and 1.03 for distal lesions. Heart doses were lower for breath-hold proximal lesions but higher for distal lesions as compared to free-breathing plans. Lung doses were lower for both proximal and distal breath-hold lesions except mean lung dose and V5 for distal lesions. Conclusion: This study showed improvement of OAR doses for esophageal lesions at mid-thoracic level utilizing DIBH vs FB technique but did not show consistent OAR sparing with DIBH for distal lesions.

  16. SU-E-J-254: Utility of Pinnacle Dynamic Planning Module Utilizing Deformable Image Registration in Adaptive Radiotherapy

    International Nuclear Information System (INIS)

    Jani, S

    2014-01-01

    Purpose For certain highly conformal treatment techniques, changes in patient anatomy due to weight loss and/or tumor shrinkage can result in significant changes in dose distribution. Recently, the Pinnacle treatment planning system added a Dynamic Planning module utilizing Deformable Image Registration (DIR). The objective of this study was to evaluate the effectiveness of this software in adapting to altered anatomy and adjusting treatment plans to account for it. Methods We simulated significant tumor response by changing patient thickness and altered chin positions using a commercially-available head and neck (H and N) phantom. In addition, we studied 23 CT image sets of fifteen (15) patients with H and N tumors and eight (8) patients with prostate cancer. In each case, we applied deformable image registration through Dynamic Planning module of our Pinnacle Treatment Planning System. The dose distribution of the original CT image set was compared to the newly computed dose without altering any treatment parameter. Result was a dose if we did not adjust the plan to reflect anatomical changes. Results For the H and N phantom, a tumor response of up to 3.5 cm was correctly deformed by the Pinnacle Dynamic module. Recomputed isodose contours on new anatomies were within 1 mm of the expected distribution. The Pinnacle system configuration allowed dose computations resulting from original plans on new anatomies without leaving the planning system. Original and new doses were available side-by-side with both CT image sets. Based on DIR, about 75% of H and N patients (11/15) required a re-plan using new anatomy. Among prostate patients, the DIR predicted near-correct bladder volume in 62% of the patients (5/8). Conclusions The Dynamic Planning module of the Pinnacle system proved to be an accurate and useful tool in our ability to adapt to changes in patient anatomy during a course of radiotherapy

  17. Comments to " Retrieval of source parameters of an event of the 2000 West Bohemia earthquake swarm assuming an anisotropic crust", Stud. geophys. geod., 51, 231-254

    Czech Academy of Sciences Publication Activity Database

    Rössler, D.; Krüger, F.; Pšenčík, Ivan; Rümpker, G.

    2008-01-01

    Roč. 52, č. 2 (2008), s. 285-286 ISSN 0039-3169 Institutional research plan: CEZ:AV0Z30120515 Keywords : West Bohemia * tensile faulting * seismic anisotropy * seismic source Subject RIV: DC - Siesmology, Volcanology, Earth Structure Impact factor: 0.770, year: 2008

  18. sEEG is a Safe Procedure for a Comprehensive Anatomic Exploration of the Insula: A Retrospective Study of 108 Procedures Representing 254 Transopercular Insular Electrodes.

    Science.gov (United States)

    Salado, Anne Laure; Koessler, Laurent; De Mijolla, Gabriel; Schmitt, Emmanuelle; Vignal, Jean-Pierre; Civit, Thierry; Tyvaert, Louise; Jonas, Jacques; Maillard, Louis Georges; Colnat-Coulbois, Sophie

    2018-01-01

    The exploration of the insula in pre-surgical evaluation of epilepsy is considered to be associated with a high vascular risk resulting in an incomplete exploration of the insular cortex. To report a retrospective observational study of insular exploration using stereoelectroencephalography (sEEG) with transopercular and parasagittal oblique intracerebral electrodes from January 2008 to January 2016. The first purpose of this study was to evaluate the surgical risks of insular cortex sEEG exploration. The second purpose was to define the ability of placing intracerebral contacts in the whole insular cortex. Ninety-nine patients underwent 108 magnetic resonance imaging (MRI)-guided stereotactic implantations of intracerebral electrodes in the context of preoperative assessment of drug-resistant epilepsy, including at least 1 electrode placed in the insular cortex. On postoperative computed tomography images co-registered with MRI, followed by MRI segmentation and application of a transformation matrix, intracerebral contact coordinates of the insular electrodes' contacts were anatomically localized in the Talairach space. Finally, dispersion and clustering analysis was performed. There was no morbidity, in particular hemorrhagic complications, or mortality related to insular electrodes. Statistical comparison of intracerebral contact positions demonstrated that whole insula exploration is possible on the left and right sides. In addition, the clustering analysis showed the homogeneous distribution of the electrodes within the insular cortex. In the presurgical evaluation of drug-resistant epilepsy, the insular cortex can be explored safely and comprehensively using transopercular sEEG electrodes. Parasagittal oblique trajectories may also be associated to achieve an optimal exploration. Copyright © 2017 by the Congress of Neurological Surgeons

  19. Comparison of Recanalization and In-Stent Stenosis Between the Low-Profile Visualized Intraluminal Support Stent and Enterprise Stent-Assisted Coiling for 254 Intracranial Aneurysms.

    Science.gov (United States)

    Feng, Xin; Qian, Zenghui; Liu, Peng; Zhang, Baorui; Wang, Luyao; Guo, Erkang; Wen, Xiaolong; Xu, Wenjuan; Jiang, Chuhan; Wu, Zhongxue; Li, Youxiang; Liu, Aihua

    2018-01-01

    To compare the rates of recanalization and in-stent stenosis between the Enterprise (EP) and low-profile visualized intraluminal support (LVIS) stent deployments for intracranial aneurysms (IAs), and the factors associated therein. Between June 2014 and July 2016, 142 patients with a total of 161 IAs were treated by LVIS stent-assisted coiling and 111 patients with a total of 142 IAs were treated by EP stent-assisted coiling at our institution. Procedure-related complications, angiographic follow-up results, and clinical outcomes were analyzed statistically. The rates of initially complete and near-complete IA occlusion immediately after the procedure were similar in the LVIS and EP groups (94.3% vs. 89.9%; P = 0.275). On follow-up, complete and near-complete occlusion rates and recanalization rates were also similar in the 2 groups (96.6% vs. 92.1%; P =0.330 and 8.0% vs. 13.5%; P = 0.245, respectively). On logistic regression analysis, a higher size ratio (SR) was significantly associated with the recanalization of aneurysms in the EP group, but not in the LVIS group. The rate of moderate to severe in-stent stenosis was lower in the LVIS group (10.2%) than in the EP group (16.8%), but the difference was not statistically significant (P = 0.198). Our data show acceptable rates of complete and near-complete occlusion with both the LVIS and EP stents. LVIS stents were associated with lower rates of recanalization and in-stent stenosis, but the difference was not significant. Higher SR (≥2) was a significant predictor of recanalization in IAs treated with EP stents, but not in those treated with LVIS stents. Copyright © 2017. Published by Elsevier Inc.

  20. Herschel Spectroscopy of the Taffy Galaxies (UGC 12914/12915 = VV 254): Enhanced [C II] Emission in the Collisionally Formed Bridge

    Science.gov (United States)

    Peterson, B. W.; Appleton, P. N.; Bitsakis, T.; Guillard, P.; Alatalo, K.; Boulanger, F.; Cluver, M.; Duc, P.-A.; Falgarone, E.; Gallagher, S.; Gao, Y.; Helou, G.; Jarrett, T. H.; Joshi, B.; Lisenfeld, U.; Lu, N.; Ogle, P.; Pineau des Forêts, G.; van der Werf, P.; Xu, C. K.

    2018-03-01

    Using the PACS and SPIRE spectrometers on board Herschel, we obtained observations of the Taffy galaxies (UGC 12914/12915) and bridge. The Taffy system is believed to be the result of a face-on collision between two gas-rich galaxies, in which the stellar disks passed through each other, but the gas was dispersed into a massive H I and molecular bridge between them. Emission is detected and mapped in both galaxies and the bridge in the [C II]157.7 μm and [O I]63.2 μm fine-structure lines. Additionally, SPIRE FTS spectroscopy detects the [C I] {}3{{{P}}}2\\to {}3{{{P}}}1(809.3 {GHz}) and [C I] {}3{{{P}}}1\\to 3{{{P}}}0(492.2 {GHz}) neutral carbon lines, and weakly detects high-J CO transitions in the bridge. These results indicate that the bridge is composed of a warm multi-phase medium consistent with shock and turbulent heating. Despite low star formation rates in the bridge, the [C II] emission appears to be enhanced, reaching [C II]/FIR ratios of 3.3% in parts of the bridge. Both the [C II] and [O I] lines show broad intrinsic multi-component profiles, similar to those seen in previous CO (1–0) and H I observations. The [C II] emission shares similar line profiles with both the double-peaked H I profiles and shares a high-velocity component with single-peaked CO profiles in the bridge, suggesting that the [C II] emission originates in both the neutral and molecular phases. We show that it is feasible that a combination of turbulently heated H2 and high column-density H I, resulting from the galaxy collision, is responsible for the enhanced [C II] emission.

  1. N′-Benzylidene-2-({5-[(4-chlorophenoxymethyl]-4-phenyl-4H-1,2,4-triazol-3-yl}sulfanylacetohydrazide hemihydrate

    Directory of Open Access Journals (Sweden)

    Joel T. Mague

    2016-04-01

    Full Text Available The title compound, C24H20ClN5O2S·0.5H2O, has three independent molecules in the asymmetric unit and two water molecules of crystallization, one of which is equally disordered over two sites. The three unique organic molecules differ in the conformations of the substituents on the pyrazole ring. In the crystal, extensive O—H...O, O—H...N, N—H...O and C—H...O hydrogen bonding generates a three-dimensional network and C—H...π interactions are also observed.

  2. Nr 254 - Opinion on the behalf of the Commission of foreign affairs in the finance bill project for 2013 (nr 235), Volume 5 - ecology, sustainable development and planning

    International Nuclear Information System (INIS)

    Le Guen, Jean-Marie

    2012-01-01

    After an introduction evoking the different parts of the finance bill project, its main programs and endowments, this report sets the associated national strategy within the context of the European and world agenda with respect to the protection of the environment, to climate change, and to international negotiations (Rio protocol, Durban conference, biodiversity). It outlines three main challenges: the international conference on climate of 2015 France has proposed to organize, the creation of European community on energy, and solving the current difficulties of the carbon trading scheme

  3. 5-Bromo-2-[5-(4-nitrophenyl-3-phenyl-4,5-dihydro-1H-pyrazol-1-yl]pyrimidine

    Directory of Open Access Journals (Sweden)

    B. Kalluraya

    2009-12-01

    Full Text Available In the title pyrazoline compound, C19H14BrN5O2, the essentially planar pyrazoline and pyrimidine rings [maximum deviations = 0.013 (1 and 0.009 (1 Å, respectively] are inclined slightly to one another, making a dihedral angle of 10.81 (10°. The nitrobenzene unit is almost perpendicular to the attached pyrazoline ring, as indicated by the dihedral angle of 84.61 (8°. In the crystal structure, intermolecular C—H...N contacts link the molecules into dimers in an antiparallel manner. These dimers are further linked into one-dimensional chains along the b axis via C—H...O contacts. The crystal structure is consolidated by three different intermolecular π–π interactions [range of centroid–centroid distances = 3.5160 (11–3.6912 (11 Å].

  4. Effects of pH and H2O2 on ammonia, nitrite, and nitrate transformations during UV254nm irradiation: Implications to nitrogen removal and analysis.

    Science.gov (United States)

    Wang, Junli; Song, Mingrui; Chen, Baiyang; Wang, Lei; Zhu, Rongshu

    2017-10-01

    In order to achieve better removal and analyses of three dissolved inorganic nitrogen (DIN) species via ultraviolet-activated hydrogen peroxide (UV/H 2 O 2 ) process, this study systematically investigated the rates of photo-oxidations of ammonia/ammonium (NH 3 /NH 4 + ) and nitrite (NO 2 - ) as well as the photo-reduction of nitrate (NO 3 - ) at varying pH and H 2 O 2 conditions. The results showed that the mass balances of nitrogen were maintained along irradiation despite of interconversions of DIN species, suggesting that no nitrogen gas (N 2 ) or other nitrogen-containing compound was formed. NH 3 was more reactive than NH 4 + with hydroxyl radical (OH), and by a stepwise H 2 O 2 addition method NH 3 /NH 4 + can be completely converted to NO x - ; NO 2 - underwent rapid oxidation to form NO 3 - when H 2 O 2 was present, suggesting that it is an intermediate compound linking NH 3 /NH 4 + and NO 3 - ; but once H 2 O 2 was depleted, NO 3 - can be gradually photo-reduced back to NO 2 - at high pH conditions. Other than H 2 O 2 , the transformation kinetics of DINs were all dependent on pH, but to varying aspects and extents: the NH 3 photo-oxidation favored a pH of 10.3, which fell within the pK a values of NH 4 + (9.24) and H 2 O 2 (11.6); the NO 3 - photo-reduction increased with increasing pH provided that it exceeds the pK a of peroxynitrous acid (6.8); while the NO 2 - photo-oxidation remained stable unless the pH neared the pK a of H 2 O 2 (11.6). The study thereby demonstrates a picture of the evolutions of DIN species together during UV/H 2 O 2 irradiation process, and for the first time presents a method to achieve complete conversion of NH 4 + to NO 3 - with UV/H 2 O 2 process. Copyright © 2017 Elsevier Ltd. All rights reserved.

  5. Effect of germicidal UV-C light(254 nm) on eggs and adult of house dustmites, Dermatophagoides pteronyssinus and Dermatophagoides farinae (Astigmata: Pyroglyhidae).

    Science.gov (United States)

    Lah, Ernieenor Faraliana Che; Musa, Raja Noor Azreen Raja; Ming, Ho Tze

    2012-09-01

    To examined the immediate and 24 hours post- irradiation germicidal effects of UV-C lamp on eggs and adults of house dust mites Dermatophagoides pteronyssinus (D. pteronyssinus) and Dermatophagoides farinae (D. farinae). This study investigated the immediate and 24 hours post irradiation mortalities of adult mites exposed to UV-C at different exposure times (5 mins, 10 mins, 15 mins, 20 mins, 30 mins and 60 mins) and distances (10 cm, 25 cm, 35 cm, 45 cm and 55 cm). Fresh eggs of the 2 dust mites were also irradiated at 10, 35 and 55 cm for 0.5, 1, 2, 3, and 5 minutes, and observed daily post- irradiation for up to 7 days. Highest immediate mortality of 100% occurred with direct irradiation at 10 cm distance from UV-C lamp and for 60 mins, for both species of mites. The post 24 hours mean mortality rates were (58.4±17.4)% for D. pteronyssinus and (27.7±9.7)% for D. farinae when irradiated for 1 hour at 55 cm distance under UV-C lamp. When mites were irradiated in the presence of culture media, the highest mortality rates were lower compared to the direct irradiation; at 10 cm distance and 60 mins exposure, the mean mortality was (74.0±6.8)% for D. pteronyssinus and (70.3±6.7)% for D. farinae. Egg hatchability for both species of mites was also notably reduced by greater than 50% following irradiation. Ultraviolet C irradiation is lethal to an array of organisms by damaging their nucleic acids (DNA and RNA). This study demonstrates the increasing mite mortalities with increasing exposure times and decreasing distances.

  6. Effect of germicidal UV-C light(254 nm) on eggs and adult of house dustmites, Dermatophagoides pteronyssinus and Dermatophagoides farinae (Astigmata: Pyroglyhidae)

    OpenAIRE

    Lah, Ernieenor Faraliana Che; Musa, Raja Noor Azreen Raja; Ming, Ho Tze

    2012-01-01

    Objective: To examined the immediate and 24 hours post- irradiation germicidal effects of UV-C lamp on eggs and adults of house dust mites Dermatophagoides pteronyssinus (D. pteronyssinus) and Dermatophagoides farinae (D. farinae). Methods: This study investigated the immediate and 24 hours post irradiation mortalities of adult mites exposed to UV-C at different exposure times (5 mins, 10 mins, 15 mins, 20 mins, 30 mins and 60 mins) and distances (10 cm, 25 cm, 35 cm, 45 cm and 55 cm). Fre...

  7. 254. Impacto de la oxigenación de membrana extracorpórea en el shock cardiogénico postrasplante cardíaco

    Directory of Open Access Journals (Sweden)

    L. Doñate Bertolín

    2012-04-01

    Conclusiones: Pese a que la tasa de supervivencia hospitalaria es baja, hay que tener en cuenta que se trata de un grupo de pacientes de muy alto riesgo, para los que no existen alternativas de tratamiento más eficaces disponibles.

  8. Ethanogenic fermentation of co-cultures of Candida shehatae HM 52.2 and Saccharomyces cerevisiae ICV D254 in synthetic medium and rice hull hydrolysate.

    Science.gov (United States)

    Hickert, Lilian Raquel; da Cunha-Pereira, Fernanda; de Souza-Cruz, Priscila Brasil; Rosa, Carlos Augusto; Ayub, Marco Antônio Záchia

    2013-03-01

    The ability of Candida shehatae, Saccharomyces cerevisiae, or the combination of these two yeasts in converting the mixed sugar composition of rice hull hydrolysate (RHH) as substrate for ethanol production is presented. In shake flask experiments, co-cultures showed ethanol yields (YP/S) of 0.42 and 0.51 in synthetic medium simulating the sugar composition of RHH and in RHH, respectively, with both glucose and xylose being completely depleted, while pure cultures of C. shehatae produced slightly lower ethanol yields (0.40). Experiments were scaled-up to bioreactors, in which anaerobiosis and oxygen limitation conditions were tested. Bioreactor co-cultures produced similar ethanol yields in both conditions (0.50-0.51) in synthetic medium, while in RHH, yields of 0.48 and 0.44 were obtained, respectively. The results showed near-theoretical yields of ethanol. Results suggest the feasibility of co-cultures of C. shehatae, a newly isolated strain, and S. cerevisiae in RHH as substrate for second-generation ethanol production. Copyright © 2012 Elsevier Ltd. All rights reserved.

  9. SU-E-T-254: Optimization of GATE and PHITS Monte Carlo Code Parameters for Uniform Scanning Proton Beam Based On Simulation with FLUKA General-Purpose Code

    International Nuclear Information System (INIS)

    Kurosu, K; Takashina, M; Koizumi, M; Das, I; Moskvin, V

    2014-01-01

    Purpose: Monte Carlo codes are becoming important tools for proton beam dosimetry. However, the relationships between the customizing parameters and percentage depth dose (PDD) of GATE and PHITS codes have not been reported which are studied for PDD and proton range compared to the FLUKA code and the experimental data. Methods: The beam delivery system of the Indiana University Health Proton Therapy Center was modeled for the uniform scanning beam in FLUKA and transferred identically into GATE and PHITS. This computational model was built from the blue print and validated with the commissioning data. Three parameters evaluated are the maximum step size, cut off energy and physical and transport model. The dependence of the PDDs on the customizing parameters was compared with the published results of previous studies. Results: The optimal parameters for the simulation of the whole beam delivery system were defined by referring to the calculation results obtained with each parameter. Although the PDDs from FLUKA and the experimental data show a good agreement, those of GATE and PHITS obtained with our optimal parameters show a minor discrepancy. The measured proton range R90 was 269.37 mm, compared to the calculated range of 269.63 mm, 268.96 mm, and 270.85 mm with FLUKA, GATE and PHITS, respectively. Conclusion: We evaluated the dependence of the results for PDDs obtained with GATE and PHITS Monte Carlo generalpurpose codes on the customizing parameters by using the whole computational model of the treatment nozzle. The optimal parameters for the simulation were then defined by referring to the calculation results. The physical model, particle transport mechanics and the different geometrybased descriptions need accurate customization in three simulation codes to agree with experimental data for artifact-free Monte Carlo simulation. This study was supported by Grants-in Aid for Cancer Research (H22-3rd Term Cancer Control-General-043) from the Ministry of Health, Labor and Welfare of Japan, Grants-in-Aid for Scientific Research (No. 23791419), and JSPS Core-to-Core program (No. 23003). The authors have no conflict of interest

  10. No 2965, No 254. Report on new energy technologies and carbon dioxide sequestration: scientifical and technical aspects; N. 2965, N. 254. Rapport sur les nouvelles technologies de l'energie et la sequestration du dioxyde de carbone: aspects scientifiques et techniques

    Energy Technology Data Exchange (ETDEWEB)

    Bataille, Ch.; Birraux, C

    2006-03-15

    The abatement of CO{sub 2} emissions is a huge technical and economical challenge. Fossil fuels, which represent 88% of the world primary energy consumption, are the main source of the 25 billions of CO{sub 2} released each year in the atmosphere. The mastery of CO{sub 2} emissions cannot come from a single technology but must result from the simultaneous implementation of several means, like the development of carbon-free energies and the mastery of fossil fuel emissions. The opportunities of progress are numerous and compatible with the economic development. This document presents, first, the different greenhouse gases, the CO{sub 2} emissions per country and the main sources of CO{sub 2} emissions (power and heat generation, transports). Then it presents different ways of abatement of CO{sub 2} emissions: clean coal technologies, gas combined cycles, CO{sub 2} sequestration, reduction of fuel consumption in transports, development of carbon-free energies: wind power, solar photovoltaic for decentralized power generation, nuclear energy for a competitive power generation and for CO{sub 2} abatement, biofuels of 2. generation and fuel cells. The conclusion stresses on the investments needed for the renewal and increase of energy capacities, and on the necessary visibility and moderation of emission abatement mechanisms (carbon trading and CO{sub 2} prices). (J.S.)

  11. Chemistry of the heaviest elements--one atom at a time

    International Nuclear Information System (INIS)

    Hoffman, Darleane C.; Lee, Diana M.

    2000-01-01

    In keeping with the goal of the Viewpoint series of the Journal of Chemical Education, this article gives a 75-year perspective of the chemistry of the heaviest elements, including a 50-year retrospective view of past developments, a summary of current research achievements and applications, and some predictions about exciting, new developments that might be envisioned within the next 25 years. A historical perspective of the importance of chemical separations in the discoveries of the transuranium elements from neptunium (Z=93) through mendelevium (Z=101) is given. The development of techniques for studying the chemical properties of mendelevium and still heavier elements on the basis of measuring the radioactive decay of a single atom (''atom-at-a-time'' chemistry) and combining the results of many separate experiments is reviewed. The influence of relativistic effects (expected to increase as Z 2 ) on chemical properties is discussed. The results from recent atom-at-a-time studies of the chemistry of the heaviest elements through seaborgium (Z=106) are summarized and show that their properties cannot be readily predicted based on simple extrapolation from the properties of their lighter homologues in the periodic table. The prospects for extending chemical studies to still heavier elements than seaborgium are considered and appear promising

  12. SU-E-J-254: Evaluating the Role of Mid-Treatment and Post-Treatment FDG-PET/CT in Predicting Progression-Free Survival and Distant Metastasis of Anal Cancer Patients Treated with Chemoradiotherapy

    International Nuclear Information System (INIS)

    Zhang, H; Wang, J; Chuong, M; D’Souza, W; Choi, W; Lu, W; Latifi, K; Hoffe, S; Moros, E; Saeed, Nadia; Tan, S; Shridhar, R

    2015-01-01

    Purpose: To evaluate the role of mid-treatment and post-treatment FDG-PET/CT in predicting progression-free survival (PFS) and distant metastasis (DM) of anal cancer patients treated with chemoradiotherapy (CRT). Methods: 17 anal cancer patients treated with CRT were retrospectively studied. The median prescription dose was 56 Gy (range, 50–62.5 Gy). All patients underwent FDG-PET/CT scans before and after CRT. 16 of the 17 patients had an additional FDG-PET/CT image at 3–5 weeks into the treatment (denoted as mid-treatment FDG-PET/CT). 750 features were extracted from these three sets of scans, which included both traditional PET/CT measures (SUVmax, SUVpeak, tumor diameters, etc.) and spatialtemporal PET/CT features (comprehensively quantify a tumor’s FDG uptake intensity and distribution, spatial variation (texture), geometric property and their temporal changes relative to baseline). 26 clinical parameters (age, gender, TNM stage, histology, GTV dose, etc.) were also analyzed. Advanced analytics including methods to select an optimal set of predictors and a model selection engine, which identifies the most accurate machine learning algorithm for predictive analysis was developed. Results: Comparing baseline + mid-treatment PET/CT set to baseline + posttreatment PET/CT set, 14 predictors were selected from each feature group. Same three clinical parameters (tumor size, T stage and whether 5-FU was held during any cycle of chemotherapy) and two traditional measures (pre- CRT SUVmin and SUVmedian) were selected by both predictor groups. Different mix of spatial-temporal PET/CT features was selected. Using the 14 predictors and Naive Bayes, mid-treatment PET/CT set achieved 87.5% accuracy (2 PFS patients misclassified, all local recurrence and DM patients correctly classified). Post-treatment PET/CT set achieved 94.0% accuracy (all PFS and DM patients correctly predicted, 1 local recurrence patient misclassified) with logistic regression, neural network or support vector machine model. Conclusion: Applying radiomics approach to either midtreatment or post-treatment PET/CT could achieve high accuracy in predicting anal cancer treatment outcomes. This work was supported in part by the National Cancer Institute Grant R01CA172638

  13. Can neuromuscular fatigue threshold bedetermined by short and non-exhaustive bouts?. DOI: http://dx.doi.org/10.5007/1980-0037.2012v14n3p254

    Directory of Open Access Journals (Sweden)

    Alexandre Hideki Okano

    2012-05-01

    Full Text Available The present study determined the neuromuscular fatigue threshold (NFT using four different time-periods of analysis of the electromyographic signal and compared these estimations with critical power (CP. Fifteen healthy young men (73.6 ± 5.1 kg, 177.8 ± 7.0 cm, 23.4 ± 5.2 years performed 3-4 different severe constant workload trials until exhaustion on a cycle ergometer with simultaneous SEMG signals acquisition. The obtained data permitted NFT estimation with four different periods of analysis as follows: initial 30s (T30, 1min (T1, 2min (T2 and total time (TT, as well as CP. T30 and T1 were significantly higher than TT and CP and, T2 and TT did not differ between each other, and both were significantly higher than CP. In addition, TT was significantly correlated to CP (0.72; P < 0.05 and to T2 (0.58; P < 0.05. We conclude that NFT overestimates CP, independent of the time-period analysis used for its determination.

  14. A complexa convivência humana e os processos educativos libertadores (The human coexistence and the process of the liberating education - DOI: 10.5752/P.2175-5841.2013v11n29p254

    Directory of Open Access Journals (Sweden)

    Sergio Rogerio Junqueira

    2013-03-01

    Full Text Available Este artigo objetiva traçar o itinerário da educação libertadora na realidade social brasileira e refletir sobre a necessidade de se repensar a ação dessa modalidade de educação nos dias atuais. Ao se articular a realidade da época do surgimento da educação libertadora, que pretendia  responder aos apelos de libertação dos povos Latino-Americanos, com a realidade dos tempos atuais e suas implicações, este artigo busca respostas às questões postas por essa educação libertadora na atualidade. Para abordar as funções do processo educativo dentro do contexto de uma sociedade, é preciso situar as abordagens em sua realidade, contemporizando e adequando as suas ações. Essa temática representa um grande desafio, pois a concepção libertadora de educação extrapola os ambientes acadêmicos, visando sobretudo o bem comum do ser humano e o seu pleno desenvolvimento. Para a realização deste trabalho foram realizadas pesquisas bibliográficas e estudo da realidade desta época informatizada em que estamos inseridos, assim como suas consequências. Palavras-chave: Conscientização. Emancipação. Informatização. Educação Libertadora. Abstract This article aims to trace the route of liberating education in Brazilian social reality and reflect on the need to rethink the action of this type of education these days. In order to articulate the onset of liberating education that intended to respond to calls for liberation of Latin American peoples with the reality of the present time and its implications, this article seeks to answer to the questions posed by this liberating education today. To address the functions of the educational process within the context of a society, one must situate the approaches in their reality, compromising and adapting their actions. This theme represents a great challenge because the conception of such liberating education goes beyond the academic environments, seeking above all, the common good of the human being and its full development. The methodology used in this paper consisted of bibliographical research and a study of the reality of this computerized era in which we operate. Keywords: Awareness Empowerment. Information Technology. Liberating Education. 

  15. Single and double [ital K]-shell ionization and electron-transfer cross sections for Fe and Ni bombarded by S ions and Fe by Si ions at 1. 25--4. 70 MeV/amu

    Energy Technology Data Exchange (ETDEWEB)

    Tribedi, L.C.; Prasad, K.G.; Tandon, P.N. (Tata Institute of Fundamental Research, Bombay 400005 (India)); Chen, Z.; Lin, C.D. (Department of Physics, Kansas State University, Manhattan, Kansas (United States))

    1994-02-01

    Single and double [ital K]-shell vacancy production and [ital K]-[ital K] electron-transfer cross sections have been measured in the limit of zero target thickness for Fe and Ni induced by 1.25--4.70 MeV/amu [sup 28]Si and [sup 32]S ions. The fluorescence yield [omega][sub [ital k

  16. [ital K]-[ital K]-electron transfer and [ital K]-shell-vacancy production cross sections for Ti bombarded by [sup 28]Si and [sup 32]S beams at 1. 25--4. 70 MeV/amu

    Energy Technology Data Exchange (ETDEWEB)

    Tribedi, L.C.; Prasad, K.G.; Tandon, P.N. (Tata Institute of Fundamental Research, Bombay 400 005 (India))

    1993-05-01

    Single and double [ital K]-[ital K]-electron transfer and the [ital K]-shell-vacancy production cross sections for Ti bombarded by [sup 28]Si and [sup 32]S beams at energies varying between 1.25 and 4.7 MeV/amu have been determined, in the limit of zero target thickness, from the thickness variation of the Ti [ital K] x-ray yield with ion beams having 0, 1, or 2 vacancies in their [ital K] shell. From the measured energy shift and the intensity ratios of [ital K][alpha], [ital K][beta] lines, the average number of 2[ital p] and 3[ital p] vacancies were determined from which the average value of the fluorescence yield [omega][sub [ital K

  17. Compilation and testing of tools and methods for sustainable coastal management at local and regional scales : Deliverable D2.5.4, Thresholds project, 6th framework programme, EU, 108 p.

    OpenAIRE

    Håkanson, Lars

    2008-01-01

    This work describes how general methods and models for sustainable coastal ecosystem management at local to regional scales may be used to address key questions in coastal management and threshold science. The general, process-based mass-balance model (CoastMab) for substances transported to, within and from for coastal areas may be used as a tool to: 1. Combat eutrophication, 2. Rank nutrient fluxes, 3. Estimate the system response related to nutrient reductions and 4. Estimate realistic val...

  18. 48 CFR 15.403-1 - Prohibition on obtaining certified cost or pricing data (10 U.S.C. 2306a and 41 U.S.C. 254b).

    Science.gov (United States)

    2010-10-01

    ... (contracts, subcontracts, or modifications) (but may require data other than certified cost or pricing data... the best value (see 2.101) where price is a substantial factor in source selection; and (B) There is..., that two or more responsible offerors, competing independently, would submit priced offers in response...

  19. SU-E-J-254: Evaluating the Role of Mid-Treatment and Post-Treatment FDG-PET/CT in Predicting Progression-Free Survival and Distant Metastasis of Anal Cancer Patients Treated with Chemoradiotherapy

    Energy Technology Data Exchange (ETDEWEB)

    Zhang, H; Wang, J; Chuong, M; D’Souza, W; Choi, W; Lu, W [University of Maryland School of Medicine, Baltimore, MD (United States); Latifi, K; Hoffe, S; Moros, E [Moffitt Cancer Center, Tampa, FL (United States); Saeed, Nadia [Brwon University, Providence, RI (United States); Tan, S [Huazhong University of Science & Technology, Wuhan (China); Shridhar, R [Florida Hospital, Orlando, FL (United States)

    2015-06-15

    Purpose: To evaluate the role of mid-treatment and post-treatment FDG-PET/CT in predicting progression-free survival (PFS) and distant metastasis (DM) of anal cancer patients treated with chemoradiotherapy (CRT). Methods: 17 anal cancer patients treated with CRT were retrospectively studied. The median prescription dose was 56 Gy (range, 50–62.5 Gy). All patients underwent FDG-PET/CT scans before and after CRT. 16 of the 17 patients had an additional FDG-PET/CT image at 3–5 weeks into the treatment (denoted as mid-treatment FDG-PET/CT). 750 features were extracted from these three sets of scans, which included both traditional PET/CT measures (SUVmax, SUVpeak, tumor diameters, etc.) and spatialtemporal PET/CT features (comprehensively quantify a tumor’s FDG uptake intensity and distribution, spatial variation (texture), geometric property and their temporal changes relative to baseline). 26 clinical parameters (age, gender, TNM stage, histology, GTV dose, etc.) were also analyzed. Advanced analytics including methods to select an optimal set of predictors and a model selection engine, which identifies the most accurate machine learning algorithm for predictive analysis was developed. Results: Comparing baseline + mid-treatment PET/CT set to baseline + posttreatment PET/CT set, 14 predictors were selected from each feature group. Same three clinical parameters (tumor size, T stage and whether 5-FU was held during any cycle of chemotherapy) and two traditional measures (pre- CRT SUVmin and SUVmedian) were selected by both predictor groups. Different mix of spatial-temporal PET/CT features was selected. Using the 14 predictors and Naive Bayes, mid-treatment PET/CT set achieved 87.5% accuracy (2 PFS patients misclassified, all local recurrence and DM patients correctly classified). Post-treatment PET/CT set achieved 94.0% accuracy (all PFS and DM patients correctly predicted, 1 local recurrence patient misclassified) with logistic regression, neural network or support vector machine model. Conclusion: Applying radiomics approach to either midtreatment or post-treatment PET/CT could achieve high accuracy in predicting anal cancer treatment outcomes. This work was supported in part by the National Cancer Institute Grant R01CA172638.

  20. ORF Alignment: NC_004461 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available AIVKGYFADQLQQYFLSHGVSSAIIDLGGNVLTIGRQPETLE 180 ... Query: 254 ASVTIISDHGIDGEVWSTICSFGQSQKNIELLNLIDGIEGIIVTRDGSV...LMTSKMQKY 311 ... ASVTIISDHGIDGEVWSTICSFGQSQKNIELLNLIDGIEGIIVTRDGSVLMTSKMQKY Sbjct: 241 ASVTIISDHGIDGEVWSTICSFGQSQKNIELLNLIDGIEGIIVTRDGSVLMTSKMQKY 298

  1. ORF Alignment: NC_006513 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available Length = 66 ... Query: 254 MAGDLARTDADRALILAGVSHDLRTPLARLRLGVEMSGAPETEVAAMVADVEEMDRIIGQ 313 ... MAGDLA...RTDADRALILAGVSHDLRTPLARLRLGVEMSGAPETEVAAMVADVEEMDRIIGQ Sbjct: 1 ... MAGDLARTDADRALILAGVSHDLRTPLARLRLGVEMSGAPETEVAAMVADVEEMDRIIGQ 60 ...

  2. ORF Alignment: NC_004463 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available DDDPSMRS 180 ... Query: 254 AAGVVRELYPDCAQLYAANGWRLFPQIDRVYVNDRARHELGWRPEFDFAHVLHSLRA 310 ... AAGVVRELYPDCA...QLYAANGWRLFPQIDRVYVNDRARHELGWRPEFDFAHVLHSLRA Sbjct: 241 AAGVVRELYPDCAQLYAANGWRLFPQIDRVYVNDRARHELGWRPEFDFAHVLHSLRA 297

  3. Isotopic and chemical composition (δ13C, Δ14C, δ15N, C:N, SUVA254nm, % HPOA) of aquatic carbon and field conditions (water temperature, pH, discharge) in the Upper Mississippi River Basin, October 2014 – February 2016

    Data.gov (United States)

    Department of the Interior — This dataset contains stable isotope (δ13C) and radioisotope (Δ14C) compositions of dissolved inorganic carbon, dissolved organic carbon, particulate organic carbon,...

  4. Retraction Notice to ;Fabrication, electromagnetic characteristics of microwave absorbers containing Li0.35Zn0.3Fe2.35O4 micro-belts, nickel-coated carbon fibers; [J. Magn. Magn. Mater. 345 (2013) 249-254

    Science.gov (United States)

    Zhao, Bin; Wang, Qilei; Zhang, Cunrui

    2017-08-01

    This article has been retracted: please see Elsevier Policy on Article Withdrawal (http://www.elsevier.com/locate/withdrawalpolicy) This article has been retracted at the request of the Editor-in-Chief. The authors have plagiarized part of a paper that had already appeared in Ceram. Int., 39 (2013) 2317-2322, http://dx.doi.org/10.1016/j.ceramint.2012.08.079.

  5. Comment on "Nanosecond laser textured superhydrophobic metallic surfaces and their chemical sensing applications" by Duong V. Ta, Andrew Dunn, Thomas J. Wasley, Robert W. Kay, Jonathan Stringer, Patrick J. Smith, Colm Connaughton, Jonathan D. Shephard (Appl. Surf. Sci. 357 (2015) 248-254)

    Science.gov (United States)

    Boinovich, L. B.; Emelyanenko, A. M.; Emelyanenko, K. A.; Domantovsky, A. G.; Shiryaev, A. A.

    2016-08-01

    Nowadays the problem of design of durable ecologically friendly superhydrophobic surfaces is of great importance for science and technology. A recent paper in Applied Surface Science reports the method of fabricating the superhydrophobic metallic surfaces by infrared nanosecond laser surface texturing without using hydrophobic agents. Since this method of surface texturing can be considered as one of the most suitable for various industrial applications, the nature of superhydrophobic state of surfaces produced by laser texturing in the abovementioned paper deserves to be analyzed in detail. Authors of the commented paper attributed the change in wettability to the partial deoxidation of CuO into Cu2O on the surface during storage in atmosphere. However, such interpretation of the results contradicts to the basic notions in the theory of wetting and to more accurate and detailed data. In our Comment we discuss these contradictions point by point.

  6. Optical simulations for the S3 project - Super separator spectrometer - gamma-electron coincidence spectroscopy of a transfermium nucleus: the 251Md101

    International Nuclear Information System (INIS)

    Dechery, Fabien

    2012-01-01

    In analogy with the atomic closed shells giving rise to the stability and high ionisation energies of noble gases, nuclear physics also has its magic numbers of protons and neutrons which enhance nuclear structure stability. Knowledge of the structure of doubly-magic nuclei, both proton and neutron numbers, is crucial to parameterize theoretical models. The discovery of the next and ultimate magic numbers will provide a strong constraint on the many predictions. These two numbers are like the centre coordinates of an area of enhanced stability of the nuclear chart, well known as 'island of stability'. These superheavy nuclei only exist due to pure quantum shell effects. My thesis work deals with two distinct, but complementary, aspects of fundamental physics with the common goal of studying these extreme mass nuclei structure. The first part corresponds to the development of a next generation instrument for nuclear physics to allow synthesis and spectroscopy studies of superheavy nuclei: the Super Separator Spectrometer S 3 . This project will be installed at SPIRAL2 (GANIL) and has been approved by the French Research National Agency (ANR) within the EQUIPEX framework. It has been designed to take advantage of the high intensity heavy ion beam from the LINAC, giving access to a wide range of physical programs. The second part corresponds to the preparation, realisation and analysis of an experiment on 251-Mendelevium in which the very first prompt gamma-electron coincidence spectroscopy was performed for a transfermium nuclei. (author) [fr

  7. 10 CFR 110.23 - General license for the export of byproduct material.

    Science.gov (United States)

    2010-01-01

    ...) Actinium-225 and -227, americium-241 and -242m, californium-248, -249, -250, -251, -252, -253, and -254, curium-240, -241, -242, -243, -244, -245, -246 and -247, einsteinium-252, -253, -254 and -255, fermium...

  8. ORF Alignment: NC_002932 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available AMSPVFSRLMKVIITKLYDKNIRGFWHVKSRL 180 ... Query: 254 FXXXXXXXXXXXXVIPDCAHLPQEEQPAAFVAGVKKFVEKL 294 ... F ... VIPDCA...HLPQEEQPAAFVAGVKKFVEKL Sbjct: 241 FRLARELPRAELLVIPDCAHLPQEEQPAAFVAGVKKFVEKL 281

  9. Grover, Dr Arun Kumar

    Indian Academy of Sciences (India)

    Specialization: Magnetism & Superconductivity, Vortex State Studies in Superconductors, Strongly Correlated Systems Address: Vice Chancellor, Panjab University, Chandigarh 160 014, U.T.. Contact: Office: (0172) 254 1945. Residence: (0172) 254 1428. Fax: (0172) 254 1022. Email: vc@pu.ac.in, arunkgrover@gmail.com.

  10. African Heath Sciences Vol 7 No 2.p65

    African Journals Online (AJOL)

    FOMCS2

    2007-06-02

    Jun 2, 2007 ... College of Health Sciences,. University Of Nairobi, Kenyatta National Hospital,. PO BOX 20956-00202, Nairobi. Tel 254 20 2714877/ 254 722 718770,. Email hcc@uhmc.co.keFax 254-020-2726299. Introduction. The World Health Organization (WHO) recommends. Mothers' milk alone during the first six ...

  11. Grover, Dr Arun Kumar

    Indian Academy of Sciences (India)

    ... Magnetism & Superconductivity, Vortex State Studies in Superconductors, Strongly Correlated Systems Address: Vice Chancellor, Panjab University, Chandigarh 160 014, U.T.. Contact: Office: (0172) 254 1945. Residence: (0172) 254 1428. Fax: (0172) 254 1022. Email: vc@pu.ac.in, arunkgrover@gmail.com. YouTube ...

  12. Dicty_cDB: [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VF (Link to library) VFC254 (Link to dictyBase) - - - Contig-U15456-1 VFC254P (Link... to Original site) VFC254F 509 VFC254Z 569 VFC254P 1078 - - Show VFC254 Library VF (Link to library) Clone ID VFC254 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U15456-1 Original site URL http://dict...mology vs DNA Score E Sequences producing significant alignments: (bits) Value N Y16962 |Y16962.1 Dictyostel...ium discoideum mRNA for cathepsin D. 910 0.0 3 AJ243946 |AJ243946.1 Dictyostelium

  13. Application of alpha spectrometry to the discovery of new elements by heavy-ion-beam bombardment

    International Nuclear Information System (INIS)

    Nitschke, J.M.

    1983-05-01

    Starting with polonium in 1898, α-spectrometry has played a decisive role in the discovery of new, heavy elements. For even-even nuclei, α-spectra have proved simple to interpret and exhibit systematic trends that allow extrapolation to unknown isotopes. The early discovery of the natural α-decay series led to the very powerful method of genetically linking the decay of new elements to the well-established α-emission of daughter and granddaughter nuclei. This technique has been used for all recent discoveries of new elements including Z = 109. Up to mendelevium (Z = 101), thin samples suitable for α-spectrometry were prepared by chemical methods. With the advent of heavy-ion accelerators new sample preparation methods emerged. These were based on the large momentum transfer associated with heavy-ion reactions, which produced energetic target recoils that, when ejected from the target, could be thermalized in He gas. Subsequent electrical deposition or a He-jet technique yielded samples that were not only thin enough for α-spectroscopy, but also for α- and #betta#-recoil experiments. Many variations of these methods have been developed and are discussed. For the synthesis of element 106 an aerosol-based recoil transport technique was devised. In the most recent experiments, α-spectrometry has been coupled with the magnetic analysis of the recoils. The time from production to analysis of an isotope has thereby been reduced to 10 - 6 s; while it was 10 - 1 to 10 0 s for He-jets and 10 1 to 10 3 s for rapid chemical separations. Experiments are now in progress to synthesize super heavy elements (SHE) and to analyze them with these latest techniques. Again, α-spectrometry will play a major role since the expected signature for the decay of a SHE is a sequence of α-decays followed by spontaneous fission

  14. 75 FR 61816 - Agency Information Collection Activities: Notice of Request for Extension of Currently Approved...

    Science.gov (United States)

    2010-10-06

    ... Puerto Rico, the Commonwealth of the Northern Mariana Islands, the Territories of Guam, the Virgin... 254, Indianapolis, Indiana, 46204, Monday through Friday, except Federal holidays. SUPPLEMENTARY...

  15. ORF Alignment: NC_005296 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available ... palustris CGA009] ... Length = 77 ... Query: 195 NRRKVYPESARQTRQQGTASLSFAIGASGEVISYKITRSTGSDALDRAIDS...MMKTARPPP 254 ... NRRKVYPESARQTRQQGTASLSFAIGASGEVISYKITRSTGSDALDRAIDSMMKTA...RPPP Sbjct: 1 ... NRRKVYPESARQTRQQGTASLSFAIGASGEVISYKITRSTGSDALDRAIDSMMKTARPPP 60 ...

  16. 2012 Military Family Life Project (MFLP): Tabulations of Responses

    Science.gov (United States)

    2013-10-31

    problems ................................................................................. 254 j. Loneliness ...358 o. Be different in another way...administrative data ........................................................................................ 386 83. What is your gender ? Constructed from

  17. Protein (Cyanobacteria): 428774810 [PGDBj - Ortholog DB

    Lifescience Database Archive (English)

    Full Text Available 65093:254 ... SUA5/yciO/yrdC domain-containing protein Halothece sp. PCC 7418 MSLVSFSELVTGAKEGKVVSFPTDTVPALAVRPDCA...EAIFELKQREATKPLILMGASPEQLWDYVEGTPEEFQVWEQTAQQYFPGQLTLVLPSSSLVRPEVNPKTADTIGIRVPDCAIARQVFASTGVLATTSANRSGQPPLTTPEAINQAFPEVLVLADTEPIVSSGLPSTVAKWTGQDWEILRQGNIYLK

  18. Systema Naturae. Classification of living things.

    OpenAIRE

    Alexey Shipunov

    2007-01-01

    Original classification of living organisms containing four kingdoms (Monera, Protista, Vegetabilia and Animalia), 60 phyla and 254 classes, is presented. The classification is based on latest available information.

  19. ORF Alignment: NC_003272 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available DVELQKELLVHRFGFQATDILTLTEEQASREFIEAA 60 ... Query: 160 XXXXXXXPTDHAIAVLDTSYTFTGINQPAGLKIRARPESPGTRLAAAEIDFRQQIK...NQNP 219 ... PTDHAIAVLDTSYTFTGINQPAGLKIRARPESPGTRLAAAEIDFRQQIKNQNP ...Sbjct: 121 LLLLRSLPTDHAIAVLDTSYTFTGINQPAGLKIRARPESPGTRLAAAEIDFRQQIKNQNP 180 ... Query: 280 QLGSKQQPGLLTKK 293 ... QLGSKQQPGLLTKK Sbjct: 241 QLGSKQQPGLLTKK 254

  20. Discovery and Innovation: Contact

    African Journals Online (AJOL)

    Principal Contact. Prof. Keto Mshigeni Editor-in-Chief Academy Science Publishers. PO Box 14798-00200. Nairobi. Kenya. Phone: 254 (20) 884401-5. Fax: 254 (20) 884406. Email: aas@aasciences.org. Support Contact. Prof. Keto Mshigeni Email: aas@aasciences.org. ISSN: 1015-079X. AJOL African Journals Online.

  1. Mechanisms of Fracture and Fragmentation by Explosive Loading

    Science.gov (United States)

    1992-04-21

    of Hybrid Crater from Test CG-6PC. g .5 MM 6. 35mmv Stem EStem Igo I gPETN Chiarge Charg. - . t_____________________L____ 254 ffvn Damter 254 iTUT...three dimensional models which used no bonding agent but merely relied upon self weight to hold the two surfaces together indicate that quite efficient

  2. 37 CFR 270.5 - Designated collection and distribution organizations for records of use of sound recordings under...

    Science.gov (United States)

    2010-07-01

    ... Edition) Index INDEX TO CHAPTER II—COPYRIGHT OFFICE, LIBRARY OF CONGRESS Editorial Note: This listing is... 254.1 to 254.3 Collective works, Deposit of contributions to 202.20(c)(2)(xv) Colleges and... for making/distributing phonorecords of nondramatic musical works, Notice of intention to obtain 201...

  3. IDENTITY THEFT SERVICES: Services Offer Some Benefits but Are Limited in Preventing Fraud

    Science.gov (United States)

    2017-03-01

    17-254 Identity Theft Services standards. Those standards require that we plan and perform the audit to obtain sufficient, appropriate evidence to... audited financial statements. Page 34 GAO-17-254 Identity Theft Services Although the websites of many identity theft services ...reasonable assurance that significant decisions on the use of identity theft services are appropriately documented. We provided a draft of this

  4. HPMA-based drug delivery system and its interactions of human serum albumin: SAXS, ITC, and NMR study

    Czech Academy of Sciences Publication Activity Database

    Filippov, Sergey K.; Kaberov, Leonid; Zhang, X.; Niebuur, B.-J.; Chytil, Petr; Etrych, Tomáš; Wieland, F.; Velychkivska, Nadiia; Starovoytova, Larisa; Svergun, D.; Papadakis, C.

    2017-01-01

    Roč. 254, 20 August (2017), s. 455 ISSN 0065-7727. [ACS National Meeting & Exposition /254./. 20.08.2017-24.08.2017, Washington] R&D Projects: GA ČR(CZ) GC15-10527J Institutional support: RVO:61389013 Keywords : HPMA * human serum albumin * SAXS Subject RIV: CF - Physical ; Theoretical Chemistry OBOR OECD: Physical chemistry

  5. Book Review: John M. Hobson and Leonard Seabrooke (2007) (eds) Everyday Politics of the World Economy

    DEFF Research Database (Denmark)

    Strange, Michael Stewart

    2009-01-01

    Book Review: John M. Hobson and Leonard Seabrooke (2007) (eds) Everyday Politics of the World Economy (Cambridge: Cambridge University Press), 254pp. Udgivelsesdato: 2009......Book Review: John M. Hobson and Leonard Seabrooke (2007) (eds) Everyday Politics of the World Economy (Cambridge: Cambridge University Press), 254pp. Udgivelsesdato: 2009...

  6. Bacterial growth in humic waters exposed to UV-radiation and simulated sunlight

    DEFF Research Database (Denmark)

    Corin, N.; Backlund, P.; Wiklund, T.

    1998-01-01

    Sterile filtered (0.45 mu m) humic lake water was exposed to simulated sunlight (300-800 nm) or W-radiation (254 run)for various periods of times and the dissolved organic carbon content, absorbance at 254 and 460 nm and PH were recorded. The irradiated water was inoculated with a natural bacterial...

  7. 78 FR 14913 - Domestic Baggage Liability

    Science.gov (United States)

    2013-03-08

    ... liability that air carriers may incur in cases of mishandled baggage, as required by section 254.6. The... Office of the Secretary 14 CFR Part 254 RIN 2105-AE21 Domestic Baggage Liability AGENCY: Office of the... existing regulations, this final rule raises the minimum limit on domestic baggage liability applicable to...

  8. Modeling temperature effect on dynamic modulus of elasticity of red pine (Pinus resinosa) in frozen and non-frozen states

    Science.gov (United States)

    Shan Gao; Xiping Wang; Lihai Wang

    2015-01-01

    The response of dynamic and static modulus of elasticity (MOEdyn and MOEsta) of red pine small clear wood (25.4 × 25.4 × 407 mm3) within the temperature range -40 to 40°C has been investigated. The moisture content (MC) of the specimens ranged from 0 to 118%. The MOEdyn was...

  9. Fiscal consequences of monetary integration within the common economic area: the case of Belarus, Kazakhstan and Russia

    Czech Academy of Sciences Publication Activity Database

    Uzagalieva, Ainura

    -, č. 254 (2005), s. 1-46 ISSN 1211-3298 Institutional research plan: CEZ:AV0Z70850503 Keywords : seigniorage * monetary integration * transition economies Subject RIV: AH - Economics http://www.cerge-ei.cz/pdf/wp/Wp254.pdf

  10. Dollar Summary of Prime Contract Awards by State, Place, and Contractor, FY84, Part 3, (Anderson, Indiana-Winona, Mississippi).

    Science.gov (United States)

    1984-01-01

    MECH-AIR INC 127 127 MELDICK SERVICES INC 614 614 MICHAELS CONSTR CO INC 254 254 MOTOROLA INC 55 55 NAZARIO CONSTRUCTION CO INC 139 139 ORFANOS...CUMMINS NORTH ATLANTIC INC 105 105 LUIZ JOSEPH 3 3RD INC 338 338 MC PAK CO INC 90 90 WCH INDUSTRIES INC 30 30 TOTAL - BOURNE 68 688 BOXBORO BIRO MFT CO 174

  11. Automated Analysis of Vital Signs Identified Patients with Substantial Bleeding Prior to Hospital Arrival

    Science.gov (United States)

    2015-10-01

    threatening bleeding may be effectively treated when surgery and blood resuscitation are provided sufficiently quickly after injury [1, 2]. Standard...HFM-254 resuscitation volumes and improvement in survival in 390 damage control laparotomy patients," Ann Surg, vol. 254, no. 4, pp. 598-605, Oct

  12. 77 FR 65571 - Notice of Submission of Proposed Information Collection to OMB; Comment Request; HOME Investment...

    Science.gov (United States)

    2012-10-29

    ... project eligibility Sec. 92.218 I.e., eligible uses and costs, Sec. 92.250 cost limits, mixed-projects and... 33,335 requirement). Sec. 92.254 Homeownership--Median Purchase 5 80 400 Price. Sec. 92.254... Affirmative Marketing 10 6,667 66,670 [[Page 65573

  13. Antibacterial and cytotoxic properties of isoprenoids from the red sea ...

    African Journals Online (AJOL)

    TLC aluminum sheets 20 x 20 cm. Silica gel 60 F254 was used for preparative, Pre-coated TLC glass plates SIL. G-25 UV254, 0.25 mm silica gel (E. Merck,. Darmstadt, Germany) ... preparative TLC using solvent system n-hexane: ethyl acetate (9:1) ..... bearing cembrane diterpenoids from a South China Sea soft coral, J Nat ...

  14. 75 FR 43115 - National Oil and Hazardous Substances Pollution Contingency Plan; National Priorities List...

    Science.gov (United States)

    2010-07-23

    ..., as amended, is an appendix of the National Oil and Hazardous Substances Pollution Contingency Plan... the soil and groundwater of parcels 24, 27, 28, 2-53, 2-53L, 2-54, 2-54L, 2-70, 2-70L, 3-89, 3-90, and... and Hazardous Substances Pollution Contingency Plan; National Priorities List: Intent to Partially...

  15. Život i djelo Dmitrija Ivanoviča Mendeljejeva - povodom 100. obljetnice smrti

    Directory of Open Access Journals (Sweden)

    Vaščić, V.

    2007-04-01

    Full Text Available The life and activities of D. I. Mendeleyev are presented primarily in view of his role in the progress of chemistry. Born in Tobolsk in 1834 to a numerous and poor family, burdened by the family's bad luck and his ill health, he graduated natural sciences in 1855 at St. Petersburg and was awarded a gold medal for exceptional success. In 1855/56 he was teacher at a secondary school in Odessa. He obtained his MSc degree in 1856 in St. Petersburg where he was appointed lecturer in 1857. He was guest scientist 1859-1861 at the University in Heidelberg where he investigated the behavior of gases under various pressures and temperatures and discovered the criticaltemperature of liquefaction. He achieved his PhD degree in 1865 in St. Petersburg with a thesis on ethanol/water mixtures. Therein he had proven the existence of alcohol hydrates. His work later enabled the elaboration of modern conceptions on solvate formation in solutions. In 1865 he was elected professor at the University in St. Petersburg where he worked until 1890 when he was forced to retire. Preparing his textbook "Fundamentals of Chemistry" in 1869, he discovered that properties of chemical elements depend periodically on atomic weights. This enabled the elaboration of a periodic system as the base for classification in chemistry, as well as for further research and development of chemical science and technology. The international scientific community accepted Mendeleyev's system with distrust and it was generally acknowledged not before three "prophecies" of Mendeleyev were realized by the discovery of gallium (1875, scandium (1879 and germanium (1886. Later, in verification of his predictions, other elements - including transuranics - were discovered. Hence, in honor of the creator of the periodic system, the element of atomic number 101 was named mendelevium (1955. Mendeleyev was reactivated in 1892 as director of the Central Bureau for Measures and Weights where he worked until

  16. Communications dated 15 and 22 March 1994 received from the permanent mission of South Africa to the International Atomic Energy Agency

    International Nuclear Information System (INIS)

    1994-01-01

    The Director General received notes verbales dated 15 and 22 March 1994 from the Permanent Mission of South Africa providing information on the nuclear export policies and practices of the Government of South Africa. These notes verbales contain, in their attachments, copies of the relevant legislation and other documentation pertaining to South Africa's policy to act in accordance with the provisions of INFCIRC/254/Rev.1/Part 1 and INFCIRC/254/Rev.1/Part 1/Mod.1 and INFCIRC/254/Rev.1/Part 2 as amended. The documents are available on request from the Secretariat of the IAEA

  17. Intact brown seaweed (Ascophyllum nodosum) in diets of weaned piglets: Effects on performance, gut bacteria and morphology and plasma oxidative status

    Czech Academy of Sciences Publication Activity Database

    Michiels, J.; Skřivanová, E.; Missotten, J.; Ovyn, A.; Mrázek, Jakub; De Smet, S.; Dierick, N.

    2012-01-01

    Roč. 96, č. 6 (2012), s. 1101-1111 ISSN 0931-2439 Institutional support: RVO:67985904 Keywords : antioxidant * gut function * weaning piglets Subject RIV: FB - Endocrinology, Diabetology, Metabolism, Nutrition Impact factor: 1.254, year: 2012

  18. Zero-ODP Refrigerants for Low Tonnage Centrifugal Chiller Systems

    National Research Council Canada - National Science Library

    Gui, Fulin

    1996-01-01

    ..., HFC-236cb, HFC-236fa, HFC-245cb, and HFC-254cb, for centrifugal chiller applications. We took into account the thermodynamic properties of the refrigerant and aerodynamic properties of the impeller compression process to this evaluation...

  19. Gclust Server: 122813 [Gclust Server

    Lifescience Database Archive (English)

    Full Text Available Sequences 1 Homologs 1 Clustering threshold 1.00e-99 Plants and algae (7species) (%) 0.0 Other Bikonts (Chr...th 254 Representative annotation transcriptional regulator, TetR family Number of

  20. Joint analysis of Rayleigh-wave dispersion and HVSR of lunar seismic data from the Apollo 14 and 16 sites

    Czech Academy of Sciences Publication Activity Database

    Dal Moro, Giancarlo

    2015-01-01

    Roč. 254, JUL 1 (2015), s. 338-349 ISSN 0019-1035 Institutional support: RVO:67985891 Keywords : moon * Regoliths * geophysics * surface- wave Subject RIV: BN - Astronomy, Celestial Mechanics, Astrophysics Impact factor: 3.383, year: 2015

  1. Gender differences in seasonal movement of dice snakes in Histria, southeastern Romania

    Czech Academy of Sciences Publication Activity Database

    Kärvemo, S.; Carlsson, M.; Tudor, M.; Sloboda, M.; Mihalca, A. D.; Ghira, I.; Bel, L.; Modrý, David

    2011-01-01

    Roč. 18, 20 September 2011 (2011), s. 245-254 ISSN 0934-6643 Institutional support: RVO:60077344 Keywords : Squamata * Natrix tessellata * dice snake * seasonal movements * activity patterns * sex ratio Subject RIV: EG - Zoology

  2. ORF Alignment: NT_033779 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available n-like protein CL3 [Periplaneta americana] ... Length = 128 ... Query: 1 ... MVLDNQEDKLLTTTFLKSMGLSFTQSWHH... NT_033779 gi|21357645 >1qddA 26 143 127 254 1e-07 ... dbj|BAA82266.1| Cockroach lecti

  3. Enforcement and Effectiveness of Consumer Law in the Czech Republic

    Czech Academy of Sciences Publication Activity Database

    Pauknerová, Monika; Skalská, H.

    2017-01-01

    Roč. 7, č. 4 (2017), s. 243-254 ISSN 1805-8396 Institutional support: RVO:68378122 Keywords : consumer law * enforcement * alternative dispute resolution Subject RIV: AG - Legal Sciences OBOR OECD: Law

  4. THE LIVED ExPERIENCES OF LATE -ADOLESCENT FEMALE ...

    African Journals Online (AJOL)

    2010-06-08

    18). A phenomenological psychology research approach focuses on the psychological meanings of research participants' lived experiences in their particular life worlds. (Giorgi 1997:252–254; Kruger 1988:37–38). An arts- ...

  5. The Role of Personalities in Passing-Down the Tradition within the System of Culture

    Czech Academy of Sciences Publication Activity Database

    Pospíšilová, Jana; Stefanović-Banović, Milesa

    LXV, č. 2 (2017), s. 249-254 ISSN 0350-0861 Institutional support: RVO:68378076 Keywords : Personalities * Ethnology * Tradition * System of Culture Subject RIV: AC - Archeology, Anthropology, Ethnology

  6. Resonance – Journal of Science Education | Indian Academy of ...

    Indian Academy of Sciences (India)

    -Medication in Wild Animals · Rajasekar Raman Sripathi Kandula · More Details Fulltext PDF. pp 254-260 Feature Article. Molecule Matters - The Quinine Story: A 100-Year Saga · Vijay Nair Sreekumar Vellalath · More Details Fulltext PDF.

  7. KWIC Index of nuclear codes (1975 edition)

    International Nuclear Information System (INIS)

    Akanuma, Makoto; Hirakawa, Takashi

    1976-01-01

    It is a KWIC Index for 254 nuclear codes in the Nuclear Code Abstracts (1975 edition). The classification of nuclear codes and the form of index are the same as those in the Computer Programme Library at Ispra, Italy. (auth.)

  8. Tuli, Dr Rakesh

    Indian Academy of Sciences (India)

    Date of birth: 21 September 1953. Specialization: Plant Biotechnology, Genetic Engineering and Molecular Biology, Secondary Metabolism Address: Senior Research Adviser, University Institute of Engineering & Technology, Panjab University, Sector 25, Chandigarh 160 014, Panjab Contact: Office: (0172) 254 4107

  9. Variation in some haematological parameters and levels of selected ...

    African Journals Online (AJOL)

    absorbed cosmetic-borne toxic metals in cosmetologists and heavy cosmetic users in Benin City, using haematological parameters and toxic metal levels as indices. Methods: The cosmetologists (n=50; mean age, 25.4 yrs.) comprised of female ...

  10. Mikrogravimetrická měření - aplikace v inženýrské geologii, archeologii a geodynamice

    Czech Academy of Sciences Publication Activity Database

    Mrlina, Jan

    2004-01-01

    Roč. 54, č. 4 (2004), s. 252-254 ISSN 0009-0700 Institutional research plan: CEZ:AV0Z3012916 Keywords : gravity measurements * microgravity surveys * subsurface geological settings Subject RIV: DE - Earth Magnetism, Geodesy, Geography

  11. Johannes Müller, Exile Memories and the Dutch Revolt: The Narrated Diaspora, 1550-1750

    Directory of Open Access Journals (Sweden)

    C.A. (Annemieke Romein

    2017-10-01

    Full Text Available Johannes Müller, Exile Memories and the Dutch Revolt: The Narrated Diaspora, 1550-1750 (Dissertation Leiden University 2014; Leiden/ Boston: Brill. 2016, 254 pp., ISBN 9789004315914.

  12. Magnetically responsive biological materials and their applications

    Czech Academy of Sciences Publication Activity Database

    Šafařík, Ivo; Pospíšková, K.; Baldíková, E.; Šafaříková, Miroslava

    2016-01-01

    Roč. 7, č. 4 (2016), s. 254-261 ISSN 0976-3961 Institutional support: RVO:60077344 Keywords : adsorbents * biological materials * carriers * magnetic modification * whole-cell biocatalyst Subject RIV: EI - Biotechnology ; Bionics

  13. Opava (K. Ú. Kateřinky u Opavy, Malé Hoštice, okres Opava). " Na hoštických lukách". LnK. Sídliště. Záchranný výzkum.

    Czech Academy of Sciences Publication Activity Database

    Juchelka, Jiří

    2009-01-01

    Roč. 50, 1-2 (2009), s. 254 ISSN 1211-7250 Institutional research plan: CEZ:AV0Z80010507 Keywords : Czech Silesia * Cultur of linear potter * archaeological research Subject RIV: AC - Archeology, Anthropology, Ethnology

  14. Glia: the fulcrum of brain diseases

    Czech Academy of Sciences Publication Activity Database

    Giaume, C.; Kirchhoff, F.; Matute, C.; Reichenbach, A.; Verkhratsky, Alexei

    2007-01-01

    Roč. 14, - (2007), s. 1324-1335 ISSN 1350-9047 Institutional research plan: CEZ:AV0Z50390512 Keywords : Glia * Astrocyte * Oligodendrocyte Subject RIV: FH - Neurology Impact factor: 8.254, year: 2007

  15. Genetic Abnormalities in Breast Cancer Tumors and Relationships to environmental and Genetic Risk Factors Using Twins

    National Research Council Canada - National Science Library

    Mack, Thomas

    1999-01-01

    .... Blocks from 488 twins (254 in concordant pairs and 234 in discordant pairs) have been received. Based on 46 concordant pairs, intra-pair analyses showed that ER was the biomarker most likely to be identical within the pair...

  16. Resonance – Journal of Science Education | News

    Indian Academy of Sciences (India)

    -Medication in Wild Animals · Rajasekar Raman Sripathi Kandula · More Details Fulltext PDF. pp 254-260 Feature Article. Molecule Matters - The Quinine Story: A 100-Year Saga · Vijay Nair Sreekumar Vellalath · More Details Fulltext PDF.

  17. 77 FR 56798 - Fisheries of the Exclusive Economic Zone Off Alaska; Revise Maximum Retained Amounts for...

    Science.gov (United States)

    2012-09-14

    ... Alaska fisheries in 2009, there are 254 catcher vessels directly regulated by this action that had gross... percent of the trawl gear allocation of sablefish in the BS and AI is apportioned from the nonspecified...

  18. New Approaches to Underwater Surface Preparation and Painting (USPPT) Techniques (CD-ROM)

    National Research Council Canada - National Science Library

    Ledda, Jeffrey

    2006-01-01

    ...: 1 CD-ROM; 4 3/4 in.; 25.4 MB. ABSTRACT: This paper summarizes Oceaneering's findings for the ONR work entitled "New Approaches to Underwater Surface Preparation and Painting Techniques, Phase 2 Final Report...

  19. Arno Rafael Cederberg ja Eesti ajalooteadus / Hans Kruus

    Index Scriptorium Estoniae

    Kruus, Hans, 1891-1976

    2005-01-01

    Soome ajalooprofessorist Arno Rafael Cederbergist (1885-1948). Tartu Ülikoolis töötades oli tema peamine õppe-ja uurimisaine Eesti ja Põhjamaade ajalugu. Ilm.: Eesti Kirjandus, 1935, nr. 6., lk. 254-255

  20. A Uniform Approach to National Suicide Bomber Incident Response and Recovery

    Science.gov (United States)

    2008-03-01

    infrastructure and key assets encompass the following eleven sectors: agriculture and food , water, public health, emergency services, defense...254 Federal Emergency Management Agency (FEMA), National Preparedness Directorate ( NPD ), National Integration Center (NIC

  1. 75 FR 39040 - National Register of Historic Places; Notification of Pending Nominations and Related Actions

    Science.gov (United States)

    2010-07-07

    ... Manistee Iron Works Machine Shop, 254 River St., Manistee, 10000477 Wayne County Rosedale Gardens Historic... Berry Morot Car Service Building, (Auto-Related Resources of St. Louis, Missouri [[Page 39041

  2. CAMEX-4 NOAA LYMAN-ALPHA HYGROMETER V1

    Data.gov (United States)

    National Aeronautics and Space Administration — Ozone is measured in situ using a photometer consisting of a mercury lamp, two sample chambers and two detectors. The detectors measure the 254nm radiation...

  3. African Journal of Urology - Vol 13, No 4 (2007)

    African Journals Online (AJOL)

    Pediatric Urinary Tract Infections and Vesicoureteral Refl ux: What Have We Learned? EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT · DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. A A Cadamone, M A Koyle, 242-254 ...

  4. Arsenic mineralogy of near-neutral soils and mining waste at the Smolotely-Líšnice historical gold district, Czech Republic

    Czech Academy of Sciences Publication Activity Database

    Drahota, P.; Kulakowski, O.; Culka, A.; Knappová, M.; Rohovec, Jan; Veselovský, F.; Racek, M.

    2018-01-01

    Roč. 89, February (2018), s. 243-254 ISSN 0883-2927 Institutional support: RVO:67985831 Keywords : soil * mining waste * pharmacosiderite * yukonite * arseniosiderite Subject RIV: DB - Geology ; Mineralogy OBOR OECD: Mineralogy Impact factor: 2.581, year: 2016

  5. Small molecule inhibitors of protein interaction with glycosaminoglycans (SMIGs), a novel class of bioactive agents with anti-inflammatory properties

    Czech Academy of Sciences Publication Activity Database

    Harris, N.; Kogan, F. Y.; Ilková, G.; Juhás, Štefan; Lahmy, O.; Gregor, Y. I.; Koppel, J.; Zhuk, R.; Gregor, P.

    2014-01-01

    Roč. 1840, č. 1 (2014), s. 245-254 ISSN 0304-4165 Institutional support: RVO:67985904 Keywords : heparan sulfate * heparin binding protein * glycosaminoglycan Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 4.381, year: 2014

  6. Je to neobyčejně milý člověk, ten znamenitý Einstein! (Reflexe Viktora Trkala ze studijního pobytu na univerzitě v Leidenu v letech 1919-1920)

    Czech Academy of Sciences Publication Activity Database

    Těšínská, Emilie

    2015-01-01

    Roč. 60, č. 3 (2015), s. 239-254 ISSN 0032-2423 Institutional support: RVO:68378114 Keywords : general theory of relativity * Albert Einstein * history of science * Viktor Trkal Subject RIV: AB - History

  7. Neúspěšní kandidáti Nobelovy ceny za fyziku do roku 1956

    Czech Academy of Sciences Publication Activity Database

    Jindra, Jiří

    2008-01-01

    Roč. 41, č. 4 (2008), s. 233-254 ISSN 0300-4414 Institutional research plan: CEZ:AV0Z80630520 Keywords : Nobel prize for physics * nominations for prizes * successfull and unsuccessfull candidates Subject RIV: AB - History

  8. 37(4) All.cdr

    African Journals Online (AJOL)

    HP

    . 254 responses or injuries to asphyxia. (Shakespare, 2012). Although overwhelming aspiration of regurgitated contents had been considered a potential cause of instant death in mature bovines (Lopez, 2012, Shakespare,. 2012; McEwen ...

  9. Carotenoid-protein interaction alters the S1 energy of hydroxyechinenone in the Orange Carotenoid Protein

    Czech Academy of Sciences Publication Activity Database

    Polívka, Tomáš; Chábera, P.; Kerfeld, C.A.

    2013-01-01

    Roč. 1827, č. 3 (2013), s. 248-254 ISSN 0005-2728 Institutional support: RVO:60077344 Keywords : orange-carotenoid protein * excited states * photoprotection Subject RIV: BO - Biophysics Impact factor: 4.829, year: 2013

  10. Time resolution measurements with an improved discriminator and conical scintillators

    International Nuclear Information System (INIS)

    McGervey, J.D.; Vogel, J.; Sen, P.; Knox, C.

    1977-01-01

    A new constant fraction discriminator with improved stability and walk characteristics is described. The discriminator was used with RCA C31024 photomultiplier tubes to test scintillators of conical and cylindrical shapes. Conical scintillators of 2.54 cm base diameter, 1.0 cm top diameter, and 2.54 cm height gave a fwhm of 155 ps for 60 Co gamma rays; larger conical scintillators gave an improvement of 10-15% in fwhm over cylindrical scintillators of equal volume. (Auth.)

  11. Learning to Predict Social Influence in Complex Networks

    Science.gov (United States)

    2012-03-29

    derived from the Enron Email Dataset by extracting the senders and the recipients and linking those that had bidirectional communications. It has 4,254...Kimura et al. (2008), which has 9, 481 nodes and 245, 044 directed links (the Wikipedia network). The third one is a network derived from the Enron ...It contains 4, 254 nodes and 44, 314 directed links (the Enron network). The last one is a coauthorship network employed in Palla et al. (2005). It

  12. UV-radiation and the flavonoid content in callus culture of Ononis arvensis L

    International Nuclear Information System (INIS)

    Tumowa, L.; Psotowa, R.

    1998-01-01

    The paper discussed a possible influence on the production of secondary metabolites - the flavonoids, by the method of elicitation in the callus cultures of Ononis arvensis L., the elicitor employed being the UV 254 and 366 nm and the sun-lamp. In some cases there was an increase in the production of flavonoids particularly 60, 120, 240 and 300 s after sun-lamp irradiation and in case of 15 and 30 min irradiation with UV-254 nm

  13. A MULTIPLE EQUATION MODEL OF HOUSEHOLD LOCATIONAL AND TRIPMAKING BEHAVIOR,

    Science.gov (United States)

    This Memorandum describes a multiple equation model of household locational and tripmaking behavior , to be used in RAND’s study of urban...workers were aggregated to 254 spatially separate workplace zones. The model explains four types of locational and tripmaking behavior for the white...workers employed in these 254 zones: residential space consumption , automobile ownership, modal choice, and length of journey-to-work. In all, the final

  14. 75 FR 43082 - National Oil and Hazardous Substances Pollution Contingency Plan; National Priorities List...

    Science.gov (United States)

    2010-07-23

    ... and Hazardous Substances Pollution Contingency Plan; National Priorities List: Partial Deletion of the... pertains to the soil and groundwater of parcels 24, 27, 28, 2-53, 2-53L, 2-54, 2-54L, 2-70, 2-70L, 3-89, 3... Priorities List (NPL). This partial deletion pertains to the soil and groundwater of parcels 24, 27, 28, 2-53...

  15. Role of physiological mechanisms and EPSPS gene expression in glyphosate resistance in wild soybeans (Glycine soja).

    Science.gov (United States)

    Gao, Yue; Tao, Bo; Qiu, Lijuan; Jin, Longguo; Wu, Jing

    2014-02-01

    The physiological mechanisms underlying glyphosate resistance in wild soybean germplasm and relevant EPSPS gene expression were evaluated. These germplasms were selected by gradually increasing glyphosate selection pressure started from 2010. As indicated by a whole-plant dose response bioassay, ZYD-254 plants were resistant to glyphosate at concentrations of 1230gaeha(-1), but the susceptible plants (ZYD-16) were unable to survive in the presence of 300gaeha(-1) glyphosate. The ED50 values of resistant germplasm were approximately 8.8 times of the susceptible germplasm. Chlorophyll content was significantly decreased in ZYD-16 plants in comparison with ZYD-254 plants. ZYD-16 plants accumulated 10.1 times more shikimate in leaves at 5days after glyphosate treatment at 1230gaeha(-1) than ZYD-254 did. GST activity differed between ZYD-254 and ZYD-16 in three tissues. It was highest in leaves. There were no significant differences in EPSPS1 or EPSPS3 expression between two germplasms before exposure to glyphosate treatment. After glyphosate treatment, there was a 2- to 4-fold increase in EPSPS1 mRNA levels in ZYD-254, but there was no change in EPSPS3 mRNA levels in ZYD-254 or ZYD-16. Copyright © 2014 Elsevier Inc. All rights reserved.

  16. Acid modified diatomaceous earth--a sorbent material for thin layer chromatography.

    Science.gov (United States)

    Ergül, Soner; Savaşci, Sahin

    2008-04-01

    Natural diatomaceous earth (DE) is modified by flux calcination and refluxing with acid. To characterize natural DE, modified DE's [flux calcinated (FC)DE and FCDE-I] and silica gel 60GF(254) (Si-60GF(254)) are analyzed microscopically, physically, and chemically by various techniques. FCDE-I and Si-60GF(254) are investigated for their usefulness in the stationary phase of thin layer chromatography (TLC) both individually and in composition. Sodium diethyldithiocarbamate (DEDTC) and ammonium pyrrolidinedithiocarbamate (PyDTC) are prepared as Co or Cu (M) complexes [M(DEDTC)(2) and M(PyDTC)(2), respectively]. These complexes and their mixtures are run on thin layers of Si-60GF(254) and FCDE-I individually, and on various FCDE-I and Si-60GF(254) mixtures. Pure toluene and various toluene-cyclohexane mixtures (3:1, 1:1, 1:2, 1:3, v/v) are used as mobile phases for the running the complexes. The best analytical separations of both M(DEDTC)(2) and M(PyDTC)(2) complexes are obtained when using pure toluene and toluene-cyclohexane (3:1, 1:1, v/v) as mobile phases on FCDE-I-Si-60GF(254) (1:3, 1:1, w/w) layers as stationary phases. This study shows that it is possible to qualitatively analyze and to satisfactorily separate a mixture Cu(2+) and Co(2+) cations on cited chromatographic systems.

  17. Removal of fluorescence and ultraviolet absorbance of dissolved organic matter in reclaimed water by solar light.

    Science.gov (United States)

    Wu, Qianyuan; Li, Chao; Wang, Wenlong; He, Tao; Hu, Hongying; Du, Ye; Wang, Ting

    2016-05-01

    Storing reclaimed water in lakes is a widely used method of accommodating changes in the consumption of reclaimed water during wastewater reclamation and reuse. Solar light serves as an important function in degrading pollutants during storage, and its effect on dissolved organic matter (DOM) was investigated in this study. Solar light significantly decreased the UV254 absorbance and fluorescence (FLU) intensity of reclaimed water. However, its effect on the dissolved organic carbon (DOC) value of reclaimed water was very limited. The decrease in the UV254 absorbance intensity and FLU excitation-emission matrix regional integration volume (FLU volume) of reclaimed water during solar light irradiation was fit with pseudo-first order reaction kinetics. The decrease of UV254 absorbance was much slower than that of the FLU volume. Ultraviolet light in solar light had a key role in decreasing the UV254 absorbance and FLU intensity during solar light irradiation. The light fluence-based removal kinetic constants of the UV254 and FLU intensity were independent of light intensity. The peaks of the UV254 absorbance and FLU intensity with an apparent molecular weight (AMW) of 100Da to 2000Da decreased after solar irradiation, whereas the DOC value of the major peaks did not significantly change. Copyright © 2015. Published by Elsevier B.V.

  18. Degradation of methyl orange using short-wavelength UV irradiation with oxygen microbubbles

    Energy Technology Data Exchange (ETDEWEB)

    Tasaki, Tsutomu; Wada, Tsubasa; Fujimoto, Kanji [JST Innovation Satellite Miyazaki, 1-1 Gakuen Kibanadai Nishi, Miyazaki 889-2192 (Japan); Kai, Shinji; Ohe, Kaoru; Oshima, Tatsuya; Baba, Yoshinari [Department of Applied Chemistry, Faculty of Engineering, University of Miyazaki, 1-1 Gakuen Kibanadai Nishi, Miyazaki 889-2192 (Japan); Kukizaki, Masato [Department of Material Development, Miyazaki Prefecture Industrial Technology Center, 16500-2 Higashi Kaminaka, Sadowara, Miyazaki 880-0303 (Japan)], E-mail: kukizaki@iri.pref.miyazaki.jp

    2009-03-15

    A novel wastewater treatment technique using 8 W low-pressure mercury lamps in the presence of uniform-sized microbubbles (diameter = 5.79 {mu}m) was investigated for the decomposition of methyl orange as a model compound in aqueous solution. Photodegradation experiments were conducted with a BLB black light blue lamp (365 nm), a UV-C germicidal lamp (254 nm) and an ozone lamp (185 nm + 254 nm) both with and without oxygen microbubbles. The results show that the oxygen microbubbles accelerated the decolorization rate of methyl orange under 185 + 254 nm irradiation. In contrast, the microbubbles under 365 and 254 nm irradiation were unaffected on the decolorization of methyl orange. It was found that the pseudo-zero order decolorization reaction constant in microbubble system is 2.1 times higher than that in conventional large bubble system. Total organic carbon (TOC) reduction rate of methyl orange was greatly enhanced by oxygen microbubble under 185 + 254 nm irradiation, however, TOC reduction rate by nitrogen microbubble was much slower than that with 185 + 254 nm irradiation only. Possible reaction mechanisms for the decolorization and mineralization of methyl orange both with oxygen and nitrogen mirobubbles were proposed in this study.

  19. Degradation of methyl orange using short-wavelength UV irradiation with oxygen microbubbles.

    Science.gov (United States)

    Tasaki, Tsutomu; Wada, Tsubasa; Fujimoto, Kanji; Kai, Shinji; Ohe, Kaoru; Oshima, Tatsuya; Baba, Yoshinari; Kukizaki, Masato

    2009-03-15

    A novel wastewater treatment technique using 8 W low-pressure mercury lamps in the presence of uniform-sized microbubbles (diameter = 5.79 microm) was investigated for the decomposition of methyl orange as a model compound in aqueous solution. Photodegradation experiments were conducted with a BLB black light blue lamp (365 nm), a UV-C germicidal lamp (254 nm) and an ozone lamp (185 nm+254 nm) both with and without oxygen microbubbles. The results show that the oxygen microbubbles accelerated the decolorization rate of methyl orange under 185+254 nm irradiation. In contrast, the microbubbles under 365 and 254 nm irradiation were unaffected on the decolorization of methyl orange. It was found that the pseudo-zero order decolorization reaction constant in microbubble system is 2.1 times higher than that in conventional large bubble system. Total organic carbon (TOC) reduction rate of methyl orange was greatly enhanced by oxygen microbubble under 185+254 nm irradiation, however, TOC reduction rate by nitrogen microbubble was much slower than that with 185+254 nm irradiation only. Possible reaction mechanisms for the decolorization and mineralization of methyl orange both with oxygen and nitrogen mirobubbles were proposed in this study.

  20. Inpatient allergy/immunology consultations in a tertiary care setting.

    Science.gov (United States)

    Otto, Hans F; England, Ronald W; Quinn, James M

    2010-01-01

    Few studies have examined inpatient referral patterns for fellowship training programs and none for allergy/immunology (AI) since 2003. The primary end point was the reason for consultation, and secondary end points included the AI diagnosis made and outcomes. We retrospectively reviewed all inpatient AI consultations from July 1, 2001 through June 30, 2007. These 6 years of data were combined with 14 years of data examining the reason for consult from a previous study. The data were analyzed for trends and changes over the entire 20-year period. A total of 254 AI inpatient consults were reviewed over the 6 years studied. Thirty-six percent (92/254) of inpatient consults were for evaluation of adverse drug reactions (ADRs), 22% (55/254) miscellaneous reasons, 17% (43/254) urticaria/angioedema, 13% (32/254) for possible immunodeficiency, 9% (23/254) for anaphylaxis, and 3% (8/254) for asthma. AI inpatient consults show a significant decline over the recent 6-year period (p = 0.0023) despite stable total hospital admissions since 1998. Over the last 20 years, an 85% decrease (p < 0.00001) in inpatient asthma consults and increases (p < 0.05) in immunodeficiency, rash, and urticaria/angioedema evaluations have been observed. Not following AI recommendations resulted in a 16.6 odds ratio (95% CI, 5.55-49.93) that a patient's clinical status would be worse or unchanged. Inpatient AI consults have declined with associated reduction in asthma inpatient consults. Although ADRs and anaphylaxis consults have been stable, evaluations for immunodeficiency, rash, and urticaria/angioedema have increased. Following inpatient AI recommendations is associated with improved patient outcomes.

  1. Effect of landfill characteristics on leachate organic matter properties and coagulation treatability.

    Science.gov (United States)

    Comstock, Sarah E H; Boyer, Treavor H; Graf, Katherine C; Townsend, Timothy G

    2010-11-01

    This work spans landfill characteristics, leachate organic matter properties, and coagulation chemistry to provide new insights into the physical-chemical treatability of stabilized landfill leachate. Furthermore, leachate organic matter is viewed in terms of dissolved organic matter (DOM) present in the natural environment, and coagulation chemistry is evaluated based on previous leachate and water treatment coagulation studies. Stabilized leachate was collected from four landfills for a total of seven leachate samples, and samples were coagulated using ferric chloride, ferric sulfate, and aluminum sulfate. Landfill characteristics, such as age, leachate recirculation, and cover material, influenced properties of DOM present in the leachate, as measured by specific ultraviolet (UV) absorbance at 254 nm (SUVA254) and fluorescence excitation-emission matrices. The coagulation performance of the metal salts was ferric sulfate>aluminum sulfate>ferric chloride, and DOM removal followed the trend of color>UV254>dissolved organic carbon>chemical oxygen demand (COD). Finally, a strong association was found between increasing SUVA254 and increasing DOM removal for coagulation of both leachate and natural surface water. Thus, SUVA254 is expected to be a better predictor of leachate treatability, in particular DOM removal, than the traditionally used ratio of biochemical oxygen demand to COD. Copyright © 2010 Elsevier Ltd. All rights reserved.

  2. Effects of uv irradiation of nymphs of Blattella germanic and Periplaneta americana

    International Nuclear Information System (INIS)

    Cohen, S.H.; Sousa, J.A.; Roach, J.F.; Gingrich, J.B.

    1975-01-01

    Certain effects of uv irradiation on nymphs of the American cockroach, Periplaneta americana (L.), and the German cockroach, Blattella germanica (L.), were investigated. Of 7 wavelengths to which the nymphs were exposed, 254 and 265 nm were the most effective in producing mortality. The approximate LD 50 dose for nymphs exposed to germicidal (254 nm) uv was 4.56 x 10 4 μ j cm -2 for P. americana and 1.9 x 10 4 μj cm -2 for B. germanica. UV irradiation resulted in retarded feeding and delay in weight gain and molting. Structural abnormalities were observed among adults of those nymphs which were exposed to either pulsed or continuous uv. Pulsed uv was more effective in producing mortality than continuous uv exposure. Nymphs lured to a specific area by food, water, food and water, contaminated filter paper, or filter paper containing a crude extract of aggregation pheromone were killed when irradiated with germicidal (254 nm) uv

  3. Stretchable microelectrode array using room-temperature liquid alloy interconnects

    International Nuclear Information System (INIS)

    Wei, P; Ziaie, B; Taylor, R; Chung, C; Higgs, G; Pruitt, B L; Ding, Z; Abilez, O J

    2011-01-01

    In this paper, we present a stretchable microelectrode array for studying cell behavior under mechanical strain. The electrode array consists of gold-plated nail-head pins (250 µm tip diameter) or tungsten micro-wires (25.4 µm in diameter) inserted into a polydimethylsiloxane (PDMS) platform (25.4 × 25.4 mm 2 ). Stretchable interconnects to the outside were provided by fusible indium-alloy-filled microchannels. The alloy is liquid at room temperature, thus providing the necessary stretchability and electrical conductivity. The electrode platform can withstand strains of up to 40% and repeated (100 times) strains of up to 35% did not cause any failure in the electrodes or the PDMS substrate. We confirmed biocompatibility of short-term culture, and using the gold pin device, we demonstrated electric field pacing of adult murine heart cells. Further, using the tungsten microelectrode device, we successfully measured depolarizations of differentiated murine heart cells from embryoid body clusters

  4. Removal of humic substances for coagulation with Alum

    International Nuclear Information System (INIS)

    Camargo Valero, Miller; Cruz Torres, Luis Eduardo

    1999-01-01

    In the search of better conditions to remove precursory material in the formation of disinfections sub-products with free chlorine, was found that the absorbance to the ultraviolet to 254 nm (AUV 254 nm) it is a parameter that can be used as non-specific measure, to estimate concentrations of precursory material, specifically humic substances, and also, like control instrument in the operations and previous processes to the disinfections with free chlorine. The study tries the importance so that in the handling essays of potable water is included the AUV 254 nm like control parameter. In essays of coagulation with alum was found that the removal of these substances depends on the dose of coagulation and the pH of coagulation

  5. Maximum permissible concentration (MPC) values for spontaneously fissioning radionuclides

    International Nuclear Information System (INIS)

    Ford, M.R.; Snyder, W.S.; Dillman, L.T.; Watson, S.B.

    1976-01-01

    The radiation hazards involved in handling certain of the transuranic nuclides that exhibit spontaneous fission as a mode of decay were reaccessed using recent advances in dosimetry and metabolic modeling. Maximum permissible concentration (MPC) values in air and water for occupational exposure (168 hr/week) were calculated for 244 Pu, 246 Cm, 248 Cm, 250 Cf, 252 Cf, 254 Cf, /sup 254m/Es, 255 Es, 254 Fm, and 256 Fm. The half-lives, branching ratios, and principal modes of decay of the parent-daughter members down to a member that makes a negligible contribution to the dose are given, and all daughters that make a significant contribution to the dose to body organs following inhalation or ingestion are included in the calculations. Dose commitments for body organs are also given

  6. Crisis pregnancy center websites: Information, misinformation and disinformation.

    Science.gov (United States)

    Bryant, Amy G; Narasimhan, Subasri; Bryant-Comstock, Katelyn; Levi, Erika E

    2014-12-01

    Most states with 24-h waiting periods prior to abortion provide state resource directories to women seeking abortion. Our objective was to evaluate the information on abortion provided on the websites of crisis pregnancy centers listed in these resource directories. We performed a survey of the websites of crisis pregnancy centers referenced in state resource directories for pregnant women. We searched for these state-provided resource directories online. We contacted state Departments of Health and Human Services for a print copy when a directory could not be found online. The crisis pregnancy center websites were evaluated for the information provided on abortion. Standardized data collection tools were used. Descriptive statistics were generated. Resource directories of 12 states were procured. A total of 254 websites referring to 348 crisis pregnancy centers were identified. Overall, a total of 203/254 [80%, 95% confidence interval (CI) 75%-84%] of websites provided at least one false or misleading piece of information. The most common misleading or false information included on the websites were a declared link between abortion and mental health risks (122/254 sites; 48%, 95% CI 42%-54%), preterm birth (54/254; 21%, 95% CI 17%-27%), breast cancer (51/254; 20%, 95% CI 16%-25%) and future infertility (32/254; 13%, 95% CI 9%-17%). Most crisis pregnancy centers listed in state resource directories for pregnant women provide misleading or false information regarding the risks of abortion. States should not list agencies that provide inaccurate information as resources in their directories. Copyright © 2014 Elsevier Inc. All rights reserved.

  7. Communication Received from the Permanent Mission of the Republic of Serbia to the International Atomic Energy Agency Regarding Guidelines for the Export of Nuclear Material, Equipment and Technology and the Guidelines for Transfers of Nuclear-related Dual-use Equipment, Materials, Software and Related Technology

    International Nuclear Information System (INIS)

    2012-01-01

    The Director General has received a note verbale dated 28 September 2012 from the Permanent Mission of Serbia to the International Atomic Energy Agency providing information on the decision of the Government of Serbia to adhere to the 'Guidelines for the Export of Nuclear Material, Equipment and Technology', issued as document INFCIRC/254/Rev.10/Part 1, including its Annexes, and with the 'Guidelines for Transfers of Nuclear-Related Dual-Use Equipment, Material, Software and Related Technology', issued as document INFCIRC/254/Rev.8/Part 2 [es

  8. Accelerating the discovery of hidden two-dimensional magnets using machine learning and first principle calculations

    Science.gov (United States)

    Miyazato, Itsuki; Tanaka, Yuzuru; Takahashi, Keisuke

    2018-02-01

    Two-dimensional (2D) magnets are explored in terms of data science and first principle calculations. Machine learning determines four descriptors for predicting the magnetic moments of 2D materials within reported 216 2D materials data. With the trained machine, 254 2D materials are predicted to have high magnetic moments. First principle calculations are performed to evaluate the predicted 254 2D materials where eight undiscovered stable 2D materials with high magnetic moments are revealed. The approach taken in this work indicates that undiscovered materials can be surfaced by utilizing data science and materials data, leading to an innovative way of discovering hidden materials.

  9. Remoción de sustancias húmicas por coagulación con alumbre

    OpenAIRE

    Miller Camargo Valero; Luis Eduardo Cruz Torres

    2011-01-01

    En la búsqueda de mejores condiciones para remover material precursor en la formación de subproductos de desinfección con cloro libre, se encontró que la absorbancia al ultravioleta a 254 nm (AUV 254 nm) es un parámetro que puede ser usado como medida no específica para estimar concentraciones de material precursor, específicamente sustancias húmicas, y además, como instrumento de control en las operaciones y procesos previos a la desinfección con cloro libre. El estudio plantea la importanci...

  10. Effects of Wavelength of Ultraviolet Ray on the Formation Rate of Pre-vitamin D_2 From Ergosterol

    OpenAIRE

    高村, 一知; 星野, 浩子; 豊増, 哲郎; 田中, 徳夫; 中沢, 武; タカムラ, カズノリ; ホシノ, ヒロコ; トヨマス, テツオ; タナカ, ノリオ; ナカザワ, タケシ; KAZUNORI, TAKAMURA; HIROKO, HOSHINO; TETSUO, TOYOMASU; NORIO, TANAKA; TAKESHI, NAKAZAWA

    1996-01-01

    In the ultraviolet (hereafter called UV) irradiation of ergosterol, the effects of wavelength (UV irradiation lamp 254nm and 310nm) were investigated on the formation of pre-vitamin D_2. The determination of pre-vitamin D_2 used high performance liquid chromatography. The results were as follows: (19 The precursor of vitamin D_2 is pre-vitamin D_2. It was formed when ergosterol (solution alcohol) was exposed to UV irradiation (254nm and 310nm). (2) The formation rate of pre-vitamin D_2 with t...

  11. Communication Received from the PermanentMission of Mexico to the International Atomic Energy Agency Regarding Guidelines for the Export of Nuclear Material, Equipment and Technology and the Guidelines for Transfers of Nuclear-related Dual-use Equipment, Materials, Software and Related Technology

    International Nuclear Information System (INIS)

    2012-01-01

    The Director General has received a note verbale dated 15 June 2012 from the Permanent Mission of Mexico to the International Atomic Energy Agency providing information on the decision of the Government of Mexico to act in accordance with the 'Guidelines for the Export of Nuclear Material, Equipment and Technology', issued as document INFCIRC/254/Rev.10/Part 1, including its Annexes, and with the 'Guidelines for Transfers of Nuclear-Related Dual-Use Equipment, Material, Software and Related Technology', issued as document INFCIRC/254/Rev.8/Part 2

  12. Communication Received from the Permanent Mission of Mexico to the International Atomic Energy Agency Regarding Guidelines for the Export of Nuclear Material, Equipment and Technology and the Guidelines for Transfers of Nuclear-related Dual-use Equipment, Materials, Software and Related Technology

    International Nuclear Information System (INIS)

    2012-01-01

    The Director General has received a note verbale dated 15 June 2012 from the Permanent Mission of Mexico to the International Atomic Energy Agency providing information on the decision of the Government of Mexico to act in accordance with the 'Guidelines for the Export of Nuclear Material, Equipment and Technology', issued as document INFCIRC/254/Rev.10/Part 1, including its Annexes, and with the 'Guidelines for Transfers of Nuclear-Related Dual-Use Equipment, Material, Software and Related Technology', issued as document INFCIRC/254/Rev.8/Part 2

  13. Influence of Solid Target Reflectivity and Incident Angle on Depolarization Ratio and Reflected Energy from Polarized Lights: Experimental Results of the May 2008 Field Trial

    Science.gov (United States)

    2009-11-01

    center No On the list English Name Center x (cm) y (cm) 1 Vive Empty 2 Spectralon blanc White spectralon 25.4 6.75 3 Spectralon noir Black spectralon 44.45...Styrofoam� 26 -22 9 Styro-mousse: noir Black Styrofoam� 41.5 -22 10 Réectik� Reectik� 10 -37.5 11 Styro-mousse noir léger Black light Styrofoam� 26 -37.5...Spectralon blanc White spectralon 25.4 6.75 3 Spectralon noir Black spectralon 44.45 6.75 4 Pins Pine 10 -6.5 5 Épinette Spruce 26 -6.5 6 Merisier Cherry

  14. The Five-Factor Nonverbal Personality Questionnaire in the Czech context

    Czech Academy of Sciences Publication Activity Database

    Hřebíčková, Martina

    2010-01-01

    Roč. 52, č. 3 (2010), s. 165-177 ISSN 0039-3320 Institutional research plan: CEZ:AV0Z70250504 Keywords : Nonverbal personality measurement * five -factor model * The Five -Factor Nonverbal Personality Questionnaire * FF-NPQ Subject RIV: AN - Psychology Impact factor: 0.254, year: 2010

  15. Multilayer and functionally gradient films of plasma polymers intended as compatible interlayers for hybrid materials

    Czech Academy of Sciences Publication Activity Database

    Hoferek, L.; Mistřík, J.; Trivedi, R.; Chen, K. S.; Peřina, Vratislav; Čech, V.

    2014-01-01

    Roč. 254, SEP (2014), s. 49-53 ISSN 0257-8972 R&D Projects: GA MŠk(XE) LM2011019 Institutional support: RVO:61389005 Keywords : multilayer * Gradient film * Plasma polymerization * ellipsometry * nanoindentation Subject RIV: BG - Nuclear, Atomic and Molecular Physics, Colliders Impact factor: 1.998, year: 2014

  16. Hybrid Molecule-Nanocrystal Photon Upconversion Across the Visible and Near-Infrared

    Science.gov (United States)

    2015-07-10

    triplet annihilation. Coord. Chem. Rev. 2010, 254, 2560−2573. (6) Baluschev, S.; Miteva, T.; Yakutkin, V.; Nelles, G.; Yasuda, A.; Wegner , G. Up...1141. (31) Keivanidis, P. E.; Baluschev, S.; Lieser, G.; Wegner , G. Inherent Photon Energy Recycling Effects in the Up-Converted Delayed Luminescence

  17. Single intravenous and oral dose pharmacokinetics of florfenicol in the channel catfish Ictalurus punctatus

    Science.gov (United States)

    Plasma distribution and elimination of florfenicol in channel catfish were investigated after a single dose (10mg/kg) of intravenous i.v.) or oral administration in freshwater at a mean water temperature of 25.4°C. Florfenicol concentrations in plasma were analyzed by means of liquid chromatography...

  18. Pramana – Journal of Physics | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    Home; Journals; Pramana – Journal of Physics. K V Ramanathan. Articles written in Pramana – Journal of Physics. Volume 59 Issue 2 August 2002 pp 243-254. Developments in quantum information processing by nuclear magnetic resonance: Use of quadrupolar and dipolar couplings · Anil Kumar K V Ramanathan T S ...

  19. Production enhancement of Cyclosporin 'A' by Aspergillus terreus ...

    African Journals Online (AJOL)

    In this study, mutation was carried out by ultraviolet radiation (254 nm) and alkylating agent ethylmethane sulphonate (EMS). UV 5 min time treatment was proved to be the best treatment because most of the resulted mutants showed enhancement in drug production. Chemical treatment of 200 μg/ml produced best mutants, ...

  20. 1454-IJBCS-Article-Ngokam David

    African Journals Online (AJOL)

    hp

    coupling constants (J) are given in Hertz. HR-. ESI-MS experiments were performed using a. Micromass Q-TOF micro instrument. (Manchester, UK) with an electrospray source. Column chromatography was run on. Merck silica gel 60 and Sephadex LH-20 while TLC was carried out on silica gel GF254 precoated plates with ...

  1. Preschool Gifted Education: Perceived Challenges Associated with Program Development

    Science.gov (United States)

    Kettler, Todd; Oveross, Mattie E.; Salman, Rania C.

    2017-01-01

    This descriptive study investigated the challenges related to implementing gifted education services in preschool centers. Participants were 254 licensed preschool center directors in a southern state. Participants completed a researcher-created survey including both selected response items and constructed response items to examine the perceived…

  2. Cyberbullying and Victimisation among Turkish University Students

    Science.gov (United States)

    Akbulut, Yavuz; Eristi, Bahadir

    2011-01-01

    This study investigated the extent of cyberbullying and victimisation among Turkish university students at a state college of education. A personal information form and 56 scaled items were administered to 254 students. Items addressing cyberbullying victimisation were adopted from a recent study, whereas parallel cyberbullying items were…

  3. In this section of Resonance, we invite readers to pose questions ...

    Indian Academy of Sciences (India)

    Home; Journals; Resonance – Journal of Science Education; Volume 20; Issue 3. Discovering Facts: Finding the Longest Day with School Children. Vishwesha Guttal. Classroom Volume 20 Issue 3 March 2015 pp 254-259. Fulltext. Click here to view fulltext PDF. Permanent link:

  4. The Practice of Learner-Centered Method in Upper Primary Schools ...

    African Journals Online (AJOL)

    user

    recognized the inadequacy of the education system to prepare the learner ... education program (iv) Selection criteria for pre-service teacher ..... Table 3: Departmental distribution of observed teachers. Department. Frequency. Percentage. Language. 68. 29.8. Mathematics. 26. 11.4. Natural science. 58. 25.4. Aesthetics and ...

  5. Proliferation of epithelial cell forming hamster palate during prenatal period

    Czech Academy of Sciences Publication Activity Database

    Buchtová, M.; Tichý, F.; Matulová, Petra; Míšek, Ivan

    2003-01-01

    Roč. 76, č. 4 (2003), s. 254-255 [Moravský morfologický den/4./. 11.06.2003, Brno] R&D Projects: GA ČR GA304/02/0448; GA ČR GP304/01/P021 Institutional research plan: CEZ:AV0Z5045916 Keywords : hamster Subject RIV: ED - Physiology

  6. Opuštěné vojenské prostory jako významná refugia motýlí fauny

    Czech Academy of Sciences Publication Activity Database

    Vrba, Pavel; Čížek, Oldřich; Marhoul, P.; Zámečník, J.; Beneš, Jiří; Konvička, Martin

    2012-01-01

    Roč. 2012, č. 5 (2012), s. 251-254 ISSN 0044-4812 R&D Projects: GA ČR GAP505/10/2167 Grant - others:Ministerstvo životního prostředí(CZ) VaV/SP/2d3/153/08 Institutional support: RVO:60077344 Keywords : butterfly fauna

  7. M-Rated Video Games and Aggressive or Problem Behavior among Young Adolescents

    Science.gov (United States)

    Olson, Cheryl K.; Kutner, Lawrence A.; Baer, Lee; Beresin, Eugene V.; Warner, Dorothy E.; Nicholi, Armand M., II

    2009-01-01

    This research examined the potential relationship between adolescent problem behaviors and amount of time spent with violent electronic games. Survey data were collected from 1,254 7th and 8th grade students in two states. A "dose" of exposure to Mature-rated games was calculated using Entertainment Software Rating Board ratings of…

  8. Michelia banghamii (Magnoliaceae), a new species from Sumatra

    NARCIS (Netherlands)

    Nooteboom, H.P.

    1994-01-01

    Arbor magna ramulis appresse puberulis 2.5-4 mm crassis foliis 7 ad 12 cm longis, 3 ad 7 cm latis base rotunda venis lateralibus 10 ad 12 paribus petiolo 15 ad 25 mm longo cicatrice stipulorum ad dimidium vel longiore. Brachyblastus et gynophorus carpelliscum appresse puberuli. Gynophorus 3 ad 5 mm

  9. Fractionation and identification of bioactive constituents from ...

    African Journals Online (AJOL)

    In view of antidiabetic and antioxidant properties observed in a previous study, crude ethanol leaf extract of Sapium ellipticum (SE) was fractionated using Silica gel F254 column chromatography to yield 164 fractions. Pooling together of fractions with similar thin layer chromatographic (TLC) mobility profile afforded five ...

  10. Floodplain architecture of an actively meandering river (the Ploucnice River, the Czech Republic) as revealed by the distribution of pollution and electrical resistivity tomography

    Czech Academy of Sciences Publication Activity Database

    Matys Grygar, Tomáš; Elznicová, J.; Tůmová, Štěpánka; Faměra, Martin; Balogh, M.; Kiss, T.

    2016-01-01

    Roč. 254, FEB (2016), s. 41-56 ISSN 0169-555X R&D Projects: GA ČR(CZ) GA15-00340S Institutional support: RVO:61388980 Keywords : Floodplain architecture * Fades assignment * Electric resistivity imaging * Floodplain recyclation Subject RIV: DD - Geochemistry Impact factor: 2.958, year: 2016

  11. S. Afr. Tydskr. Veek. I I , 2BS -286 ( I 98 I ) NAVORSINGSBERIG DIE ...

    African Journals Online (AJOL)

    Die produksie van lusernhooi het toegeneem vanaf. 448 000 ton in die l95ll52 seisoen tot | 254 000 ton in die 1979180 seisoen (Kortbegrip van l-andboustati- stiek, l98l). Verder is dit insiggewend om daarop te let dat lusemhooi nagenoeg3g/' bydra tot die hoeveelheid proteibne geproduseer uit die proteibnryke voersoorte ...

  12. Browse Title Index

    African Journals Online (AJOL)

    Items 151 - 200 of 254 ... Vol 27, No 3-4 (2015), Non-communicable diseases among prison inmates in North-West Nigeria, Abstract. Anas Ahmad Sabir ... Vol 21, No 1-4 (2009), Pattern of Eye Disorders among Inmates of a Nigerian Prison, Abstract ... Placidus N. Ogualili, Dan C.D. Anyiam, Ogochukwu I. Ezejiofor. Vol 26, No ...

  13. A practitioner’s perspective on coaching effectiveness

    NARCIS (Netherlands)

    Theeboom, T.; van Vianen, A.E.M.; Beersma, B.; Zwitser, R.; Kobayashi, V.; Nota, L.; Soresi, S.

    2017-01-01

    In past decades, coaching – which involves a “result-oriented, systematic process in which the coach facilitates the enhancement of life experience and goal-attainment in the personal and/or professional life of normal, non-clinical clients” (Grant, 2003, p. 254) – has grown into a $2 billion

  14. A test of the permanent income hypothesis on Czech voucher privatization

    Czech Academy of Sciences Publication Activity Database

    Hanousek, Jan; Tůma, Z.

    2002-01-01

    Roč. 10, č. 2 (2002), s. 235-254 ISSN 0967-0750 Institutional research plan: CEZ:AV0Z7085904 Keywords : Barro-Riccardian * equivalence * permanent income hypothesis Subject RIV: AH - Economics Impact factor: 0.897, year: 2002 http://search. ebscohost .com/login.aspx?direct=true&db=bth&AN=6844845&site=ehost-live

  15. Production of Polyclonal Antibodies to the Recombinant Potato virus M (PVM) Non-structural Triple Gene Block Protein 1 and Coat Protein

    Czech Academy of Sciences Publication Activity Database

    Čeřovská, Noemi; Moravec, Tomáš; Plchová, Helena; Hoffmeisterová, Hana; Dědič, P.

    2012-01-01

    Roč. 160, č. 5 (2012), s. 251-254 ISSN 0931-1785 R&D Projects: GA MŠk 1M06030 Institutional research plan: CEZ:AV0Z50380511 Keywords : Potato virus M * recombinant protein * coat protein Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 1.000, year: 2012

  16. Vaginal yeast infections in diabetic women | Peer | South African ...

    African Journals Online (AJOL)

    Yeasts were isolated from the vaginas of 35,5% of patients and were more common in the symptomatic group (48,0%) than the asymptomatic group (25,4%; P < 0,(5). Candida albicans ... C. glabrata (Torulopsis glabrata) was the COmDlonest yeast species isolated (50,0%), with C. albicans the next most frequent (36,1%).

  17. Making a Difference : Measuring the Impact of Information on ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Making a Difference : Measuring the Impact of Information on Development. Couverture du livre Making a Difference : Measuring the Impact of Information on Development. Directeur(s):. Paul McConnell. Maison(s) d'édition: CRDI. 1 janvier 1995. ISBN : Épuisé. 254 pages. e-ISBN : 1552502996. Téléchargez le PDF.

  18. Examining Intrinsic Thalamic Resting State Networks Using Graph Theory Analysis : Implications for mTBI detection

    Science.gov (United States)

    2012-08-01

    McGraw-Hill, Jan. 2000. [15] R.W. Cox, “AFNI: software for analysis and visualization of functional magnetic resonance neuroimages”, Computers...Network homogeneity reveals decreased integrity of default-mode network in ADHD ”, J Neuroscience Met. Vol. 169, no. 1, pp. 249-254, 2008. [25

  19. Regional cerebral blood flow in aphasia

    DEFF Research Database (Denmark)

    Soh, K; Larsen, B; Skinhøj, E

    1978-01-01

    Regional cerebral blood flow (rCBF) was studied in 13 aphasic patients with left hemisphere lesions, using the intracarotid xenon 133 injection method and a 254-detector gamma camera system. The rCBF was measured during rest and during various function tests, including a simple speech test...

  20. A representation formula for linearized stationary incompressible viscous flows around rotating and translating bodies

    Czech Academy of Sciences Publication Activity Database

    Deuring, P.; Kračmar, S.; Nečasová, Šárka

    2010-01-01

    Roč. 3, č. 2 (2010), s. 237-254 ISSN 1937-1632 R&D Projects: GA AV ČR IAA100190804 Institutional research plan: CEZ:AV0Z10190503 Keywords : viscous incompressible fluids * rotating body * fundamental solution Subject RIV: BA - General Mathematics http://www.aimsciences.org/journals/displayArticles.jsp?paperID=5050

  1. SINET: Ethiopian Journal of Science - Vol 24, No 2 (2001)

    African Journals Online (AJOL)

    Bagridae) in Lake Chamo, Ethiopia · EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT · DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. Hailu Anja, Seyoum Mengistou, 239-254. http://dx.doi.org/10.4314/sinet.v24i2.18189 ...

  2. Thin Layer chromatographic analyses of pesticides in a soil ecosystem

    African Journals Online (AJOL)

    Silica gel 60, silica gel 60 F254, and aluminium oxide as adsorbents were used to investigate their suitability for the analysis and detection of the pesticides: nitrofen, atrazine, diuron, dioxacarb, propoxur, propanil, carbaryl and cypermethrin in soil ecosystem using ethyl acetate, chloroform, dichloromethane and ethyl ...

  3. Team Theory and Decentralized Resource Allocation: An Example.

    Science.gov (United States)

    1982-02-01

    continues through Walras [1954, pp. 84-86, 90-91, 105-106, 169-172, 243-254, and 184-1951, Pareto 11927, pp. 233-2341, Barone, pp. 245-290 in von Hayek...politique (Deuxi~me edition), Marcel Girard, Paris. Walras , L. [19541, Elements of Pure Economics, ed. and tr. by W. Jaffe, George Allen and Unwin

  4. "For Us It Is Like Living in the Dark." Ethiopian Women?s Experiences With Domestic Violence

    Science.gov (United States)

    Sullivan, Marianne; Senturia, Kirsten; Negash, Tigist; Shiu-Thornton, Sharyne; Giday, Beruke

    2005-01-01

    This article discusses the experiences of domestic violence among Ethiopian refugees and immigrants in the United States. A subset (n = 18) of the larger study sample (N = 254) participated in three focus groups with Amharic-speaking survivors of domestic violence who were currently in or had left abusive relationships. The research was conducted…

  5. Real-time UV imaging of nicotin release from transdermal patch

    DEFF Research Database (Denmark)

    Østergaard, Jesper; Meng-Lund, Emil; Larsen, Susan Weng

    2010-01-01

    H 7.40, was studied by UV imaging (Actipix SDI300 dissolution imaging system) at 254 nm. The release rates were compared to those obtained using the paddle-over-disk method. RESULTS: Calibration curves were successfully established which allowed temporally and spatially resolved quantification...

  6. Study of Elemental Mass Distributions at Skukuza, South Afrika, during the SAFARI 2000 Dry Season Campaign

    Czech Academy of Sciences Publication Activity Database

    Maenhaut, W.; Schwarz, Jaroslav; Cafmeyer, J.; Annegarn, H. J.

    2002-01-01

    Roč. 189, - (2002), s. 254-258 ISSN 0168-583X Institutional research plan: CEZ:AV0Z4072921 Keywords : PIXE * multielement analysis * atmospheric aerosols Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 1.158, year: 2002

  7. Determinants of self-reported health in two Czech studies

    Czech Academy of Sciences Publication Activity Database

    Šolcová, Iva; Kebza, V.

    2005-01-01

    Roč. 20, Suppl. 1 (2005), s. 254 ISSN 0887-0446 R&D Projects: GA ČR(CZ) GA406/03/1168 Institutional research plan: CEZ:AV0Z70250504 Keywords : Self-rated health * age * SES * physical activity * negative affectivity * resilience factors Subject RIV: AN - Psychology Impact factor: 1.796, year: 2005

  8. SACRED TEXTS AND MYSTIC MEANING: AN INqUIRY INTO ...

    African Journals Online (AJOL)

    “Theological adequacy”, as Turner (1995:24) states, “requires the maximization of ... to Origen (c. 185 – 254 CE), within the Christian tradition itself. Philo's search to know God in se, a particular aspect of searching that, one may contend, .... 11 For similar expressions by Gregory of Nazianzus, Thomas Aquinas, and John of.

  9. 76 FR 65751 - Notice of intent to grant exclusive license

    Science.gov (United States)

    2011-10-24

    ... Crystalline Semiconductor Alloys on Basal Plane of Trigonal or Hexagonal Crystal,'' U.S. Patent Application No. 12/254,134 entitled ``Hybrid Bandgap Engineering for Super-Hetero- Epitaxial Semiconductor Materials... Semiconductor Materials on Trigonal Substrate with Single Crystal Properties and Devices Based on Such Materials...

  10. 40 CFR 721.10104 - Halophosphate mixed metal complex (generic).

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 30 2010-07-01 2010-07-01 false Halophosphate mixed metal complex... Specific Chemical Substances § 721.10104 Halophosphate mixed metal complex (generic). (a) Chemical... as halophosphate mixed metal complex (PMN P-04-254) is subject to reporting under this section for...

  11. South African Journal of Animal Science - Vol 47, No 3 (2017)

    African Journals Online (AJOL)

    Basal metabolic rate scaled to body mass between species by the fractal dimension of the vascular system and body composition · EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. C.Z. Roux, 246-254. http://dx.doi.org/10.4314/sajas.v47i3.1 ...

  12. 24 CFR 241.1200 - Cross-references.

    Science.gov (United States)

    2010-04-01

    ... 24 Housing and Urban Development 2 2010-04-01 2010-04-01 false Cross-references. 241.1200 Section... Rights and Obligations § 241.1200 Cross-references. (a) Projects with a HUD-insured or HUD-held mortgage....254Insurance endorsement. (2) For the purposes of subpart F of this part, all references in part 207 of this...

  13. The Supreme Court of Estonia constitutional judgement 3-3-1-35-10: judgment of the Supreme Court en banc : date of decision 31 August 2011

    Index Scriptorium Estoniae

    2013-01-01

    Kohtulahendi 3-3-1-35-10 (Riigiprokuratuuri ning Politsei- ja Piirivalveameti kassatsioonkaebused Tallinna Ringkonnakohtu 16. veebruari 2010. a otsuse peale haldusasjas nr 3-08-265 Ülar Kaasi (Kaas) kaebuses Eesti Vabariigi tekitatud 254 087 krooni suuruse kahju hüvitamise nõudes) tekst inglise keeles

  14. In vitro Cytotoxic, Antibacterial and Antiviral Activities of Triterpenes ...

    African Journals Online (AJOL)

    with tetramethylsilane (TMS) as an internal standard. Thin layer chromatography (TLC) was performed on precoated silica gel F254 plates (E. Merck, Darmstadt .... Unpaired Student t-test was conducted on the results using GraphPad. InStat (ISI Software) computer program. Differences were considered significant at p <.

  15. Screening of potent anticancer drug taxol from Entophytic fungus ...

    African Journals Online (AJOL)

    Muthumary

    2011-02-21

    Feb 21, 2011 ... scanned using TLC scanner-3 with winCATS software. Documentation of the TLC plate was performed under a shortwave. (254 nm) UV lamp. ... values δ-relative to tetramethylsilane (TMS) as internal reference and the coupling constant were reported in hertz. The FAB mass spectra were recorded on a ...

  16. 7 CFR 1710.303 - Power cost studies-power supply borrowers.

    Science.gov (United States)

    2010-01-01

    ... conservation alternatives as set forth in §§ 1710.253 and 1710.254; (2) A present-value analysis of the costs... contracts or revisions to existing contracts, and an analysis of the effects on power costs; (4) Use of sensitivity analyses to determine the vulnerability of the alternatives to a reasonable range of assumptions...

  17. Spatio-temporal patterns of recurrent slope instabilities affecting undercut slopes in flysch: A dendrogeomorphic approach using broad-leaved trees

    Czech Academy of Sciences Publication Activity Database

    Šilhán, K.; Pánek, T.; Turský, O.; Brázdil, R.; Klimeš, Jan; Kašičková, L.

    2014-01-01

    Roč. 213, MAY 15 (2014), s. 240-254 ISSN 0169-555X Institutional support: RVO:67985891 Keywords : dendrogeomorphology * tree - ring eccentricity * bedrock landslides * hydrometeorological triggers Subject RIV: DE - Earth Magnetism, Geodesy, Geography Impact factor: 2.577, year: 2013 http://www.sciencedirect.com/science/article/pii/S0169555X14000506

  18. Evaluation of Residential Consumers Knowledge of Wireless Network Security and Its Correlation with Identity Theft

    Science.gov (United States)

    Kpaduwa, Fidelis Iheanyi

    2010-01-01

    This current quantitative correlational research study evaluated the residential consumers' knowledge of wireless network security and its relationship with identity theft. Data analysis was based on a sample of 254 randomly selected students. All the study participants completed a survey questionnaire designed to measure their knowledge of…

  19. Removal efficiency and economic cost comparison of hydrated electron-mediated reductive pathways for treatment of bromate

    DEFF Research Database (Denmark)

    Nawaz, Shah; Shah, Noor S.; Khan, Javed Ali

    2017-01-01

    Bromate, a potential carcinogen, is a well known highly persistent and environmentally recalcitrant contaminant. UV-254/sulfite-based advanced reductive pathways (ARPs) were proposed to eliminate bromate successfully from water. Experiments with N2, N2O, 2-chlorophenol, inorganic ions, and differ...

  20. Dissolved organic matter removal using magnetic anion exchange resin treatment on biological effluent of textile dyeing wastewater.

    Science.gov (United States)

    Fan, Jun; Li, Haibo; Shuang, Chendong; Li, Wentao; Li, Aimin

    2014-08-01

    This study investigated the removal of dissolved organic matter (DOM) from real dyeing bio-treatment effluents (DBEs) with the use of a novel magnetic anion exchange resin (NDMP). DOMs in two typical DBEs were fractionized using DAX-8/XAD-4 resin and ultrafiltration membranes. The hydrophilic fractions and the low molecular weight (MW) (50%) of DOMs for the two effluents. The hydrophilic and low MW fractions of both effluents were the greatest contributors of specific UV254 absorbance (SUVA254), and the SUVA254 of DOM fractions decreased with hydrophobicity and MW. Two DBEs exhibited acute and chronic biotoxicities. Both acute and chronic toxicities of DOM fractions increased linearly with the increase of SUVA254 value. Kinetics of dissolved organic carbon (DOC) removal via NDMP treatment was performed by comparing it with that of particle active carbon (PAC). Results indicated that the removal of DOC from DBEs via NDMP was 60%, whereas DOC removals by PAC were lower than 15%. Acidic organics could be significantly removed with the use of NDMP. DOM with large MW in DBE could be removed significantly by using the same means. Removal efficiency of NDMP for DOM decreased with the decrease of MW. Compared with PAC, NDMP could significantly reduce the acute and chronic bio-toxicities of DBEs. NaCl/NaOH mixture regenerants, with selected concentrations of 10% NaCl (m/m)/1% NaOH (m/m), could improve desorption efficiency. Copyright © 2014. Published by Elsevier B.V.

  1. South African Journal of Philosophy - Vol 19, No 3 (2000)

    African Journals Online (AJOL)

    Politics, Friendship and Solitude in Nietzsche (Confronting Derrida's reading of Nietzsche in 'Politics of Friendship') · EMAIL FULL TEXT EMAIL FULL TEXT ... Die sin van pyn. (The meaning of pain) · EMAIL FULL TEXT EMAIL FULL TEXT · DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. Abraham Olivier, 235-254.

  2. Phytosterols from Dombeya torrida (J. F. Gmel.) S.N. NDWIGAH1 ...

    African Journals Online (AJOL)

    NDWIGA

    2006-08-03

    Aug 3, 2006 ... phytochemical investigation of Dombeya torrida. MATERIALS ... Normal phase thin layer chromatography (TLC) pre-coated plates with silica gel 60F254 were from Sigma-Aldrich Chemie (Steinheim,. Germany). Column chromatography was carried out on silica gel for column chromatography. (0.032-0.63 ...

  3. Sn interaction with the CeO.sub.2./sub.(111) system: bimetallic bonding and ceria reduction

    Czech Academy of Sciences Publication Activity Database

    Škoda, M.; Cabala, M.; Cháb, Vladimír; Prince, K. C.; Sedláček, L.; Skála, T.; Šutara, F.; Matolín, V.

    2008-01-01

    Roč. 254, č. 14 (2008), 4375-4379 ISSN 0169-4332 R&D Projects: GA MŠk(CZ) LC06058 Institutional research plan: CEZ:AV0Z10100521 Keywords : resonant photoemission * RPES * XPS * LEED * ceria * tin * reduction * bimetallic interaction * bimetallic bonding Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 1.576, year: 2008

  4. Using multilevel modeling in the analysis of experimental data: cumulative effects of structural priming in children

    Czech Academy of Sciences Publication Activity Database

    Smolík, Filip

    2010-01-01

    Roč. 52, č. 3 (2010), s. 229-242 ISSN 0039-3320 Institutional research plan: CEZ:AV0Z70250504 Keywords : sentence production * syntactic persistence * language production Subject RIV: AN - Psychology Impact factor: 0.254, year: 2010

  5. Association between Cigarette Smoking and Metabolic Syndrome in ...

    African Journals Online (AJOL)

    Purpose: To investigate the relationship between metabolic syndrome as defined by using the modified NCEP/ATP III criteria [modified the National Cholesterol Education Program (NCEP)/Adult Treatment Panel III (ATP III) criteria] and cigarette smoking in Thai subjects. Methods: This study was carried out among 254 ...

  6. 77 FR 13352 - Notice of Determinations Regarding Eligibility To Apply for Worker Adjustment Assistance

    Science.gov (United States)

    2012-03-06

    .... Services Group, Inc., Corporate/Finance/ Controllers. 81,213 American Express Travel Phoenix, AZ February.... Corporate Resources, Aerotek, Dysis and Tek. 81,254 BT North America, Network Atlanta, GA February 13, 2010... February 7, 2011. Services Group, Inc., Corporate/EIT/Consumer. The following certifications have been...

  7. Prevalent Diseases Identified in Semi-Industrial Poultry Farming in ...

    African Journals Online (AJOL)

    This study was conducted in 2003-2007 with the aim of identifying prevalent diseases in modern poultry farming in Mali. It covered 22 modern layer farms located in the suburban areas of Bamako District and of Sikasso and Segou towns. Analyses focused on a total of 536 samples, 260 sera, 254 eggs, 149 organ samples, ...

  8. Growing up with Frisian and Dutch: The role of language input in the early development of Frisian and Dutch among preschool children in Friesland

    NARCIS (Netherlands)

    Dijkstra, J.E.

    2013-01-01

    Bilingual acquisition largely depends on the input that children receive in each language. The more input in a language, the more proficient a child becomes in that language. The current project studied the role of language input among bilingual Frisian-Dutch preschool children (age 2.5-4 years) in

  9. Mexican American Female Adolescent Self-Esteem: The Effect of Body Image, Exercise Behavior, and Body Fatness.

    Science.gov (United States)

    Guinn, Bobby; Semper, Tom; Jorgensen, Layne

    1997-01-01

    A study of 254 Mexican American eighth-grade girls in south Texas found that girls' self-esteem was positively related to body image and exercise involvement and negatively related to body fatness. This population displayed somewhat distorted body image, which was the strongest predictor of self-esteem. Contains 43 references. (SV)

  10. Treatment Approach, Autism Severity and Intervention Outcomes in Young Children

    Science.gov (United States)

    Zachor, Ditza A.; Itzchak, Esther Ben

    2010-01-01

    The current study examined the relation between autism severity at baseline, type of intervention employed and outcomes in young children with autism spectrum disorder (ASD). Seventy-eight children with ASD, aged 15-35 months (M=25.4, SD=4.2), received either applied behavioral analysis (ABA) or integration of several intervention approaches…

  11. Photoluminescence properties of Er-doped Ge–In(Ga)–S glasses modified by caesium halides

    Czech Academy of Sciences Publication Activity Database

    Ivanova, Z.G.; Zavadil, Jiří; Kostka, P.; Djouama, T.; Reinfelde, M.

    2017-01-01

    Roč. 254, č. 6 (2017), č. článku 1600662. ISSN 0370-1972 Institutional support: RVO:67985882 Keywords : caesium halides * chalcohalide glass es * erbium doping * transmission spectroscopy * photoluminiscence Subject RIV: JH - Ceramics, Fire-Resistant Materials and Glass OBOR OECD: Ceramics Impact factor: 1.674, year: 2016

  12. Impact-pressure controlled orientation of shatter cone magnetizations in Sierra Madera, Texas, USA

    Czech Academy of Sciences Publication Activity Database

    Adachi, T.; Kletetschka, Günther

    2008-01-01

    Roč. 52, č. 2 (2008), s. 237-254 ISSN 0039-3169 Institutional research plan: CEZ:AV0Z30130516 Keywords : shatter cones * impact crater * shock fractures * magnetism * Mars Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 0.770, year: 2008

  13. Eye Complications and Markers of Morbidity and Mortality in Long-term Type 1 Diabetes

    DEFF Research Database (Denmark)

    Grauslund, Jakob

    2011-01-01

    of either micro- or macrovascular disease in type 1 diabetes. As demonstrated in Paper VII, even though association between higher levels of OPG and nephropathy were found in an age- and sex-adjusted model (OR 2.54, 95% CI 1.09-5.90), this was no longer statistically significant when other factors were...

  14. Use of Carbon Nano-Fiber Foams as Strain Gauges to Detect Crack Propagation

    Science.gov (United States)

    2015-06-01

    capacitors [18]. Another example are recent attempts to use carbon fibers and carbon nanotubes to develop sensor devices. Sida Luo created aligned...ring caps made out of Ethlyene-Propylene • Super Glue (Cyanoacrylate, C5H5NO2) • One sheet of aluminum foil • AL5083 specimen (27.94 mm Length, 2.54

  15. Shyness and Vocabulary: The Roles of Executive Functioning and Home Environmental Stimulation

    Science.gov (United States)

    Blankson, A. Nayena; O'Brien, Marion; Leerkes, Esther M.; Marcovitch, Stuart; Calkins, Susan D.

    2011-01-01

    Although shyness has often been found to be negatively related to vocabulary, few studies have examined the processes that produce or modify this relation. The present study examined executive functioning skills and home environmental stimulation as potential mediating and moderating mechanisms. A sample of 3 1/2-year-old children (N = 254) was…

  16. Pan African Medical Journal: Contact

    African Journals Online (AJOL)

    Principal Contact. Dr Raoul Kamadjeu Editor-in-Chief The Pan African Medical Journal Phone: +254 714 606 223. Email: raoul.kamadjeu@gmail.com. Support Contact. Editor Email: editor@panafrican-med-journal.com. ISSN: 1937-8688. AJOL African Journals Online. HOW TO USE AJOL... for Researchers · for Librarians ...

  17. Aaserud Finn (9) 881 (FF)

    Indian Academy of Sciences (India)

    INDEX. AUTHOR INDEX. Aaserud Finn (9) 881 (FF). Ahuja Kamal (10) 956 (PR). Ajith P (10) 922 (GA). Ananthasuresh G K (4) 356 (BR). Anoop P D (1) 29 (GA). Antony Amrita (4) 392 (FF). Arun K G (10) 922 (GA). Balakrishnan V (2) 129, (3) 254 (GA);. (9) 886 (BR). Bhat Rajarama (2) 104 (AIB). Bhattacharya Aniket (8) 742 ...

  18. UV penetration depth in liquid egg white and liquid whole egg

    Science.gov (United States)

    Knowledge of penetration depth of UV in liquid egg is crucial in designing nonthermal UV pasteurizers. An experimental method was developed to determine penetration depth of 254 nm UV in liquid whole egg (LWE) and liquid egg white (LEW). An apparatus was assembled consisting of a bank of UV bulbs at...

  19. Disorder-induced broadening of transverse acoustic phonons in SixGe1-x mixed crystals

    Czech Academy of Sciences Publication Activity Database

    Beraud, A.; Kulda, Jiří; Yonenaga, I.; Foret, M.; Salce, B.; Courtens, E.

    2004-01-01

    Roč. 350, č. 1 (2004), s. 254-257 ISSN 0921-4526 R&D Projects: GA AV ČR KSK1010104 Keywords : disordered crystals * acoustic branches Subject RIV: BG - Nuclear, Atomic and Molecular Physics, Colliders Impact factor: 0.679, year: 2004

  20. Nigerian Journal of Physics - Vol 18, No 2 (2006)

    African Journals Online (AJOL)

    Bouguer correction density determination from fractal analysis using data from part of the Nigerian Basement Complex · EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. K M Lawal, C Z Akaolisa, 251-254. http://dx.doi.org/10.4314/njphy.v18i2.38111 ...

  1. Binary Disassembly Block Coverage by Symbolic Execution vs. Recursive Descent

    Science.gov (United States)

    2012-03-01

    Polytechnique Federale de Lausanne, Switzerland, 2010. [CCKK12] Vitaly Chipounov, George Candea, Andreas Kirchner , and Volodymyr Kuznetsov. S2E Source Code...Foundation, 2008. http://www.python.org/getit/releases/2.5.4/. [CSXK08] Anthony Cozzie, Frank Stratton, Hui Xue, and Samuel T. King. Digging for data

  2. 1-Methylimidazolium trifluoroacetate [Hmim]Tfa: Mild and efficient ...

    Indian Academy of Sciences (India)

    ing points were measured in open capillaries and are uncorrected. TLC was performed on Silica Gel 60 F254 pre-coated plates (Merck). IR spectra were recorded on a FT IR Perkin Elmer Spectrum 100 spectrometer, mass spectra on a Shimadzu LCMS 2010 spectrometer, and elemental analysis on Perkin Elmer PE 2400 ...

  3. Prevalence and Risk Factors for Brucellosis in Jazan Province ...

    African Journals Online (AJOL)

    Sciences, Jazan University, Jazan, Saudi Arabia, 5Department of Microbiology, Faculty of Medicine, Jazan University, Jazan,. Saudi Arabia .... Nationality. Saudi. 317. 90.6. Non-Saudi. 33. 9.4. Residence. Rural. 89. 25.4. Urban. 261. 74.6. Occupation. Working. 132. 37.7. Not working. 67. 19.1. Student. 104. 29.7. Not stated.

  4. Personal and Psychological Factors as Determinants of Attitude ...

    African Journals Online (AJOL)

    This study investigated the predictability of educational qualifications, age, achievement, motivation, career salience and problem solving ability on attitudes toward multiple-role planning (ATMRP) among employed women in Southwestern Nigeria. The participants were 254 employed women randomly selected from five ...

  5. Using small punch testing method for the analysis of creep behaviour of Al-Al4C3 composites

    Czech Academy of Sciences Publication Activity Database

    Besterci, M.; Dobeš, Ferdinand; Kulu, P.; Sülleiová, K.

    2010-01-01

    Roč. 16, č. 3 (2010), s. 243-254 ISSN 1736-6038 Grant - others:Science Grant Agency of Slovakia(SK) VEGA 2/0105/08 Institutional research plan: CEZ:AV0Z20410507 Keywords : dispersion-strengthened Al-Al4C3 composite * mechanical alloying * creep * small punch Subject RIV: JI - Composite Materials

  6. Assessment of drug usage and antimicrobial residues in milk on ...

    African Journals Online (AJOL)

    Milk samples were also collected for evaluation of antimicrobial drug residues using three tests; the Delvotest® SP, agar well diffusion and agar plate disc assays. On the day of farm visit, 25.4% of study farms had various drugs used to treat animals, categorised as antimicrobials (54.2%), anthelmintics (25.0%), ...

  7. Resonance – Journal of Science Education | Indian Academy of ...

    Indian Academy of Sciences (India)

    Home; Journals; Resonance – Journal of Science Education; Volume 17; Issue 3. General Relativity and the Accelerated Expansion of the Universe. Patrick Das Gupta. General Article Volume 17 Issue 3 March 2012 pp 254-273. Fulltext. Click here to view fulltext PDF. Permanent link:

  8. Rapid Chromatographic Analysis of Enzymes and Other Proteins (Rychla Chromatograficka Analyza Enzymu a Jinych Bilkovin),

    Science.gov (United States)

    1983-11-01

    German 15. Special issue of the Journal "Ernshrung, Nutrition , ,$io.2, 1981 63. v tisku - awaiting publication -20.. Sph-o,, . Ss’Own Ima. Lachrna...End spare components for the aminoacid annlyser, tandem system of two through- flow analysers (A2 8 5 , A254) and fraction collector coupled with

  9. 75 FR 45113 - Notice of Public Information Collection(s) Being Submitted for Review and Approval to the Office...

    Science.gov (United States)

    2010-08-02

    ... collection is contained in 47 U.S.C. sections 254 and Pub. L. No. 107-110, Leave No Child Behind Act of 2002... employees. The FCC may not conduct or sponsor a collection of information unless it displays a currently...

  10. 75 FR 28806 - Notice of Public Information Collection(s) Being Reviewed by the Federal Communications...

    Science.gov (United States)

    2010-05-24

    ... collection is contained in 47 U.S.C. section 254 and Pub. L. No. 107-110, Leave No Child Behind Act of 2002... information collection burden on small business concerns with fewer than 25 employees. ] The FCC may not...

  11. Different cortical areas in man in organization of voluntary movements in extrapersonal space

    DEFF Research Database (Denmark)

    Roland, P E; Skinhøj, E; Lassen, N A

    1980-01-01

    1. This paper reports regional cerebral blood flow (rCBF) measurements in 254 cortical regions with 133Xe injected into the internal carotid artery in 19 patients, none of whom had any major neurological defect. The purpose was to demonstrate the pattern of cortical activity, as revealed by rCBF ...

  12. Characterization of spirochetal isolates from arthropods collected in South Moravia, Czech Republic, using fatty acid methyl esters analysis

    Czech Academy of Sciences Publication Activity Database

    Čechová, L.; Durnová, E.; Šikutová, Silvie; Halouzka, Jiří; Němec, M.

    2004-01-01

    Roč. 808, č. 2 (2004), s. 249-254 ISSN 1570-0232 R&D Projects: GA ČR GA206/03/0726 Institutional research plan: CEZ:AV0Z6093917 Keywords : spirochetes * arthropods * fatty acid methyl esters Subject RIV: EE - Microbiology, Virology Impact factor: 2.176, year: 2004

  13. Paths to subreplacement fertility : the empirical evidence / Tomas Frejka, John Ross

    Index Scriptorium Estoniae

    Frejka, Tomas

    2001-01-01

    Autorid väidavad, et paljudes riikides jääb sündimus ka edaspidi väga madalaks. Vaadeldakse 54 riigis abielude sõlmimist, rasestumisvastaste vahendite kasutamist ja abortide arvu. Diagrammid ja tabelid. Lisa lk. 213-254

  14. Projekt evaluace primárně-preventivního komunitního programu

    Czech Academy of Sciences Publication Activity Database

    Miovský, Michal; Miovská, L.; Trapková, B.

    2004-01-01

    Roč. 4, č. 3 (2004), s. 236-254 ISSN 1213-3841 R&D Projects: GA ČR GP406/04/P250 Institutional research plan: CEZ:AV0Z7025918 Keywords : process evaluation * outcome evaluation * primary prevention Subject RIV: AN - Psychology

  15. Bis(imino)pyridine (BIMP) Fe(II) catalyses one-pot green ...

    Indian Academy of Sciences (India)

    silica gel and analytical thin layer chromatography was performed on pre-coated silica gel plates (60F-. 254). Sonication was performed in a Shanghai Branson-. CQX ultrasonic cleaner with a frequency of 40kHz and a nominal power of 100W. The reaction vessel placed inside the ultrasonic bath. Elemental analyses.

  16. SUPPLEMENTARY INFORMATION

    Indian Academy of Sciences (India)

    Saket

    monitoring was accomplished by thin-layer chromatography (TLC) on Merck silica gel 60 F254 plates. Silica gel 60-120 mess was used for column chromatography. Melting points of all the compounds were recorded on Thermomik Campbell melting point apparatus having an oil bath system and are uncorrected. The FT-IR ...

  17. 1109.doc

    Indian Academy of Sciences (India)

    Aluminium sheets 20 x 20cm, Silica gel 60 F254 , Merck grade was used for thin layer chromatography to determine progress of reaction. The column chromatography was carried out over silica gel (80–120 mesh). Optical rotations were measured on a Polax-2L digital polarimeter at 27 C. Melting points were determined ...

  18. pyrroles

    Indian Academy of Sciences (India)

    and TMS as internal standard. Elemental analysis (C,. H, N%) was carried out by Perkin-Elmer 2400 series-. II elemental analyzer. Flash column chromatography was performed with 300 and 400 meshes silica gel and analytical thin-layer chromatography (TLC) was performed on pre-coated silica gel plates (60F-254). 893 ...

  19. Reconstruction of Effective Cloud Field Geometry from Series of Sunshine Number

    Czech Academy of Sciences Publication Activity Database

    Badescu, V.; Paulescu, M.; Brabec, Marek

    176-177, 1 July - 1 August (2016), s. 254-266 ISSN 0169-8095 Institutional support: RVO:67985807 Keywords : cloud field geometry * sunshine number * point cloud iness Subject RIV: BB - Applied Statistics, Operational Research Impact factor: 3.778, year: 2016

  20. Flower palate structure of the aquatic bladderworts Utricularia bremii Heer and U. minor L. from section Utricularia (Lentibulariaceae)

    Czech Academy of Sciences Publication Activity Database

    Płachno, B.J.; Stpiczyńska, M.; Krajewski, Ł.; Świątek, P.; Adamec, Lubomír; Miranda, V.F.O.

    2017-01-01

    Roč. 254, č. 5 (2017), s. 2007-2015 ISSN 0033-183X Institutional support: RVO:67985939 Keywords : aquatic bladderworts * pollination * ultrastructure Subject RIV: EF - Botanics OBOR OECD: Plant sciences, botany Impact factor: 2.870, year: 2016

  1. The structure of the desiccated Richtersius coronifer (Richters, 1903)

    Czech Academy of Sciences Publication Activity Database

    Czerneková, Michaela; Jönsson, K. I.; Chajec, Ł.; Student, S.; Poprawa, I.

    2017-01-01

    Roč. 254, č. 3 (2017), s. 1367-1377 ISSN 0033-183X Institutional support: RVO:67985823 Keywords : anhydrobiosis * cryptobiosis * tardigrades * tun * ultrastructure Subject RIV: ED - Physiology OBOR OECD: Cell biology Impact factor: 2.870, year: 2016

  2. Design of polymer networks by variation of precursor structure and crosslinking regime

    Czech Academy of Sciences Publication Activity Database

    Dušek, Karel; Dušková, Miroslava; Huybrecht, J.

    2003-01-01

    Roč. 44, č. 1 (2003), s. 62-63 ISSN 0032-3934. [ACS National Meeting "Crosslinking Materials and Processes"/254./. New Orleans, 23.03.2003-27.03.2003] R&D Projects: GA AV ČR KSK4050111 Keywords : polymer networks * designed precursor * crosslinking Subject RIV: CD - Macromolecular Chemistry

  3. Method for removal of mercury from various gas streams

    Science.gov (United States)

    Granite, E.J.; Pennline, H.W.

    2003-06-10

    The invention provides for a method for removing elemental mercury from a fluid, the method comprising irradiating the mercury with light having a wavelength of approximately 254 nm. The method is implemented in situ at various fuel combustion locations such as power plants and municipal incinerators.

  4. Ultraviolet-visible absorptive features of water extractable and humic fractions of animal manure and compost

    Science.gov (United States)

    UV-vis spectroscopy is a useful tool for characterizing water extractable or humic fractions of natural organic matter (WEOM). Whereas the whole UV-visible spectra of these fractions are more or less featureless, the specific UV absorptivity at 254 and 280 nm as well as spectral E2/E3 and E4/E6 rat...

  5. Pleiotropic phenotypes of the salt-tolerant and cytosine ...

    Indian Academy of Sciences (India)

    Planta 227, 245–254. St-Pierre B. and De Luca V. 1995 A Cytochrome P-450 monooxy- genase catalyzes the first step in the conversion of taber- sonine to vindoline in Catharanthus roseus. Plant Physiol. 109,. 131–139. St-Pierre B., Vazquez-Flota F. A. and De Luca V. 1999 Multicellu- lar compartmentation of Catharanthus ...

  6. Separation and identification of carp pituitary proteins and glycoproteins

    Czech Academy of Sciences Publication Activity Database

    Ryšlavá, H.; Janatová, M.; Čalounová, G.; Selicharová, Irena; Barthová, J.; Barth, Tomislav

    2005-01-01

    Roč. 50, č. 9 (2005), 430-437 ISSN 1212-1819 R&D Projects: GA MZe(CZ) QF3028 Institutional research plan: CEZ:AV0Z4055905 Keywords : carp hormones * glycoproteins * oligosaccharide chains Subject RIV: CE - Biochemistry Impact factor: 0.254, year: 2005

  7. Discrepancies between Parents' and Children's Attitudes toward TV Advertising

    Science.gov (United States)

    Baiocco, Roberto; D'Alessio, Maria; Laghi, Fiorenzo

    2009-01-01

    The authors conducted a study with 500 parent-child dyads. The sample comprised 254 boys and 246 girls. The children were grouped into 5 age groups (1 group for each age from 7 to 11 years), with each group comprising 100 children. The survey regards discrepancies between children and their parents on attitudes toward TV advertising to determine…

  8. Journal of Astrophysics and Astronomy | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    2016-01-27

    Jan 27, 2016 ... Home; Journals; Journal of Astrophysics and Astronomy; Volume 36; Issue 1. Issue front cover thumbnail. Volume 36, Issue 1. March 2015, pages a-254. Dynamical Plasma Processes in the Sun and Sun-like Stars. pp a-b. General Editorial on Publication Ethics · More Details Fulltext PDF. pp 1-3. Editorial.

  9. African Health Sciences - Vol 5, No 3 (2005)

    African Journals Online (AJOL)

    Crossing the digital divide: the contribution of information technology to the professional performance of malaria researchers in Africa · EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. I van Schayk, M Bennett, N Kamau, M Alilio, M Alilio, 246-254 ...

  10. Respiratory arrest in subarachnoid hemorrhage

    NARCIS (Netherlands)

    Hijdra, A.; Vermeulen, M.; van Gijn, J.; van Crevel, H.

    1984-01-01

    Sudden loss of consciousness and cardiorespiratory disorders occurred in 43 of 254 patients with subarachnoid hemorrhage. Two patients had ventricular fibrillation, 37 had one or more episodes with a disturbance of respiratory rhythm that required assisted ventilation, and 4 died suddenly without

  11. Treatability of South African surface waters by enhanced coagulation

    African Journals Online (AJOL)

    2013-06-05

    Jun 5, 2013 ... standard, many South African water treatment managers may need to consider adoption of enhanced coagulation (EC) in the near future to achieve both turbidity and NOM removal. From the study of 4 South African inland waters, this paper demonstrates that UV254 absorbance provides a more accessible ...

  12. Collision strengths for transitions in Ni XIX

    Indian Academy of Sciences (India)

    . 254, 436 (1992). [25] V M Burke, P G Burke and N S Scott, Comput. Phys. Commun. 69, 76 (1992). [26] S S Tayal, P G Burke and A E Kingston, J. Phys. B17, 3847 (1984). [27] S S Tayal, P G Burke and A E Kingston, J. Phys. B18, 4321 (1985).

  13. Ontwikkelingsplannen

    NARCIS (Netherlands)

    J. Tinbergen (Jan)

    1967-01-01

    textabstractSeries ‘Wereldakademie’ No. 18. In English: Development Planning, Series World University Library No. 18, Weidenfeld and Nicolson, London, 1967, 256 p. In Spanish: Planificacion del Desarrollo, Series ‘Biblioteca para el Hombre Actual’, Ediciones Guadarrama, Madrid, 1967, 254 p. In

  14. Coping a rezistencia voči mobbingu v kontexte paradigmatického prístupu

    Czech Academy of Sciences Publication Activity Database

    Vitková, M.; Zábrodská, Kateřina

    2014-01-01

    Roč. 58, č. 3 (2014), s. 254-269 ISSN 0009-062X R&D Projects: GA ČR GA14-02098S Institutional support: RVO:68081740 Keywords : coping * rezistencia * mobbing Subject RIV: AN - Psychology Impact factor: 0.239, year: 2014

  15. Biochemical and quality parameters changes of green sweet bell ...

    African Journals Online (AJOL)

    In this research, the effects of different postharvest treatments on quality and biochemical properties of “Maxibell F1” California Wonder type peppers at green mature stage were determined. In this content, ultraviolet C (UV-C) at 254 nm treatments for 2.5, 5, 10 min and hot water dipping (HWD) treatments for 2 min at 40, 50, ...

  16. 245 Zoopharmacognosy

    Indian Academy of Sciences (India)

    Sulochana Gadgil. GENERAL ARTICLES. 236 Wallace and Natural Selection, 1858. Sahotra Sarkar. 245 Zoopharmacognosy. Self-Medication in Wild Animals. Rajasekar Raman and Sripathi Kandula. FEATURE ARTICLE. 254 Molecule Matters. The Quinine Story: A 100-Year Saga. Vijay Nair and Sreekumar Vellalath. 245.

  17. Corrigendum to “Geometric Arveson–Douglas conjecture” [Adv. Math. 274 (2015) 606–630

    Czech Academy of Sciences Publication Activity Database

    Engliš, Miroslav; Eschmeier, J.

    2015-01-01

    Roč. 278, June (2015), s. 254 ISSN 0001-8708 Institutional support: RVO:67985840 Keywords : Arveson-Douglas conjecture * generalized Toeplitz operator Subject RIV: BA - General Math ematics Impact factor: 1.405, year: 2015 http://www.sciencedirect.com/science/article/pii/S000187081500119X

  18. Regularity criteria for the 3D magneto-micropolar fluid equations via ...

    Indian Academy of Sciences (India)

    microploar fluid equations, Internet. J. Eng. Sci. 15 (1997) 105–108. [6] He C and Xin Z P, On the regularity of weak solutions to the magnetohydrodynamic equations, J. Diff. Equat. 23 (2005) 235–254. [7] Luo Y W, Regularity of weak solutions to the magneto-hydrodynamics equations in terms of the direction of the velocity, ...

  19. The efficacy of sulfadoxine-pyrimethamine alone and in combination with chloroquine for malaria treatment in rural Eastern Sudan: the interrelation between resistance, age and gametocytogenesis

    DEFF Research Database (Denmark)

    A-Elbasit, Ishraga E; Elbashir, Mustafa I; Khalil, Insaf F

    2006-01-01

    OBJECTIVE: To compare the efficacy of sulfadoxine-pyremethamine (SP)+chloroquine (CQ) combination treatment against falciparum malaria with SP treatment alone. METHOD: In-vivo study of 254 patients with uncomplicated Plasmodium falciparum malaria in rural eastern Sudan, where the population is semi...

  20. Testing hadronic interaction models using a highly granular silicon-tungsten calorimeter

    Czech Academy of Sciences Publication Activity Database

    Bilki, B.; Repond, J.; Schlereth, J.; Cvach, Jaroslav; Gallus, Petr; Havránek, Miroslav; Janata, Milan; Kvasnička, Jiří; Lednický, Richard; Marčišovský, Michal; Polák, Ivo; Popule, Jiří; Tomášek, Lukáš; Tomášek, Michal; Růžička, Pavel; Šícho, Petr; Smolík, Jan; Vrba, Václav; Zálešák, Jaroslav

    2015-01-01

    Roč. 794, Sep (2015), s. 240-254 ISSN 0168-9002 R&D Projects: GA MŠk LG14033 Institutional support: RVO:68378271 Keywords : electromagnetic silicon tungsten calorimeter * highly granular detectors * hadronic showers * data and simulations Subject RIV: BF - Elementary Particles and High Energy Physics Impact factor: 1.200, year: 2015

  1. AUTHOR INDEX

    Indian Academy of Sciences (India)

    Sahni Varun (5) 409 (GA); 463 (PR). Samuelson A G (12) 1152 (FA); 1284 (RN). Saxena Anupam (3) 220 (GA). Sebastian K L (12) 1132 (GA). Sharma Nimmi (1) 38 (GA). Shinde Rajendra (8) 722 (GA). Shirali Shailesh A (5) 437 (GA). Shukla A K (12) 1294 (GA). Simon R (2) 129, (3) 254 (GA). Singh S R (2) 188 (CR).

  2. Musica, identita e mitografie nazionali dei cechi nel dicianovesimo secolo

    Czech Academy of Sciences Publication Activity Database

    Slavický, Tomáš

    2016-01-01

    Roč. 12, č. 1 (2016), s. 45-56. ISBN 978-961-254-915-2. ISSN 1854-3405 Institutional support: RVO:68378076 Keywords : Czech national music * Czech historical myths * Panslavism * Austroslavism Subject RIV: AL - Art, Architecture, Cultural Heritage; AL - Art, Architecture, Cultural Heritage (UEF-S)

  3. Real-time H_2 and H_infty control of a gyroscope using a polynomial approach

    Czech Academy of Sciences Publication Activity Database

    Orozco, J. L. M.; Ruiz-Leon, J.; Henrion, Didier; Šebek, M.

    2005-01-01

    Roč. 35, č. 3 (2005), s. 247-254 R&D Projects: GA ČR GA102/02/0709 Institutional research plan: CEZ:AV0Z10750506 Keywords : control system design * optimization H_2 * polynomial H_infty Subject RIV: BC - Control Systems Theory

  4. A screening method for banana weevil (Cosmopolites sordidus ...

    African Journals Online (AJOL)

    EJIRO

    2010-07-26

    Jul 26, 2010 ... Diferencias sexuales en la morfologia externa de. Cosmopolites sordidus Germar (Coleoptera: Curculionidae). Ciencias. Biol. l, La Habana 1: 1-11. Mesquita ALM, Alvers EJ, Caldas RC (1984). Resistance of banana cultivars to Cosmopolites sordidus (Germar). Fruits, 39(4): 254-257. Mitchell G (1978).

  5. Polyp prevalence at colonoscopy among Nigerians: A prospective ...

    African Journals Online (AJOL)

    2014-05-20

    May 20, 2014 ... result of lower gastrointestinal bleeding, 14 (20.9%) for colorectal cancer (CRC) and 13 (19.4%) for routine screening. Thirty-nine (58.2%) patients had the polyps at the rectosigmoid region of the colon, 17 (25.4%) had the polyps located proximal to .... (rectum and sigmoid colon) and proximal colon (from.

  6. Hollow-Core Fiber Lamp

    Science.gov (United States)

    Yi, Lin (Inventor); Tjoelker, Robert L. (Inventor); Burt, Eric A. (Inventor); Huang, Shouhua (Inventor)

    2016-01-01

    Hollow-core capillary discharge lamps on the millimeter or sub-millimeter scale are provided. The hollow-core capillary discharge lamps achieve an increased light intensity ratio between 194 millimeters (useful) and 254 millimeters (useless) light than conventional lamps. The capillary discharge lamps may include a cone to increase light output. Hollow-core photonic crystal fiber (HCPCF) may also be used.

  7. Case, Teacher and School Characteristics Influencing Teachers' Detection and Reporting of Child Physical Abuse and Neglect: Results from an Australian Survey

    Science.gov (United States)

    Walsh, Kerryann; Bridgstock, Ruth; Farrell, Ann; Rassafiani, Mehdi; Schweitzer, Robert

    2008-01-01

    Objective: To identify the influence of multiple case, teacher and school characteristics on Australian primary school teachers' propensity to detect and report child physical abuse and neglect using vignettes as short hypothetical cases. Methods: A sample of 254 teachers completed a self-report questionnaire. They responded to a series of 32…

  8. 2016-2017 Travel Expense Report for Stephen McGurk, Vice ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Beata Bialic

    . Destination(s):. Saskatchewan. Airfare: $933.24. Other. Transportation: $89.13. Accommodation: $546.67. Meals and. Incidentals: $254.65. Other: $0.00. Total: $1,823.69. Comments: 2016-2017 Travel Expense Report for Stephen. McGurk ...

  9. Skills Needed by Secondary School Graduates for Breeding and Rearing of Giant African Land Snail (GALS) in Ebonyi State

    Science.gov (United States)

    Ogba, Ernest Ituma; Ndem, Joseph Uka

    2016-01-01

    The purpose of the study is to identify the skills required by secondary school Graduates for breeding and rearing Giant African Land Snail (GALS) in Ebonyi State. Three research questions guided the study. The design was descriptive survey. The total population was 254 agricultural science Teachers in junior and senior secondary schools in Ebonyi…

  10. Thin layer chromatographic analyses of pesticides in a soil ecosystem

    International Nuclear Information System (INIS)

    Afful, S.; Dogbe, S.A.; Ahmad, K.; Ewusie, A.T.

    2008-01-01

    Silica gel 60, silica gel 60 F 254 , and aluminium oxide as adsorbents were used to investigate their suitability for the analysis and detection of the pesticides: nitrofen, atrazine, diuron, dioxacarb, propoxur, propanil, carbaryl and cypermethrin in soil ecosystem using ethyl acetate, chloroform, dichloromethane and ethyl acetate/chloroform (1:1) as developing solvents. O-tolidine and potassium iodide reagent were used for the detection of pesticides. R f values obtained for the pesticides using the silica gel 60-ethyl acetate. silica gel 60F 254 -ethyl acetate, silica gel 60 chloroform, silica gel 60 F 254 - chloroform, silica gel 60 - (1:1) ethyl acetate/chloroform and silica gel 60 F 254 - (1:1) ethyl acetate/chloroform systems generally were within the stipulated range of 0.4-0.8. R f values obtained for the pesticides using silica gel 60-dichloromethane systems were very low except for cypermethrin and nitrofen. Analysis with aluminium oxide coated plates gave a heavy yellow background with the detection reagent making visualization of spots difficult. Aluminium oxide coated plate is, therefore, not recommended when o-tolidine plus potassium iodide is used as detection reagent. (au)

  11. General Relativity and the Accelerated Expansion of the Universe

    Indian Academy of Sciences (India)

    Home; Journals; Resonance – Journal of Science Education; Volume 17; Issue 3. General Relativity and the Accelerated Expansion of the Universe. Patrick Das Gupta. General Article Volume 17 Issue 3 March 2012 pp 254-273. Fulltext. Click here to view fulltext PDF. Permanent link:

  12. Rickettsia bellii in ticks Amblyomma varium Koch, 1844, from birds in Peru

    Czech Academy of Sciences Publication Activity Database

    Ogrzewalska, M.; Literák, I.; Cárdenas-Callirgos, J. M.; Čapek, Miroslav; Labruna, M. B.

    2012-01-01

    Roč. 3, č. 4 (2012), s. 254-256 ISSN 1877-959X R&D Projects: GA AV ČR IAA601690901; GA MŠk LC06073 Institutional support: RVO:68081766 Keywords : Rickettsia bellii * ticks * Amblyomma calcaratum * birds * Peru Subject RIV: EG - Zoology Impact factor: 2.353, year: 2012

  13. Oxidation of very-long-chain fatty acids in rat brain: cerotic acid is beta-oxidized exclusively in rat brain peroxisomes

    NARCIS (Netherlands)

    Lageweg, W.; Sykes, J. E.; Lopes-Cardozo, M.; Wanders, R. J.

    1991-01-01

    We studied the effect of sodium 2-[5-(4-chlorophenyl)pentyl]oxirane-2-carboxylate (POCA), a potent inhibitor of mitochondrial carnitine palmitoyltransferase I, on fatty acid oxidation by rat brain cells. In cultured glial cells as well as in dissociated brain cells from adult rats palmitic acid

  14. Texas, 2008 forest inventory and analysis factsheet

    Science.gov (United States)

    James Bentley

    2011-01-01

    This science update summarizes the findings of the first statewide annual inventory conducted by the Southern Forest Inventory and Analysis (FIA) Program in cooperation with the Texas Forest Service of the forest resource attributes in Texas. The 254 counties of Texas are consolidated into seven FIA survey units—southeast (unit 1), the northeast (unit 2), the north...

  15. East Texas, 2012—Forest Inventory and Analysis Factsheet

    Science.gov (United States)

    Thomas J. Brandeis; Jason A. Cooper; James W. Bentley

    2014-01-01

    This science update summarizes the findings of the statewide annual inventory of the forest resource attributes in Texas conducted by the Southern Forest Inventory and Analysis (FIA) Program in cooperation with the Texas A&M Forest Service. The 254 counties of Texas are consolidated into seven FIA survey units—southeast (unit 1), northeast (unit 2), north central (...

  16. Texas, 2010 forest inventory and analysis factsheet

    Science.gov (United States)

    James W. Bentley

    2012-01-01

    This science update summarizes the findings of the statewide annual inventory conducted by the Southern Forest Inventory and Analysis (FIA) Program in cooperation with the Texas Forest Service of the forest resource attributes in Texas. The 254 counties of Texas are consolidated into seven FIA survey units – southeast (unit 1), northeast (unit 2), north central (unit 3...

  17. Forests of east Texas, 2016

    Science.gov (United States)

    Kerry Dooley

    2018-01-01

    This resource update provides an overview of forest resources in east Texas based on an inventory conducted by the U.S. Forest Service, Forest Inventory and Analysis (FIA) program at the Southern Research Station (SRS) in cooperation with Texas A&M Forest Service. The 254 counties of Texas are consolidated into seven FIA survey units—Southeast (unit 1),...

  18. East Texas, 2011 forest inventory and analysis factsheet

    Science.gov (United States)

    Jason A. Cooper; James W. Bentley

    2012-01-01

    This science update summarizes the findings of the annual inventory conducted by the Southern Forest Inventory and Analysis (FIA) Program in cooperation with the Texas Forest Service of the forest resource attributes in east Texas. The 254 counties of Texas are consolidated into 7 FIA survey units—southeast (unit 1), northeast (unit 2), north central (unit 3), south (...

  19. Large-basis no-core shell model

    Czech Academy of Sciences Publication Activity Database

    Barrett, BR.; Navrátil, Petr; Vary, J. P.

    2002-01-01

    Roč. 704, č. 17 (2002), s. 254C-263C ISSN 0375-9474 Institutional research plan: CEZ:AV0Z1048901 Keywords : monte-carlo calculations * light-nuclei * cross-sections * ground-state * C12 * systems Subject RIV: BE - Theoretical Physics Impact factor: 1.568, year: 2002

  20. Special Issue: International Congress of Cell Biology 2016, Prague

    Czech Academy of Sciences Publication Activity Database

    Stick, R.; Dráber, Pavel

    2017-01-01

    Roč. 254, č. 3 (2017), s. 1141-1142 ISSN 0033-183X R&D Projects: GA ČR GA16-25159S Institutional support: RVO:68378050 Keywords : cell ular structures and functions, ,, , * tubulin isotypes * actin * transcription regulation * signaling pathways Subject RIV: EB - Genetics ; Molecular Biology OBOR OECD: Cell biology Impact factor: 2.870, year: 2016

  1. A successful workplace program for voluntary counseling and testing and treatment of HIV/AIDS at Heineken, Rwanda

    NARCIS (Netherlands)

    Collier, Alizanne C.; van der Borght, Stefaan F. M.; Rinke de Wit, Tobias; Richards, Sarah C.; Feeley, Frank G.

    2007-01-01

    Heineken Breweries launched a workplace HIV/AIDS program at its Rwanda subsidiary in September 2001. By January 25, 2005, 736/2,595 eligible individuals had reported for counseling and HIV testing: 380/521 employees (72.9%), 254/412 spouses (61.7%), 99/1,517 children (6.5%), and 3/145 retired

  2. Inactivation of avirulent Yersinia pestis on food and food contact surfaces by ultraviolet light and freezing

    Science.gov (United States)

    Yersinia pestis, the causative agent of plague, can occasionally be contracted as a naso-pharangeal or gastrointestinal illness through consumption of contaminated meat. In this study, the use of 254 nm ultraviolet light (UV-C) to inactivate a multi-isolate cocktail of avirulent Y. pestis on food an...

  3. Focal cerebral ischemia measured by the intra-arterial 133xenon method. Limitations of 2-dimensional blood flow measurements

    DEFF Research Database (Denmark)

    Skyhøj Olsen, T; Larsen, B; Bech Skriver, E

    1981-01-01

    The limitations of 2-dimensional isotope techniques in the study of focal cerebral ischemia were investigated using the intra-carotid 133 xenon injection method and a 254 multidetector scintillation camera. To make sure that the detectors "look" directly on infarcted areas, only patients with inf...

  4. A novel synthesis of chromone based unnatural -amino acid ...

    Indian Academy of Sciences (India)

    VENU KANDULA

    All melting points were taken in open capillaries and are uncorrected. Analytical thin-layer chromatography (TLC) was performed on commercially available Merck TLC Silica gel 60 F254. .... was quenched with ice and extracted with EtOAc (3×100. mL). .... ous layer gave the compound 12 (off-white solid) as HCl salt.

  5. Burnout and health of primary school educators in the North West ...

    African Journals Online (AJOL)

    Burnout and health of primary school educators in the North West Province. Amanda Montgomery, Karina Mostert, Leon Jackson. Abstract. No Abstract. South African journal of Education Vol. 25(4) 2005: 266-272. Full Text: EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT · DOWNLOAD FULL TEXT DOWNLOAD FULL ...

  6. Do clonal and bud bank traits vary in correspondence with soil properties and resource acquisition strategies? Patterns in alpine communities in the Scandian mountains

    Czech Academy of Sciences Publication Activity Database

    Rusch, G. M.; Wilmann, B.; Klimešová, Jitka; Evju, M.

    2011-01-01

    Roč. 46, 2-3 (2011), 237-254 ISSN 1211-9520 R&D Projects: GA ČR GA526/07/0808 Institutional research plan: CEZ:AV0Z60050516 Keywords : clonal traits * bud bank * SLA Subject RIV: EH - Ecology, Behaviour Impact factor: 1.500, year: 2011

  7. Photoprotective role of epidermal melanin granules against ultraviolet damage and DNA repair in guinea pig skin

    Energy Technology Data Exchange (ETDEWEB)

    Ishikawa, T.; Kodama, K.; Matsumoto, J.; Takayama, S.

    1984-11-01

    We previously developed a quantitative autoradiographic technique with special forceps for measuring unscheduled DNA synthesis (UDS) in mouse skin after treatment with ultraviolet light in vivo. By this method, we investigated the relationship between the protective role of melanin and UV-induced DNA repair in black-and-white guinea pigs. Flat areas containing a sharp border between pigmented and unpigmented skin were selected. The skin of the selected areas was shaved and irradiated with short-wave UV (254 nm) or UV-AB (270 to 440 nm, emission peak at 312 nm) at various doses. Immediately after irradiation, the skin was clamped off with forceps, and an isotonic aqueous solution of (methyl-/sup 3/H)thymidine was injected s.c. into the clamped off portion. UDS was clearly demonstrated as silver grains in this portion of the skin after irradiation with 254 nm UV or UV-AB. Errors due to individual differences were avoided by comparing the intensities of UDS in basal cells from pigmented skin and unpigmented skin of the same animals. Unexpectedly, in groups of animals treated with 254 nm UV or UV-AB, no difference in UDS in pigmented and unpigmented skin was seen at any UV dose. These results suggested that epidermal melanin granules do not significantly protect DNA of basal cells against 254 nm UV or UV-AB irradiation. Results of a study on the effect of the wavelength of irradiation on the UDS response of albino guinea pigs are also reported.

  8. Original Research Article

    African Journals Online (AJOL)

    Erah

    Purpose: To investigate the relationship between metabolic syndrome as defined by using the modified NCEP/ATP III criteria. [modified the National Cholesterol Education Program (NCEP)/Adult. Treatment Panel III (ATP III) criteria] and cigarette smoking in Thai subjects. Methods: This study was carried out among 254 ...

  9. Reading Interests of High School Students.

    Science.gov (United States)

    Diaz-Rubin, C.

    1996-01-01

    Investigates the reading genre preferences of 254 male and female high school students in Pennsylvania. Draws comparisons with similar research done 10 years earlier. Finds a substantial change in reading interests. Notes the top 10 areas of interest are adventure, horror, mysteries, humor, murder, love, fantasy, crime, sports, and movies. (RS)

  10. High-power asymptotics of some weighted harmonic Bergman kernels

    Czech Academy of Sciences Publication Activity Database

    Engliš, Miroslav

    2016-01-01

    Roč. 271, č. 5 (2016), s. 1243-1261 ISSN 0022-1236 Institutional support: RVO:67985840 Keywords : Bergman kernel * harmonic Bergman kernel * asymptotic expansion Subject RIV: BA - General Mathematics Impact factor: 1.254, year: 2016 http://www.sciencedirect.com/science/article/pii/S0022123616301513

  11. Corporal Punishment in Tanzania's Schools

    Science.gov (United States)

    Feinstein, Sheryl; Mwahombela, Lucas

    2010-01-01

    The purpose of this survey was to acquire descriptive information regarding corporal punishment in Tanzania's O-level secondary schools. 448 individuals participated in the study: 254 teachers and 194 students, all from government or private secondary schools in the Iringa Region of Tanzania. In addition, 14 students and 14 teachers were…

  12. 48 CFR 1615.7001 - Audit and records.

    Science.gov (United States)

    2010-10-01

    ... EMPLOYEES HEALTH BENEFITS ACQUISITION REGULATION CONTRACTING METHODS AND CONTRACT TYPES CONTRACTING BY NEGOTIATION Audit and Records-Negotiation 1615.7001 Audit and records. The Contracting officer will modify 52... application of the Truth in Negotiations Act pursuant to 41 U.S.C. 254b(a)(7). [70 FR 31381, June 1, 2005] ...

  13. AcEST: DK963372 [AcEST

    Lifescience Database Archive (English)

    Full Text Available nt phospho... 31 4.9 sp|Q4KJX9|AGUA_PSEF5 Agmatine deiminase OS=Pseudomonas fluoresce... 31 4.9 sp|O29443|TR...75%) Frame = +2 Query: 161 SGVVNEDDTPTETANQDDAV 220 S +VNED+TP T N DDAV Sbjct: 235 SVIVNEDETPVATINDDDAV 254 >sp|Q4KJX9|AGUA

  14. Photoluminescence properties of Er-doped Ge–In(Ga)–S glasses modified by caesium halides

    Czech Academy of Sciences Publication Activity Database

    Ivanova, Z.G.; Zavadil, Jiří; Kostka, P.; Djouama, T.; Reinfelde, M.

    2017-01-01

    Roč. 254, č. 6 (2017), č. článku 1600662. ISSN 0370-1972 Institutional support: RVO:67985882 Keywords : caesium halides * chalcohalide glasses * erbium doping * transmission spectroscopy * photoluminiscence Subject RIV: JH - Ceramics , Fire-Resistant Materials and Glass OBOR OECD: Ceramics Impact factor: 1.674, year: 2016

  15. Brno (k.ú. Bystrc, okr. Brno-město). Rokle. Neolit. Ojedinělý nález. Povrchový průzkum

    Czech Academy of Sciences Publication Activity Database

    Kirchner, Karel; Kuča, M.

    2009-01-01

    Roč. 50, 1-2 (2009), s. 253-254 ISSN 1211-7250 R&D Projects: GA ČR GA205/06/1024 Institutional research plan: CEZ:AV0Z30860518 Keywords : Brno Reservoir * neolithic * surface survey Subject RIV: AC - Archeology, Anthropology, Ethnology

  16. 30 CFR 250.243 - What general information must accompany the DPP or DOCD?

    Science.gov (United States)

    2010-07-01

    ... characteristics of the produced oil (see definition under 30 CFR 254.6) that you will handle or store at the... definition under § 250.200) you will use to carry out your proposed development and production activities. In... that you expect will have the highest volume of liquid hydrocarbons. Include the estimated flow rate...

  17. Subscriptions

    African Journals Online (AJOL)

    Subscriptions Contact. Demesi Mande Department of Clinical Studies Faculty of Veterinary Medicine University of Nairobi PO Box 29053-00625 Nairobi Kenya Phone: 254 020 3003403. Email: jmande@wananchi.com. The Kenya Veterinarian is published two issues in a year. Subscription runs for a full calendar year.

  18. Blood pressure and risk of renal cell carcinoma in the European prospective investigation into cancer and nutrition

    DEFF Research Database (Denmark)

    Weikert, Steffen; Boeing, Heiner; Pischon, Tobias

    2007-01-01

    in the European Prospective Investigation into Cancer and Nutrition (EPIC). Blood pressure was measured in 296,638 women and men, recruited in eight European countries during 1992-1998, 254,935 of whom provided information on antihypertensive medication. During a mean follow-up of 6.2 years, 250 cases of RCC were...

  19. Regional cerebral blood flow in focal cortical epilepsy

    DEFF Research Database (Denmark)

    Hougaard, Kristina Dupont; Oikawa, T; Sveinsdottir, E

    1976-01-01

    Regional cerebral blood flow (rCBF) was studied in ten patients with focal cortical epilepsy. The blood flow was measured by the intra-arterial injection of xenon 133 (133Xe), and the isotope clearance was recorded by a multidetector scintillation camera with 254 detectors. Three patients were st...

  20. Regional cerebral blood flow alterations remote from the site of intracranial tumors

    DEFF Research Database (Denmark)

    Endo, H; Larsen, B; Lassen, N A

    1977-01-01

    Regional cerebral blood flow (rCBF) was investigated in 12 patients with brain tumors, using a 254-channel dynamic gamma camera. In nine of the 12 cases, hyperemic regions with loss of autoregulation were seen in sites remote from the tumor (the area around the tumor was in most cases also...

  1. Assessing the carcinogenic potential of low-dose exposures to chemical mixtures in the environment: the challenge ahead

    Czech Academy of Sciences Publication Activity Database

    Goodson, W.H.; Vondráček, Jan

    2015-01-01

    Roč. 36, JUN 2015 (2015), s. 254-296 ISSN 0143-3334 R&D Projects: GA ČR(CZ) GA13-07711S Keywords : BREAST-CANCER CELLS * ESTROGEN-RECEPTOR-ALPHA * EPITHELIAL-MESENCHYMAL TRANSITION Subject RIV: BO - Biophysics Impact factor: 4.874, year: 2015

  2. PR Perceptions: A Master's Thesis Reveals How Campus Pros View Public Relations--And Their Presidents.

    Science.gov (United States)

    Shoemaker, Donna

    1993-01-01

    A survey of 254 college public relations (PR) officers that focused on their relationships with their presidents is reported, and results are compared with an earlier survey of presidents. Differences in the two groups' perceptions of the PR officer's role in policy formation, lines of authority, and title are highlighted. (MSE)

  3. 76 FR 14818 - Chemical Testing

    Science.gov (United States)

    2011-03-18

    ... DEPARTMENT OF HOMELAND SECURITY Coast Guard 46 CFR Part 16 Chemical Testing CFR Correction In Title 46 of the Code of Federal Regulations, Parts 1 to 40, revised as of October 1, 2010, on page 254, in Sec. 16.105, in the definition of Crewmember, remove the second paragraph (1) and the second...

  4. Evaluation of Capsicum as a Source of Natural Antioxidant in ...

    African Journals Online (AJOL)

    These residues were tested on sunflower oil to evaluate their antioxidant effects. The accelerated methods used for oxidation were the Automated Rancimat, Oven heating and UV light at 254 nm. The oxidation of sunflower oil was measured using changes in peroxide values and the UV absorbances (Conjugated diene) at ...

  5. CATALYTIC STEAM REFORMING OF CHLOROCARBONS: CATALYST COMPARISONS. (R826694C633)

    Science.gov (United States)

    Catalyst candidates for steam reforming chlorocarbons have been screened for activity using methyl chloride as a model reactant. At 500°C, a H2O/C ratio of about 10 and a GHSV of 254 000 h-1, catalysts comprising 0.5% loading of the metals ...

  6. CATALYTIC STEAM REFORMING OF CHLOROCARBONS: CATALYST COMPARISONS. (R822721C633)

    Science.gov (United States)

    Catalyst candidates for steam reforming chlorocarbons have been screened for activity using methyl chloride as a model reactant. At 500°C, a H2O/C ratio of about 10 and a GHSV of 254 000 h-1, catalysts comprising 0.5% loading of the metals o...

  7. Carbon-supported iron and iron-molybdenum sulfide catalysts

    International Nuclear Information System (INIS)

    Ramselaar, W.L.T.M.

    1988-01-01

    The main objective was to describe the relations between the characteristics (composition and dispersion) of the actual sulfide phase and the catalytic activity. Attention was also paid to the influence of preparational aspects on these characteristics. The catalysts were characterized using in-situ Moessbauer spectroscopy down to 2.0 K. 254 refs.; 47 figs.; 22 tabs

  8. Isolation and characterization of microsatellite DNA loci from Sillago ...

    Indian Academy of Sciences (India)

    species, Sillago sinica (Perciformes: Sillaginidae), from coastal waters of China. Zool. Stud. 50, 254–263. Lee C.-S., Hu F. and Hirano R. 1981 Salinity tolerance of fertilized eggs and larval survival in the fish Sillago sihama. Mar. Ecol. Prog. Ser. 4, 169–174. Lu Z.-B., Chen X. and Du J.-G. 2008 The population dynamics.

  9. Untitled

    Indian Academy of Sciences (India)

    0.254 gm. of chrysin was dissolved in one litre of alcohol. The absorption spectrum of chrysin was taken using Perkin-Elmer spectracord. All other spectrophotometric measurements were made using Coleman spectrophotometer, Model 14. All pH measurements were made with the help of a Metrohm pH-meter, type E350.

  10. Provenance of Neoproterozoic to upper Cretaceous sedimentary rocks, eastern Greenland: Implications for recognizing the sources of sediments in the Norwegian Sea

    Czech Academy of Sciences Publication Activity Database

    Sláma, Jiří; Walderhaug, O.; Fonneland, H.; Kosler, J.; Pederson, R. B.

    2011-01-01

    Roč. 238, 3/4 (2011), s. 254-267 ISSN 0037-0738 Institutional research plan: CEZ:AV0Z30130516 Keywords : sedimentary * Eastern Greenland * provenance * U-Pb and Lu-Hf * zircon * Jan Mayen Island * North Atlantic Subject RIV: DB - Geology ; Mineralogy Impact factor: 1.537, year: 2011

  11. AFRREV LALIGENS

    African Journals Online (AJOL)

    User

    expand the meaning. Inflection: For Malmkjær (2002:254) inflection refers to the outer layer of the morphology of word forms, and derivation as the inner layer. In other .... (Who ate that food?) 21. Ebere na-ach onye? 22. Kedu g ? (Where are you?) 23. Kedu ka I mere ?(How are you?) 24. Kedu ihe bx? (What is it?) etc.

  12. Joint research using small tokamaks

    Czech Academy of Sciences Publication Activity Database

    Gryaznevich, M.P.; Del Bosco, E.; Malaquias, A.; Mank, G.; Van Oost, G.; He, Yexi; Hegazy, H.; Hirose, A.; Hron, Martin; Kuteev, B.; Ludwig, G.O.; Nascimento, I.C.; Silva, C.; Vorobyev, G.M.

    2005-01-01

    Roč. 45, č. 10 (2005), S245-S254 ISSN 0029-5515. [Fusion Energy Conference contributions. Vilamoura, 1.11.2004-6.11.2004] Institutional research plan: CEZ:AV0Z20430508 Keywords : small tokamaks * thermonuclear fusion Subject RIV: BL - Plasma and Gas Discharge Physics Impact factor: 3.418, year: 2005

  13. Does Burnout Begin with Student-Teaching? Analyzing Efficacy, Burnout, and Support during the Student-Teaching Semester

    Science.gov (United States)

    Fives, Helenrose; Hamman, Doug; Olivarez, Arturo

    2007-01-01

    The burnout process may begin as early as the student-teaching experience [Gold, Y., 1985. Does teacher burnout begin with student teaching? "Education", 105, 254-257]. Data from 49 student-teachers in the southwest United States were gathered twice during their student-teaching practicum. Data assessing teacher efficacy, teacher…

  14. Kolaviron, a biflavonoid complex from Garcinia kola seeds ...

    African Journals Online (AJOL)

    olayemitoyin

    Drug Metabolism and Toxicology Research Laboratories, Department of Biochemistry,, College of Medicine,. University of Ibadan ... possible ameliorative effect of KV against ethanol-induced reproductive toxicity in male Wistar rats. Twenty-eight rats .... layer chromatography (TLC) using Silica gel GF 254- coated plates and ...

  15. Download this PDF file

    African Journals Online (AJOL)

    cadewumi

    mechanism by which plants inhibit microbial growth may differ from presently used antibiotics and may have clinical value in treatment of resistant microbial ... W) (10: 1.35: 1 v/v). The developed plates were air dried in the fume cupboard and thereafter visualized under UV light (254 and 360 nm Camac Universal UV lamp).

  16. Journal of Earth System Science | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    Home; Journals; Journal of Earth System Science; Volume 109; Issue 2. Volume 109, Issue 2 ... pp 207-209. Bay of Bengal Monsoon Experiment (BOBMEX) — A component of the Indian Climate Research Programme (ICRP) ... pp 249-254. BOBMEX-98 Pilot: Measurement and analysis of incoming shortwave radiation data.

  17. Array-CGH detection of three cryptic submicroscopic imbalances in ...

    Indian Academy of Sciences (India)

    patient with a language disorder and mild mental retardation by array-CGH. Am. J. Med. Genet. Part A 129A, 254–260. Zwaigenbaum L., Sonnenberg L. K., Heshka T., Eastwood S. and. Xu J. 2005 A girl with pervasive developmental disorder and complex chromosome rearrangement involving 8p and 10p. J. Autism. Dev.

  18. Amplicon restriction patterns associated with nitrogenase activity of ...

    Indian Academy of Sciences (India)

    2013-10-01

    Oct 1, 2013 ... Pl. Mol. Biol. Reporter 1 19–21. Jackson ML 1967 Soil chemical analysis (New Delhi, India: Pren- tice Hall). Navarro E, Bousquet J, Moiroud A, Munive A, Piou D and. Normand P 2003 Molecular phylogeny of Alnus (Betulaceae), inferred from nuclear ribosomal DNA ITS sequences. Plant Soil. 254 207–217.

  19. Fish species and size distribution and abundance in different areas ...

    African Journals Online (AJOL)

    Tanzania Journal of Science ... The results show that there were significant differences in catch rates between rainy and dry seasons (F (12, 12) = 2.69; p < 0.05). ... The distribution of the fish species in different areas recorded a significant difference during the dry season (Q = 18.254, df = 8, P < 0.001), while during the rainy ...

  20. Evaluation of a UV/Ozone Treatment Process for Removal of MTBE in Groundwater Supplies in New Mexico

    Science.gov (United States)

    EPA’s Office of Research and Development is funding pilot-scale studies on MTBE contaminated groundwater using UV/ozone treatment technology (254 nm UV, 5.8 mg/L ozone). The pilot-scale treatment system consists of a GW well pump, a feed tank, a pretreatment system (water softene...

  1. Regional cerebral blood flow alterations remote from the site of intracranial tumors

    DEFF Research Database (Denmark)

    Endo, H; Larsen, B; Lassen, N A

    1977-01-01

    Regional cerebral blood flow (rCBF) was investigated in 12 patients with brain tumors, using a 254-channel dynamic gamma camera. In nine of the 12 cases, hyperemic regions with loss of autoregulation were seen in sites remote from the tumor (the area around the tumor was in most cases also hypere...

  2. Personality as Correlate of Perceived Job Stress Among Electoral ...

    African Journals Online (AJOL)

    This study examined the relationship of personality (conscientiousness dimension) with electoral officers perceived job stress during election. The survey utilised the expost facto research design. A total of 346 participants responded to the questionnaires. In all, 254 (70.4%) were males and 101 (29.6%) were females.

  3. The Effects of Parental Involvement, Trust in Parents, Trust in Students and Pupil Control Ideology on Conflict Management Strategies of Early Childhood Teachers

    Science.gov (United States)

    Karakus, Mehmet; Savas, Ahmet Cezmi

    2012-01-01

    In this study it was aimed to determine the effects of parental involvement, teachers' trust in parents and students, and teachers' pupil control ideology on the conflict management strategies used by teachers in classroom management. Data were collected from a sample of 254 teachers through paper and pencil questionnaires. Data were analyzed with…

  4. Lethal action of ultraviolet and visible (blue violet) radiations at defined wavelengths on human lymphoblastoid cells; action spectra and interaction sites

    Energy Technology Data Exchange (ETDEWEB)

    Tyrrell, R.M.; Werfelli, P.; Moraes, E.C. (Institut Suisse de Recherches Experimentales sur le Cancer, Lausanne)

    1984-02-01

    The repair proficient human lymphoblastoid line (TK6) has been employed to construct an action spectrum for the lethal action of ultraviolet (UV) radiation in the range 254 to 434 nm and to examine possible interactions between longer (334, 365 and 405 nm) and shorter wavelength (254 and 313 nm) radiations. The action spectrum follows a DNA absorption spectrum fairly closely out to 360 nm. As in previously determined lethal action spectra for procaryotic and eucaryotic cell populations, there is a broad shoulder in the 334 to 405 nm region which could reflect the existence of either (a) a non-DNA chromophore or (b) a unique photochemical reaction in the DNA over this region. Pre-treatment with radiation at 334 or 365 nm causes either a slight sensitivity to (low fluences) or protection from (higher fluences) subsequent exposure to radiation at a shorter wavelength (254 or 313 nm). Pre-irradiation at a visible wavelength (405 nm) at all fluence levels employed sensitizes the populations to treatment with 254 or 313 nm radiations. These interactions will influence the lethal outcome of cellular exposure to broad-band radiation sources.

  5. Underrecognition and undertreatment of asthma in Cape Town ...

    African Journals Online (AJOL)

    1955 parents of sub B pupils from 16 schools completed a questionnaire, followed by: (f) an interview of parents of 348 symptomatic children; and (if) bronchial responsiveness testing on 254 children. the final case group consisted of 242 children with reported asthma or multiple asthma symptoms on both questionnaires.

  6. Download this PDF file

    African Journals Online (AJOL)

    In Crop Genetic Resources of Africa Vol. 11 (Edited by N. Q. Ng, P. Perrino, F. Attere and. H. Zedan). IITA, Ibadan, Nigeria. Ukungwu M. N. (1990) Efficacy of granular isazofos against rice gall midge in Nigeria. Crop. Prot. 9. 252-254. ,. Ukungwu M. N. and Alam M. S. (1991) Field resistance of rice cultivars to the gall midge.

  7. Reálné možnosti reduktivní dehalogenace chlorovaných látek přítomných ve vodách pomocí elementárních kovů

    Czech Academy of Sciences Publication Activity Database

    Kaštánek, František; Čížek, Z.

    2010, č. 3 (2010), s. 247-254 ISSN 1804-0195 R&D Projects: GA MPO FI-IM3/050 Institutional research plan: CEZ:AV0Z40720504 Keywords : reductive dehalogenation * grey cast iron * cast iron with palladium Subject RIV: CI - Industrial Chemistry, Chemical Engineering www.WasteForum.cz

  8. Wives' Relative Wages, Husbands' Paid Work Hours, and Wives' Labor-Force Exit

    Science.gov (United States)

    Shafer, Emily Fitzgibbons

    2011-01-01

    Economic theories predict that women are more likely to exit the labor force if their partners' earnings are higher and if their own wage rate is lower. In this article, I use the National Longitudinal Survey of Youth (N = 2,254) and discrete-time event-history analysis to show that wives' relative wages are more predictive of their exit than are…

  9. Pramana – Journal of Physics | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    Home; Journals; Pramana – Journal of Physics. T S Mahesh. Articles written in Pramana – Journal of Physics. Volume 59 Issue 2 August 2002 pp 243-254. Developments in quantum information processing by nuclear magnetic resonance: Use of quadrupolar and dipolar couplings · Anil Kumar K V Ramanathan T S Mahesh ...

  10. Kirjad vallutatud Hiinast / Karl Rumor

    Index Scriptorium Estoniae

    Rumor, Karl, pseud., 1886-1971

    2008-01-01

    1937. a. alanud Hiina-Jaapani sõjast, poliitlistest oludest ja revolutsioonist Hiinas, hiinlastest ja Hiina suhetest teiste riikidega. Varem ilmunud: Uus Eesti 19.-20. aug, 1938, nr. 226-227; 12.-13., 16. sept. 1938, nr. 250-251, 254

  11. Repdigits in k-Lucas sequences

    Indian Academy of Sciences (India)

    57(2) 2000 243-254) proved that 11 is the largest number with only one distinct digit (the so-called repdigit) in the sequence ( L n ( 2 ) ) n . In this paper, we address a similar problem in the family of -Lucas sequences. We also show that the -Lucas sequences have similar properties to those of -Fibonacci sequences ...

  12. Download this PDF file

    African Journals Online (AJOL)

    Slowing down the population growth could help improve ... Around the world over 600 million married women are using contraception and in ..... Education Committee on Population. Factors affecting contraceptive use in sub-Saharan. Africa. Washington D C, National Academy. Press, 1993: 252-254. 15. Caldwell J C. The ...

  13. DGFEM for dynamical systems describing interaction of compressible fluid and structures

    Czech Academy of Sciences Publication Activity Database

    Feistauer, M.; Hasnedlová, J.; Horáček, Jaromír; Kosík, A.; Kučera, V.

    2013-01-01

    Roč. 254, December 2013 (2013), s. 17-30 ISSN 0377-0427 R&D Projects: GA ČR(CZ) GAP101/11/0207 Institutional support: RVO:61388998 Keywords : compressible Navier–Stokes equations * dynamic elasticity equations * newmark method * flow-induced vibrations of vocal folds Subject RIV: BI - Acoustics Impact factor: 1.077, year: 2013

  14. Optimal seeding depth of five forb species from the Great Basin

    Science.gov (United States)

    Jennifer K. Rawlins; Val J. Anderson; Robert Johnson; Thomas Krebs

    2009-01-01

    Use of forbs in revegetation projects in the Great Basin is limited due to high seed cost and insufficient understanding of their germination and establishment requirements. We tested the effects of seeding depth from 0 to 25.4 mm (1 in) on emergence and survival in clay and sandy loam soils of 5 ecologically important forbs. Significantly less emergence occurred of...

  15. Choosing Adolescent Smokers as Friends: The Role of Parenting and Parental Smoking

    Science.gov (United States)

    Mercken, L.; Sleddens, E. F. C.; de Vries, H.; Steglich, C. E. G.

    2013-01-01

    The present study examined whether parenting and parental smoking can prevent children from selecting smoking friends during adolescence. 254 Adolescents of one Belgian secondary school participated. Self-administered questionnaires were distributed among 2nd-4th graders (mean ages = 14.2-16.2 years) during spring 2006. Follow-up was conducted 12…

  16. Preliminary gut content and dentition analysis reveal subtle resource ...

    African Journals Online (AJOL)

    use

    been hypothesized to have contributed to the evolution and adaptive .... nets with stretched mesh sizes (25.4 to 203.2 mm) during both day and night hours .... Embryos, Eggs. Unicuspid (Deeply embended). 3. Hypotrophic. Sucking. A. alluaudi. Molluscs. Subequally – Unequally bicuspid. 3. Hypertrophic. Crushing. A. nubila.

  17. Book Review: Experiencing Ethnomusicology: "Teaching and ...

    African Journals Online (AJOL)

    Book Review: Experiencing Ethnomusicology: "Teaching and Learning in European Universities" By Krüger, Simone. (2009) ... Surrey (UK), Burlington, VT (USA): Ashgate. ISBN 9780754667780. 14 b&w illustrations, 3 music examples, 254 pp. $114.95 (hardback) Journal of the Musical Arts in Africa, Volume 9 2012, 81–83 ...

  18. Descriptive Summaries of the Research Development Test & Evaluation Army Appropriation FY 1983. Supporting Data FY 1983, Budget Estimate Submitted to Congress February 1982. Volume II.

    Science.gov (United States)

    1982-02-01

    decision must be reached in late FY 1985 or early FY 1986. This to not considered to be high risk, as the basis fat LADS will be the mature componenta of...tactical scenario work as necessary and prepare for prototype system field excercises at selected Army sites. UNCLASSIFIED 11-254 UNCLASSIFIED Program

  19. Word order and information structure in Czech 3-and 4-year-olds' comprehension.

    Czech Academy of Sciences Publication Activity Database

    Smolík, Filip

    2015-01-01

    Roč. 35, č. 3 (2015), s. 237-253 ISSN 0142-7237 R&D Projects: GA ČR GA13-26779S Institutional support: RVO:68081740 Keywords : Case marking * grammar comprehension * information structure Subject RIV: AN - Psychology Impact factor: 1.254, year: 2015

  20. Comparative ecophysiology of cold-tolerance-related traits: Assessing range expansion potential for an invasive insect at high latitude

    Czech Academy of Sciences Publication Activity Database

    Lehmann, P.; Kaunisto, S.; Košťál, Vladimír; Margus, A.; Zahradníčková, Helena; Lindström, L.

    2015-01-01

    Roč. 88, č. 3 (2015), s. 254-265 ISSN 1522-2152 R&D Projects: GA MŠk LH12103 Grant - others:Academy of Finland(FI) 118456; Academy of Finland(FI) 128888 Institutional support: RVO:60077344 Keywords : Leptinotarsa decemlineata Subject RIV: ED - Physiology Impact factor: 2.007, year: 2015

  1. Resonance – Journal of Science Education | News

    Indian Academy of Sciences (India)

    pp 254-273 General Article. Symmetries and Conservation Laws in Classical and Quantum Mechanics - Quantum Mechanics · K S Mallesh S Chaturvedi V Balakrishnan R Simon N Mukunda ... T Padmanabhan · More Details Fulltext PDF. pp 279-292 Reflections. Darshana Jolts - Sound: The Vehicle for Speech and Music.

  2. VII. mezinárodní balkanistické sympozium / 7th International Symposium on Balkan Studies (Brno, 28. – 29. 11. 2016)

    Czech Academy of Sciences Publication Activity Database

    Sovilj, Milan

    2017-01-01

    Roč. 25, č. 1 (2017), s. 251-254 ISSN 0354-6497 Institutional support: RVO:68378114 Keywords : conference * Balkan studies * contemporary history Subject RIV: AB - History OBOR OECD: History (history of science and technology to be 6.3, history of specific sciences to be under the respective headings)

  3. InterProScan Result: FS858176 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available FS858176 FS858176_5_ORF1 254F313A614617BC PANTHER PTHR11511 INSECT HEMOCYANIN-RELAT...ED 6.7e-33 T IPR013788 Arthropod hemocyanin/insect LSP Molecular Function: oxygen transporter activity (GO:0005344)|Biological Process: transport (GO:0006810) ...

  4. Fate map of the dental mesenchyme: Dynamic development of the dental papilla and follicle

    Czech Academy of Sciences Publication Activity Database

    Rothová, Michaela; Peterková, Renata; Tucker, A. S.

    2012-01-01

    Roč. 366, č. 2 (2012), s. 244-254 ISSN 0012-1606 R&D Projects: GA ČR GA304/07/0223 Institutional research plan: CEZ:AV0Z50390703; CEZ:AV0Z50390512 Keywords : tooth * mouse * mesenchyme Subject RIV: EA - Cell Biology Impact factor: 3.868, year: 2012

  5. SURVEY OF THE RESOURCES AND USE OF THE LIBRARIES OF ...

    African Journals Online (AJOL)

    Audio-Visual aids. 56. 44. -. 100. 33%. Print materials. General & Reference 90. 88. 76. 254. 85%. Books. SERIALS. Newspapers. 54. 46. 28. 128. 43%. Magazines. Pamphlets. Table II shows a 100% response in affirmation to the availability of shelves, tables and chairs. Racks, cataloguing boxes, charging and discharging ...

  6. Photoluminescence properties of Er-doped Ge–In(Ga)–S glasses modified by caesium halides

    Czech Academy of Sciences Publication Activity Database

    Ivanova, Z.G.; Zavadil, Jiří; Kostka, Petr; Djouama, T.; Reinfelde, M.

    2017-01-01

    Roč. 254, č. 6 (2017), č. článku 1600662. ISSN 0370-1972 Institutional support: RVO:67985891 Keywords : caesium halides * chalcohalide glasses * erbium doping * transmission spectroscopy * photoluminiscence Subject RIV: JH - Ceramics, Fire-Resistant Materials and Glass OBOR OECD: Ceramics Impact factor: 1.674, year: 2016

  7. A Photodegradation Study of Three Common Paint and Plaster Biocides under monochromatic UV Light

    DEFF Research Database (Denmark)

    Minelgaite, Greta; Vollertsen, Jes; Nielsen, Asbjørn Haaning

    2014-01-01

    Photodegradation of the three common paint-and-plaster biocides (carbendazim, diuron and terbutryn) was investigated at controlled laboratory conditions. Samples prepared in two types of water (demineralized water and pond water) were subjected to 254 nm monochromatic UV light. Light intensity (W m...

  8. S Chaturvedi

    Indian Academy of Sciences (India)

    Symmetries and Conservation Laws in Classical and Quantum Mechanics - Classical Mechanics · K S Mallesh S Chaturvedi V Balakrishnan R Simon N Mukunda · More Details Fulltext PDF. Volume 16 Issue 3 March 2011 pp 254-273 General Article. Symmetries and Conservation Laws in Classical and Quantum ...

  9. Dileep Kumar, Dr Maripi

    Indian Academy of Sciences (India)

    Specialization: Control of Sea Water Composition, Biogeochemical Cycles & Global Change and Chemical Oceanography Address: National Institute of Oceanography, Regional Centre, 176, Lawson Bay Colony, Visakhapatnam 530 017, A.P.. Contact: Office: (0891) 251 4018. Mobile: 94044 34053. Fax: (0891) 254 3495

  10. José Manuel Lucía Megías, ed., Lope de Vega en la piel de Brugalla. La Colección Lope de Vega de la Biblioteca Histórica Municipal

    Directory of Open Access Journals (Sweden)

    Luis Gómez Canseco

    2015-01-01

    Full Text Available Review of José Manuel Lucía Megías, ed., Lope de Vega en la piel de Brugalla. La Colección Lope de Vega de la Biblioteca Histórica Municipal, Ayuntamiento de Madrid, Madrid, 2013, 254 pp. ISBN: 9788478127627.

  11. The effects of cognitive and emotional workload on physiological reactions in Word Association Test in healthy adults

    Czech Academy of Sciences Publication Activity Database

    Lukavský, Jiří

    2010-01-01

    Roč. 52, č. 1 (2010), s. 15-22 ISSN 0039-3320 Institutional research plan: CEZ:AV0Z70250504 Keywords : Word Association Test * electrodermal activity * pupillary activity Subject RIV: AN - Psychology Impact factor: 0.254, year: 2010

  12. 77 FR 9949 - Agency Information Collection Activities: Proposed Collection: Comment Request

    Science.gov (United States)

    2012-02-21

    ... Service Act, Section 330A(f) (42 U.S.C. 254c) as amended by Section 201, Public Law 107-251 of the Health Care Safety Net Amendments of 2002, is to improve health care and support the adoption of Health... provides HHS with the authority to establish programs to improve health care quality, safety, and...

  13. Examining Associations between Race, Urbanicity, and Patterns of Bullying Involvement

    Science.gov (United States)

    Goldweber, Asha; Waasdorp, Tracy Evian; Bradshaw, Catherine P.

    2013-01-01

    Research on the role of race and urbanicity in bullying involvement has been limited. The present study examined bullying involvement subgroups that relate to race, urbanicity, and the perceived reason for the bullying. Self-report data were collected from 10,254 middle school youth (49.8% female; 62.4% Caucasian, 19.0% African American, and 5.6%…

  14. The Reasons behind Early Adolescents' Responses to Peer Victimization

    Science.gov (United States)

    Bellmore, Amy; Chen, Wei-Ting; Rischall, Emily

    2013-01-01

    Victims of school-based peer harassment face a range of risks including psycho-social, physical, and academic harm. The aim of the present study was to examine the behavioral coping responses used by early adolescents when they face peer victimization. To meet this aim, 216 sixth grade students (55% girls) from two urban middle schools and 254

  15. Effects of Participation in a Martial Arts-Based Antibullying Program in Elementary Schools

    Science.gov (United States)

    Twemlow, Stuart W.; Biggs, Bridget K.; Nelson, Timothy D.; Vernberg, Eric M.; Fonagy, Peter; Twemlow, Stephen W.

    2008-01-01

    This study evaluated the Gentle Warrior Program, a traditional martial arts-based intervention to reduce aggression in children, as it was implemented in three elementary schools. The sample consisted of 254 children in grades 3, 4, and 5 who participated in the Gentle Warrior Program as part of a larger school violence intervention. Results…

  16. When Boy Meets Girl (Revisited): Gender, Gender Role Orientation, and Prospect of Future Interaction as Determinants of Self-Disclosure among Same- and Opposite-Sex Acquaintances.

    Science.gov (United States)

    Shaffer, David R.; And Others

    1996-01-01

    Male and female research participants (n=254) self-disclosed to a male or female confederate with whom they anticipated or did not anticipate further interaction. Women disclosed more intimately, with increasing emotion, and displayed more topical responsiveness with female than with male targets. Only the highly masculine men reliably disclosed…

  17. Short Communication

    African Journals Online (AJOL)

    Fatope, M.O., Ibrahim, H., Takeda, Y. (1991). Screening of higher plants reputed as pesticides using the brine shrimp lethality assay. International. Journal of Pharmacognosy 31: 250-254. Hossain, A.M., Ferdous, T., Salehuddin, S.M and Das,. A.K. (2009). In vitro cytotoxicity (LC50) of extracts obtained from the seeds of Zea ...

  18. Parent-Endorsed Sex Differences in Toddlers with and without ASD: Utilizing the M-CHAT

    Science.gov (United States)

    Øien, Roald A.; Hart, Logan; Schjølberg, Synnve; Wall, Carla A.; Kim, Elizabeth S.; Nordahl-Hansen, Anders; Eisemann, Martin R.; Chawarska, Katarzyna; Volkmar, Fred R.; Shic, Frederick

    2017-01-01

    Sex differences in typical development can provide context for understanding ASD. Baron-Cohen ("Trends Cogn Sci" 6(6):248-254, 2002) suggested ASD could be considered an extreme expression of normal male, compared to female, phenotypic profiles. In this paper, sex-specific M-CHAT scores from N = 53,728 18-month-old toddlers, including n…

  19. Characterization and Classification of Soils on a Toposequence in ...

    African Journals Online (AJOL)

    Soils were sandy and Silt/clay ratios were low and increased down the slope. Organic matter, Total N and Available P were all low and deceased down the profile. Base saturation values were 25.4, 27.0 and 54.75% for crest, mid and foot slopes, respectively. However, in all the physiographic views; OM, TN, P and Base ...

  20. 77 FR 1495 - Criteria for Determining Priorities Among Correctional Facility Health Professional Shortage Areas

    Science.gov (United States)

    2012-01-10

    ... determined in the primary care, mental health, and dental HPSA designation process. See 42 CFR part 5... HPSAs. This notice revises the criteria for scoring primary care, mental health and dental correctional... Health Care Safety Net Amendments of 2002, 42 U.S.C. 254f-1(b)(1), the Secretary of HHS shall establish...

  1. Synthesis of some novel fluoro isoxazolidine and isoxazoline ...

    Indian Academy of Sciences (India)

    N-Benzyl fluoro nitrone; cycloaddition reaction; fluoro isoxazolidine and isoxazolines; ionic liquid; 1,3-amino alcohol; ... fluoro nitrone and application of the nitrone in atom-efficient aldehyde and ketone synthesis. In continuation of our ... chromatography (TLC) using 0.25 mm silica gel plates. (Merck 60F254 UV indicator), ...

  2. In vitro anti-hyperglycaemic effect of glucocapparin isolated from the ...

    African Journals Online (AJOL)

    enoh

    2012-03-20

    Mar 20, 2012 ... It showed a single spot on TLC precoated silica gel 60 F254 with the solvent system 15:85 ethyl acetate/hexane. ... oxidation by the measurement of the optical density at λ = 500 nm using a spectrophotometer DREL 2400 HACH. ... It showed on thin layer chroma- tography (TLC) a spot with Rf = 0.52.

  3. Norma tulemuste taga on eksport Venemaale / Virge Lahe

    Index Scriptorium Estoniae

    Lahe, Virge

    2008-01-01

    Autode turvavarustuse tootja AS-i Norma teise kvartali puhaskasum oli 25,4 miljonit krooni, mis on kaks korda enam kui 2007. aasta teises kvartalis, edaspidi võib kasumit survestada terasehinna tõus. Diagramm: Norma kasum on kasvanud

  4. Book review Information and Communication Technologies for ...

    African Journals Online (AJOL)

    Book review. Information and Communication Technologies for Development in Africa: Volume 2. The Experience with Community Telecentres By Florence Etta and Sheila Parvyn-Wamahiu (2003). Kibet A Ngetich. Abstract. No Abstract Available Africa Development Vol. XXX (1&2) 2005: 254-256. Article Metrics. No metrics ...

  5. Book review Information and Communication Technologies for ...

    African Journals Online (AJOL)

    Book review. Information and Communication Technologies for Development in Africa: Volume 2. The Experience with Community Telecentres By Florence Etta and Sheila Parvyn-Wamahiu (2003). Kibet A Ngetich. Abstract. No Abstract Available Africa Development Vol. XXX (1&2) 2005: 254-256.

  6. Strategies for Preparing United States Combat Organizations for the Inevitability of Casualties

    Science.gov (United States)

    2012-06-08

    operational stressors are prolonged exposure to extreme temperatures, sleep deprivation , boredom, reduced quality of life, prolonged separation from family...increase of proximity meant “small unit leaders identified more with their men than with their superiors” which caused several unexpected ...possibly recycling or failing a course (Grossman 1995, 254). Although this example explains how to essentially make soldiers 60 more efficient killers

  7. Degradation Mechanism of Cyanobacterial Toxin Cylindrospermopsin by Hydroxyl Radicals in Homogeneous UV/H2O2 Process

    Science.gov (United States)

    The degradation of cylindrospermopsin (CYN), a widely distributed and highly toxic cyanobacterial toxin (cyanotoxin), remains poorly elucidated. In this study, the mechanism of CYN destruction by UV-254 nm/H2O2 advanced oxidation process (AOP) was investigated by mass spectrometr...

  8. Kõrgõzstani vahevalitsus külmutas pangad / Hendrik Vosman

    Index Scriptorium Estoniae

    Vosman, Hendrik

    2010-01-01

    Kõrgõzstani pangasüsteem on külmutatud, sest võimult tõrjutud Kõrgõzstani president Kurmanbek Bakijev olevat enne pealinnast põgenemist tühjendanud riigikassa. Riigi arvel on vaid 254 mln. krooni

  9. The influence of the wavelength of ultraviolet radiation on survival, mutation induction and DNA repair in irradiated Chinese hamster cells

    NARCIS (Netherlands)

    Zelle, B.; Reynolds, R.J.; Kottenhagen, M.J.; Schuite, A.; Lohman, P.H.M.

    1980-01-01

    Chinese hamster ovary cells were used to compare the cytotoxicity and mutagenicity of far-UV radiation emitted by a low-pressure mercury, germicidal lamp (wavelength predominantly 254 nm) with that of near-UV radiation emitted by a fluorescent lamp with a continuous spectrum (Westinghouse 'Sun

  10. The Effects of Viewing "Violent" TV upon Children's at-Home and in-School Behavior.

    Science.gov (United States)

    Cameron, Paul; Janky, Christine

    A project is reported in which the in-home TV viewing of 254 kindergarteners was controlled for 3 weeks by a selected "diet" of "violent" or "pacific" programming. Eight teachers recorded all in-school instances of violent-aggressive-hostile behavior by each child over a 5 week period. Parental report of in-home changes and the in-school changes…

  11. Evaluation of the Contact Angle from Molecular Simulations.

    Czech Academy of Sciences Publication Activity Database

    Škvára, J.; Škvor, J.; Nezbeda, Ivo

    2018-01-01

    Roč. 44, č. 3 (2018), s. 190-199 ISSN 0892-7022 R&D Projects: GA ČR GA15-19542S Institutional support: RVO:67985858 Keywords : contact angle * argon droplet * surface molecules Subject RIV: CF - Physical ; Theoretical Chemistry OBOR OECD: Physical chemistry Impact factor: 1.254, year: 2016

  12. Clinicopathological Characteristics of Odontogenic Myxoma in ...

    African Journals Online (AJOL)

    Odontogenic epithelium was rare and observed in 5 (9.5%) cases while calcific material was present in sixteen (25.4%) cases. Late presentation was a common feature and surgical excision was the treatment of choice. Conclusion: Odontogenic myxoma is un-common among Nigerians when compared with ameloblastoma ...

  13. Významný slezský rodák Květoň Čermák (1911-1981)

    Czech Academy of Sciences Publication Activity Database

    Novotný, Gustav

    2007-01-01

    Roč. 56, č. 3 (2007), s. 254-288 ISSN 1211-3131 R&D Projects: GA ČR(CZ) GA404/06/0167 Institutional research plan: CEZ:AV0Z80150510 Keywords : history of forestry * czech agricultural education * biography * ergonomics Subject RIV: AB - History

  14. HEALTH COMPLAINTS, SOCIAL COMPARISONS, AND ABSENTEEISM

    NARCIS (Netherlands)

    GEURTS, SA; BUUNK, BP; SCHAUFELI, WB

    1994-01-01

    In this study the relationship between health problems and objectively recorded absence frequency is investigated from a social psychological perspective in a prospective design. By employing LISREL, a model is developed (tested and revised) among blue-collar workers in Plant North (N = 254) of a

  15. Neutron diffraction analysis of solid phases transforming in CuAlZnMn shape memory alloy

    Czech Academy of Sciences Publication Activity Database

    Neov, Dimitar; Lukáš, Petr; Černík, M.; Šittner, P.

    2001-01-01

    Roč. 2001, - (2001), s. 251-254 [Conference on applied crystallography (CAC) /18./. Katowice, 04.09.2000-07.09.2000] R&D Projects: GA AV ČR IAA1048107 Institutional research plan: CEZ:AV0Z1048901 Keywords : neutron diffraction * shape memory alloy Subject RIV: BM - Solid Matter Physics ; Magnetism

  16. EBOLA VIRUS DISEAES (EVD)

    African Journals Online (AJOL)

    boaz

    1996 (Jan-Apr) Gabon. Zaire. 31. 21. 68%. 1995. Democratic Republic of Congo. Zaire. 315. 254. 81%. 1994. Cote d'Ivoire. Taï Forest. 1. 0. 0%. 1994. Gabon. Zaire .... DIAGNOSIS. The following diseases must be excluded before EVD is considered, particularly in a tropical setting; malaria, typhoid fever, shigellosis, cholera,.

  17. Download this PDF file

    African Journals Online (AJOL)

    made visible by ethidium bromide. The results from gel electrophoresis were visualized on a UV transillumination. (254 nm). Agarose gel preparation as well as electrophoresis were carried out using buffer solution (pH 8.0), contain- ing 45 mmol/L Tris-base/boric acid and. 1 mmol/L EDTA adjusted with hydro- chloric acid.

  18. Testing a Model Linking Environmental Hope and Self-Control with Students' Positive Emotions and Environmental Behavior

    Science.gov (United States)

    Kerret, Dorit; Orkibi, Hod; Ronen, Tammie

    2016-01-01

    This study examined a moderated mediation model with 254 Israeli junior high school students, hypothesizing that students' environmental hope would simultaneously mediate the relationship between their engagement in school-based environmental activities (green engagement) and their environmental behavior as well as their positivity ratio, but that…

  19. Journalists\\' Knowledge of AIDS and Attitude to Persons Living with ...

    African Journals Online (AJOL)

    This study surveyed 254 journalists from the seven media organisations in Ibadan, Nigeria, to assess their knowledge of acquired immune deficiency syndrome (AIDS), attitude to persons living with HIV/AIDS (PLWA) and reports of AIDS-related issues. The journalists\\' overall mean AIDS knowledge score was 10.6 out of 14 ...

  20. BACTERIOPHAGE AND MICROSPHERE TRANSPORT IN SATURATED POROUS MEDIA: FORCED-GRADIENT EXPERIMENT AT BORDEN, ONTARIO

    Science.gov (United States)

    A two-well forced-gradient experiment involving virus and microsphere transport was carried out in a sandy aquifer in Borden, Ontario, Canada. Virus traveled at least a few meters in the experiment, but virus concentrations at observation points 1 and 2.54 m away from the injecti...