WorldWideScience

Sample records for mendelevium 253

  1. Symposium commemorating the 25th anniversary of the discovery of mendelevium

    Energy Technology Data Exchange (ETDEWEB)

    Seaborg, G.T. (ed.)

    1980-01-01

    The Symposium honoring the 25th Anniversary of the discovery of mendelevium was held at the Lawrence Berkeley Laboratory on March 28, 1980. The following three papers were presented: Chemical Properties of Mendelevium; Nuclear Properties of Mendelevium; and Radioactive Decay of Md Isotopes. Besides these papers there were introductory remarks, reminiscences, and concluding remarks.

  2. Studies on some physico-chemical properties of the monovalent mendelevium

    International Nuclear Information System (INIS)

    Kamenskaya, A.N.; Mikheev, N.B.; Novichenko, V.L.

    1979-01-01

    It was established that Md 3+ reduced by Yb 2+ or Eu 2+ co-crystallizes with NaCl in water-ethanol solutions. The co-crystallization coefficient is independent of the relative quantities of the solid and liquid phase, of the concentration of the reducing agent in the concentration range from 1 to 8 mg/ml, and of the concentration of the chloride ion in the solution. Basing on the knowledge of anomalous mixed crystals and on the thermodynamical analysis of the formation of truly isomorphical solid solutions and anomalous mixed crystals, it was shown that mendelevium co-crystallizing with NaCl is in its monovalent state. Besides, it was concluded that up to 1.5 M chloride concentration the monovalent mendelevium does not form stable chloride complexes in water-ethanol solutions. (author)

  3. Identification of 253Md

    International Nuclear Information System (INIS)

    Kadkhodayan, B.; Czerwinski, K.R.; Kreek, S.A.; Hannink, N.J.; Gregorich, K.E.; Lee, D.M.; Nurmia, M.J.; Hoffman, D.C.; Hall, H.L.

    1992-01-01

    We have measured the half-life and production cross section of the new isotope 253 Md, produced via the 243 Am( 13 C,3n) reaction. Isolation of Md from other activities was accomplished using elution with ammonium α-hydroxyisobutyrate from a cation exchange resin column. Experiments were performed with different irradiation time intervals, but the chemical separation always began and ended at exactly the same length of time after the end of irradiation. All separations with the same irradation lengths were combined and analyzed for growth and decay of the 3.0-d 253 Fm daughter and 20.47-d 253 Es, granddaugther of 253 Md. The amount of 253 Es in each fraction depends on the length of each irradiation and the 253 Md half-life. An increase in the length of irradiation will cause a corresponding increase in the amount of the new isotope 253 Md and hence, in the amount of 253 Es produced, provided the length of irradiations are not very long compared to the half-life of 253 Md. In this way, the Md half-life was estimated to be about 6 minutes with a production cross section of the order of 50 nb. (orig.)

  4. Chemical properties of mendelevium

    Energy Technology Data Exchange (ETDEWEB)

    Hulet, E.K.

    1980-11-01

    Even with the most intense ion beams and the largest available quantities of target isotope, about 10/sup 6/ atoms at a time is all the Md that can be produced for chemical studies. This lack of sufficient sample size coupled with the very short lifetimes of the few atoms produced has severely restricted the gathering and the broadness of our knowledge concerning the properties of Md and the heavier elements. To illustrate, the literature contains a mere eleven references to the chemical studies of Md, and none of these deal with bulk properties associated with the element bound in solid phases. Some of these findings are: Md was found to be more volatile than other actinide metals which lead to the belief that it is divalent in the metallic state; separation of Md from the other actinides can be accomplished either by reduction of Md/sup 3 +/ to the divalent state or by chromatographic separations with Md remaining in the tripositive state; extraction of Md/sup 2 +/ with bis(2-ethylhexyl)phosphoric acid is much poorer than the extraction of the neighboring tripositive actinides; attempts to oxidize Md/sup 3 +/ with sodium bismuthate failed to show any evidence for Md/sup 4 +/; reduction potential of Md/sup 3 +/ was found to be close to -0.1 volt; Md/sup 3 +/ can be reduced to Md(Hg) by sodium amalgams and by electrolysis; the electrochemical behavior of Md is very similar to that of Fm and can be summarized in the equation, Md/sup 2 +/ + 2e/sup -/ = Md(Hg) and E/sup 0/ = -1.50 V.; and Md cannot be reduced to a monovalent ion with Sm/sup 2 +/.

  5. Chemical properties of mendelevium

    International Nuclear Information System (INIS)

    Hulet, E.K.

    1980-01-01

    The isotope 256 Md is nearly always employed for chemical studies of this element. This nuclide can be made by bombardment of fractions of a microgram of 254 Es with intense alpha-particle beams which will produce about 10 6 atoms of 256 Md with a half-life of 77 minutes. Even with the most intense ion beams and the largest available quantities of target isotope, about 10 6 atoms at a time is all the Md that can be produced for chemical studies. This lack of sufficient sample size coupled with the very short lifetimes of the few atoms produced has severly restricted the gathering and broadening of our knowledge concerning the properties of Md and the heavier elements. To illustrate, the literature contains a mere eleven references to the chemical studies of Md, and none of these deal with bulk properties associated with element found in solid phases. Some of these findings are: Md was found to be more volatile than other actinide metals which lead to the belief that it is divalent in the metallic state; separation of Md from the other actinides can be accomplished either by reduction of Md to the divalent state or by chromatographic separations with Md remaining in the tripositive state; extraction of Md with bis(2-ethylhexyl)phosphoric acid is much poorer than the extraction of the neighboring tripositive actinides; attempts to oxidize Md wih sodium bismuthate failed to show any evidence of Md 4+ ; standard reduction potential of Md 3+ was found to be close to -0.1 volt; Md 3+ can be reduced to Md(Hg) by sodium amalgams and by electrolysis; the electrochemical behavior of Md is very similar to that of Fm and can be summarized in the equation, Md 2+ + 2e - = Md(Hg), and E 0 = 1.5 V

  6. Chemical properties of mendelevium

    International Nuclear Information System (INIS)

    Hulet, E.K.

    1980-11-01

    Even with the most intense ion beams and the largest available quantities of target isotope, about 10 6 atoms at a time is all the Md that can be produced for chemical studies. This lack of sufficient sample size coupled with the very short lifetimes of the few atoms produced has severely restricted the gathering and the broadness of our knowledge concerning the properties of Md and the heavier elements. To illustrate, the literature contains a mere eleven references to the chemical studies of Md, and none of these deal with bulk properties associated with the element bound in solid phases. Some of these findings are: Md was found to be more volatile than other actinide metals which lead to the belief that it is divalent in the metallic state; separation of Md from the other actinides can be accomplished either by reduction of Md 3+ to the divalent state or by chromatographic separations with Md remaining in the tripositive state; extraction of Md 2+ with bis(2-ethylhexyl)phosphoric acid is much poorer than the extraction of the neighboring tripositive actinides; attempts to oxidize Md 3+ with sodium bismuthate failed to show any evidence for Md 4+ ; reduction potential of Md 3+ was found to be close to -0.1 volt; Md 3+ can be reduced to Md(Hg) by sodium amalgams and by electrolysis; the electrochemical behavior of Md is very similar to that of Fm and can be summarized in the equation, Md 2+ + 2e - = Md(Hg) and E 0 = -1.50 V.; and Md cannot be reduced to a monovalent ion with Sm 2+

  7. 7 CFR 1220.253 - Personal liability.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 10 2010-01-01 2010-01-01 false Personal liability. 1220.253 Section 1220.253 Agriculture Regulations of the Department of Agriculture (Continued) AGRICULTURAL MARKETING SERVICE (MARKETING... CONSUMER INFORMATION Soybean Promotion and Research Order Miscellaneous § 1220.253 Personal liability. No...

  8. 7 CFR 1951.253 - Objectives.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 14 2010-01-01 2009-01-01 true Objectives. 1951.253 Section 1951.253 Agriculture Regulations of the Department of Agriculture (Continued) RURAL HOUSING SERVICE, RURAL BUSINESS-COOPERATIVE....253 Objectives. (a) [Reserved] (b) Borrowers must graduate to other credit at reasonable rates and...

  9. 7 CFR 25.3 - Definitions.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 1 2010-01-01 2010-01-01 false Definitions. 25.3 Section 25.3 Agriculture Office of the Secretary of Agriculture RURAL EMPOWERMENT ZONES AND ENTERPRISE COMMUNITIES General Provisions § 25.3 Definitions. As used in this part— Annual report means the report submitted to USDA by all rural...

  10. 43 CFR 2.53 - Government contracts.

    Science.gov (United States)

    2010-10-01

    ... 43 Public Lands: Interior 1 2010-10-01 2010-10-01 false Government contracts. 2.53 Section 2.53 Public Lands: Interior Office of the Secretary of the Interior RECORDS AND TESTIMONY; FREEDOM OF INFORMATION ACT Privacy Act § 2.53 Government contracts. (a) Required contract provisions. When a contract...

  11. 30 CFR 253.44 - [Reserved

    Science.gov (United States)

    2010-07-01

    ... 30 Mineral Resources 2 2010-07-01 2010-07-01 false [Reserved] 253.44 Section 253.44 Mineral Resources MINERALS MANAGEMENT SERVICE, DEPARTMENT OF THE INTERIOR OFFSHORE OIL SPILL FINANCIAL RESPONSIBILITY FOR OFFSHORE FACILITIES Requirements for Submitting OSFR Information § 253.44 [Reserved] ...

  12. 33 CFR 117.253 - Anacostia River.

    Science.gov (United States)

    2010-07-01

    ... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Anacostia River. 117.253 Section 117.253 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY BRIDGES DRAWBRIDGE OPERATION REGULATIONS Specific Requirements District of Columbia § 117.253 Anacostia River. (a...

  13. 7 CFR 983.253 - Assessment rate.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 8 2010-01-01 2010-01-01 false Assessment rate. 983.253 Section 983.253 Agriculture Regulations of the Department of Agriculture (Continued) AGRICULTURAL MARKETING SERVICE (Marketing Agreements..., ARIZONA, AND NEW MEXICO Assessment Rate § 983.253 Assessment rate. (a) On and after September 1, 2006, a...

  14. 36 CFR 25.3 - Supervision; suspensions.

    Science.gov (United States)

    2010-07-01

    ... 36 Parks, Forests, and Public Property 1 2010-07-01 2010-07-01 false Supervision; suspensions. 25.3 Section 25.3 Parks, Forests, and Public Property NATIONAL PARK SERVICE, DEPARTMENT OF THE INTERIOR NATIONAL MILITARY PARKS; LICENSED GUIDE SERVICE REGULATIONS § 25.3 Supervision; suspensions. (a) The guide...

  15. 28 CFR 25.3 - System information.

    Science.gov (United States)

    2010-07-01

    ... 28 Judicial Administration 1 2010-07-01 2010-07-01 false System information. 25.3 Section 25.3 Judicial Administration DEPARTMENT OF JUSTICE DEPARTMENT OF JUSTICE INFORMATION SYSTEMS The National Instant Criminal Background Check System § 25.3 System information. (a) There is established at the FBI a...

  16. 7 CFR 253.4 - Administration.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 4 2010-01-01 2010-01-01 false Administration. 253.4 Section 253.4 Agriculture... GENERAL REGULATIONS AND POLICIES-FOOD DISTRIBUTION ADMINISTRATION OF THE FOOD DISTRIBUTION PROGRAM FOR HOUSEHOLDS ON INDIAN RESERVATIONS § 253.4 Administration. (a) Federal administration. Within the Department...

  17. 50 CFR 253.22 - State projects.

    Science.gov (United States)

    2010-10-01

    ... 50 Wildlife and Fisheries 7 2010-10-01 2010-10-01 false State projects. 253.22 Section 253.22... State projects. (a) General—(1) Designation of state agency. The Governor of each state shall notify the... participation under the Act, to sign project documents, and to receive payments. (2) States that choose to...

  18. 7 CFR 253.1 - General purpose and scope.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 4 2010-01-01 2010-01-01 false General purpose and scope. 253.1 Section 253.1... AGRICULTURE GENERAL REGULATIONS AND POLICIES-FOOD DISTRIBUTION ADMINISTRATION OF THE FOOD DISTRIBUTION PROGRAM FOR HOUSEHOLDS ON INDIAN RESERVATIONS § 253.1 General purpose and scope. This part describes the terms...

  19. 30 CFR 253.11 - Who must demonstrate OSFR?

    Science.gov (United States)

    2010-07-01

    ... 30 Mineral Resources 2 2010-07-01 2010-07-01 false Who must demonstrate OSFR? 253.11 Section 253.11 Mineral Resources MINERALS MANAGEMENT SERVICE, DEPARTMENT OF THE INTERIOR OFFSHORE OIL SPILL FINANCIAL RESPONSIBILITY FOR OFFSHORE FACILITIES Applicability and Amount of OSFR § 253.11 Who must...

  20. 48 CFR 253.215 - Contracting by negotiation.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false Contracting by negotiation. 253.215 Section 253.215 Federal Acquisition Regulations System DEFENSE ACQUISITION REGULATIONS SYSTEM, DEPARTMENT OF DEFENSE CLAUSES AND FORMS FORMS Prescription of Forms 253.215 Contracting by negotiation. ...

  1. 27 CFR 44.253 - Tax classification for cigars.

    Science.gov (United States)

    2010-04-01

    ... cigars. 44.253 Section 44.253 Alcohol, Tobacco Products and Firearms ALCOHOL AND TOBACCO TAX AND TRADE... PAPERS AND TUBES, WITHOUT PAYMENT OF TAX, OR WITH DRAWBACK OF TAX Withdrawal of Cigars From Customs Warehouses Packaging Requirements § 44.253 Tax classification for cigars. Before withdrawal of cigars from a...

  2. 24 CFR 983.253 - Leasing of contract units.

    Science.gov (United States)

    2010-04-01

    ... 24 Housing and Urban Development 4 2010-04-01 2010-04-01 false Leasing of contract units. 983.253 Section 983.253 Housing and Urban Development Regulations Relating to Housing and Urban Development... DEVELOPMENT PROJECT-BASED VOUCHER (PBV) PROGRAM Occupancy § 983.253 Leasing of contract units. (a) Owner...

  3. 7 CFR 253.3 - Availability of commodities.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 4 2010-01-01 2010-01-01 false Availability of commodities. 253.3 Section 253.3... FOR HOUSEHOLDS ON INDIAN RESERVATIONS § 253.3 Availability of commodities. (a) Conditions for... commodities to households under the authority of any law, except that distribution may be made (1) on a...

  4. Powering the superwind in NGC 253

    Science.gov (United States)

    Watson, Alan; Gallagher, Jay; Merrill, Michael; Keppel, Jean; Phillips, Mark

    1993-01-01

    NGC 253 is a prototypical moderate nuclear starburst galaxy. It is a barred SBc spiral galaxy at a distance of approximately 3 Mpc and can be studied on scales down to 15 pc in the optical and near IR. It is a bright IRAS source with a flux of 1000 Jy at 60 microns and a FIR luminosity of 3 x 10(exp 10) solar luminosity. It has a strong Br(gamma) emission line, a signature of ongoing massive star formation and deep CO absorption bands, which are indicative of the dominance of red supergiants in the near IR. It contains a population of compact radio sources, similar to those seen in M82. Optical spectra show that the nucleus is heavily reddened, with a Balmer decrement of approximately 30. NGC 253 possesses a 'superwind,' seen both in x-ray emission and in optical line emission. Nuclear ejection was first suggested to explain the kinematics of the nuclear region. We have obtained J, H, and K images of the entire galaxy at 1.3 arcsec/pixel (18 pc/pixel) using the superconducting quantum interference device (SQUID) on the KPNO 1.3 m. We have constructed a mosaic of 180 s exposures which traces the galaxy over much of its optical extent. The data were shifted, rotated, magnified, and calibrated following normal practice.

  5. UNCOVERING THE NUCLEUS CANDIDATE FOR NGC 253

    Energy Technology Data Exchange (ETDEWEB)

    Günthardt, G. I.; Camperi, J. A. [Observatorio Astronómico, Universidad Nacional de Córdoba (Argentina); Agüero, M. P. [Observatorio Astronómico, Universidad Nacional de Córdoba, and CONICET (Argentina); Díaz, R. J.; Gomez, P. L.; Schirmer, M. [Gemini Observatory, AURA (United States); Bosch, G., E-mail: gunth@oac.uncor.edu, E-mail: camperi@oac.uncor.edu, E-mail: mpaguero@oac.uncor.edu, E-mail: rdiaz@gemini.edu, E-mail: pgomez@gemini.edu, E-mail: mschirmer@gemini.edu, E-mail: guille@fcaglp.unlp.edu.ar [Instituto de Astrofísica de La Plata (CONICET-UNLP) (Argentina)

    2015-11-15

    NGC 253 is the nearest spiral galaxy with a nuclear starburst that becomes the best candidate for studying the relationship between starburst and active galactic nucleus activity. However, this central region is veiled by large amounts of dust, and it has been so far unclear which is the true dynamical nucleus to the point that there is no strong evidence that the galaxy harbors a supermassive black hole co-evolving with the starburst as was supposed earlier. Near-infrared (NIR) spectroscopy, especially NIR emission line analysis, could be advantageous in shedding light on the true nucleus identity. Using Flamingos-2 at Gemini South we have taken deep K-band spectra along the major axis of the central structure and through the brightest infrared source. In this work, we present evidence showing that the brightest NIR and mid-infrared source in the central region, already known as radio source TH7 and so far considered just a large stellar supercluster, in fact presents various symptoms of a genuine galactic nucleus. Therefore, it should be considered a valid nucleus candidate. Mentioning some distinctive aspects, it is the most massive compact infrared object in the central region, located at 2.″0 of the symmetry center of the galactic bar, as measured in the K-band emission. Moreover, our data indicate that this object is surrounded by a large circumnuclear stellar disk and it is also located at the rotation center of the large molecular gas disk of NGC 253. Furthermore, a kinematic residual appears in the H{sub 2} rotation curve with a sinusoidal shape consistent with an outflow centered in the candidate nucleus position. The maximum outflow velocity is located about 14 pc from TH7, which is consistent with the radius of a shell detected around the nucleus candidate, observed at 18.3 μm (Qa) and 12.8 μm ([Ne ii]) with T-ReCS. Also, the Brγ emission line profile shows a pronounced blueshift and this emission line also has the highest equivalent width at this

  6. Dicty_cDB: VHP253 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHP253 (Link to dictyBase) - - - Contig-U16349-1 - (Link to Or...iginal site) - - VHP253Z 355 - - - - Show VHP253 Library VH (Link to library) Clone ID VHP253 (Link to dicty...Base) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16349-1 Original site URL http://dictycdb.b...CTTGGGTACCAAGAACTGACCGTCAATTTGCTGGTTCATGGTTTGC sequence update 2002. 9.10 Translated Amino Acid sequence ---MQLFAGIKSICT...VPIMRMYFHTGILDYILFKSWVPRTDRQFAGSWF Translated Amino Acid sequence (All Frames) Frame A: ---MQLFAGIKSICTEMAMD

  7. 7 CFR 253.10 - Commodity control, storage and distribution.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 4 2010-01-01 2010-01-01 false Commodity control, storage and distribution. 253.10... THE FOOD DISTRIBUTION PROGRAM FOR HOUSEHOLDS ON INDIAN RESERVATIONS § 253.10 Commodity control... issuance of commodities to households and the control of and accountability for the commodities upon its...

  8. 14 CFR 23.253 - High speed characteristics.

    Science.gov (United States)

    2010-01-01

    ... 14 Aeronautics and Space 1 2010-01-01 2010-01-01 false High speed characteristics. 23.253 Section... Requirements § 23.253 High speed characteristics. If a maximum operating speed VMO/MMO is established under § 23.1505(c), the following speed increase and recovery characteristics must be met: (a) Operating...

  9. 20 CFR 632.253 - Special operating provisions.

    Science.gov (United States)

    2010-04-01

    ... 632.253 Employees' Benefits EMPLOYMENT AND TRAINING ADMINISTRATION, DEPARTMENT OF LABOR INDIAN AND NATIVE AMERICAN EMPLOYMENT AND TRAINING PROGRAMS Summer Youth Employment and Training Programs § 632.253...; (b) Develop outreach and recruitment techniques aimed at all segments of the economically...

  10. 50 CFR 253.14 - Economic and financial requirements.

    Science.gov (United States)

    2010-10-01

    ... 50 Wildlife and Fisheries 7 2010-10-01 2010-10-01 false Economic and financial requirements. 253... Obligation Guarantee Program § 253.14 Economic and financial requirements. (a) Income and expense projections... protect the U.S. against the industry's cyclical economics and other risks of loss. (b) Working capital...

  11. 14 CFR 253.5 - Notice of incorporated terms.

    Science.gov (United States)

    2010-01-01

    ... information concerning: (1) Limits on the air carrier's liability for personal injury or death of passengers.... Except as provided in § 253.8, each air carrier shall include on or with a ticket, or other written... contract, passengers may inspect the full text of each term incorporated by reference at the carrier's...

  12. 14 CFR 25.253 - High-speed characteristics.

    Science.gov (United States)

    2010-01-01

    ... 14 Aeronautics and Space 1 2010-01-01 2010-01-01 false High-speed characteristics. 25.253 Section...-speed characteristics. (a) Speed increase and recovery characteristics. The following speed increase and recovery characteristics must be met: (1) Operating conditions and characteristics likely to cause...

  13. 37 CFR 253.10 - Cost of living adjustment.

    Science.gov (United States)

    2010-07-01

    ... 37 Patents, Trademarks, and Copyrights 1 2010-07-01 2010-07-01 false Cost of living adjustment... NONCOMMERCIAL EDUCATIONAL BROADCASTING § 253.10 Cost of living adjustment. (a) (a) On December 1, 2003, the Librarian of Congress shall publish in the Federal Register a notice of the change in the cost of living as...

  14. 37 CFR 253.7 - Recording rights, rates and terms.

    Science.gov (United States)

    2010-07-01

    ... 37 Patents, Trademarks, and Copyrights 1 2010-07-01 2010-07-01 false Recording rights, rates and... NONCOMMERCIAL EDUCATIONAL BROADCASTING § 253.7 Recording rights, rates and terms. (a) Scope. This section... include: (i) The title, composer and author to the extent such information is reasonably obtainable. (ii...

  15. 14 CFR 253.8 - Qualifications to notice requirements.

    Science.gov (United States)

    2010-01-01

    ... to notice requirements. (a) If notice is not provided in accordance with § 253.5 at a ticket sales location outside of the United States that is not a U.S. air carrier ticket office, the price paid for the portion of such ticket that is for interstate and overseas air transportation shall be refundable without...

  16. Extragalactic molecular line surveys: the starburst galaxy NGC253

    Science.gov (United States)

    Martín, S.; Mauersberger, R.; Martín-Pintado, J.; Henkel, C.; García-Burillo, S.

    Figure 1 shows the first spectral line survey towards an extragalactic source, the starburst galaxy NGC253. The scan, carried out at the IRAM 30m telescope, covers ~86% of the observable 2mm atmospheric window from 129.1 to 175.2GHz. A total of ~ 100 spectral features have been identified as transitions from 25 different molecular species. Ten out of these 25 molecules have been detected for the first time towards a starbust galaxy. NO, NS, SO2, H2S and H2CS were reported by Martín et al.(2003), Martín et al.(2005) while C2S, CH2NH, NH2CN, HOCO+ and C3H are tentatively detected in the survey. These new detections implies an increase of ~ 40% in the 27 molecular species previosly detected outside the galaxy (Mauersberger & Henkel(1993), Mauersberger et al.(1995), Sage & Ziurys(1995), Heikkila et al.(1999).) Additionaly, DNC and N2D+, two deuterated species never obseved in the extragalactic ISM, are tentatively identified. The molecular abundances derived for each species in NGC253 have been compared with five Galactic sources known to be prototypes of different types of chemistry. The chemical complexity of NGC253 resembles closely that observed towards prototypical Galactic Center molecular clouds (SgrB2(OH) in, thought to be mainly dominated by low velocity shocks Martín-Pintado et al.(2001). This comparison certainly indicates that the chemistry of the molecular environment within the nuclear region of NGC253 and that in Galactic Center molecular clouds are driven by similar physical processes. Also a comparison has been performed with five selected prominent galaxies which clearly shows up the chemical differenciation between nuclei of galaxies. The chemical complexity of IC342, and also that of NGC4945 except for the observed lack of SiO, clearly resemble that of NGC253. On the other hand, it is remarkable the different chemical complexity observed between the starburst nuclei within NGC253 and M82. This difference has been interpreted in terms of the

  17. Hard Gamma Ray Emission from the Starburst Galaxy NGC 253

    Science.gov (United States)

    Jackson, James M.; Marscher, Alan M.

    1996-01-01

    We have completed the study to search for hard gamma ray emission from the starburst galaxy NGC 253. Since supernovae are thought to provide the hard gamma ray emission from the Milky Way, starburst galaxies, with their extraordinarily high supernova rates, are prime targets to search for hard gamma ray emission. We conducted a careful search for hard gamma ray emission from NGC 253 using the archival data from the EGRET experiment aboard the CGRO. Because this starburst galaxy happens to lie near the South Galactic Pole, the Galactic gamma ray background is minimal. We found no significant hard gamma ray signal toward NGC 253, although a marginal signal of about 1.5 sigma was found. Because of the low Galactic background, we obtained a very sensitive upper limit to the emission of greater than 100 MeV gamma-rays of 8 x 10(exp -8) photons/sq cm s. Since we expected to detect hard gamma ray emission, we investigated the theory of gamma ray production in a dense molecular medium. We used a leaky-box model to simulate diffusive transport in a starburst region. Since starburst galaxies have high infrared radiation fields, we included the effects of self-Compton scattering, which are usually ignored. By modelling the expected gamma-ray and synchrotron spectra from NGC 253, we find that roughly 5 - 15% of the energy from supernovae is transferred to cosmic rays in the starburst. This result is consistent with supernova acceleration models, and is somewhat larger than the value derived for the Galaxy (3 - 10%). Our calculations match the EGRET and radio data very well with a supernova rate of 0.08/ yr, a magnetic field B approx. greater than 5 x 10(exp -5) G, a density n approx. less than 100/sq cm, a photon density U(sub ph) approx. 200 eV/sq cm, and an escape time scale tau(sub 0) approx. less than 10 Myr. The models also suggest that NGC 253 should be detectable with only a factor of 2 - 3 improvement in sensitivity. Our results are consistent with the standard picture

  18. 30 CFR 253.13 - How much OSFR must I demonstrate?

    Science.gov (United States)

    2010-07-01

    ... 30 Mineral Resources 2 2010-07-01 2010-07-01 false How much OSFR must I demonstrate? 253.13 Section 253.13 Mineral Resources MINERALS MANAGEMENT SERVICE, DEPARTMENT OF THE INTERIOR OFFSHORE OIL SPILL FINANCIAL RESPONSIBILITY FOR OFFSHORE FACILITIES Applicability and Amount of OSFR § 253.13 How...

  19. 30 CFR 253.30 - How can I use an indemnity as OSFR evidence?

    Science.gov (United States)

    2010-07-01

    ... 30 Mineral Resources 2 2010-07-01 2010-07-01 false How can I use an indemnity as OSFR evidence? 253.30 Section 253.30 Mineral Resources MINERALS MANAGEMENT SERVICE, DEPARTMENT OF THE INTERIOR OFFSHORE OIL SPILL FINANCIAL RESPONSIBILITY FOR OFFSHORE FACILITIES Methods for Demonstrating OSFR § 253.30...

  20. 30 CFR 253.10 - What facilities does this part cover?

    Science.gov (United States)

    2010-07-01

    ... 30 Mineral Resources 2 2010-07-01 2010-07-01 false What facilities does this part cover? 253.10 Section 253.10 Mineral Resources MINERALS MANAGEMENT SERVICE, DEPARTMENT OF THE INTERIOR OFFSHORE OIL SPILL FINANCIAL RESPONSIBILITY FOR OFFSHORE FACILITIES Applicability and Amount of OSFR § 253.10 What...

  1. 30 CFR 253.31 - How can I use a surety bond as OSFR evidence?

    Science.gov (United States)

    2010-07-01

    ... 30 Mineral Resources 2 2010-07-01 2010-07-01 false How can I use a surety bond as OSFR evidence? 253.31 Section 253.31 Mineral Resources MINERALS MANAGEMENT SERVICE, DEPARTMENT OF THE INTERIOR OFFSHORE OIL SPILL FINANCIAL RESPONSIBILITY FOR OFFSHORE FACILITIES Methods for Demonstrating OSFR § 253.31...

  2. 30 CFR 253.29 - How can I use insurance as OSFR evidence?

    Science.gov (United States)

    2010-07-01

    ... 30 Mineral Resources 2 2010-07-01 2010-07-01 false How can I use insurance as OSFR evidence? 253.29 Section 253.29 Mineral Resources MINERALS MANAGEMENT SERVICE, DEPARTMENT OF THE INTERIOR OFFSHORE OIL SPILL FINANCIAL RESPONSIBILITY FOR OFFSHORE FACILITIES Methods for Demonstrating OSFR § 253.29 How...

  3. 30 CFR 253.20 - What methods may I use to demonstrate OSFR?

    Science.gov (United States)

    2010-07-01

    ... 30 Mineral Resources 2 2010-07-01 2010-07-01 false What methods may I use to demonstrate OSFR? 253.20 Section 253.20 Mineral Resources MINERALS MANAGEMENT SERVICE, DEPARTMENT OF THE INTERIOR OFFSHORE OIL SPILL FINANCIAL RESPONSIBILITY FOR OFFSHORE FACILITIES Methods for Demonstrating OSFR § 253.20...

  4. 30 CFR 253.1 - What is the purpose of this part?

    Science.gov (United States)

    2010-07-01

    ... 30 Mineral Resources 2 2010-07-01 2010-07-01 false What is the purpose of this part? 253.1 Section 253.1 Mineral Resources MINERALS MANAGEMENT SERVICE, DEPARTMENT OF THE INTERIOR OFFSHORE OIL SPILL FINANCIAL RESPONSIBILITY FOR OFFSHORE FACILITIES General § 253.1 What is the purpose of this part? This part...

  5. 48 CFR 253.215-70 - DD Form 1547, Record of Weighted Guidelines Application.

    Science.gov (United States)

    2010-10-01

    ... Forms 253.215-70 DD Form 1547, Record of Weighted Guidelines Application. Follow the procedures at PGI... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false DD Form 1547, Record of Weighted Guidelines Application. 253.215-70 Section 253.215-70 Federal Acquisition Regulations System...

  6. The ULX Population in the Starburst Galaxy NGC 253

    Science.gov (United States)

    Weaver, K. A.; Heckman, T. M.; Strickland, D. K.

    2004-01-01

    Optimism is mounting for the existence of intermediate mass black holes (IMBH), which occupy the mass spectrum somewhere between the stellar-mass and supermassive varieties. IMBH are naturally predicted by theoretical stellar and black hole evolution models, but the strong attention to them began only recently with the discovery of ultraluminous x-ray sources (ULX). If isotropic and accreting normally, ULX have luminosities tens to thousands of times greater than the Eddington luminosity of a neutron star or stellar-mass black hole. A standard interpretation of their x-ray flux implies that they are powered by IMBH. On the other hand, they may be stellar-mass black holes that are beamed or emit anisotropically. Therefore, the exact nature of ULX is highly controversial. ULX are common in starburst galaxies. At a distance of only 3 Mpc, NGC 253 is bright, nearby, and one of the best-studied starburst galaxies. Approximately 50 distinct x-ray point sources are detected in or near the plane of the galaxy. At least six of these are ULX, with luminosities greater than 10 times that expected for a stellar-mass, accreting compact object. We present new Chandra data from an 80 ksec observation of NGC 253 obtained in 2003 that provides high quality spectra of these sources. Comparing the 1999 and 2003 Chandra observations, the sources have varied significantly over the course of four years, with one of the ULX disappearing completely. The ULX spectra are similar to black-hole XRBs and at least one appears to possess an iron K line. We will discuss what insight these data provide for the nature of ULX in NGC 253 .

  7. SWAN: NGC 253’s Nucleated Star Bursting Environment

    Science.gov (United States)

    Gorski, Mark; Ott, Juergen; Meier, David; Momjian, Emmanuel; Walter, Fabian; Rand, Richard

    2015-08-01

    We present the first results from SWAN: Survey of Water and Ammonia in Nearby galaxies. Nearby galaxies are conveniently located to probe molecular gas properties on scales of 10 to 200 pc, which are appropriate for Giant Molecular Clouds (GMCs). The resolution of the VLA in D and C configurations maps to a few 10’s of parsecs in these galaxies. To advance studies of galaxy evolution it is paramount to understand how processes in the molecular ISM and star formation are linked on these scales. We have observed the metastable transitions of ammonia and the 22GHz water maser line in four nearby galaxies: NGC 253, IC 342, NGC 2146, and NGC 6946. These galaxies were chosen to span an order of magnitude in star formation rate, and a range of galactic ecosystems. We use the ammonia transitions to derive kinetic temperatures, which exposes the heating and cooling balance of the ISM. We then aim to relate these conditions to energetic feedback from star formation indicated by water masers. Currently our analysis is focused on NGC 253. NGC 253 is a barred spiral galaxy with a nucleated starburst of ≈3M⊙ per year. We have observed ammonia transitions (1,1) to (5,5) and the 22GHz water maser line with a resolution of ≈63pc. We have identified nine regions across the nucleated starburst for study. The ammonia (3,3) line appears to be masing in the centermost 200pc. In combination with Large Velocity Gradient models (LVG) we find that the properties of the molecular gas is warm, ranging from 100K to 160K, with molecular hydrogen densities from 2.2e3 cm-3 to 4.8e3 cm-3. We have identified two regions of water maser emission. The first region is a north south extension, about the center of the galaxy, with a major axis of ≈7”(150pc) and a minor axis of ≈3”(90pc), and the second is a nearby region ≈6”(100pc) to the southeast of the galaxy center. By means of these measurements, we gain an understanding of the molecular ISM associated with the nucleated

  8. PCA/HEXTE Observations of M82 and NGC253

    Science.gov (United States)

    Rephaeli, Yoel

    1999-01-01

    The nearby starburst galaxies M82 & NGC 253 were observed by the RXTE satellite during the period February - November 1997. Data reduction and analysis began in summer 1998, and continued through March 1999. The spectral analysis indicates that the main emission in these galaxies is from hot gas. We find a considerable degree of variability in the emission from M82, possibly due to M81 (a known AGN) in the FOV. The main spectral parameters were determined for both sources. The results of the analysis were reported in the March 1999 meeting of the AAS. Summary of the data analysis, theoretical modeling, and interpretation will be presented in a paper which is currently being prepared for publication in the Astrophysical Journal.

  9. Long-term effects of intratracheally instilled 253EsCl3 in rats

    International Nuclear Information System (INIS)

    Ballou, J.E.; Dagle, G.E.; Morrow, W.

    1975-01-01

    ts administered 253 EsCl 3 by intratracheal instillation developed more bone tumors and fewer lung tumors than similar rats administered 239 Pu(NO 3 ) 4 . In explanation, it is suggested that 253 Es may irradiatete bone surface cells more effectively while 239 Pu may irradiate a greater total number of cells in the lung. (U.S.)

  10. 15 CFR 25.3 - Basis for civil penalties and assessments.

    Science.gov (United States)

    2010-01-01

    ... assessments. 25.3 Section 25.3 Commerce and Foreign Trade Office of the Secretary of Commerce PROGRAM Fraud... considered made to the authority, recipient, or party when such claim is actually made to an agent, fiscal... considered made to the authority when such statement is actually made to an agent, fiscal intermediary, or...

  11. 44 CFR 206.253 - Insurance requirements for facilities damaged by disasters other than flood.

    Science.gov (United States)

    2010-10-01

    ... facilities damaged by disasters other than flood. 206.253 Section 206.253 Emergency Management and Assistance... by disasters other than flood. (a) Prior to approval of a Federal grant for the restoration of a facility and its contents which were damaged by a disaster other than flood, the Grantee shall notify the...

  12. 30 CFR 253.23 - What information must I submit to support my net worth demonstration?

    Science.gov (United States)

    2010-07-01

    ... net worth demonstration? 253.23 Section 253.23 Mineral Resources MINERALS MANAGEMENT SERVICE, DEPARTMENT OF THE INTERIOR OFFSHORE OIL SPILL FINANCIAL RESPONSIBILITY FOR OFFSHORE FACILITIES Methods for..., prepared in accordance with the generally accepted accounting practices (GAAP) of the United States or...

  13. 50 CFR 14.253 - What are the restrictions contained in these regulations?

    Science.gov (United States)

    2010-10-01

    ... 50 Wildlife and Fisheries 1 2010-10-01 2010-10-01 false What are the restrictions contained in these regulations? 14.253 Section 14.253 Wildlife and Fisheries UNITED STATES FISH AND WILDLIFE SERVICE....255, it is unlawful for any person to import, export, transport, sell, receive, acquire, or purchase...

  14. 30 CFR 253.26 - What information must I submit to support my unencumbered assets demonstration?

    Science.gov (United States)

    2010-07-01

    ... amortization, using the same valuation method used in your audited annual financial statement and expressed in... unencumbered assets demonstration? 253.26 Section 253.26 Mineral Resources MINERALS MANAGEMENT SERVICE, DEPARTMENT OF THE INTERIOR OFFSHORE OIL SPILL FINANCIAL RESPONSIBILITY FOR OFFSHORE FACILITIES Methods for...

  15. 30 CFR 253.40 - What OSFR evidence must I submit to MMS?

    Science.gov (United States)

    2010-07-01

    ... 30 Mineral Resources 2 2010-07-01 2010-07-01 false What OSFR evidence must I submit to MMS? 253.40... § 253.40 What OSFR evidence must I submit to MMS? (a) You must submit to MMS: (1) A single demonstration... unaltered Form MMS-1016; (3) MMS forms that identify your COFs (Form MMS-1021, Form MMS-1022), and the...

  16. Late effects of inhaled 253Es(NO3)3 in rats

    International Nuclear Information System (INIS)

    Ballou, J.E.; Dagle, G.E.; Gies, R.A.; Smith, L.G.

    1979-01-01

    Einsteinium-253 nitrate was administered as an aerosol to male Wistar rats and the long-term biological effects were followed for the animals' life span. Lung was the major target organ for absorbed radiation dose and tumor induction, in agreement with results for other inhaled transuranic nitrates. The earlier finding of a high incidence of bone tumors following intratracheal instillation of 253 EsCl 3 was not confirmed in the present study with inhaled 253 Es(NO 3 ) 3 . The reason for the difference in bone tumor production is believed to be related to the different acute toxicities of intratracheally instilled and inhaled 253 Es. Intratracheally instilled 253 EsCl 3 was less acutely toxic (only a single lobe or one-half the lung was irradiated); thus, a larger more tumorigenic dose could be translocated to bone without shortening the life span to the extent that bone tumors could not be expressed. The radiation dose from inhaled 253 Es(NO 3 ) 3 was uniformly spread throughout both lungs and early death due to a generalized radiation pneumonitis precluded the development of long-term effects in bone. (author)

  17. 49 CFR 40.253 - What are the procedures for conducting an alcohol confirmation test?

    Science.gov (United States)

    2010-10-01

    ... FOR TRANSPORTATION WORKPLACE DRUG AND ALCOHOL TESTING PROGRAMS Alcohol Confirmation Tests § 40.253 What are the procedures for conducting an alcohol confirmation test? As the BAT conducting an alcohol... 49 Transportation 1 2010-10-01 2010-10-01 false What are the procedures for conducting an alcohol...

  18. Spectral Energy Distribution and Radio Halo of NGC 253 at Low Radio Frequencies

    Energy Technology Data Exchange (ETDEWEB)

    Kapińska, A. D.; Staveley-Smith, L.; Meurer, G. R.; For, B.-Q. [International Centre for Radio Astronomy Research (ICRAR), University of Western Australia, 35 Stirling Hwy, WA 6009 (Australia); Crocker, R. [Research School of Astronomy and Astrophysics, Australian National University, Canberra, ACT 2611 (Australia); Bhandari, S.; Callingham, J. R.; Gaensler, B. M.; Hancock, P. J.; Lenc, E. [ARC Centre of Excellence for All-Sky Astrophysics (CAASTRO), Sydney NSW (Australia); Hurley-Walker, N.; Seymour, N. [International Centre for Radio Astronomy Research (ICRAR), Curtin University, Bentley, WA 6102 (Australia); Offringa, A. R. [Netherlands Institute for Radio Astronomy (ASTRON), P.O. Box 2, 7990 AA Dwingeloo (Netherlands); Hanish, D. J. [Spitzer Science Center, California Institute of Technology, MC 220-6, 1200 East California Boulevard, Pasadena, CA 91125 (United States); Ekers, R. D.; Bell, M. E. [CSIRO Astronomy and Space Science (CASS), P.O. Box 76, Epping, NSW 1710 (Australia); Dwarakanath, K. S. [Raman Research Institute, Bangalore 560080 (India); Hindson, L. [Centre of Astrophysics Research, University of Hertfordshire, College Lane, Hatfield AL10 9AB (United Kingdom); Johnston-Hollitt, M. [School of Chemical and Physical Sciences, Victoria University of Wellington, P.O. Box 600, Wellington 6140 (New Zealand); McKinley, B., E-mail: anna.kapinska@uwa.edu.au [School of Physics, The University of Melbourne, Parkville, VIC 3010 (Australia); and others

    2017-03-20

    We present new radio continuum observations of NGC 253 from the Murchison Widefield Array at frequencies between 76 and 227 MHz. We model the broadband radio spectral energy distribution for the total flux density of NGC 253 between 76 MHz and 11 GHz. The spectrum is best described as a sum of a central starburst and extended emission. The central component, corresponding to the inner 500 pc of the starburst region of the galaxy, is best modeled as an internally free–free absorbed synchrotron plasma, with a turnover frequency around 230 MHz. The extended emission component of the spectrum of NGC 253 is best described as a synchrotron emission flattening at low radio frequencies. We find that 34% of the extended emission (outside the central starburst region) at 1 GHz becomes partially absorbed at low radio frequencies. Most of this flattening occurs in the western region of the southeast halo, and may be indicative of synchrotron self-absorption of shock-reaccelerated electrons or an intrinsic low-energy cutoff of the electron distribution. Furthermore, we detect the large-scale synchrotron radio halo of NGC 253 in our radio images. At 154–231 MHz the halo displays the well known X-shaped/horn-like structure, and extends out to ∼8 kpc in the z -direction (from the major axis).

  19. 30 CFR 253.50 - How can MMS refuse or invalidate my OSFR evidence?

    Science.gov (United States)

    2010-07-01

    ... 30 Mineral Resources 2 2010-07-01 2010-07-01 false How can MMS refuse or invalidate my OSFR... can MMS refuse or invalidate my OSFR evidence? (a) If MMS determines that any OSFR evidence you submit... acceptable evidence without being subject to civil penalty under § 253.51. (b) MMS may immediately and...

  20. The world on a train: global narration in Geoff Ryman’s 253

    Directory of Open Access Journals (Sweden)

    Berthold Schoene,

    2013-08-01

    Full Text Available The focus of this essay is an exploration of Geoff Ryman’s interactive novel 253, which was originally released online as 253, or Tube Theatre: A Novel for the Internet on London Underground in Seven Cars and a Crash and then, two years later in 1998, also as a ‘print remix’. Examining Ryman’s text as an example of contemporary global narration, Schoene explores the cosmopolitan techniques and structural devices employed in 253 not merely to envisage the individual’s immersion in global community but to facilitate an enduring interactive experience of it. Aligning the hypertextuality of 253 with Jean-Luc Nancy’s philosophy of community, Schoene argues that Ryman’s use of hyperlinks does not destroy plot, but deconstructs it, reconceiving it as fluid and ‘inoperative’ instead of strictly telos-driven. With close reference to Ryman’s ‘The World on a Train’, his BBC News tribute to the 52 victims of the 7/7 London terrorist attacks, the essay concludes by looking at the new cosmopolitical currency acquired by Ryman’s novel – a currency it did not originally have in the mid-1990s.

  1. 42 CFR 441.253 - Sterilization of a mentally competent individual aged 21 or older.

    Science.gov (United States)

    2010-10-01

    ... 42 Public Health 4 2010-10-01 2010-10-01 false Sterilization of a mentally competent individual... LIMITS APPLICABLE TO SPECIFIC SERVICES Sterilizations § 441.253 Sterilization of a mentally competent individual aged 21 or older. FFP is available in expenditures for the sterilization of an individual only if...

  2. H I observations of the nearest starburst galaxy NGC 253 with the SKA precursor KAT-7

    NARCIS (Netherlands)

    Lucero, D. M.; Carignan, C.; Elson, E. C.; Randriamampandry, T. H.; Jarrett, T. H.; Oosterloo, T. A.; Heald, G. H.

    We present H I observations of the Sculptor group starburst spiral galaxy NGC 253, obtained with the Karoo Array Telescope (KAT-7). KAT-7 is a pathfinder for the Square Kilometre Array precursor MeerKAT, under construction. The short baselines and low system temperature of the telescope make it very

  3. Extra-planar H I in the starburst galaxy NGC 253

    NARCIS (Netherlands)

    Boomsma, R; Oosterloo, TA; Fraternali, F; van der Hulst, JM; Sancisi, R

    Observations of the nearby starburst galaxy NGC 253 in the 21-cm line reveal the presence of neutral hydrogen in the halo, up to 12 kpc from the galactic plane. This extra-planar H I is found in only one half of the galaxy and is concentrated in a half-ring structure and plumes which are lagging in

  4. 37 CFR 253.6 - Performance of musical compositions by other public broadcasting entities.

    Science.gov (United States)

    2010-07-01

    ... 37 Patents, Trademarks, and Copyrights 1 2010-07-01 2010-07-01 false Performance of musical... CERTAIN COPYRIGHTED WORKS IN CONNECTION WITH NONCOMMERCIAL EDUCATIONAL BROADCASTING § 253.6 Performance of... performance of copyrighted published nondramatic musical compositions by radio stations not licensed to...

  5. 30 CFR 253.5 - What is the authority for collecting Oil Spill Financial Responsibility (OSFR) information?

    Science.gov (United States)

    2010-07-01

    ... 30 Mineral Resources 2 2010-07-01 2010-07-01 false What is the authority for collecting Oil Spill Financial Responsibility (OSFR) information? 253.5 Section 253.5 Mineral Resources MINERALS MANAGEMENT... the information to ensure that the designated applicant for a COF has the financial resources...

  6. 7 CFR 1726.253 - Prior approved contract modification related to alternative bid provision for payment to...

    Science.gov (United States)

    2010-01-01

    ... alternative bid provision for payment to contractor for bulk purchase of materials. 1726.253 Section 1726.253... contractor for bulk purchase of materials. When construction is to be performed over an extended period of... AGRICULTURE ELECTRIC SYSTEM CONSTRUCTION POLICIES AND PROCEDURES Modifications to RUS Standard Contract Forms...

  7. Active galactic nuclei, neutrinos, and interacting cosmic rays in NGC 253 and NGC 1068

    Energy Technology Data Exchange (ETDEWEB)

    Yoast-Hull, Tova M.; Zweibel, Ellen G. [Department of Physics, University of Wisconsin-Madison, WI 53706 (United States); Gallagher III, J. S. [Department of Astronomy, University of Wisconsin-Madison, WI 53706 (United States); Everett, John E., E-mail: yoasthull@wisc.edu [Center for Interdisciplinary Exploration and Research in Astrophysics, Northwestern University, IL 60208 (United States)

    2014-01-10

    The galaxies M82, NGC 253, NGC 1068, and NGC 4945 have been detected in γ-rays by Fermi. Previously, we developed and tested a model for cosmic-ray interactions in the starburst galaxy M82. Now, we aim to explore the differences between starburst and active galactic nucleus (AGN) environments by applying our self-consistent model to the starburst galaxy NGC 253 and the Seyfert galaxy NGC 1068. Assuming a constant cosmic-ray acceleration efficiency by supernova remnants with Milky Way parameters, we calculate the cosmic-ray proton and primary and secondary electron/positron populations, predict the radio and γ-ray spectra, and compare with published measurements. We find that our models easily fit the observed γ-ray spectrum for NGC 253 while constraining the cosmic-ray source spectral index and acceleration efficiency. However, we encountered difficultly modeling the observed radio data and constraining the speed of the galactic wind and the magnetic field strength, unless the gas mass is less than currently preferred values. Additionally, our starburst model consistently underestimates the observed γ-ray flux and overestimates the radio flux for NGC 1068; these issues would be resolved if the AGN is the primary source of γ-rays. We discuss the implications of these results and make predictions for the neutrino fluxes for both galaxies.

  8. Diffuse Gamma-Ray Emission from the Starburst Galaxy NGC 253

    Science.gov (United States)

    Bertsch, David L.; Paglione, Timothy A. D.; Marscher, Alan P.; Jackson, James M.

    1995-01-01

    The starburst galaxy NGC 253 was observed with the Energetic Gamma Ray Experiment Telescope (EGRET) aboard the Compton Gamma Ray Observatory (CGRO) satellite. We obtain a 2 sigma upper limit to the gamma-ray emission above 100 MeV of 8 x 10(exp -8) photons/sq cm/s. Because of their large gas column densities and supernova rates, nearby starburst galaxies were predicted to have gamma-ray fluxes detectable by EGRET. Our nondetection of gamma-rays from NGC 253 motivates us to reexamine in detail the premise of supernova acceleration of cosmic rays and the effect of enhanced cloud densities, photon densities, and magnetic fields on the high-energy spectra of galaxies. By modeling the expected gamma-ray and synchrotron spectra from NGC 253, we find that up to 20% of the energy from supernovae is transferred to cosmic rays in the starburst, which is consistent with supernova acceleration models. Our calculations match the EGRET and radio data well with a supernova rate of 0.08/yr, a magnetic field B greater than or approximately equal to 5 x 10(exp -5) G, a density n approximately 300/cu cm, a photon density U(sub ph) approximately 200 eV/cu cm, and an escape timescale tau(sub o) less than or approximately equal to 10 Myr.

  9. Depletion of cdc-25.3, a Caenorhabditis elegans orthologue of cdc25, increases physiological germline apoptosis.

    Science.gov (United States)

    Sung, Minhee; Kawasaki, Ichiro; Shim, Yhong-Hee

    2017-07-01

    In Caenorhabditis elegans hermaphrodites, physiological germline apoptosis is higher in cdc-25.3 mutants than in wild-type. The elevated germline apoptosis in cdc-25.3 mutants seems to be induced by accumulation of double-stranded DNA breaks (DSBs). Both DNA damage and synapsis checkpoint genes are required to increase the germline apoptosis. Notably, the number of germ cells that lose P-granule components, PGL-1 and PGL-3, increase in cdc-25.3 mutants, and the increase in germline apoptosis requires the activity of SIR-2.1, a Sirtuin orthologue. These results suggest that elevation of germline apoptosis in cdc-25.3 mutants is induced by accumulation of DSBs, leading to a loss of PGL-1 and PGL-3 in germ cells, which promotes cytoplasmic translocation of SIR-2.1, and finally activates the core apoptotic machinery. © 2017 Federation of European Biochemical Societies.

  10. 40 CFR 147.253 - Existing Class I, II (except enhanced recovery and hydrocarbon storage) and III wells authorized...

    Science.gov (United States)

    2010-07-01

    ... recovery and hydrocarbon storage) and III wells authorized by rule. 147.253 Section 147.253 Protection of... operating requirements of § 144.28(f)(3) (i) or (ii) as applicable; or (b) A value for well head pressure calculated by using the following formula: Pm=(0.733−0.433 Sg)d where: Pm=injection pressure at the well head...

  11. CO(4-3) and CO(7-6) maps of the nucleus of NGC 253

    Science.gov (United States)

    Güsten, R.; Philipp, S. D.; Weiß, A.; Klein, B.

    2006-08-01

    Context: .Molecular line excitation studies of the nuclei of nearby starburst galaxies yield important information on the starburst phenomena, in particular on the temperature and density of the star-forming gas. Such studies also provide templates for high redshift galaxies with even more extreme star formation. Aims: .Fundamental constraints on the physical properties in the nuclear regions of external galaxies can be derived from the spectral energy distribution (i.e., integrated flux density vs. rotational quantum number) of CO rotational emission arising from warm gas. Methods: .The resolution and sensitivity of the APEX telescope makes it feasible to perform spatially resolved studies of submillimeter (submm) CO emission from the warm, dense gas in nearby starburst nuclei. Using the FLASH dual-channel heterodyne receiver we mapped emission in the CO J=4-3 and 7-6 lines toward the archetypical nuclear starburst galaxy NGC 253. Results: .Combining our new observations with data from the literature, we derive the CO line SED in the central 250 pc of NGC 253, which peaks near the 6-5 transition and has a shape very similar to that of M 82. All CO transitions in the central region can well be fitted with a single temperature/density Large Velocity Gradient (LVG) model. A good match to the observations is found by assuming kinetic gas temperatures that are comparable to the dust temperature ({T}kin ≈ 60 K) and a H2 density of order 104 cm-3. Conclusions: .Our very first APEX submm study of a nearby starburst nucleus (NGC 253) meaningfully constrains the physical properties of the star-forming molecular gas it contains. With broader band spectrometers and a chopping secondary coming soon, the impact of APEX on extragalactic astrophysics will be foreseeably significant.

  12. Chandra Observations of the Evening Core of the Starburst Galaxy NGC 253

    Science.gov (United States)

    Weaver, K. A.; Heckman, T. M.; Dahlem, M.; White, Nicholas E. (Technical Monitor)

    2002-01-01

    Chandra observations of the core of the nearby starburst galaxy NGC 253 reveal a heavily absorbed source of hard X-rays embedded within the nuclear starburst region. The source has an unabsorbed, 2 to 10 keV luminosity of greater than or equal to 10(exp 39) erg per s and photoionizes the surrounding gas. We observe this source through a dusty torus with a neutral absorbing column density of N(sub eta) approximately 2 x 10(exp 23)cm (exp -2). The torus is hundreds of pc across and collimates the starburst-driven nuclear outflow. We suggest that the ionizing source is an intermediate-mass black hole or a weakly accreting supermassive black hole, which may signal the beginnings or endings of AGN (active galactic nuclei) activity.

  13. Study of 253 dogs in the United Kingdom with diabetes mellitus.

    Science.gov (United States)

    Davison, L J; Herrtage, M E; Catchpole, B

    2005-04-09

    Clinical information and blood samples were collected from 253 dogs with naturally occurring diabetes mellitus. Over half of them were labrador retrievers, collies, Yorkshire terriers or crossbred dogs, and approximately 80 per cent of them were diagnosed between the ages of five and 12 years. The majority of the dogs were receiving insulin therapy once a day, but in the dogs receiving insulin injections twice a day there was a trend for lower serum fructosamine concentrations, suggesting better glycaemic control. The proportion of female dogs with diabetes was lower than in previous surveys. The disease was diagnosed more commonly in the winter months, a seasonal pattern also observed in human beings with diabetes, suggesting that similar environmental factors might be involved in the disease.

  14. H I studies of the Sculptor group galaxies. V. NGC 253

    International Nuclear Information System (INIS)

    Puche, D.; Carignan, C.; Van Gorkom, J.H.

    1991-01-01

    A study of the H I properties and mass distribution of the Sculptor group galaxy NGC 253, from VLA obserations, is presented. The detected H I disk is fairly small with a diameter of about 0.8 D HO. The rotation curve, derived from the velocity field using a full tilted ring model, is still rising at the last observed point. The maximum observed rotation velocity is 224 km/s at a radius of 8.5 kpc. From this analysis, a systematic velocity of 245 km/s, a mean inclination of 72 deg, and a mean position angle of 229 deg are derived. The study of the mass distribution shows that a two-component (luminous and dark) mass model is needed to explain the observed rotation curve over the whole radius range. 24 refs

  15. In-beam study of {sup 253}No using the SAGE spectrometer

    Energy Technology Data Exchange (ETDEWEB)

    Mistry, A.K.; Herzberg, R.D.; Butler, P.A.; Cox, D.M.; Joss, D.T.; Page, R.D.; Seddon, D.; Thornhill, J.; Wells, D. [University of Liverpool, Oliver Lodge Laboratory, Liverpool (United Kingdom); Greenlees, P.T.; Papadakis, P.; Auranen, K.; Grahn, T.; Jakobsson, U.; Julin, R.; Konki, J.; Leino, M.; Pakarinen, J.; Peura, P.; Rahkila, P.; Sandzelius, M.; Scholey, C.; Sorri, J.; Stolze, S.; Uusitalo, J. [University of Jyvaskyla, Department of Physics, Jyvaskyla (Finland); Garnsworthy, A.B.; Ketelhut, S. [University of British Columbia, TRIUMF, Vancouver, British Columbia (Canada); Hauschild, K.; Lopez-Martens, A. [Universite Paris-Sud, CSNSM, CNRS, IN2P3, Orsay (France); Simpson, J. [STFC, Daresbury Laboratory, Daresbury, Warrington (United Kingdom)

    2017-02-15

    The heavy actinide nucleus {sup 253}No (Z = 102) was studied using the (S)ilicon (A)nd (Ge)rmanium (SAGE) spectrometer allowing simultaneous in-beam γ-ray and conversion electron spectroscopy at the accelerator laboratory of the University of Jyvaeskylae. Using the recoil-tagging technique, γ-electron coincidences have allowed for the extension of the level scheme in the lower-spin region of the yrast band. In addition, internal conversion coefficient (ICC) measurements to establish the multipolarity of transitions have been performed. Measurement of the interband-intraband branching ratios supports the assignment of the Nilsson band-head configuration 9/2{sup -}[734] assigned in previous studies. The study shows the viability of combined in-beam electron and γ-ray spectroscopy down to μb cross sections. (orig.)

  16. Suppression of star formation in the galaxy NGC 253 by a starburst-driven molecular wind.

    Science.gov (United States)

    Bolatto, Alberto D; Warren, Steven R; Leroy, Adam K; Walter, Fabian; Veilleux, Sylvain; Ostriker, Eve C; Ott, Jürgen; Zwaan, Martin; Fisher, David B; Weiss, Axel; Rosolowsky, Erik; Hodge, Jacqueline

    2013-07-25

    The under-abundance of very massive galaxies in the Universe is frequently attributed to the effect of galactic winds. Although ionized galactic winds are readily observable, most of the expelled mass (that is, the total mass flowing out from the nuclear region) is likely to be in atomic and molecular phases that are cooler than the ionized phases. Expanding molecular shells observed in starburst systems such as NGC 253 (ref. 12) and M 82 (refs 13, 14) may facilitate the entrainment of molecular gas in the wind. Although shell properties are well constrained, determining the amount of outflowing gas emerging from such shells and the connection between this gas and the ionized wind requires spatial resolution better than 100 parsecs coupled with sensitivity to a wide range of spatial scales, a combination hitherto not available. Here we report observations of NGC 253, a nearby starburst galaxy (distance ∼ 3.4 megaparsecs) known to possess a wind, that trace the cool molecular wind at 50-parsec resolution. At this resolution, the extraplanar molecular gas closely tracks the Hα filaments, and it appears to be connected to expanding molecular shells located in the starburst region. These observations allow us to determine that the molecular outflow rate is greater than 3 solar masses per year and probably about 9 solar masses per year. This implies a ratio of mass-outflow rate to star-formation rate of at least 1, and probably ∼3, indicating that the starburst-driven wind limits the star-formation activity and the final stellar content.

  17. THE COMPACT STAR-FORMING COMPLEX AT THE HEART OF NGC 253

    Energy Technology Data Exchange (ETDEWEB)

    Davidge, T. J., E-mail: tim.davidge@nrc.ca [Dominion Astrophysical Observatory, National Research Council of Canada, 5071 West Saanich Road, Victoria, BC V9E 2E7 (Canada)

    2016-02-20

    We discuss integral field spectra of the compact star-forming complex that is the brightest near-infrared (NIR) source in the central regions of the starburst galaxy NGC 253. The spectra cover the H and K passbands and were recorded with the Gemini NIR Spectrograph during subarcsecond seeing conditions. Absorption features in the spectrum of the star-forming complex are weaker than in the surroundings. An absorption feature is found near 1.78 μm that coincides with the location of a C{sub 2} bandhead. If this feature is due to C{sub 2} then the star-forming complex has been in place for at least a few hundred Myr. Emission lines of Brγ, [Fe ii], and He i 2.06 μm do not track the NIR continuum light. Pockets of star-forming activity that do not have associated concentrations of red supergiants, and so likely have ages <8 Myr, are found along the western edge of the complex, and there is evidence that one such pocket contains a rich population of Wolf–Rayet stars. Unless the star-forming complex is significantly more metal-poor than the surroundings, then a significant fraction of its total mass is in stars with ages <8 Myr. If the present-day star formation rate is maintained then the timescale to double its stellar mass ranges from a few Myr to a few tens of Myr, depending on the contribution made by stars older than ∼8 Myr. If—as suggested by some studies—the star-forming complex is centered on the galaxy’s nucleus, which presumably contains a large population of old and intermediate-age stars, then the nucleus of NGC 253 is currently experiencing a phase of rapid growth in its stellar mass.

  18. En undersøgelse af de 253 første nyrestensbehandlinger med 3. generations Siemens Lithoskop™

    DEFF Research Database (Denmark)

    Kruckow, Line; Eldrup, Jesper

    Introduktion: Kandidatspecialets formål er at undersøge et års behandlinger af nyresten ved ny stenknuser, Siemens Lithoskop. Undersøgelsen fokuserer på hvorvidt stenstørrelse, BMI og stenplacering har indflydelse på stenfrihedsraten. Metode: Mellem 6/12-11 og 11/12-12 blev 253 behandlinger og...

  19. 37 CFR 253.5 - Performance of musical compositions by public broadcasting entities licensed to colleges and...

    Science.gov (United States)

    2010-07-01

    ... 37 Patents, Trademarks, and Copyrights 1 2010-07-01 2010-07-01 false Performance of musical... BROADCASTING § 253.5 Performance of musical compositions by public broadcasting entities licensed to colleges and universities. (a) Scope. This section applies to the performance of copyrighted published...

  20. A VST and VISTA study of globular clusters in NGC 253

    Science.gov (United States)

    Cantiello, Michele; Grado, Aniello; Rejkuba, Marina; Arnaboldi, Magda; Capaccioli, Massimo; Greggio, Laura; Iodice, Enrica; Limatola, Luca

    2018-03-01

    Context. Globular clusters (GCs) are key to our understanding of the Universe, as laboratories of stellar evolution, fossil tracers of the past formation epoch of the host galaxy, and effective distance indicators from local to cosmological scales. Aim. We analyze the properties of the sources in the NGC 253 with the aim of defining an up to date catalog of GC candidates in the galaxy. Given the distance of the galaxy, GCs in NGC 253 are ideal targets for resolved color-magnitude diagram studies of extragalactic GCs with next-generation diffraction limited ground-based telescopes. Methods: Our analysis is based on the science verification data of two ESO survey telescopes, VST and VISTA. Using ugri photometry from VST and JKs from VISTA, GC candidates were selected using as reference the morpho-photometric and color properties of spectroscopically confirmed GCs available in the literature. The strength of the results was verified against available archival HST/ACS data from the GHOSTS survey: all but two of the selected GC candidates appear as star clusters in HST footprints. Results: The adopted GC selection leads to the definition of a sample of ˜350 GC candidates. At visual inspection, we find that 82 objects match all the requirements for selecting GC candidates and 155 are flagged as uncertain GC candidate; however, 110 are unlikely GCs, which are most likely background galaxies. Furthermore, our analysis shows that four of the previously spectroscopically confirmed GCs, i.e., ˜20% of the total spectroscopic sample, are more likely either background galaxies or high-velocity Milky Way stars. The radial density profile of the selected best candidates shows the typically observed r1/4-law radial profile. The analysis of the color distributions reveals only marginal evidence of the presence of color bimodality, which is normally observed in galaxies of similar luminosity. The GC luminosity function does not show the typical symmetry, mainly because of the lack

  1. Gene Mutation Analysis in 253 Chinese Children with Unexplained Epilepsy and Intellectual/Developmental Disabilities.

    Science.gov (United States)

    Zhang, Yujia; Kong, Weijing; Gao, Yang; Liu, Xiaoyan; Gao, Kai; Xie, Han; Wu, Ye; Zhang, Yuehua; Wang, Jingmin; Gao, Feng; Wu, Xiru; Jiang, Yuwu

    2015-01-01

    Epilepsy and intellectual/developmental disabilities (ID/DD) have a high rate of co-occurrence. Here, we investigated gene mutations in Chinese children with unexplained epilepsy and ID/DD. We used targeted next-generation sequencing to detect mutations within 300 genes related to epilepsy and ID/DD in 253 Chinese children with unexplained epilepsy and ID/DD. A series of filtering criteria was used to find the possible pathogenic variations. Validation and parental origin analyses were performed by Sanger sequencing. We reviewed the phenotypes of patients with each mutated gene. We identified 32 novel and 16 reported mutations within 24 genes in 46 patients. The detection rate was 18% (46/253) in the whole group and 26% (17/65) in the early-onset (before three months after birth) epilepsy group. To our knowledge, we are the first to report KCNAB1 is a disease-causing gene of epilepsy by identifying a novel de novo mutation (c.1062dupCA p.Leu355HisfsTer5) within this gene in one patient with early infantile epileptic encephalopathy (EIEE). Patients with an SCN1A mutation accounted for the largest proportion, 17% (8/46). A total of 38% (9/24) of the mutated genes re-occurred at least 2 times and 63% (15/24) occurred only one time. Ion channel genes are the most common (8/24) and genes related to synapse are the next most common to occur (5/24). We have established genetic diagnosis for 46 patients of our cohort. Early-onset epilepsy had the highest detection rate. KCNAB1 mutation was first identified in EIEE patient. We expanded the phenotype and mutation spectrum of the genes we identified. The mutated genes in this cohort are mostly isolated. This suggests that epilepsy and ID/DD phenotypes occur as a consequence of brain dysfunction caused by a highly diverse population of mutated genes. Ion channel genes and genes related to synapse were more common mutated in this patient cohort.

  2. Gene Mutation Analysis in 253 Chinese Children with Unexplained Epilepsy and Intellectual/Developmental Disabilities

    Science.gov (United States)

    Gao, Yang; Liu, Xiaoyan; Gao, Kai; Xie, Han; Wu, Ye; Zhang, Yuehua; Wang, Jingmin; Gao, Feng; Wu, Xiru; Jiang, Yuwu

    2015-01-01

    Objective Epilepsy and intellectual/developmental disabilities (ID/DD) have a high rate of co-occurrence. Here, we investigated gene mutations in Chinese children with unexplained epilepsy and ID/DD. Methods We used targeted next-generation sequencing to detect mutations within 300 genes related to epilepsy and ID/DD in 253 Chinese children with unexplained epilepsy and ID/DD. A series of filtering criteria was used to find the possible pathogenic variations. Validation and parental origin analyses were performed by Sanger sequencing. We reviewed the phenotypes of patients with each mutated gene. Results We identified 32 novel and 16 reported mutations within 24 genes in 46 patients. The detection rate was 18% (46/253) in the whole group and 26% (17/65) in the early-onset (before three months after birth) epilepsy group. To our knowledge, we are the first to report KCNAB1 is a disease-causing gene of epilepsy by identifying a novel de novo mutation (c.1062dupCA p.Leu355HisfsTer5) within this gene in one patient with early infantile epileptic encephalopathy (EIEE). Patients with an SCN1A mutation accounted for the largest proportion, 17% (8/46). A total of 38% (9/24) of the mutated genes re-occurred at least 2 times and 63% (15/24) occurred only one time. Ion channel genes are the most common (8/24) and genes related to synapse are the next most common to occur (5/24). Significance We have established genetic diagnosis for 46 patients of our cohort. Early-onset epilepsy had the highest detection rate. KCNAB1 mutation was first identified in EIEE patient. We expanded the phenotype and mutation spectrum of the genes we identified. The mutated genes in this cohort are mostly isolated. This suggests that epilepsy and ID/DD phenotypes occur as a consequence of brain dysfunction caused by a highly diverse population of mutated genes. Ion channel genes and genes related to synapse were more common mutated in this patient cohort. PMID:26544041

  3. Gene Mutation Analysis in 253 Chinese Children with Unexplained Epilepsy and Intellectual/Developmental Disabilities.

    Directory of Open Access Journals (Sweden)

    Yujia Zhang

    Full Text Available Epilepsy and intellectual/developmental disabilities (ID/DD have a high rate of co-occurrence. Here, we investigated gene mutations in Chinese children with unexplained epilepsy and ID/DD.We used targeted next-generation sequencing to detect mutations within 300 genes related to epilepsy and ID/DD in 253 Chinese children with unexplained epilepsy and ID/DD. A series of filtering criteria was used to find the possible pathogenic variations. Validation and parental origin analyses were performed by Sanger sequencing. We reviewed the phenotypes of patients with each mutated gene.We identified 32 novel and 16 reported mutations within 24 genes in 46 patients. The detection rate was 18% (46/253 in the whole group and 26% (17/65 in the early-onset (before three months after birth epilepsy group. To our knowledge, we are the first to report KCNAB1 is a disease-causing gene of epilepsy by identifying a novel de novo mutation (c.1062dupCA p.Leu355HisfsTer5 within this gene in one patient with early infantile epileptic encephalopathy (EIEE. Patients with an SCN1A mutation accounted for the largest proportion, 17% (8/46. A total of 38% (9/24 of the mutated genes re-occurred at least 2 times and 63% (15/24 occurred only one time. Ion channel genes are the most common (8/24 and genes related to synapse are the next most common to occur (5/24.We have established genetic diagnosis for 46 patients of our cohort. Early-onset epilepsy had the highest detection rate. KCNAB1 mutation was first identified in EIEE patient. We expanded the phenotype and mutation spectrum of the genes we identified. The mutated genes in this cohort are mostly isolated. This suggests that epilepsy and ID/DD phenotypes occur as a consequence of brain dysfunction caused by a highly diverse population of mutated genes. Ion channel genes and genes related to synapse were more common mutated in this patient cohort.

  4. 30 CFR 253.28 - What financial test procedures must I use to evaluate the amount of self-insurance allowed as...

    Science.gov (United States)

    2010-07-01

    ... 30 Mineral Resources 2 2010-07-01 2010-07-01 false What financial test procedures must I use to... 253.28 Mineral Resources MINERALS MANAGEMENT SERVICE, DEPARTMENT OF THE INTERIOR OFFSHORE OIL SPILL FINANCIAL RESPONSIBILITY FOR OFFSHORE FACILITIES Methods for Demonstrating OSFR § 253.28 What financial test...

  5. The Compact Star-forming Complex at the Heart of NGC 253

    Science.gov (United States)

    Davidge, T. J.

    2016-02-01

    We discuss integral field spectra of the compact star-forming complex that is the brightest near-infrared (NIR) source in the central regions of the starburst galaxy NGC 253. The spectra cover the H and K passbands and were recorded with the Gemini NIR Spectrograph during subarcsecond seeing conditions. Absorption features in the spectrum of the star-forming complex are weaker than in the surroundings. An absorption feature is found near 1.78 μm that coincides with the location of a C2 bandhead. If this feature is due to C2 then the star-forming complex has been in place for at least a few hundred Myr. Emission lines of Brγ, [Fe II], and He I 2.06 μm do not track the NIR continuum light. Pockets of star-forming activity that do not have associated concentrations of red supergiants, and so likely have ages National Aeronautics and Space Administration.

  6. Gas phase photolysis of ethyl bromide at 253.7 nm

    International Nuclear Information System (INIS)

    Frank, A.J.; Hanrahan, R.J.

    1978-01-01

    The photolysis of ethyl bromide was studied at 100 torr and 23 0 C using 253.7-nm radiation. In the pure system between 60 and 90 s at an absorbed light intensity of 8.3 x 10 13 quanta/cm 3 s the major products and their respective quantum yields are as follows: hydrogen bromide, 0.26; ethane, 0.40; ethylene, 0.028; 1,1-dibromoethane, 0.102; 1,2-dibromoethane, 0.0092; vinyl bromide, 0.009; 1,1,2-tribromoethane, 0.0027; methane, 0.00052; and methyl bromide, 0.00091. When 5 mol % oxygen is added, the quantum yields in this time period become the following: hydrogen bromide, 0.47; ethane, 0.00032; ethylene, 0.0081; 1,1-dibromoethane, 0.0040; 1,2-dibromoethane, 0.022; vinyl bromide, 0; 1,1,2-tribromoethane, 0; methane, 0.0001; and methyl bromide, 0.091. Bromine is also formed with a quantum yield of 0.22. At long photolysis times the HBr and C 2 H 4 go into a stationary state, and the main photolysis products are C 2 H 6 and 1,1-C 2 H 4 Br 2 with quantum yields of 0.24 and 0.17, respectively. The behavior of the system is interpreted based on a model involving C--Br rupture as the main primary process (phi = 0.8) with a substantial contribution of HBr elimination (phi = 0.2). Primary C 2 H 5 . and Br . fragments abstract hydrogen from the substrate to produce mainly the 1-C 2 H 4 Br. radical. Net product formation involves reaction of radical species with Br 2 (present at low, steady-state concentration -5 M), Br. atoms, or HBr. The dynamic behavior of the system was investigated by computer simulation and compared with experimental results. 2 tables, 7 figures

  7. STAR FORMATION IN THE MASSIVE ''STARLESS'' INFRARED DARK CLOUD G0.253+0.016

    Energy Technology Data Exchange (ETDEWEB)

    Rodriguez, Luis F.; Zapata, Luis A., E-mail: lrodriguez@crya.unam.mx, E-mail: lzapata@crya.unam.mx [Centro de Radioastronomia y Astrofisica, UNAM, Apdo. Postal 3-72 (Xangari), 58089 Morelia, Michoacan (Mexico)

    2013-04-10

    G0.253+0.016 is a remarkable massive infrared dark cloud located within {approx}100 pc of the galactic center. With a high mass of 1.3 Multiplication-Sign 10{sup 5} M{sub Sun }, a compact average radius of {approx}2.8 pc, and a low dust temperature of 23 K, it has been believed to be a yet starless precursor to a massive Arches-like stellar cluster. We present sensitive JVLA 1.3 and 5.6 cm radio continuum observations that reveal the presence of three compact thermal radio sources projected against this cloud. These radio sources are interpreted as H II regions powered by {approx}B0.5 zero-age main sequence stars. We conclude that although G0.253+0.016 does not show evidence of O-type star formation, there are certainly early B-type stars embedded in it. We detect three more sources in the periphery of G0.253+0.016 with non-thermal spectral indices. We suggest that these sources may be related to the galactic center region and deserve further study.

  8. G0.253 + 0.016: A MOLECULAR CLOUD PROGENITOR OF AN ARCHES-LIKE CLUSTER

    Energy Technology Data Exchange (ETDEWEB)

    Longmore, Steven N.; Ascenso, Joana; Testi, Leonardo; Bressert, Eli [European Southern Observatory, Karl-Schwarzschild-Str. 2, 85748 Garching bei Munchen (Germany); Rathborne, Jill [CSIRO Astronomy and Space Science, Epping, Sydney (Australia); Bastian, Nate [Excellence Cluster Universe, Boltzmannstr. 2, 85748 Garching (Germany); Alves, Joao; Meingast, Stefan [Institute of Astronomy, University of Vienna, Tuerkenschanzstrasse 17, 1180 Vienna (Austria); Bally, John; Battersby, Cara [Center for Astrophysics and Space Astronomy, University of Colorado, UCB 389, Boulder, CO 80309 (United States); Longmore, Andy [UK Astronomy Technology Centre, Royal Observatory, Blackford Hill, Edinburgh EH9 3HJ (United Kingdom); Purcell, Cormac [School of Physics and Astronomy, University of Leeds, Leeds LS2 9JT (United Kingdom); Walsh, Andrew [Department of Astronomy, James Cook University, Townesville (Australia); Jackson, James; Foster, Jonathan [Institute for Astrophysical Research, Boston University, Boston, MA 02215 (United States); Molinari, Sergio [INAF-Istituto Fisica Spazio Interplanetario, Via Fosso del Cavaliere 100, I-00133, Rome (Italy); Amorim, A.; Lima, J.; Marques, R.; Moitinho, A., E-mail: slongmor@eso.org [SIM, Faculdade de Ciencias da Universidade de Lisboa, Ed. C8. Campo Grande 1749-016 Lisbon (Portugal); and others

    2012-02-20

    Young massive clusters (YMCs) with stellar masses of 10{sup 4}-10{sup 5} M{sub Sun} and core stellar densities of 10{sup 4}-10{sup 5} stars per cubic pc are thought to be the 'missing link' between open clusters and extreme extragalactic super star clusters and globular clusters. As such, studying the initial conditions of YMCs offers an opportunity to test cluster formation models across the full cluster mass range. G0.253 + 0.016 is an excellent candidate YMC progenitor. We make use of existing multi-wavelength data including recently available far-IR continuum (Herschel/Herschel Infrared Galactic Plane Survey) and mm spectral line (H{sub 2}O Southern Galactic Plane Survey and Millimetre Astronomy Legacy Team 90 GHz Survey) data and present new, deep, multiple-filter, near-IR (Very Large Telescope/NACO) observations to study G0.253 + 0.016. These data show that G0.253 + 0.016 is a high-mass (1.3 Multiplication-Sign 10{sup 5} M{sub Sun }), low-temperature (T{sub dust} {approx} 20 K), high-volume, and column density (n {approx} 8 Multiplication-Sign 10{sup 4} cm{sup -3}; N{sub H{sub 2}}{approx}4 Multiplication-Sign 10{sup 23} cm{sup -2}) molecular clump which is close to virial equilibrium (M{sub dust} {approx} M{sub virial}) so is likely to be gravitationally bound. It is almost devoid of star formation and, thus, has exactly the properties expected for the initial conditions of a clump that may form an Arches-like massive cluster. We compare the properties of G0.253 + 0.016 to typical Galactic cluster-forming molecular clumps and find it is extreme, and possibly unique in the Galaxy. This uniqueness makes detailed studies of G0.253 + 0.016 extremely important for testing massive cluster formation models.

  9. Experimental determination of the solubility product of dolomite at 50-253 °C

    Science.gov (United States)

    Bénézeth, Pascale; Berninger, Ulf-Niklas; Bovet, Nicolas; Schott, Jacques; Oelkers, Eric H.

    2018-03-01

    The 'dolomite problem', the scarcity of present-day dolomite formation near the Earth's surface, has attracted much attention over the past century. Solving this problem requires having reliable data on the stability and kinetics of formation of this mineral. Toward this goal, the solubility of natural dolomite (CaMg(CO3)2) has been measured from 50 to 253 °C in 0.1 mol/kg NaCl solutions using a hydrogen electrode concentration cell (HECC). The obtained apparent solubility products (Kapp-sp-dol), for the reaction: CaMg(CO3)2 = Ca2+ + Mg2+ + 2CO32-, were extrapolated to infinite dilution to generate the solubility product constants for this reaction (Ksp°-dol). The derived equilibrium constants were fit and can be accurately described by log10Ksp°-dol = a + b/T (K) + cT (K) where a = 17.502, b = -4220.119 and c = -0.0689. This equation and its first and second derivatives with respect to T were used together with corresponding aqueous species properties to calculate the revised standard state thermodynamic properties of dolomite at 25 °C and 1 bar, yielding a Gibbs energy of formation (Δf G298.15∘) equal to -2160.9 ± 2 kJ/mol, (log10Ksp°-dol = -17.19 ± 0.3); an enthalpy of formation (Δf H298.15∘) of -2323.1 ± 2 kJ/mol, an entropy (S298.15∘) of 156.9 ± 2 J/mol/K and heat capacity (Cp298.15∘) of 154.2 ± 2 J/mol/K (uncertainties are 3σ). The dolomite solubility product derived in this study is nearly identical to that computed using SUPCRT92 (Johnson et al., 1992) at 200 °C, but about one order of magnitude higher at 50 and 25 °C, suggesting that dolomite may be somewhat less stable than previously assumed at ambient temperatures.

  10. Spatially resolving a starburst galaxy at hard X-ray energies: NuSTAR, CHANDRA, AND VLBA observations of NGC 253

    DEFF Research Database (Denmark)

    Wik, D. R.; Lehmer, B. D.; Hornschemeier, A. E.

    2014-01-01

    for the first time. As a follow up to our initial study of its nuclear region, we present the first results concerning the full galaxy from simultaneous NuSTAR, Chandra, and Very Long Baseline Array monitoring of the local starburst galaxy NGC 253. Above ~10 keV, nearly all the emission is concentrated within...... 253 is typical of starburst galaxies at higher redshift, their contribution to the E > 10 keV cosmic X-ray background is...

  11. Physicochemical properties of binary solutions of propylene carbonate-acetonitrile in the range of 253.15-313.15 K

    Science.gov (United States)

    Tyunina, E. Yu.; Chekunova, M. D.

    2017-05-01

    The density, dynamic viscosity, and dielectric constant of propylene carbonate solutions with acetonitrile are measured over the composition of a mixed solvent at temperatures of 253.15, 273.15, 293.15, and 313.15 K. The molar volume, molar viscosity, and molar capacity of a mixture of propylene carbonate-acetonitrile and an excess amount of it are calculated. The effect the temperature and composition of the mixture have on the excess molar properties is discussed. A linear correlation is observed between the values of the molar fluidity, capacity, polarization, and molar volume of the studied system.

  12. Direct Evidence for Maser Emission from the 36.2 GHz Class I Transition of Methanol in NGC253

    Science.gov (United States)

    Chen, Xi; Ellingsen, Simon P.; Shen, Zhi-Qiang; McCarthy, Tiege P.; Zhong, Wei-Ye; Deng, Hui

    2018-04-01

    Observations made with the Jansky Very large Array (JVLA) at an angular resolution of ∼0.″1 have detected class I methanol maser emission from the 36.2 GHz transition toward the starburst galaxy NGC 253. The methanol emission is detected toward four sites which lie within the regions of extended methanol emission detected in previous lower angular resolution (a few arcseconds) observations. The peak flux densities of the detected compact components are in the range 3–9 mJy beam‑1. Combining the JVLA data with single-dish observations from the Shanghai Tianma Radio Telescope (TMRT) and previous interferometric observations with the Australia Telescope Compact Array (ATCA), we show that the 36.2 GHz class I methanol emission consists of both extended and compact structures, with typical scales of ∼6″ (0.1 kpc) and ∼0.″05 (1 pc), respectively. The strongest components have a brightness temperature of >103 K, much higher than the maximum kinetic temperature (∼100 K) of the thermal methanol emission from NGC 253. Therefore, these observations conclusively demonstrate for the first time the presence of maser emission from a class I methanol transition in an external galaxy.

  13. Apert Syndrome: Molecularly Confirmed C.758C>G (P.Pro253Arg) in FGFR2

    Energy Technology Data Exchange (ETDEWEB)

    Cha Gon, Lee, E-mail: leechagon@eulji.ac.kr [Department of Pediatrics, Eulji General Hospital, College of Medicine, Eulji University, 68 Hangeulbiseok-ro, Nowon-gu, Seoul 139-711 (Korea, Republic of)

    2016-03-21

    A 5-day-old girl was referred to our clinic for evaluation of congenital malformations. She was identified with a pathogenic mutation c.758C>G (p.Pro253Arg) in FGFR2 gene using targeted exome sequencing. The de novo mutation was confirmed with Sanger sequencing in the patient and her parents. She showed occipital plagiocephaly with frontal bossing (Figure A and B). Skull frontal and lateral radiography revealed fusion of most of the sutures except coronal suture, with convolutional markings (Figure D and E). She had complete cleft palate (Figure C). Her fused bilateral hands showed type II syndactyly with complete syndactyly between the ring and the little fingers (Figure F1-F3). Both toes were simple syndactyly with side-to-side fusion of skin (Figure G1-)

  14. Apert Syndrome: Molecularly Confirmed C.758C>G (P.Pro253Arg) in FGFR2

    International Nuclear Information System (INIS)

    Cha Gon, Lee

    2016-01-01

    A 5-day-old girl was referred to our clinic for evaluation of congenital malformations. She was identified with a pathogenic mutation c.758C>G (p.Pro253Arg) in FGFR2 gene using targeted exome sequencing. The de novo mutation was confirmed with Sanger sequencing in the patient and her parents. She showed occipital plagiocephaly with frontal bossing (Figure A and B). Skull frontal and lateral radiography revealed fusion of most of the sutures except coronal suture, with convolutional markings (Figure D and E). She had complete cleft palate (Figure C). Her fused bilateral hands showed type II syndactyly with complete syndactyly between the ring and the little fingers (Figure F1-F3). Both toes were simple syndactyly with side-to-side fusion of skin (Figure G1-)

  15. Diverse Nuclear Star-forming Activities in the Heart of NGC 253 Resolved with 10-pc-scale ALMA Images

    Science.gov (United States)

    Ando, Ryo; Nakanishi, Kouichiro; Kohno, Kotaro; Izumi, Takuma; Martín, Sergio; Harada, Nanase; Takano, Shuro; Kuno, Nario; Nakai, Naomasa; Sugai, Hajime; Sorai, Kazuo; Tosaki, Tomoka; Matsubayashi, Kazuya; Nakajima, Taku; Nishimura, Yuri; Tamura, Yoichi

    2017-11-01

    We present an 8 pc × 5 pc resolution view of the central ˜200 pc region of the nearby starburst galaxy NGC 253, based on ALMA Band 7 (λ ≃ 0.85 {mm} or ν ˜ 350 GHz) observations covering 11 GHz. We resolve the nuclear starburst of NGC 253 into eight dusty star-forming clumps, 10 pc in scale, for the first time. These clumps, each of which contains (4-10) × {10}4 {M}⊙ of dust (assuming that the dust temperature is 25 K) and up to 6× {10}2 massive (O5V) stars, appear to be aligned in two parallel ridges, while they have been blended in previous studies. Despite the similarities in sizes and dust masses of these clumps, their line spectra vary drastically from clump to clump, although they are separated by only ˜10 pc. Specifically, one of the clumps, Clump 1, exhibits line-confusion-limited spectra with at least 36 emission lines from 19 molecules (including CH3OH, HNCO, H2CO, CH3CCH, H2CS, and H3O+) and a hydrogen recombination line (H26α), while far fewer kinds of molecular lines are detected in some other clumps where fragile species, such as complex organic molecules and HNCO, completely disappear from their spectra. We demonstrate the existence of hot molecular gas ({T}{rot}({{SO}}2)=90+/- 11 K) in the former clump, which suggests that the hot and chemically rich environments are localized within a 10-pc-scale star-forming clump.

  16. Two unrelated children with overlapping 6q25.3 deletions, motor speech disorders, and language delays.

    Science.gov (United States)

    Peter, Beate; Lancaster, Hope; Vose, Caitlin; Fares, Amna; Schrauwen, Isabelle; Huentelman, Matthew

    2017-10-01

    Interstitial and terminal 6q25 deletions are associated with developmental delays, hypotonia, eye pathologies, craniofacial dysmorphologies, and structural brain anomalies. In most cases, speech and language deficits are not described in detail. We report on a case (Patient 1, age 7 years) with a de novo 6q25.3-qter deletion, 11.1 Mb long and encompassing 108 genes, and a case (Patient 2, age 5 years) with an inherited interstitial 6q25.3 deletion, located within Patient 1's deletion region and 403 kb long, the smallest 6q25 deletion reported to date. Both children have hypotonia, motor speech disorders, and expressive language delays. Patient 1's speech was characterized by childhood apraxia of speech (CAS) and dysarthria. Other findings include developmental delay, ataxic cerebral palsy, optic nerve dysplagia, and atypical brain morphologies regarding the corpus callosum and gyration patterns, a clinical profile that closely matches a previously reported case with a nearly identical deletion. Patient 2 had speech characterized by CAS and typical nonverbal processing abilities. His father, a carrier, had typical speech and language but showed difficulties with complex motor speech and hand motor tasks, similar to other adults with residual signs of CAS. The small deletion in this family contains the IGF2R-AIRN-SLC22A2-SLC22A3 gene cluster, which is associated with imprinting and maternal-specific expression of Igf2R, Slc22a2, and Slc22a3 in mice, whereas imprinting in humans is a polymorphic trait. The shared phenotypes in the two patients might be associated with the deletion of the gene cluster. © 2017 Wiley Periodicals, Inc.

  17. Assessment of the clinical relevance of 17q25.3 copy number and three-dimensional telomere organization in non-small lung cancer patients.

    Science.gov (United States)

    Sunpaweravong, Patrapim; Thu, Kelsie L; Lam, Wan L; Mai, Sabine

    2016-04-01

    To identify potential biomarkers that may provide new therapeutic targets or prognostic indicators for non-small cell lung cancer (NSCLC), we investigated the three-dimensional (3D) organization of telomeres and cytoband 17q25.3 copy number in NSCLC tissues. NSCLC paraffin-embedded tissue specimens from 18 patients were assessed for 3D telomere organization by 3D nuclear telomere imaging followed by quantitative analysis. Patients were stratified by smoking, histology, and EGFR status. Cytoband 17q25.3 was examined by fluorescent in situ hybridization. Data from comparative genomic hybridization and/or single nucleotide polymorphism arrays for cytoband 17q25.3 were obtained and correlated with Q-FISH and 3D telomere results. 3D telomeric profiling demonstrated that the smokers, EGFR-negative, and squamous cell carcinoma subgroups tended to have higher numbers of lower-intensity telomeres, indicative of shorter telomeres, as well as higher numbers of telomeric aggregations compared to non-smokers, EGFR-positive, and adenocarcinomas, respectively. Gains of cytoband 17q25.3 in conjunction with an increase in the control region 17p11.2 were observed in 7 of 18 (38.9 %) patients, reflecting a gain of chromosome 17. Clonal gains of cytoband 17q25.3 were observed in 11 of 18 (61 %) patients, highlighting a potential biological significance for the genes in this region in NSCLC tumourigenesis. The 3D telomere profiles may differentiate NSCLC patients with different histologies, EGFR, and smoking statuses, rendering them a potential biomarker for distinguishing these clinically relevant histological and molecular subtypes of lung cancer. Highly frequent clonal gain of cytoband 17q25.3 was also demonstrated, suggesting an important biological role for the genes in this region.

  18. 30 CFR 253.25 - What financial test procedures must I use to determine the amount of self-insurance allowed as...

    Science.gov (United States)

    2010-07-01

    ... Mineral Resources MINERALS MANAGEMENT SERVICE, DEPARTMENT OF THE INTERIOR OFFSHORE OIL SPILL FINANCIAL RESPONSIBILITY FOR OFFSHORE FACILITIES Methods for Demonstrating OSFR § 253.25 What financial test procedures... 30 Mineral Resources 2 2010-07-01 2010-07-01 false What financial test procedures must I use to...

  19. Study of cyclic oxidation for stainless steels AISI 309 T 253 M A, with low additions of cerium; Estudio de la oxidacion ciclica de los aceros inoxidables AISI 309 T 253 MA, con pequenas adiciones de Cerio

    Energy Technology Data Exchange (ETDEWEB)

    Velazquez F, G.L.; Martinez, M.; Ruiz, A. [Universidad Nacional Experimental Politecnica (UNEXPO) - Vicerrectorado de Puerto Ordaz, Centro de Estudios de Corrosion. Puerto Ordaz. venezuela (Venezuela)

    1998-12-31

    It has been detected that the addition of small amounts (<1%) of the so called `reactive elements` such as Cerium to Fe-Cr alloys that was utilized in oxidating environment at high temperatures improving its resistance to oxidation under isothermal and cyclic conditions. In this work, it was evaluated the behavior under cyclic oxidation conditions for an austenitic stainless steel at chromium-nickel (253MA) with cerium addition, and comparing it with the AISI 310S austenitic stainless steel. The cyclic oxidation essays consist of five cycles by 24 hours each one, following of a cooling in air until ambient temperature from the temperatures of 850, 900 and 950 Centigrade, registering the gain mass of the specimen at end of each cycle. In order to this were prepared samples with dimensions of 20 mm. x 10 mm. x 1 mm. Later to the oxidation essays was evaluated the morphology of the corrosion products layer by scanning electron microscopy. The present phases were identified by X-ray diffraction and by chemical microanalysis by Dispersive energy (EDAX). The results obtained show that the steel with cerium addition, presents a higher adherence and resistance to the spalling noting that the cerium promotes the casting anchor of the oxides layer to matrix and by reducing the grain size of the layer improving its plasticity. Additionally the cerium promotes the preferential oxidation of the forming elements of protective layers like the chromium. (Author)

  20. miR-25-3p, Positively Regulated by Transcription Factor AP-2α, Regulates the Metabolism of C2C12 Cells by Targeting Akt1

    Directory of Open Access Journals (Sweden)

    Feng Zhang

    2018-03-01

    Full Text Available miR-25, a member of the miR-106b-25 cluster, has been reported as playing an important role in many biological processes by numerous studies, while the role of miR-25 in metabolism and its transcriptional regulation mechanism remain unclear. In this study, gain-of-function and loss-of-function assays demonstrated that miR-25-3p positively regulated the metabolism of C2C12 cells by attenuating phosphoinositide 3-kinase (PI3K gene expression and triglyceride (TG content, and enhancing the content of adenosine triphosphate (ATP and reactive oxygen species (ROS. Furthermore, the results from bioinformatics analysis, dual luciferase assay, site-directed mutagenesis, qRT-PCR, and Western blotting demonstrated that miR-25-3p directly targeted the AKT serine/threonine kinase 1 (Akt1 3′ untranslated region (3′UTR. The core promoter of miR-25-3p was identified, and the transcription factor activator protein-2α (AP-2α significantly increased the expression of mature miR-25-3p by binding to its core promoter in vivo, as indicated by the chromatin immunoprecipitation (ChIP assay, and AP-2α binding also downregulated the expression of Akt1. Taken together, our findings suggest that miR-25-3p, positively regulated by the transcription factor AP-2α, enhances C2C12 cell metabolism by targeting the Akt1 gene.

  1. Transitioning insulin pump therapy from the outpatient to the inpatient setting: a review of 6 years' experience with 253 cases.

    Science.gov (United States)

    Cook, Curtiss B; Beer, Karen A; Seifert, Karen M; Boyle, Mary E; Mackey, Patricia A; Castro, Janna C

    2012-09-01

    We reviewed the care of a large cohort of patients with diabetes mellitus on insulin pump therapy who required an inpatient stay. Records were reviewed of patients hospitalized between January 1, 2006, and December 31, 2011. A total of 136 patients using insulin pumps had 253 hospitalizations. Mean (standard deviation) patient age was 55 (16) years, diabetes duration was 29 (15) years, and pump duration was 6 (5) years. Insulin pump therapy was continued in 164 (65%) hospitalizations. Adherence to core process measures improved over time: by 2011, 100% of cases had an endocrinology consultation, 100% had the required insulin pump order set completed, and 94% had documentation of the signed agreement specifying patient responsibilities for continued use of the technology while hospitalized. Documentation of the insulin pump flow sheet also increased but could still be located in only 64% of cases by the end of 2011. Mean glucose was not significantly different among patients who remained on insulin pump therapy compared to those for whom it was discontinued (p > .1), but episodes of severe hyperglycemia (>300 mg/dl) and hypoglycemia (pump users. No pump site infections, mechanical pump failures, or episodes of diabetic ketoacidosis were observed among patients remaining on therapy. With appropriate patient selection and usage guidelines, most patients using insulin pumps can safely have their therapy transitioned to the inpatient setting. Further study is needed to determine whether this approach can be translated to other hospital settings. © 2012 Diabetes Technology Society.

  2. An ABCD1 Mutation (c.253dupC) Caused Diverse Phenotypes of Adrenoleukodystrophy in an Iranian Consanguineous Pedigree

    Science.gov (United States)

    Mehrpour, Masoud; Gohari, Faeze; Dizaji, Majid Zaki; Ahani, Ali; Malicdan, May Christine V.; Behnam, Babak

    2016-01-01

    Objectives Current study was the first to report a consanguineous Iranian pedigree with ABCD1 mutation. Methods Targeted molecular analysis was initially performed in three affected individuals in one family suspected to have X-ALD due to chronic progressive spasticity. Upon confirmation of genetic diagnosis, further neurologic and genetic evaluation of all family members was done. Results A mutation in ABCD1 was identified in 35 affected individuals (out 96 pedigree members). The c. 253dup, in exon 1, leads to a frame shift and a premature stop codon at amino acid position 194 (p.Arg85Profs*110). Surprisingly, affected individuals in our cohort show some variability in phenotype, including childhood cerebral ALD, adrenomyeloneuropathy, and addison-only disease phenotypes, expanding the phenotype of X-ALD with p.Arg85Profs*110. Conclusion This report characterizes the clinical spectrum of an expanded Iranian pedigree with X-ALD due to an ABCD1 mutation. Given a high frequency of carriers in this region, we expect the prevalence of X-ALD to be higher, underscoring the importance of genetic counseling through reliable identification of heterozygous as well as homozygote females in consanguineous communities. PMID:27489563

  3. AnABCD1Mutation (c.253dupC) Caused Diverse Phenotypes of Adrenoleukodystrophy in an Iranian Consanguineous Pedigree.

    Science.gov (United States)

    Mehrpour, Masoud; Gohari, Faeze; Dizaji, Majid Zaki; Ahani, Ali; Malicdan, May Christine V; Behnam, Babak

    2016-06-01

    Current study was the first to report a consanguineous Iranian pedigree with ABCD1 mutation. Targeted molecular analysis was initially performed in three affected individuals in one family suspected to have X-ALD due to chronic progressive spasticity. Upon confirmation of genetic diagnosis, further neurologic and genetic evaluation of all family members was done. A mutation in ABCD1 was identified in 35 affected individuals (out 96 pedigree members). The c. 253dup, in exon 1, leads to a frame shift and a premature stop codon at amino acid position 194 (p.Arg85Profs*110). Surprisingly, affected individuals in our cohort show some variability in phenotype, including childhood cerebral ALD, adrenomyeloneuropathy, and addison-only disease phenotypes, expanding the phenotype of X-ALD with p.Arg85Profs*110. This report characterizes the clinical spectrum of an expanded Iranian pedigree with X-ALD due to an ABCD1 mutation. Given a high frequency of carriers in this region, we expect the prevalence of X-ALD to be higher, underscoring the importance of genetic counseling through reliable identification of heterozygous as well as homozygote females in consanguineous communities.

  4. Study of cyclic oxidation for stainless steels AISI 309 T 253 M A, with low additions of cerium

    International Nuclear Information System (INIS)

    Velazquez F, G.L.; Martinez, M.; Ruiz, A.

    1998-01-01

    It has been detected that the addition of small amounts (<1%) of the so called 'reactive elements' such as Cerium to Fe-Cr alloys that was utilized in oxidating environment at high temperatures improving its resistance to oxidation under isothermal and cyclic conditions. In this work, it was evaluated the behavior under cyclic oxidation conditions for an austenitic stainless steel at chromium-nickel (253MA) with cerium addition, and comparing it with the AISI 310S austenitic stainless steel. The cyclic oxidation essays consist of five cycles by 24 hours each one, following of a cooling in air until ambient temperature from the temperatures of 850, 900 and 950 Centigrade, registering the gain mass of the specimen at end of each cycle. In order to this were prepared samples with dimensions of 20 mm. x 10 mm. x 1 mm. Later to the oxidation essays was evaluated the morphology of the corrosion products layer by scanning electron microscopy. The present phases were identified by X-ray diffraction and by chemical microanalysis by Dispersive energy (EDAX). The results obtained show that the steel with cerium addition, presents a higher adherence and resistance to the spalling noting that the cerium promotes the casting anchor of the oxides layer to matrix and by reducing the grain size of the layer improving its plasticity. Additionally the cerium promotes the preferential oxidation of the forming elements of protective layers like the chromium. (Author)

  5. Effect of UV irradiation (253.7 nm) on free Legionella and Legionella associated with its amoebae hosts.

    Science.gov (United States)

    Cervero-Aragó, Sílvia; Sommer, Regina; Araujo, Rosa M

    2014-12-15

    Water systems are the primary reservoir for Legionella spp., where the bacteria live in association with other microorganisms, such as free-living amoebae. A wide range of disinfection treatments have been studied to control and prevent Legionella colonization but few of them were performed considering its relation with protozoa. In this study, the effectiveness of UV irradiation (253.7 nm) using low-pressure lamps was investigated as a disinfection method for Legionella and amoebae under controlled laboratory conditions. UV treatments were applied to 5 strains of Legionella spp., 4 strains of free-living amoeba of the genera Acanthamoeba and Vermamoeba, treating separately trophozoites and cysts, and to two different co-cultures of Legionella pneumophila with the Acanthamoeba strains. No significant differences in the UV inactivation behavior were observed among Legionella strains tested which were 3 logs reduced for fluences around 45 J/m(2). UV irradiation was less effective against free-living amoebae; which in some cases required up to 990 J/m(2) to obtain the same population reduction. UV treatment was more effective against trophozoites compared to cysts; moreover, inactivation patterns were clearly different between the genus Acanthamoeba and Vermamoeba. For the first time data about Vermamoeba vermiformis UV inactivation has been reported in a study. Finally, the results showed that the association of L. pneumophila with free-living amoebae decreases the effectiveness of UV irradiation against the bacteria in a range of 1.5-2 fold. That fact demonstrates that the relations established between different microorganisms in the water systems can modify the effectiveness of the UV treatments applied. Copyright © 2014 Elsevier Ltd. All rights reserved.

  6. Evidence for large-scale winds from starburst galaxies. I. The nature of the ionized gas in M82 and NGC 253

    International Nuclear Information System (INIS)

    Mccarthy, P.J.; Van breugel, W.; Heckman, T.; Maryland Univ., College Park)

    1987-01-01

    The results of long-slit spectroscopy and narrow-band imaging of M82 and NGC 253, the two nearest examples of FIR luminous galaxies believed to be undergoing intense bursts of star formation, are presented. The profile of the gas pressure in the emission-line filaments in M82 is derived and found to be in good agreement with the model of Chevalier and Clegg (1985) of a supernovae-driven wind from a starburst nucleus. Lower quality data from NGC 253 support the same interpretation. Analysis of the emission-line ratios suggests that the line-emitting gas may be heated by low-velocity shocks, although photoionization from dilute UV radiation from unusually hot stars in the central starburst may also be important. 56 references

  7. Analysis of t(9;17)(q33.2;q25.3) chromosomal breakpoint regions and genetic association reveals novel candidate genes for bipolar disorder

    DEFF Research Database (Denmark)

    Rajkumar, A.P.; Christensen, Jane H.; Mattheisen, Manuel

    2015-01-01

    OBJECTIVES: Breakpoints of chromosomal abnormalities facilitate identification of novel candidate genes for psychiatric disorders. Genome-wide significant evidence supports the linkage between chromosome 17q25.3 and bipolar disorder (BD). Co-segregation of translocation t(9;17)(q33.2;q25.......3) with psychiatric disorders has been reported. We aimed to narrow down these chromosomal breakpoint regions and to investigate the associations between single nucleotide polymorphisms within these regions and BD as well as schizophrenia (SZ) in large genome-wide association study samples. METHODS: We cross......,856) data. Genetic associations between these disorders and single nucleotide polymorphisms within these breakpoint regions were analysed by BioQ, FORGE, and RegulomeDB programmes. RESULTS: Four protein-coding genes [coding for (endonuclease V (ENDOV), neuronal pentraxin I (NPTX1), ring finger protein 213...

  8. Severe intellectual disability, West syndrome, Dandy-Walker malformation, and syndactyly in a patient with partial tetrasomy 17q25.3.

    Science.gov (United States)

    Hackmann, Karl; Stadler, Anja; Schallner, Jens; Franke, Kathlen; Gerlach, Eva-Maria; Schrock, Evelin; Rump, Andreas; Fauth, Christine; Tinschert, Sigrid; Oexle, Konrad

    2013-12-01

    We report on a de novo 0.5 Mb triplication (partial tetrasomy) of chromosome 17q25.3 in a 10-year-old girl with severe intellectual disability, infantile seizures (West syndrome), moderate hearing loss, Dandy-Walker malformation, microcephaly, craniofacial dysmorphism, striking cutaneous syndactyly (hands 3-4, feet 2-3), joint laxity, and short stature. The triplication resulted from the unusual combination of a terminal duplication at 17qter and a cryptic translocation of an extra copy of the same segment onto chromosome 10qter. The breakpoint at 17q25.3 was located within the FOXK2 gene. SNP chip analysis suggested that the rearrangement occurred during paternal meiosis involving both paternal chromosomes 17. © 2013 Wiley Periodicals, Inc.

  9. Nustar and Chandra Insight into the Nature of the 3-40 Kev Nuclear Emission in Ngc 253

    Science.gov (United States)

    Lehmer, Bret D.; Wik, Daniel R.; Hornschemeier, Ann E.; Ptak, Andrew; Antoniu, V.; Argo, M.K.; Bechtol, K.; Boggs, S.; Christensen, F.E.; Craig, W.W.; hide

    2013-01-01

    We present results from three nearly simultaneous Nuclear Spectroscopic Telescope Array (NuSTAR) and Chandra monitoring observations between 2012 September 2 and 2012 November 16 of the local star-forming galaxy NGC 253. The 3-40 kiloelectron volt intensity of the inner approximately 20 arcsec (approximately 400 parsec) nuclear region, as measured by NuSTAR, varied by a factor of approximately 2 across the three monitoring observations. The Chandra data reveal that the nuclear region contains three bright X-ray sources, including a luminous (L (sub 2-10 kiloelectron volt) approximately few × 10 (exp 39) erg per s) point source located approximately 1 arcsec from the dynamical center of the galaxy (within the sigma 3 positional uncertainty of the dynamical center); this source drives the overall variability of the nuclear region at energies greater than or approximately equal to 3 kiloelectron volts. We make use of the variability to measure the spectra of this single hard X-ray source when it was in bright states. The spectra are well described by an absorbed (power-law model spectral fit value, N(sub H), approximately equal to 1.6 x 10 (exp 23) per square centimeter) broken power-law model with spectral slopes and break energies that are typical of ultraluminous X-ray sources (ULXs), but not active galactic nuclei (AGNs). A previous Chandra observation in 2003 showed a hard X-ray point source of similar luminosity to the 2012 source that was also near the dynamical center (Phi is approximately equal to 0.4 arcsec); however, this source was offset from the 2012 source position by approximately 1 arcsec. We show that the probability of the 2003 and 2012 hard X-ray sources being unrelated is much greater than 99.99% based on the Chandra spatial localizations. Interestingly, the Chandra spectrum of the 2003 source (3-8 kiloelectron volts) is shallower in slope than that of the 2012 hard X-ray source. Its proximity to the dynamical center and harder Chandra spectrum

  10. Survey of Water and Ammonia in Nearby Galaxies (SWAN): Resolved Ammonia Thermometry, and Water and Methanol Masers in the Nuclear Starburst of NGC 253

    Science.gov (United States)

    Gorski, Mark; Ott, Jürgen; Rand, Richard; Meier, David S.; Momjian, Emmanuel; Schinnerer, Eva

    2017-06-01

    We present Karl G. Jansky Very Large Array molecular line observations of the nearby starburst galaxy NGC 253, from SWAN, the Survey of Water and Ammonia in Nearby galaxies. SWAN is a molecular line survey at centimeter wavelengths designed to reveal the physical conditions of star-forming gas over a range of star-forming galaxies. NGC 253 has been observed in four 1 GHz bands from 21 to 36 GHz at 6″ ˜ 100 pc) spatial and 3.5 km s-1 spectral resolution. In total we detect 19 transitions from 7 molecular and atomic species. We have targeted the metastable inversion transitions of ammonia (NH3) from (1, 1) to (5, 5) and the (9, 9) line, the 22.2 GHz water (H2O) ({6}16{--}{5}23) maser, and the 36.1 GHz methanol (CH3OH) ({4}-1{--}{3}0) maser. Using NH3 as a thermometer, we present evidence for uniform heating over the central kpc of NGC 253. The molecular gas is best described by a two kinetic temperature model with a warm 130 K and a cooler 57 K component. A comparison of these observations with previous ALMA results suggests that the molecular gas is not heated in photon-dominated regions or shocks. It is possible that the gas is heated by turbulence or cosmic rays. In the galaxy center we find evidence for NH3(3, 3) masers. Furthermore, we present velocities and luminosities of three water maser features related to the nuclear starburst. We partially resolve CH3OH masers seen at the edges of the bright molecular emission, which coincides with expanding molecular superbubbles. This suggests that the masers are pumped by weak shocks in the bubble surfaces.

  11. El Límite a la Protección de las Tierras Indígenas de la Ley 19.253

    Directory of Open Access Journals (Sweden)

    Mario Salamanca Huenchullán

    Full Text Available Este trabajo aborda el tema del límite a la protección de las tierras indígenas, que como una exigencia del interés nacional introduce en la legislación chilena la Ley Indígena 19.253, en su relación con la expropiación para la construcción de obras públicas, que en virtud de la utilidad pública se construyen sobre estas mismas tierras.

  12. Measurements of isothermal (vapor + liquid) equilibrium for the (propane + cis-1,3,3,3-tetrafluoropropene) system at temperatures from (253.150 to 293.150) K

    International Nuclear Information System (INIS)

    Gong, Maoqiong; Zhao, Yanxing; Dong, Xueqiang; Guo, Hao; Shen, Jun; Wu, Jianfeng

    2016-01-01

    Highlights: • The VLE data for {R290 + R1234ze(Z)} system at temperatures from (253.150 to 293.150) K were presented. • The experiment was carried out based on the recirculation method. • Correlation of VLE data was made using PR-VDW and PR-HV-NRTL models. - Abstract: cis-1,3,3,3-Tetrafluoropropene, with zero ozone depleting potential and low global warming potential, has received much attention in recent years. In this work, the (vapor + liquid) phase equilibrium for the (propane + cis-1,3,3,3-tetrafluoropropene) binary system was investigated using an apparatus based on the recirculation method over the temperature range from (253.150 to 293.150) K. The VLE results were correlated by the PR-VDW model and PR-HV-NRTL model. Both models can give satisfactory results and the PR-HV-NRTL model exhibits better performance than PR-VDW model on the VLE description for this binary system. No azeotropic behavior was observed during the experiment.

  13. DETECTION OF GAMMA-RAY EMISSION FROM THE STARBURST GALAXIES M82 AND NGC 253 WITH THE LARGE AREA TELESCOPE ON FERMI

    International Nuclear Information System (INIS)

    Abdo, A. A.; Ackermann, M.; Ajello, M.; Bechtol, K.; Berenji, B.; Bloom, E. D.; Borgland, A. W.; Atwood, W. B.; Axelsson, M.; Baldini, L.; Bellazzini, R.; Bregeon, J.; Brez, A.; Ballet, J.; Barbiellini, G.; Bastieri, D.; Bonamente, E.; Brigida, M.; Bruel, P.; Burnett, T. H.

    2010-01-01

    We report the detection of high-energy γ-ray emission from two starburst galaxies using data obtained with the Large Area Telescope on board the Fermi Gamma-ray Space Telescope. Steady point-like emission above 200 MeV has been detected at significance levels of 6.8σ and 4.8σ, respectively, from sources positionally coincident with locations of the starburst galaxies M82 and NGC 253. The total fluxes of the sources are consistent with γ-ray emission originating from the interaction of cosmic rays with local interstellar gas and radiation fields and constitute evidence for a link between massive star formation and γ-ray emission in star-forming galaxies.

  14. Patients with high-bone-mass phenotype owing to Lrp5-T253I mutation have low plasma levels of serotonin

    DEFF Research Database (Denmark)

    Frost, Morten; Andersen, Tom E.; Yadav, Vijay

    2010-01-01

    The Lrp5 gene is a major determinant of bone mass accrual. It has been demonstrated recently to achieve this function by hampering the synthesis of gut-derived serotonin, which is a powerful inhibitor of bone formation. In this study we analyzed plasma serotonin levels in patients with a high......-bone-mass (HBM) phenotype owing to gain-of-function mutation of Lrp5 (T253I). A total of 9 HBM patients were compared with 18 sex- and age-matched controls. In HBM patients, the serotonin concentrations in platelet-poor plasma were significantly lower than in the controls (mean +/- SEM: 2.16 +/- 0.28 ng....../mL versus 3.51 +/- 0.49 ng/mL, respectively, p serotonin levels mediate the increased bone mass resulting from gain-of-function mutations in Lrp5 in humans. (c) 2010 American Society for Bone and Mineral Research....

  15. Novel metal-organic and supramolecular 3D frameworks constructed from flexible biphenyl-2,5,3‧-tricarboxylate blocks: Synthesis, structural features and properties

    Science.gov (United States)

    You, Ao; Li, Yu; Zhang, Ze-Min; Zou, Xun-Zhong; Gu, Jin-Zhong; Kirillov, Alexander M.; Chen, Jin-Wei; Chen, Yun-Bo

    2017-10-01

    Biphenyl-2,5,3‧-tricarboxylic acid (H3L) was selected as an unexplored tricarboxylate building block and applied for the hydrothermal synthesis of three novel coordination compounds, namely a 0D tetramer [Co4(HL)2(μ3-HL)2(phen)6(H2O)2]·3H2O (1) and two 3D metal-organic frameworks (MOFs) [Cd3(μ5-L)(μ6-L)(py)(μ-H2O)2(H2O)]n·H2O (2) and [Zn3(μ4-L)2(2,2‧-bpy)(μ-4,4‧-bpy)]n·2H2O (3). These products were easily generated in aqueous medium from the corresponding metal(II) chlorides, H3L, and various N-donor ancillary ligands, selected from 1,10-phenanthroline (phen), pyridine (py), 2,2‧-bipyridine (2,2‧-bpy), and 4,4‧-bipyridine (4,4‧-bpy). Compounds 1-3 were isolated as stable crystalline solids and were fully characterized by IR and UV-vis spectroscopy, elemental, thermogravimetric (TGA), powder (PXRD) and single-crystal X-ray diffraction analyses. Compound 1 possesses a discrete tetracobalt(II) structure, which is extended into a 3D H-bonded network with the pcu topology. In contrast, MOF 2 discloses a very complex trinodal 4,5,12-connected net with an undocumented topology, while MOF 3 features the nce/I topological framework. The magnetic (for 1) and luminescence (for 2 and 3) properties were also studied and discussed. The present study thus widens a still very limited family of metal-organic and supramolecular frameworks driven by flexible biphenyl-2,5,3‧-tricarboxylate building blocks.

  16. Co-regulation analysis of closely linked genes identifies a highly recurrent gain on chromosome 17q25.3 in prostate cancer

    International Nuclear Information System (INIS)

    Bermudo, Raquel; Martínez-A, Carlos; Ortiz, Ángel R; Fernández, Pedro L; Thomson, Timothy M; Abia, David; Ferrer, Berta; Nayach, Iracema; Benguria, Alberto; Zaballos, Ángel; Rey, Javier del; Miró, Rosa; Campo, Elías

    2008-01-01

    Transcriptional profiling of prostate cancer (PC) has unveiled new markers of neoplasia and allowed insights into mechanisms underlying this disease. Genomewide analyses have also identified new chromosomal abnormalities associated with PC. The combination of both classes of data for the same sample cohort might provide better criteria for identifying relevant factors involved in neoplasia. Here we describe transcriptional signatures identifying distinct normal and tumoral prostate tissue compartments, and the inference and demonstration of a new, highly recurrent copy number gain on chromosome 17q25.3. We have applied transcriptional profiling to tumoral and non-tumoral prostate samples with relatively homogeneous epithelial representations as well as pure stromal tissue from peripheral prostate and cultured cell lines, followed by quantitative RT-PCR validations and immunohistochemical analysis. In addition, we have performed in silico colocalization analysis of co-regulated genes and validation by fluorescent in situ hybridization (FISH). The transcriptomic analysis has allowed us to identify signatures corresponding to non-tumoral luminal and tumoral epithelium, basal epithelial cells, and prostate stromal tissue. In addition, in silico analysis of co-regulated expression of physically linked genes has allowed us to predict the occurrence of a copy number gain at chromosomal region 17q25.3. This computational inference was validated by fluorescent in situ hybridization, which showed gains in this region in over 65% of primary and metastatic tumoral samples. Our approach permits to directly link gene copy number variations with transcript co-regulation in association with neoplastic states. Therefore, transcriptomic studies of carefully selected samples can unveil new diagnostic markers and transcriptional signatures highly specific of PC, and lead to the discovery of novel genomic abnormalities that may provide additional insights into the causes and mechanisms

  17. Rapid detection of de novo P253R mutation in FGFR2 using uncultured amniocytes in a pregnancy affected by polyhydramnios, Blake's pouch cyst, and Apert syndrome.

    Science.gov (United States)

    Chen, Chih-Ping; Su, Yi-Ning; Chang, Tung-Yao; Chern, Schu-Rern; Chen, Chen-Yu; Su, Jun-Wei; Wang, Wayseen

    2013-06-01

    To present prenatal ultrasound and molecular genetic diagnosis of Apert syndrome. A 30-year-old, gravida 3, para 2 woman was referred for genetic counseling at 32 weeks of gestation because of polyhydramnios and craniofacial and digital abnormalities in the fetus. She had undergone amniocentesis at 18 weeks of gestation because of maternal anxiety. Results of amniocentesis revealed a karyotype of 46,XX. A prenatal ultrasound at 32 weeks of gestation revealed a female fetus with a fetal biometry equivalent to 32 weeks, polyhydramnios with an increased amniotic fluid index of 26.1 cm, frontal bossing, midface hypoplasia, hypertelorism, Blake's pouch cyst with an apparent posterior fossa cyst in communication with the fourth ventricle on axial images, digital fusion, and bilateral syndactyly of the hands and feet. A DNA testing for the FGFR2 gene was immediately performed using uncultured amniocytes obtained by repeated amniocentesis, which revealed a heterozygous c.758C>G, CCT>CGT transversion leading to a p.Pro253Arg (P253R) mutation in the FGFR2 gene. Subsequently, a diagnosis of Apert syndrome was made. Molecular analysis of the FGFR2 gene in the parents did not reveal such a mutation. The fetus postnatally manifested frontal bossing, midface hypoplasia, and bilateral syndactyly of the hands (mitten hands) and feet. Prenatal diagnosis of polyhydramnios, frontal bossing, and midface hypoplasia associated with brain and digital abnormalities should include a differential diagnosis of Apert syndrome. A molecular analysis of FGFR2 using uncultured amniocytes is useful for rapid confirmation of Apert syndrome at prenatal diagnosis. Copyright © 2013. Published by Elsevier B.V.

  18. Familial insertion (3;5)(q25.3;q22.1q31.3) with deletion or duplication of chromosome region 5q22.1-5q31.3 in ten unbalanced carriers.

    NARCIS (Netherlands)

    Arens, Y.H.; Engelen, J.J.M.; Govaerts, L.C.P.; Ravenswaaij-Arts, C.M.A. van; Loneus, W.H.; Lent-Albrechts, J.C. van; Blij-Philipsen, M. van der; Hamers, A.J.H.; Schrander-Stumpel, C.T.R.M.

    2004-01-01

    We report on the clinical and cytogenetic data of a large family with an unbalanced insertion translocation (3;5)(q25.3;q22.1q31.3). Analysis of GTG-banded chromosomes demonstrated that unbalanced inheritance of a parental insertion translocation caused either a partial deletion or duplication 5q in

  19. Biomass-burning during Holika at Varanasi (25.3 N, 83.0 E): Optical observations and Aerosol Radiative Forcing

    Science.gov (United States)

    Singh, A. K.; Singh, R. K.; Srivastava, M. K.; Mehrotra, B. J.; Murari, V.; Sharma, S. K., , Dr; Mandal, T. K., , Dr; Singh, R. S.; Banerjee, T.; Tiwari, S.

    2017-12-01

    All the anthropogenic activity, including various festivals, affect the environment. Impact of fireworks done during various festival are well documented in literature. In India, the festival of colors, Holi, is celebrated during spring season. During this festival, wood-log and other natural biomass are burned on the eve of the festival (Holika). Although the festival falls during a season with clear sky, that possibly can allow the pollutants to mix in the free troposphere, but observations made during Holika-2016 showed 2-3-times soot (or Black Carbon, BC) enhancement in nighttimes due to Holika, than the background levels. This observations motivated us to better understand the optical impact of Holika-2017. For this purpose, we planned first-time intensive-observation during Holika-2017 (March 13, 2017). Estimated 450 thousands kgs of wood and biomass is burnt during Holika-2017 in 2250 (± 5%) units of Holika at around 10 pm local time of March 12th, in the vicinity of Varanasi city (25.3N, 83.0E). Intensive observations are being done from 5th to 18th March, 2017. Extensive optical analyses have been done to understand the aerosol radiative impact of Holika burning on environment. The observed AOD was 0.336, 0.392 and 0.47 and daily average BC mass was 7137, 9942 and 8950 ng/m3 for Pre-Holika, Holika and Post-Holika. Top of the atmosphere, at the surface and in atmosphere are 2.53, -40.48 and 43.00 W/m2 for Pre-Holika, 6.45, -53.75 and 60.21 W/m2 for Holika and 8.91, -65.75 and 74.66 W/m2 for Post-Holika burning. Highest BC mass was observed around 0200 hrs on 13th March, just after few hours of Holika-2017. Preliminary results are shown in figure, depicting surface/ top-of-atmosphere/ atmospheric radiative forcing along with changes in heating rates from pre-holika to holika and post-holika days. Heating rates have enhanced 2-times for post-Holika than the background levels.

  20. Intellectual disability, muscle weakness and characteristic face in three siblings: A newly described recessive syndrome mapping to 3p24.3-p25.3.

    Science.gov (United States)

    Kariminejad, Ariana; Nafissi, Shahriar; Nilipoor, Yalda; Tavasoli, Alireza; Van Veldhoven, Paul P; Bonnard, Carine; Ng, Yeng Ting; Majoie, Charles B; Reversade, Bruno; Hennekam, Raoul C

    2015-11-01

    We report on a sister and two brothers born to healthy Iranian parents with mild intellectual disability, progressive muscle weakness, and characteristic facies. including highly arched eyebrows, down-slanting palpebral fissures, prominent nasal bridge, prominent nose, columella extending below alae nasi, narrow mouth, narrow palate, and dental caries, and in one of them an inability to abduct the left eye. Electrophysiological studies showed signs of myopathy, and muscle biopsies demonstrated only nonspecific signs. Brain MRIs in two of the sibs showed leukencephalopathy with delayed myelination, frontal and parietal hyperintensities, and hippocampal atrophy in one. We have been unable to find a description of this association of features in literature. Based on the occurrence in siblings, no significant difference in phenotype between the brothers and sister, absence of manifestations in parents, and a likely consanguinity between parents we performed a homozygosity mapping. A single identical-by-descent bloc encompassing 57 genes located at 3p24.3-p25.3 was found to segregate within the family with this phenotype. © 2015 Wiley Periodicals, Inc. © 2015 Wiley Periodicals, Inc.

  1. The synthesis of 2-(5-(3-methoxyphenyl)-4,5-dihydro-1H-pyrazol-3-yl)phenol using sodium impregnated on activated chicken eggshells catalyst

    Science.gov (United States)

    Mardiana, L.; Bakri, R.; Septiarti, A.; Ardiansah, B.

    2017-04-01

    The novel compound of 2-(5-(3-methoxyphenyl)-4,5-dihydro-1H-pyrazol-3-yl)phenol as a pyrazoline derivative has been synthesized by two-steps reaction using sodium impregnated on activated chicken eggshells (Na-ACE) catalyst. Na-ACE was primarily prepared by a simple wet impregnation of NaOH solution on activated chicken eggshells solid support. The Na-ACE catalyst produced was characterized using FTIR spectrophotometer, XRD and SEM then applied in pyrazoline synthesis. First, chalcone was prepared from the reaction of 2-hydroxyacetophenone and 3-methoxybenzaldehyde by base-catalyzed aldol condensation. This product was subsequently reacted with hydrazine hydrate to give corresponding pyrazoline. The structure elucidation of the compound using FTIR, UV-Vis, LC-ESI-MS and 1H-NMR indicated the desired product has been successfully synthesized. Furthermore, the potential antioxidant activities of chalcone and pyrazoline have also been studied in-vitro using DPPH radical scavenging method. The results revealed that pyrazoline has a greater antioxidant activity than chalcone.

  2. Use of an owner questionnaire to evaluate long-term surgical outcome and chronic pain after cranial cruciate ligament repair in dogs: 253 cases (2004-2006).

    Science.gov (United States)

    Mölsä, Sari H; Hielm-Björkman, Anna K; Laitinen-Vapaavuori, Outi M

    2013-09-01

    To evaluate, by means of an owner questionnaire, long-term outcome and prevalence of chronic pain after cranial cruciate ligament (CCL) surgery in dogs. Retrospective case series. 253 dogs with surgically treated CCL rupture. Data from surgical records of dogs that underwent surgical repair of CCL between 2004 and 2006 were reviewed. An owner questionnaire, including the validated Helsinki chronic pain index (HCPI), served to evaluate long-term outcome and prevalence of chronic pain after surgical repair by means of intracapsular, extracapsular, or osteotomy techniques. Additional questions inquired about recovery and rehabilitation after surgery, current well-being, medications, and adjunct treatments. Of 507 questionnaires, 272 (53.6%) were returned; 19 were excluded because of incomplete answers. Mean ± SD follow-up time was 2.7 ± 0.8 years (range, 1.3 to 4.5 years). Owners considered surgical outcome as excellent in 122 of 226 (54.0%) dogs, good in 97 (42.9%), fair in 0 (0%), and poor in 7 (3.1%). At follow-up, the mean ± SD HCPI for 206 dogs was 8.9 ± 6.3 (range, 0 to 24). Of these 206 dogs, 64 (31.1%) had an HCPI ≥ 12, indicating chronic pain. Mean HCPI in dogs with a good outcome (11.8 ± 5.4; 95% confidence interval, 10.6 to 12.9) was significantly higher than that for dogs with an excellent outcome (6.2 ± 5.7; 95% confidence interval, 5.1 to 7.2). Owner-reported postoperative lameness was significantly shorter after osteotomy techniques, compared with lameness duration after the intracapsular technique. On the basis of owner assessment, long-term chronic pain was found in approximately 30% of dogs after CCL repair.

  3. Loss-of-function variants of SETD5 cause intellectual disability and the core phenotype of microdeletion 3p25.3 syndrome

    Science.gov (United States)

    Kuechler, Alma; Zink, Alexander M; Wieland, Thomas; Lüdecke, Hermann-Josef; Cremer, Kirsten; Salviati, Leonardo; Magini, Pamela; Najafi, Kimia; Zweier, Christiane; Czeschik, Johanna Christina; Aretz, Stefan; Endele, Sabine; Tamburrino, Federica; Pinato, Claudia; Clementi, Maurizio; Gundlach, Jasmin; Maylahn, Carina; Mazzanti, Laura; Wohlleber, Eva; Schwarzmayr, Thomas; Kariminejad, Roxana; Schlessinger, Avner; Wieczorek, Dagmar; Strom, Tim M; Novarino, Gaia; Engels, Hartmut

    2015-01-01

    Intellectual disability (ID) has an estimated prevalence of 2–3%. Due to its extreme heterogeneity, the genetic basis of ID remains elusive in many cases. Recently, whole exome sequencing (WES) studies revealed that a large proportion of sporadic cases are caused by de novo gene variants. To identify further genes involved in ID, we performed WES in 250 patients with unexplained ID and their unaffected parents and included exomes of 51 previously sequenced child–parents trios in the analysis. Exome analysis revealed de novo intragenic variants in SET domain-containing 5 (SETD5) in two patients. One patient carried a nonsense variant, and the other an 81 bp deletion located across a splice-donor site. Chromosomal microarray diagnostics further identified four de novo non-recurrent microdeletions encompassing SETD5. CRISPR/Cas9 mutation modelling of the two intragenic variants demonstrated nonsense-mediated decay of the resulting transcripts, pointing to a loss-of-function (LoF) and haploinsufficiency as the common disease-causing mechanism of intragenic SETD5 sequence variants and SETD5-containing microdeletions. In silico domain prediction of SETD5, a predicted SET domain-containing histone methyltransferase (HMT), substantiated the presence of a SET domain and identified a novel putative PHD domain, strengthening a functional link to well-known histone-modifying ID genes. All six patients presented with ID and certain facial dysmorphisms, suggesting that SETD5 sequence variants contribute substantially to the microdeletion 3p25.3 phenotype. The present report of two SETD5 LoF variants in 301 patients demonstrates a prevalence of 0.7% and thus SETD5 variants as a relatively frequent cause of ID. PMID:25138099

  4. Erratum to "Solar Sources and Geospace Consequences of Interplanetary Magnetic Clouds Observed During Solar Cycle 23-Paper 1" [J. Atmos. Sol.-Terr. Phys. 70(2-4) (2008) 245-253

    Science.gov (United States)

    Gopalswamy, N.; Akiyama, S.; Yashiro, S.; Michalek, G.; Lepping, R. P.

    2009-01-01

    One of the figures (Fig. 4) in "Solar sources and geospace consequences of interplanetary magnetic Clouds observed during solar cycle 23 -- Paper 1" by Gopalswamy et al. (2008, JASTP, Vol. 70, Issues 2-4, February 2008, pp. 245-253) is incorrect because of a software error in t he routine that was used to make the plot. The source positions of various magnetic cloud (MC) types are therefore not plotted correctly.

  5. Kinetics of the gas-phase reactions of chlorine atoms with CH2F2, CH3CCl3 and CF3CFH2 over the temperature range 253 – 551 K

    DEFF Research Database (Denmark)

    Nilsson, Elna Johanna Kristina; Johnson, Matthew Stanley; Nielsen, Ole John

    2009-01-01

    Relative rate techniques were used to study the title reactions in 930–1200 mbar of N2 diluent. The reaction rate coefficients measured in the present work are summarized by the expressions k(Cl+CH2F2) = 1.19×10-17 T 2 exp(-1023/T ) cm3 molecule-1 s-1 (253– 553 K), k(Cl+CH3CCl3) = 2.41×10-12 exp(...

  6. Patients with Philadelphia-positive leukemia with Y253H or F359V mutation have a high risk of developing new mutations in the setting of dasatinib resistance.

    Science.gov (United States)

    Jiang, Qian; Qin, Ya-Zhen; Lai, Yue-Yun; Jiang, Hao; Wang, Jing; Huang, Xiao-Jun

    2015-07-01

    The treatment outcome and development of new mutations in patients with imatinib- and/or nilotinib-failure Philadelphia chromosome positive (Ph+) leukemia with highly nilotinib-resistant mutations (Y253H, E255K/V and F359V/C) were assessed on dasatinib therapy. A total of 111 patients with Ph+ leukemia were grouped into three cohorts by baseline BCR-ABL kinase domain mutation status: no mutation (n = 44), non-nilotinib-resistant mutations (n = 26) or nilotinib-resistant mutations (n = 41). The frequencies of hematological, cytogenetic and molecular responses and clinical resistance to dasatinib were similar among the three cohorts during dasatinib therapy. In dasatinib-resistant patients, new mutations were most frequently observed in the cohort with nilotinib-resistant mutations (p = 0.001). Multivariate analysis revealed that advanced disease and harboring Y253H or F359V mutation before dasatinib were independent predictors of developing new mutations. We conclude that patients with Ph+ leukemia with Y253H or F359V mutation have a high likelihood of developing new mutations in the setting of dasatinib resistance.

  7. Cosmic rays and the magnetic field in the nearby starburst galaxy NGC 253 III. Helical magnetic fields in the nuclear outflow

    Science.gov (United States)

    Heesen, V.; Beck, R.; Krause, M.; Dettmar, R.-J.

    2011-11-01

    Context. Magnetic fields are good tracers of gas compression by shock waves in the interstellar medium. These can be caused by the interaction of star-formation driven outflows from individual star formation sites as described in the chimney model. Integration along the line-of-sight and cosmic-ray diffusion may hamper detection of compressed magnetic fields in many cases. Aims. We study the magnetic field structure in the central part of the nuclear starburst galaxy NGC 253 with spatial resolutions between 40 and 150 pc to detect any filamentary emission associated with the nuclear outflow. As the nuclear region is much brighter than the rest of the disc we can distinguish this emission from that of the disc. Methods. We used radio polarimetric observations with the VLA. New observations at λ3 cm with 7.5 arcsec resolution were combined with archive data at λλ 20 and 6 cm. We created a map of the rotation measure distribution between λλ 6 and 3 cm and compared it with a synthetic polarization map. Results. We find filamentary radio continuum emission in a geometrical distribution, which we interpret as the boundary of the NW nuclear outflow cone seen in projection. The scaleheight of the continuum emission is 150 ± 20 pc, regardless of the observing frequency. The equipartition magnetic field strength is 46 ± 10 μG for the total field and 21 ± 5 μG for the regular field in the filaments. We find that the ordered magnetic field is aligned along the filaments, in agreement with amplification due to compression. The perpendicular diffusion coefficient across the filaments is κ⊥= 1.5-1028 cm2 s-1 E(GeV)0.5±0.7. In the SE part of the nuclear outflow cone the magnetic field is pointing away from the disc in form of a helix, with an azimuthal component increasing up to at least 1200 pc height, where it is about equal to the total component. The ordered magnetic field in the disc is anisotropic within a radius of 2.2 kpc. At larger radii, the large

  8. Hypoxia-Specific Drug Tirapazamine Does Not Abrogate Hypoxic Tumor Cells in Combination Therapy with Irinotecan and Methylselenocysteine in Well-Differentiated Human Head and Neck Squamous Cell Carcinoma A253 Xenografts

    Directory of Open Access Journals (Sweden)

    Arup Bhattacharya

    2008-08-01

    Full Text Available Well-differentiated hypoxic regions in head and neck squamous cell carcinoma like in A253 xenografts are avascular and, therefore, hinder drug delivery leading to drug resistance and tumor regrowth. Methylselenocysteine (MSC, 0.2 mg/mouse per day per oral for 35 days starting 7 days before the first irinotecan (CPT-11 has been found to increase efficacy of a wide variety of chemotherapeutic agents including CPT-11 (100 mg/kg per week x 4 intravenously. Whereas CPT-11 leads to a 10% complete response (CR in A253 xenografts, the combination of MSC and CPT-11 increased the CR to 70%. Surviving tumors were found to consist largely of avascular hypoxic regions. Here, we investigated the combination of tirapazamine (TPZ, 70 mg/kg per week intraperitoneal x 4 administered 3 or 72 hours before CPT-11, a bioreductive drug in clinical trial with selective toxicity for hypoxic cells, with MSC and CPT-11 in further enhancing the cure rates. Tumor response, change in tumor hypoxic regions, and DNA damage were monitored in vivo. Tirapazamine administered 3 hours before CPT-11 in combination with MSC + CPT-11 led to a lower tumor burden. Tirapazamine did not increase cure rate beyond that of MSC + CPT-11 combination and was instead found to decrease cures with no evidence of an increased DNA damage or a significant reduction in avascular hypoxic tumor regions. CD31 immunostaining in A253 demonstrated disruption of tumor vessels by TPZ that could lower cytotoxic drug delivery to carbonic anhydrase IX-positive hypoxic tumor cells and may explain at least partially these unexpected results.

  9. Publications | Page 253 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    The devastating drought that gripped much of East Africa in 2009 was one of the worst in living memory. But in the arid and semi-arid lands of Northern Kenya, drought is no stranger. Since 1993, Kenya has declared six national disasters... Putting tested options into practice in Benin. Benin depends on agriculture for some ...

  10. 253-IJBCS-Article-Dr Yah Clarence

    African Journals Online (AJOL)

    Dr Gatsing

    There has been a significant increase in resistance of common bacterial isolates from surgical site infections in our community ... (23.0%), Staphylococcus epidermidis (11.2%), Pseudomonas aeruginosa (5.0%), and species of Klebsiella and. Proteus 3.7% each. On the ... have arisen through mutation as a consequence of ...

  11. 28 CFR 2.53 - Mandatory parole.

    Science.gov (United States)

    2010-07-01

    ..., or local crime or that the prisoner has frequently or seriously violated the rules of the institution... until the expiration of his sentence less good time. (b) When feasible, at least 60 days prior to the... term of his sentence unless the Commission terminates parole supervision pursuant to § 2.43 prior to...

  12. 7 CFR 1924.253 - Definitions.

    Science.gov (United States)

    2010-01-01

    ... significantly affect the basic integrity of the dwelling or unit such as in the foundation, footings, basement walls, slabs, floors, framing, walls, ceiling, or roof. (2) Major deficiencies in the utility components...

  13. 50 CFR 253.10 - Definitions.

    Science.gov (United States)

    2010-10-01

    ... value), depreciated (excluding land) on a straightline basis at 1-year intervals over the project... any project that contributes to developing the U.S. fishing industry by: Causing any vessel to catch... (including any fishery facility for passenger fishing). Fishing means catching wild fish for commercial...

  14. 8 CFR 253.1 - Parole.

    Science.gov (United States)

    2010-01-01

    .... (g) Other crewmen. In the discretion of the district director, any alien crewman not within the... the conditions under which the alien crewman is paroled into the United States. The Form I-259 shall also specify the Service office to which the alien crewman is to be presented for inspection upon...

  15. 50 CFR 253.20 - Definitions.

    Science.gov (United States)

    2010-10-01

    ... work or investigative study, designed to acquire knowledge of fisheries resources and their habitat... the apportionment formula, which is equal to the price paid at the first point of landing. Volume...

  16. 7 CFR 1901.253 - Definitions.

    Science.gov (United States)

    2010-01-01

    ..., sites, buildings, structures, and objects, significant in American history, architecture, archeology, and culture maintained by the Secretary of the Interior under the authority of section 2(b) of the... means any district, site, building, structure, or object which the Secretary of the Interior determines...

  17. 50 CFR 253.1 - Purpose.

    Science.gov (United States)

    2010-10-01

    ... undertake projects in support of management of interjurisdictional fishery resources in both the exclusive.... Treasury securities, where interest rates are lower and maturities are longer. The Program does all credit... objectives: (1) To promote and encourage State activities in support of the management of interjurisdictional...

  18. 256 253 Profitability Analysis of Groundnut

    African Journals Online (AJOL)

    2008-12-02

    Dec 2, 2008 ... GR = Gross revenue (N /kg). TVC = Total variable costs (N /kg). The gross margin analysis was used under the assumption that fixed costs of production are negligible (Olukosi and Erhabor, 1988). Return on investment. The return on investment (ROI) was also used to assess the profitability of the ...

  19. 42 CFR 447.253 - Other requirements.

    Science.gov (United States)

    2010-10-01

    ... intermediate care services) under conditions similar to those described in section 1861(v)(1)(G) of the Act... agency determines appropriate, of payment rates. (f) Uniform cost reporting. The Medicaid agency must... Medicaid agency must provide for periodic audits of the financial and statistical records of participating...

  20. Publications | Page 253 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    IDRC works with developing-country researchers and institutions to build local capacity through funding, knowledge sharing, and training. Through books, articles, research publications, and studies, we aim to widen the impact of our investment and advance development research. We share the results of our funded ...

  1. 17 CFR 230.253 - Offering circular.

    Science.gov (United States)

    2010-04-01

    .... Repetition of information should be avoided; cross-referencing of information within the document is... COMPLETENESS OF ANY OFFERING CIRCULAR OR OTHER SELLING LITERATURE. THESE SECURITIES ARE OFFERED PURSUANT TO AN...

  2. Publications | Page 253 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Reducing vulnerability among pastoralists in northern Kenya. The devastating drought that gripped much of East Africa in 2009 was one of the worst in living memory. But in the arid and semi-arid lands of Northern Kenya, drought is no stranger. Since 1993, Kenya has declared six national disasters.

  3. A molecular line survey toward the nearby galaxies NGC 1068, NGC 253, and IC 342 at 3 mm with the Nobeyama 45 m radio telescope: Impact of an AGN on 1 kpc scale molecular abundances

    Science.gov (United States)

    Nakajima, Taku; Takano, Shuro; Kohno, Kotaro; Harada, Nanase; Herbst, Eric

    2018-01-01

    It is important to investigate the relationships between the power sources and the chemical compositions of galaxies in order to understand the scenario of galaxy evolution. We carried out an unbiased molecular line survey towards active galactic nucleus (AGN) host galaxy NGC1068, and prototypical starburst galaxies, NGC 253 and IC 342, with the Nobeyama 45 m telescope in the 3 mm band. The advantage of this line survey is that the obtained spectra have the highest angular resolution ever obtained with single-dish telescopes. In particular, the beam size of this telescope is ˜15″-19″, which is able to separate spatially the nuclear molecular emission from that of the starburst ring (d ˜ 30″) in NGC 1068. We successfully detected approximately 23 molecular species in each galaxy, and calculated rotation temperatures and column densities. We estimate the molecular fractional abundances with respect to 13CO and CS molecules and compare them among three galaxies in order to investigate the chemical signatures of an AGN environment. As a result, we found clear trends in the abundances of molecules surrounding the AGN on a 1-kpc scale. HCN, H13CN, CN, 13CN, and HC3N are more abundant, and CH3CCH is deficient in NGC 1068 compared with the starburst galaxies. High abundances of HCN, H13CN, and HC3N suggest that the circumnuclear disk in NGC 1068 is in a high-temperature environment. The reason for the non-detection of CH3CCH is likely to be dissociation by high-energy radiation or less sublimation of a precursor of CH3CCH from grains.

  4. Rice A20/AN1 zinc-finger containing stress-associated proteins (SAP1/11) and a receptor-like cytoplasmic kinase (OsRLCK253) interact via A20 zinc-finger and confer abiotic stress tolerance in transgenic Arabidopsis plants.

    Science.gov (United States)

    Giri, Jitender; Vij, Shubha; Dansana, Prasant K; Tyagi, Akhilesh K

    2011-08-01

    • The inbuilt mechanisms of plant survival have been exploited for improving tolerance to abiotic stresses. Stress-associated proteins (SAPs), containing A20/AN1 zinc-finger domains, confer abiotic stress tolerance in different plants, however, their interacting partners and downstream targets remain to be identified. • In this study, we have investigated the subcellular interactions of rice SAPs and their interacting partner using yeast two-hybrid and fluorescence resonance energy transfer (FRET) approaches. Their efficacy in improving abiotic stress tolerance was analysed in transgenic Arabidopsis plants. Regulation of gene expression by genome-wide microarray in transgenics was used to identify downstream targets. • It was found that the A20 domain mediates the interaction of OsSAP1 with self, its close homolog OsSAP11 and a rice receptor-like cytoplasmic kinase, OsRLCK253. Such interactions between OsSAP1/11 and with OsRLCK253 occur at nuclear membrane, plasma membrane and in nucleus. Functionally, both OsSAP11 and OsRLCK253 could improve the water-deficit and salt stress tolerance in transgenic Arabidopsis plants via a signaling pathway affecting the expression of several common endogenous genes. • Components of a novel stress-responsive pathway have been identified. Their stress-inducible expression provided the protection against yield loss in transgenic plants, indicating the agronomic relevance of OsSAP11 and OsRLCK253 in conferring abiotic stress tolerance. © 2011 The Authors. New Phytologist © 2011 New Phytologist Trust.

  5. Chromosome Rearrangements in Cornelia de Lange Syndrome (CdLS): Report of a der(3)t(3;12)(p25.3;p13.3) in Two Half Sibs With Features of CdLS and Review of Reported CdLS Cases With Chromosome Rearrangements

    Science.gov (United States)

    DeScipio, Cheryl; Kaur, Maninder; Yaeger, Dinah; Innis, Jeffrey W.; Spinner, Nancy B.; Jackson, Laird G.; Krantz, Ian D.

    2016-01-01

    Cornelia de Lange syndrome (CdLS; OMIM 122470) is a dominantly inherited disorder characterized by multisystem involvement, cognitive delay, limb defects, and characteristic facial features. Recently, mutations in NIPBL have been found in ~50% of individuals with CdLS. Numerous chromosomal rearrangements have been reported in individuals with CdLS. These rearrangements may be causative of a CdLS phenotype, result in a phenocopy, or be unrelated to the observed phenotype. We describe two half siblings with a der(3)t(3;12)(p25.3;p13.3) chromosomal rearrangement, clinical features resembling CdLS, and phenotypic overlap with the del(3)(p25) phenotype. Region-specific BAC probes were used to fine-map the breakpoint region by fluorescence in situ hybridization (FISH). FISH analysis places the chromosome 3 breakpoint distal to RP11-115G3 on 3p25.3; the chromosome 12 breakpoint is distal to BAC RP11-88D16 on 12p13.3. A review of published cases of terminal 3p deletions and terminal 12p duplications indicates that the findings in these siblings are consistent with the del(3)(p25) phenotype. Given the phenotypic overlap with CdLS, we have reviewed the reported cases of chromosomal rearrangements involved in CdLS to better elucidate other potential loci that could harbor additional CdLS genes. Additionally, to identify chromosome rearrangements, genome-wide array comparative genomic hybridization (CGH) was performed on eight individuals with typical CdLS and without identifiable deletion or mutation of NIPBL. No pathologic rearrangements were identified. PMID:16075459

  6. H:\\PMKER 25(3)\\TRAORE K..xps

    African Journals Online (AJOL)

    AISA

    Laboratoire de Phytopathologie de la Faculté d'Agronomie de l'Université de Parakou (Bénin) pour confirmer ou non la présence des trois virus responsables de maladies chez les Solanaceae à savoir le CMV, le PVMV et le PVYN. Des tampons ont été préparés conformément aux directives de Clarck et al. (1977), il s'agit.

  7. 48 CFR 52.253-1 - Computer Generated Forms.

    Science.gov (United States)

    2010-10-01

    ... (CONTINUED) CLAUSES AND FORMS SOLICITATION PROVISIONS AND CONTRACT CLAUSES Text of Provisions and Clauses 52... form, provided there is no change to the name, content, or sequence of the data elements on the form... is no change to the name, content, or sequence of the data elements on the form and provided the form...

  8. 42 CFR 403.253 - Calculation of benefits.

    Science.gov (United States)

    2010-10-01

    ... calculated on a net level reserve basis, using appropriate values to account for lapse, mortality, morbidity, and interest, that on the valuation date represents— (A) The present value of expected incurred benefits over the loss ratio calculation period; less— (B) The present value of expected net premiums over...

  9. 7 CFR 253.5 - State agency requirements.

    Science.gov (United States)

    2010-01-01

    ... Federal, State, or local laws, including, but not limited to, laws relating to taxation, welfare, and... Services, planning agencies, the ITO and school officials may be important sources of information in... State agency training based on information obtained from field reviews, administrative analyses and...

  10. 19 CFR 10.253 - Articles eligible for preferential treatment.

    Science.gov (United States)

    2010-04-01

    ... 19 Customs Duties 1 2010-04-01 2010-04-01 false Articles eligible for preferential treatment. 10...; DEPARTMENT OF THE TREASURY ARTICLES CONDITIONALLY FREE, SUBJECT TO A REDUCED RATE, ETC. Andean Trade Promotion and Drug Eradication Act Extension of Atpa Benefits to Tuna and Certain Other Non-Textile Articles...

  11. H:\\PMKER 25(3)\\BEUGRE F..xps

    African Journals Online (AJOL)

    AISA

    Une expérimentation sur la culture du soja a été réalisée en zone forestière de la Côte d'Ivoire, pour résoudre le problème de la .... Cameroun. Herbicide. Le Glyphosate, communément appelé Round up, qui est un herbicide total et systémique, a été utilisé en pré levée à la dose de 4 l/ha. ..... Post-Emergence herbicides.

  12. H:\\PMKER 25(3)\\TIA E..xps

    African Journals Online (AJOL)

    AISA

    INQUIRY ON HEALTH STATUS AND WORK CONDITIONS OF LOWLAND RICE FARMERS IN THE REGION IN REGION OF GAGNOA. IN CÔTE ... sectional study was conducted on the health and work conditions of a cooperative of rice farmers (CODERIZ) in Gagnoa ..... Human dwellings bordering the rice fields. Figure 3 ...

  13. Dicty_cDB: CHJ253 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available vs*lwv ylvyllgnsmkerntkrmnkn*LNKNIKKK--- ---IHYIINLFLKNL*k*kllisnklkdrrk*liigikknllkkqqkv*rmprilhxhmx xe*mhq...pnillkkmsimlkepvihqryqlldrinslvs*lwv ylvyllgnsmkerntkrmnkn*LNKNIKKK--- ---IHYIINLFLKNL*k*kllisnklkdrrk*liigikknllkkqqkv*rmprilhxhmx

  14. Underground storage tank 253-D1U1 Closure Plan

    Energy Technology Data Exchange (ETDEWEB)

    Mancieri, S.; Giuntoli, N.

    1993-09-01

    This report is a closure plan for a diesel fuel tank at the Lawrence Livermore National Laboratory. Included are maps of the site, work plans, and personnel information regarding training and qualification.

  15. 40 CFR 180.253 - Methomyl; tolerances for residues.

    Science.gov (United States)

    2010-07-01

    ..., undelinted seed 0.1(N) Cucurbits 0.2(N) Dandelion, leaves 6 Endive 5 Grape 5 Grapefruit 2 Hop, dried cones 1 12 Kale 6 Leek 3.0 Lemon 2 Lentil, seed 0.1 Lettuce 5 Mustard greens 6 Nectarine 5 Oat, forage 10 Oat... Barley, hay 10 Barley, straw 10 Bean, dry, seed 0.1(N) Bean, forage 10 Bean, succulent 2 Beet, garden...

  16. H:\\PMKER 25(3)\\ADEWOLE.xps

    African Journals Online (AJOL)

    AISA

    A field experiment was conducted in south-western Nigeria to determine the effects of different fertilizer applications on the growth performance of sunflower when cultivated in an Alfisols contaminated with effluents from a paints industry. This was with a view to assessing the yield and nutrient quality of harvested sunflower ...

  17. 40 CFR 98.253 - Calculating GHG emissions.

    Science.gov (United States)

    2010-07-01

    ...) For catalytic reforming units, calculate the CO2 emissions using the applicable methods described in... this section. Other catalytic reforming units must either install a CEMS that complies with the Tier 4... necessary) CO concentrations in the exhaust stack from the catalytic reforming unit catalyst regenerator...

  18. Gastric polyps: Retrospective analysis of 41,253 upper endoscopies.

    Science.gov (United States)

    Argüello Viúdez, Lidia; Córdova, Henry; Uchima, Hugo; Sánchez-Montes, Cristina; Ginès, Àngels; Araujo, Isis; González-Suárez, Begoña; Sendino, Oriol; Llach, Josep; Fernández-Esparrach, Gloria

    2017-10-01

    Gastric polyps are usually asymptomatic lesions incidentally discovered during endoscopy. To study the frequency of different types of gastric polyps in our population and their possible association with other factors. Retrospective study of gastroscopies performed in a tertiary hospital over a ten-year period. Demographics, medical history, indication for gastroscopy and morphological and histological characteristics of polyps were collected. Gastric polyps were found in 827 out of 41253 (2%) reviewed gastroscopies, corresponding to 709 patients. Mean age was 65.6 years, and 62% were female. 53.9% of patients had multiple polyps. The most common location was the fundus and 83.3% were smaller than 1cm. Histopathology was obtained in 607 patients: hyperplastic polyps were the most common (42.8%), followed by fundic gland polyps (37.7%). Factors independently associated with hyperplastic polyps were age and single polyp, size ≥6mm and location other than fundus. In contrast, fundic gland polyps were associated with reflux and multiple polyps, size <6mm and located in fundus. Adenomas were independently associated with single polyp. Fundic gland and hyperplastic polyps are the most common in our population and have characteristic features that can guide histological diagnosis. With single polyps it is advisable to take biopsies to rule out adenoma. Copyright © 2017 Elsevier España, S.L.U., AEEH y AEG. All rights reserved.

  19. H:\\PMKER 25(3)\\ZEZE A..xps

    African Journals Online (AJOL)

    AISA

    préalablement stérilisé à l'autoclave (110 °C,. 2 kg/cm2, 3h) et 150 g de sol de chaque échantillon servant d'inoculum (2 plants par pot). Après 75 jours de culture, 50 g de sols de chaque échantillon séché à l'air libre est utilisé pour extraire les spores selon la méthode de tamisage humide (Gerdemann et Nicolson,. 1963).

  20. 27 CFR 20.253 - Labels for samples.

    Science.gov (United States)

    2010-04-01

    ... information: (a) The word “Sample”; (b) The dealer's name, address, and permit number; (c) The words “Specially Denatured Alcohol” or “Specially Denatured Rum”; (d) The quantity; and (e) The formula number. ...

  1. 253 Education and the Paradox of Graduate Unemployment: The ...

    African Journals Online (AJOL)

    FIRST LADY

    2011-01-18

    Jan 18, 2011 ... basically four major types of unemployment; the cyclical, seasonal, frictional and structural. Cyclical unemployment is the type of joblessness that occurs as a result of lower rates of production, during recessions in business cycles resulting in massive layoffs of workers. Seasonal unemployment results from.

  2. 7 CFR 253.6 - Eligibility of households.

    Science.gov (United States)

    2010-01-01

    ...' educational benefits, and the like to the extent that they are used for tuition and mandatory school fees... loans from private individuals as well as commercial institutions, other than education loans on which...

  3. H:\\PMKER 25(3)\\BRAHIM I..xps

    African Journals Online (AJOL)

    AISA

    ordinateur. Au cours de ces dictées d'enregistrement de compor- tement et pour chaque femelle, sept paramètres ont été relevés et enregistrés à l'ordinateur : - durée de marche sans balayage (en sec) : pendant laquelle la femelle se déplace sur les.

  4. Dicty_cDB: CFG253 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Value N AF305060 |AF305060.1 Dictyostelium discoideum Wiscott-Aldrich syndrome protein (wasA) gene, complete...ences producing significant alignments: (bits) Value AF305060_1( AF305060 |pid:none) Dictyostelium discoideum Wiscott

  5. 253 Education and the Paradox of Graduate Unemployment: The ...

    African Journals Online (AJOL)

    FIRST LADY

    2011-01-18

    Jan 18, 2011 ... educational curricula, especially that of a university, imparts knowledge, relevant skills and competencies on the individual. ... for social placement. However the paper maintains that .... as a result of lower rates of production, during recessions in business cycles resulting in massive layoffs of workers.

  6. H:\\PMKER 25(3)\\NOUATIN G..xps

    African Journals Online (AJOL)

    AISA

    finance institutions, among which are PAPME whose activities cover the entire national territory. ... tant qu'instrument de lutte contre la pauvreté. ... Il est donc important pour toute entreprise qu'un accent particulier soit mis sur les caractéristiques des bénéficiaires de micro crédit et l'impact du programme de micro crédit afin ...

  7. 7 CFR 253.7 - Certification of households.

    Science.gov (United States)

    2010-01-01

    ... definite periods of time within which households shall be eligible to receive benefits. Further eligibility... agency conference. (Approved by the Office of Management and Budget under control number 0584-0071) (44 U...

  8. Dicty_cDB: SHD253 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 410884 |AJ410884.1 Influenza A virus (swine/Cotes d'Armor/1515/99 (H1N1)) partial N1NA gene for Neuraminidas...e, genomic RNA. 42 1.1 2 AJ410883 |AJ410883.1 Influenza A virus (swine/Cotes d'Armor/1482/99 (H1N1

  9. All projects related to | Page 253 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    2012-02-09

    Some 150 journalists from Latin America and the Caribbean and Southeast Asia are upgrading their skills as science reporters through IDRC support. Start Date: February 9, 2012. End Date: December 9, 2014. Topic: PEER TEACHING, SCIENCE, JOURNALISTS, Capacity building, SCIENCE AND TECHNOLOGY POLICY.

  10. H:\\PMKER 25(3)\\HALA.xps

    African Journals Online (AJOL)

    AISA

    plus fréquemment utilisées contre les cochenilles appartiennent au groupe des organophosphorés. Le chlorpyrifos-éthyl a montré une bonne efficacité comparativement aux pyréthrinoïdes tels que la bifenthrine et la lamdacyhalothrine (Dembélé, 2001). Toutes les formulations à base de chlorpyriphos- éthyl (Dursban 4 E, ...

  11. H:\\PMKER 25(3)\\EGAH J..xps

    African Journals Online (AJOL)

    AISA

    menacée par la diffusion incontrôlée de certaines technologies (introduction de variétés améliorées, gestion de la fertilité des sols, octroi de crédits agricoles et contact avec certains projets de développement agricole), l'absence d'un schéma clair pour la gestion des systèmes semenciers, le privilège accordé aux cultures.

  12. 7 CFR 1710.253 - Engineering and cost studies-addition of generation capacity.

    Science.gov (United States)

    2010-01-01

    ... costs; (2) Financing requirements and risks; (3) System reliability; (4) Alternative unit sizes; (5... assessments of service reliability and financing requirements and risks. Requirements for analyzing purchased... not significantly affect the accomplishment of the objectives of this subpart. ...

  13. 40 CFR 96.253 - Recordation of CAIR SO2 allowances.

    Science.gov (United States)

    2010-07-01

    ... subpart GGG of this part or subpart D of part 73 of this chapter. (2) In 2011 and each year thereafter... accordance with subpart GGG of this part or subpart D of part 73 of this chapter. (b)(1) After a general... accordance with subpart GGG of this part or subpart D of part 73 of this chapter. (2) In 2011 and each year...

  14. 40 CFR 97.253 - Recordation of CAIR SO2 allowances.

    Science.gov (United States)

    2010-07-01

    ... compliance account is established and transferred to the source in accordance with subpart GGG of this part... with subpart GGG of this part or subpart D of part 73 of this chapter. (b)(1) After a general account... accordance with subpart GGG of this part or subpart D of part 73 of this chapter. (2) In 2011 and each year...

  15. : tous les projets | Page 253 | CRDI - Centre de recherches pour le ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    aquaculture figurent parmi les populations les plus exposées à l'insécurité alimentaire. Date de début : 1 mars 2011. End Date: 1 mai 2014. Sujet: AQUACULTURE, FISH CULTURE, FISH PRODUCTION, FISHERY PRODUCT PROCESSING, ...

  16. Status of Radiotherapy around the World: Sub-Saharan Africa. Chapter 25.3

    International Nuclear Information System (INIS)

    Kigula Mugambe, J.B.; Kavuma, A.

    2017-01-01

    Sub-Saharan Africa is faced with numerous socioeconomic and political challenges. These significantly influence the delivery of health services, including radiotherapy. The availability of radiotherapy service in a country does not necessarily mean that its population can access that service. Financial constraints, lack of awareness and poor road infrastructure influence accessibility. For example, the Democratic Republic of the Congo is a vast country with only one centre in Kinshasa, and it is very difficult for people in the eastern part of the country to access it. Late presentation of patients for cancer management is another formidable challenge, aggravated by the issues mentioned above. The countries in this region have to address the problem of increasing cancer burden and the increasingly important role of radiotherapy in cancer management. There is an urgent need for the establishment of radiotherapy centres that are distributed widely across the region, accompanied by the training of more personnel. On the positive side, several countries in this region, e.g. Eritrea, Malawi and Niger, are in the process of establishing radiotherapy facilities in cooperation with the IAEA. Others, such as Ghana, Nigeria and the United Republic of Tanzania, are in the process of expanding the existing services. The countries in this region should address the late presentation problem by increasing awareness and establishing effective prevention and early detection programmes as part of their national cancer control strategies. They should also develop appropriate cancer policies with the continued support of international organizations such as the IAEA and the World Health Organization (WHO).

  17. Refinement of the critical 2p25.3 deletion region

    DEFF Research Database (Denmark)

    De Rocker, Nina; Vergult, Sarah; Koolen, David

    2015-01-01

    and his three children and a 5' MYT1L overlapping duplication in a father and his two children. Expression analysis in zebrafish embryos shows specific myt1l expression in the developing brain. CONCLUSION: Our data strongly strengthen the hypothesis that MYT1L is the causal gene for the observed syndromal...

  18. 30 CFR Appendix to Part 253 - List of U.S. Geological Survey Topographic Maps

    Science.gov (United States)

    2010-07-01

    ... Myers Beach; Fort Myers SW; Fort Walton Beach; Freeport; Gandy Bridge; Garcon Point; Gator Hook Swamp...; Empire; English Lookout; False Mouth Bayou; Fearman Lake; Floating Turf Bayou; Fourleague Bay; Franklin...

  19. Diagnosis and Management of 253 Cases with Cushing's syndrome in Imam Khomeini Hospital

    Directory of Open Access Journals (Sweden)

    Esteghamati A.R

    2007-09-01

    Full Text Available Background: Definite diagnosis and treatment of Cushing's syndrome is still a dilemma. The aim of this study was to evaluate the accuracy of diagnostic tests and follow-up of patients with Cushing's syndrome."nMethods: Two hundred and fifty three consecutive cases with Cushing's syndrome during 1370-78 were studied. The screening tests were performed in all patients. High dose dexamethasone suppression test (HDDST and ACTH measurement were carried out. MRI/CT Scan were performed and compared with laboratory data and pathologic specimens as a gold standard test."nResults: The age range was 32±11 yrs. The most frequent symptoms were weakness; hypertension, typical striae, and depression .The frequency of hypertension in ACTH-dependent case were 77% vs. 36% in adrenal tumors (P< 0.001. HDDST was positive in 99% of micro and 71% of macroadenomas. Adrenal tumors showed 3.6% suppression but none in ectopic cases. HDDST had a sensitivity of 98%, specificity of 97% and accuracy equals to 98%. The frequency of different etiologies was as following: Cushing's disease in 64.8%, adrenal tumors in 32.8% and ectopic ACTH in 2.4% of patients. Trans-sphenoidal surgery (TSS was performed in 120 patients .The patients were followed for 53±25 months whose remission periods were 46.7±23.8 months (range 4-114 months. Survival analysis showed 93% remission rate in 12mo, 82% in 2yr and only 33% after 5yr.This recurrence didn't have any platue level."nConclusion: In our study, hypertension was more prevalent in ACTH-dependent Cushing's syndrome. HDDST had acceptable sensitivity, specificity and accuracy. Lifelong follow up of pituitary adenomas is inevitable in the case of progressive and gradual nature of recurrence in these tumors.

  20. Sud du Sahara | Page 253 | CRDI - Centre de recherches pour le ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Savoir. Innovation. Solutions. Carrières · Communiquez avec nous · Plan du site · Droits d'auteur · Éthique de la recherche · Politique de libre accès · Politique de confidentialité · Transparence · Utilisation du site Web. Suivez-nous; Facebook · Twitter · Youtube · Linked In · RSS Feed. © 2015 CRDI. Tous droits réservés.

  1. H:\\PMKER 25(3)\\VANGA A. F..xps

    African Journals Online (AJOL)

    AISA

    pesticides de synthèse afin de provoquer la mort par empoisonnement des ... par l'homme dans les milieux aquatiques de substances ou d'énergies .... En effet, les enquêtés, pour la plupart, estiment que cette consommation provoque des diarrhées et des vomissements chez les concernés. Il y a même des avertissements ...

  2. Fungal diversity notes 253-366: taxonomic and phylogenetic contributions to fungal taxa

    Czech Academy of Sciences Publication Activity Database

    Li, G.J.; Hyde, K.D.; Zhao, R. L.; Hongsanan, S.; Abdel-Aziz, F.A.; Abdel-Wahab, M. A.; Alvarado, P.; Alves-Silva, G.; Ammirati, J.F.; Ariyawansa, H.A.; Baghela, A.; Bahkali, A. H.; Beug, M.; Bhat, D.J.; Bojantchev, D.; Boonpratuang, T.; Bulgakov, T.S.; Camporesi, E.; Boro, M.C.; Ceska, O.; Chakraborty, D.; Chen, J.J.; Chethana, K.W.T.; Chomnunti, P.; Consiglio, G.; Cui, B.K.; Dai, D. Q.; Dai, Y.C.; Daranagama, D. A.; Das, K.; Vlasák, Josef

    2016-01-01

    Roč. 78, č. 1 (2016), s. 1-237 ISSN 1560-2745 Institutional support: RVO:60077344 Keywords : lichenized ascomycota ostropales * ribosomal dna-sequences * strictly anaerobic fungus * sp-nov russulaceae * molecular phylogeny * Basidiomycota Subject RIV: EF - Botanics Impact factor: 13.465, year: 2016

  3. 30 CFR 253.3 - How are the terms used in this regulation defined?

    Science.gov (United States)

    2010-07-01

    ... in this regulation defined? Terms used in this part have the following meaning: Advertise means... well drilled from a mobile offshore drilling unit (MODU) and the associated riser and well control...

  4. Las Tierras Indígenas en la Ley 19.253

    Directory of Open Access Journals (Sweden)

    Jaime López Allendes

    Full Text Available Desde el año 1993 rige en Chile una ley que reconoce a las étnias indígenas y señala que la tierra es para estas el fundamento principal de sus existencia y de su cultura. Tal declaración del legislador chileno es el basamento donde se levanta un régimen jurídico especial. Si bien con anterioridad se habían dictado varias leyes que regían las tierras indígenas, aquellas tuvieron por objeto, primero la radicación de los indígenas en comunidades, y luego la división para el ingreso de tales inmuebles al régimen común de propiedad prinvada, y más tarde al mercado. La mayor innovación de la ley en comento se refiere a que reconoce el valor de la tierra como hábitat cultural, y no como una nueva mercancía.

  5. 29 CFR 1910.253 - Oxygen-fuel gas welding and cutting.

    Science.gov (United States)

    2010-07-01

    ... for lifting cylinders from one vertical position to another. Bars shall not be used under valves or... (84 m 3) of gas. (v) Acetylene and liquefied fuel-gas cylinders shall be manifolded in a vertical... gas shall be drained into drip pots constructed so as to permit pumping or draining out the condensate...

  6. SU-F-T-253: Volumetric Comparison Between 4D CT Amplitude and Phase Binning Mode

    Energy Technology Data Exchange (ETDEWEB)

    Yang, G; Ma, R; Reyngold, M [Memorial Sloan-Kettering Cancer Center, Commack, NY (United States); Li, X; Xiong, W; Gewanter, R [Memorial Sloan-Kettering Cancer Center, Rockville Center, NY (United States); Yorke, E; Mageras, G; Wu, A; Deasy, J; Hunt, M [Memorial Sloan-Kettering Cancer Center, New York, NY (United States); Tang, X [Memorial Sloan-Kettering Cancer Center, West Harrison, NY (United States); Chan, M [Memorial Sloan-Kettering Cancer Center, Basking Ridge, NJ (United States)

    2016-06-15

    Purpose: Motion artifact in 4DCT images can affect radiation treatment quality. To identify the most robust and accurate binning method, we compare the volume difference between targets delineated on amplitude and phase binned 4DCT scans. Methods: Varian RPM system and CT scanner were used to acquire 4DCTs of a Quasar phantom with embedded cubic and spherical objects having superior-inferior motion. Eight patients’ respiration waveforms were used to drive the phantom. The 4DCT scan was reconstructed into 10 phase and 10 amplitude bins (2 mm slices). A scan of the static phantom was also acquired. For each waveform, sphere and cube volumes were generated automatically on each phase using HU thresholding. Phase (amplitude) ITVs were the union of object volumes over all phase (amplitude) binned images. The sphere and cube volumes measured in the static phantom scan were V{sub sphere}=4.19cc and V{sub cube}=27.0cc. Volume difference (VD) and dice similarity coefficient (DSC) of the ITVs, and mean volume error (MVE) defined as the average target volume percentage difference between each phase image and the static image, were used to evaluate the performance of amplitude and phase binning. Results: Averaged over the eight breathing traces, the VD and DSC of the internal target volume (ITV) between amplitude and phase binning were 3.4%±3.2% (mean ± std) and 95.9%±2.1% for sphere; 2.1%±3.3% and 98.0% ±1.5% for cube, respectively.For all waveforms, the average sphere MVE of amplitude and phase binning was 6.5% ± 5.0% and 8.2%±6.3%, respectively; and the average cube MVE of amplitude and phase binning was 5.7%±3.5%and 12.9%±8.9%, respectively. Conclusion: ITV volume and spatial overlap as assessed by VD and DSC are similar between amplitude and phase binning. Compared to phase binning, amplitude binning results in lower MVE suggesting it is less susceptible to motion artifact.

  7. SU-E-J-253: The Radiomics Toolbox in the Computational Environment for Radiological Research (CERR)

    International Nuclear Information System (INIS)

    Apte, A; Veeraraghavan, H; Oh, J; Kijewski, P; Deasy, J

    2015-01-01

    Purpose: To present an open source and free platform to facilitate radiomics research — The “Radiomics toolbox” in CERR. Method: There is scarcity of open source tools that support end-to-end modeling of image features to predict patient outcomes. The “Radiomics toolbox” strives to fill the need for such a software platform. The platform supports (1) import of various kinds of image modalities like CT, PET, MR, SPECT, US. (2) Contouring tools to delineate structures of interest. (3) Extraction and storage of image based features like 1st order statistics, gray-scale co-occurrence and zonesize matrix based texture features and shape features and (4) Statistical Analysis. Statistical analysis of the extracted features is supported with basic functionality that includes univariate correlations, Kaplan-Meir curves and advanced functionality that includes feature reduction and multivariate modeling. The graphical user interface and the data management are performed with Matlab for the ease of development and readability of code and features for wide audience. Open-source software developed with other programming languages is integrated to enhance various components of this toolbox. For example: Java-based DCM4CHE for import of DICOM, R for statistical analysis. Results: The Radiomics toolbox will be distributed as an open source, GNU copyrighted software. The toolbox was prototyped for modeling Oropharyngeal PET dataset at MSKCC. The analysis will be presented in a separate paper. Conclusion: The Radiomics Toolbox provides an extensible platform for extracting and modeling image features. To emphasize new uses of CERR for radiomics and image-based research, we have changed the name from the “Computational Environment for Radiotherapy Research” to the “Computational Environment for Radiological Research”

  8. 7 CFR 2.53 - Administrator, Food Safety and Inspection Service.

    Science.gov (United States)

    2010-01-01

    ....S.C. 6901 et seq.); (ii) Federal Water Pollution Prevention and Control Act, as amended (33 U.S.C. 1251 et seq.); (iii) Safe Drinking Water Act, as amended (42 U.S.C. 300f et seq.); (iv) Clean Air Act... respect to consideration of the availability of qualified minority firms in awarding contracts, but...

  9. 14 CFR 25.3 - Special provisions for ETOPS type design approvals.

    Science.gov (United States)

    2010-01-01

    ... requirements; (ii) K25.1.4(a)(3), low fuel alerting; and (iii) K25.1.4(c), engine oil tank design. (2) For... 14 Aeronautics and Space 1 2010-01-01 2010-01-01 false Special provisions for ETOPS type design... for ETOPS type design approvals. (a) Applicability. This section applies to an applicant for ETOPS...

  10. 253 some biochemical effects of a mainly fruit diet in man

    African Journals Online (AJOL)

    The mean serum triglyceride levels of group Al had decreased significantly after J2 weeks on the diet (P

  11. H:\\PMKER 25(3)\\NGORAN K. E..xps

    African Journals Online (AJOL)

    AISA

    Brucelosis in sub-saharian Africa : epidemiology, control and impact. Veterinary microbiology;. 90 : 111 - 134. Meyer C. et J. P. Denis. 1999. Elevage de la vache laitière en zone tropicale. CIRAD. Montpellier, France, 314 p. MIPARH-DPP. 2003. Rapport national sur l'état des ressources zoogénétiques. Départe- ment de la ...

  12. 30 CFR 253.24 - When I submit audited annual financial statements to verify my net worth, what standards must...

    Science.gov (United States)

    2010-07-01

    ... of an independent accountant that states: (1) The financial statements are free from material misstatement, and (2) The audit was conducted in accordance with the generally accepted auditing standards...

  13. 75 FR 21298 - Determination of Regulatory Review Period for Purposes of Patent Extension; VIMPAT -NDA 22-253

    Science.gov (United States)

    2010-04-23

    ... product and continues until FDA grants permission to market the drug product. Although only a portion of a... 35 U.S.C. 156(g)(1)(B). FDA recently approved for marketing the human drug product, VIMPAT... regulatory review period and that the approval of VIMPAT represented the first permitted commercial marketing...

  14. 30 CFR 253.27 - When I submit audited annual financial statements to verify my unencumbered assets, what...

    Science.gov (United States)

    2010-07-01

    ... Resources MINERALS MANAGEMENT SERVICE, DEPARTMENT OF THE INTERIOR OFFSHORE OIL SPILL FINANCIAL... 30 Mineral Resources 2 2010-07-01 2010-07-01 false When I submit audited annual financial... financial statements to verify my unencumbered assets, what standards must they meet? Any audited annual...

  15. Nustar and Chandra insight into the nature of the 3-40 kev nuclear emission in NGC 253

    DEFF Research Database (Denmark)

    Lehmer, B. D.; Wik, D. R.; Hornschemeier, A. E.

    2013-01-01

    that was also near the dynamical center (θ ≈ 0.4 arcsec); however, this source was offset from the 2012 source position by ≈ 1 arcsec. We show that the probability of the 2003 and 2012 hard X-ray sources being unrelated is ≫99.99% based on the Chandra spatial localizations. Interestingly, the Chandra spectrum...... of the 2003 source (3-8 keV) is shallower in slope than that of the 2012 hard X-ray source. Its proximity to the dynamical center and harder Chandra spectrum indicate that the 2003 source is a better AGN candidate than any of the sources detected in our 2012 campaign; however, we were unable to rule out a ULX...

  16. SU-E-T-253: Open-Source Automatic Software for Quantifying Biological Assays of Radiation Effects

    International Nuclear Information System (INIS)

    Detappe, A; Korideck, H; Makrigiorgos, G; Berbeco, R

    2014-01-01

    Purpose: Clonogenic cell survival is a common assay for quantifying the effect of drugs and radiation. Manual counting of surviving colonies can take 30–90seconds per plate, a major limitation for large studies. Currently available automatic counting tools are not easily modified for radiation oncology research. Our goal is to provide an open-source toolkit for precise, accurate and fast analysis of biological assays in radiation oncology. Methods: As an example analysis, we used HeLa cells incubated with gadolinium nanoparticles prior to irradiation. After treatment, the cells are grown for 14days to allow for colony formation. To analyze the colony growth, we capture images of each dish for archiving and automatic computer-based analysis. A FujifilmX20 camera is placed at the top of a box setup, 20cm above the sample, which is backlit by a LED lamp placed at the bottom of the box. We use a Gaussian filter (width=1.3mm) and color threshold (19–255). The minimum size for a colony to be counted is 1mm. For this example, 20 dishes with a large range of colonies were analyzed. Each dish was counted 3 times manually by 3 different users and then compared to our counter. Results: Automatic counting of cell colonies takes an average of 7seconds, enabling the analysis process to be accelerated 4–12 times. The average precision of the automatic counter was 1.7%. The Student t-test demonstrated the non-significant differences between the two counting methods (p=0.64). The ICC demonstrated the reliability of each method with ICC>0.999 (automatic) and ICC=0.95 (manual). Conclusion: We developed an open-source automatic toolkit for the analysis of biological assays in radiation oncology and demonstrated the accuracy, precision and effort savings for clonogenic cell survival quantification. This toolkit is currently being used in two laboratories for routine experimental analysis and will be made freely available on our departmental website

  17. 37 CFR 253.8 - Terms and rates of royalty payments for the use of published pictorial, graphic, and sculptural...

    Science.gov (United States)

    2010-07-01

    ... from which the work was reproduced” means a transparency or other reproduction of an underlying work of fine art. (c) Payment of royalty rate. PBS or other public broadcasting entity shall pay the required...

  18. The importance of education in the promotion of organ donation - doi: 10.5020/18061230.2012.p253

    Directory of Open Access Journals (Sweden)

    Taise Ribeiro Morais

    2012-11-01

    Full Text Available Transplantation and human organ donation are controversial issues that have generated much interest and discussion. The lack of clarification and the sensationalist news about organ trafficking contribute to raise questions and render the myths and prejudices permanent.The donation of organs and tissues is seen by society in general, as an act of solidarity and love from the family. However, it requires decision-making at a time of extreme pain and distress, caused by the impact of breaking news of death, the feeling of loss and the unexpected interruption of a life course(1.As the criteria of death are modified, the concept of brain death arises, along with the possibility of using donor organs and tissues. When there is not a good understanding of the organ donation process, the relatives of potential donors feel apprehensive, doubtful and undecided at the time of occurrence, because it is a subject about which there hasn’t been much clarification(1.Brazil has the largest public transplants program in the world, since the government finances 92% of procedures done in the country. However, when we consider the rate of post mortem transplant into the population, Brazil’s results are little expressive(2.Family refusal is a major obstacle to the realization of transplants, and is also identified as major cause for the shortage of organs and tissues for transplantation. Families who understand well the diagnosis of brain death are more favorable to organ donation, compared to families who believe that death only occurs after the heart stops. Therefore, the poor level of information, either by the quality of information concerning brain death, either by not having exceeded the barrier of stigmatized fear of organ trading, propagated by the media, drastically reduces the number of patients who are benefited from receiving an organ(3.Although all people are responsible for disseminating information, we must also educate health professionals, since they interfere directly in the likely donor’s family decision. Perhaps, they lack the study of Thanatology. These professionals deal directly with death but do not investigate death, mourning. The family situation at the time of mourning, hardened by the difficult decision of donating the organs of their beloved one, should form a strong synergistic relationship, as it comes into question the shock of death and the decision to save other people’s lives. It has also been disclosed that religion is considered one of the reasons to refuse the donation of organs and tissues for transplantation. It is, thus, necessary to give greater attention to people’s religious beliefs and values by the time of the loss of their relatives. The literature is rich in references demonstrating that the mass media, despite their high national and global spreading power, are not best suited to provide sufficient explanation on such contentious issues as it is, among others, the organ donation. Instead, the means, the symbology and the repertoire often used by mass media cause more confusion than clarification(4.A study in Spain found that a lot of information spread in the media could be an alternative to the clarification of doubts, however, it sometimes reproduce misinformation, superficial and prejudice-based ideas, being unable to modify negative behavior related to organ donation.A research conducted with people attending health centers in Spain showed that only 7% of the respondents received information about transplantation from primary care professionals. Although the negative information has been quite absorbed, the study indicates that, even in small proportion, the positive information has generated a new way of interpreting organ donation(6We here emphasize the importance of discussing the issue “organ donation” with friends and family, because people, being well educated, are capable of promoting discussions, which that can be understood as promotion of donation.The profile of the opponent to organ donation is: man or woman over the age of 45 years, with low schooling, who does not know the concept of brain death and has a partner also against organ donation, is not conducive to blood donation and fears the manipulation of the body after death. The main reasons for not accepting the donation is the lack of knowledge of how to become a donor and the fear of misdiagnosis of death(7.Facing this reality, health professionals should act as educators, to modify public opinion regarding the misconceptions. However, unfavorable beliefs can be modified only if educators are well prepared for that, so that the population is prompted to participate in debates on organ transplants and legislation.Modifying the existing reality means developing programs planned and evaluated in an ongoing educational process, supported by theoretical background and scientifically recognized models, for all segments of the community, along with incorporating the knowledge of thanatology in the formation of health professionals, with better appreciation of religious principles, to avoid making an aggressive approach to the families of potential donors. The preparation of families should be taken into consideration, to prevent the false idea that death is being expected in order to save others’ lives, because every family wants their patient to have the opportunity to live. Therefore, the government is to be exhorted to realize that the lack of support to the practice of organ donation is a real problem, and to include educational activities regarding transplants in priority governmental programs and in public policies of health care.Since organ donation in Brazil depends exclusively on the family permission, campaigns that seek to increase the understanding of the concept of brain death among the population, and, most of all, to encourage people to express their desire to be a donor and to discuss their decision with family are important strategies to tackle this problem.With a performance based on ethics and responsibility, the relationships and public policies contribute to the interests of society and organizations being achieved and established through dialogue. On the issue of transplantation, this contribution stands out because, through information and the establishment of relations with the public segments, the activity aims to reduce the suffering of many people awaiting in queues, as well as to alleviate the suffering of donor’s relatives and friends.It is also extremely valuable to include contents related to the theme of transplants / organ donation in undergraduate courses in the health area, so that professionals can act accordingly to the needs of their clientele, safely and efficiently, improving quality of life population.

  19. 37 CFR 253.4 - Performance of musical compositions by PBS, NPR and other public broadcasting entities engaged in...

    Science.gov (United States)

    2010-07-01

    ... background or theme music in a PBS program: 2003-2007 $56.81 (3) For performance of such a work in a feature... music in a program of a station of PBS: 2003-2007 $4.04 (5) For the performance of such a work in a... theme music in an NPR program: 2003-2007 $5.51 (7) For the performance of such a work in a feature...

  20. Intellectual disability, muscle weakness and characteristic face in three siblings: A newly described recessive syndrome mapping to 3p24.3-p25.3

    NARCIS (Netherlands)

    Kariminejad, Ariana; Nafissi, Shahriar; Nilipoor, Yalda; Tavasoli, Alireza; van Veldhoven, Paul P.; Bonnard, Carine; Ng, Yeng Ting; Majoie, Charles B.; Reversade, Bruno; Hennekam, Raoul C.

    2015-01-01

    We report on a sister and two brothers born to healthy Iranian parents with mild intellectual disability, progressive muscle weakness, and characteristic facies. including highly arched eyebrows, down-slanting palpebral fissures, prominent nasal bridge, prominent nose, columella extending below alae

  1. El-AbedOroub, Unprotected: Palestinians in Egypt since 1948, Washington, DC, Institute for Palestine Studies / Ottawa: International Development Research Centre, 2009, 253 p.

    Directory of Open Access Journals (Sweden)

    Françoise de Bel-Air

    2010-06-01

    Full Text Available L’ouvrage proposé par Oroub El-Abed sur les Palestiniens d’Égypte comble un manque : cette communauté n’avait, en effet, encore jamais fait l’objet d’une étude scientifique de grande ampleur telle que celle entreprise par l’auteur sous les auspices du programme Forced Migration and Refugee Studies de l’Université américaine au Caire. L’ambition initiale de Oroub El-Abed et de son équipe était de réaliser une enquête de terrain portant sur un échantillon de 300 ménages répartis dans 15 gouvern...

  2. Interacting boson model of collective states I. The vibrational limit (Reprinted from Annals of Physics, vol 99, pg 253-317, 1976)

    NARCIS (Netherlands)

    Arima, A; Iachello, F

    2000-01-01

    We propose a unified description of collective nuclear states in terms of a system of interacting bosons. We shown that within this model both the vibrational and the rotational limit can be recovered. We study in detail the vibrational limit and brain attention to the possible existence of an

  3. Concomitant NSAID use during antipsychotic treatment and risk of 2-year relapse - a population-based study of 16,253 incident patients with schizophrenia

    DEFF Research Database (Denmark)

    Köhler, Karl Ole; Petersen, Liselotte; Benros, Michael Eriksen

    2016-01-01

    was associated with an increased risk of schizophrenia relapse (HRR = 1.21; 95%-CI = 1.11-1.31), particularly associated with acetylsalicylic acid and diclofenac. Concomitant use of paracetamol was not associated with schizophrenia relapse (HRR = 0.97; 95%-CI = 0.87-1.08). Subgroup analyses showed...

  4. 3-(4-{3,3,4,4,5,5-Hexafluoro-2-[5-(3-methoxyphenyl-2-methyl-3-thienyl]cyclopent-1-enyl}-5-methyl-2-thienylbenzonitrile

    Directory of Open Access Journals (Sweden)

    An-yin Chen

    2009-10-01

    Full Text Available The title compound, C29H19F6NOS2, is a new unsymmetrical photochromic diarylethene derivative with different meta-phenyl substituents. The distance between the two reactive (i.e. can be irradiated to form a new chemical bond C atoms is 3.501 (4 Å; the dihedral angles between the mean plane of the main central cyclopentene ring and the thiophene rings are 47.7 (5 and 45.1 (2°, and those between the thiophene rings and the adjacent benzene rings are 29.4 (2 and 28.4 (3°. The three C atoms and the F atoms of hexafuorocyclopentene ring are disordered over two positions, with site-occupancy factors of 0.751 (4 and 0.249 (4.

  5. The Phase Evolution and Property of FeCoCrNiAlTix High-Entropy Alloying Coatings on Q253 via Laser Cladding

    Directory of Open Access Journals (Sweden)

    Bin He

    2017-09-01

    Full Text Available High-entropy alloys (HEAs are emerging as a hot research frontier in the metallic materials field. The study on the effect of alloying elements on the structure and properties of HEAs may contribute to the progress of the research and accelerate the application in actual production. FeCoCrNiAlTix (x = 0, 0.25, 0.5, 0.75, and 1 in at.%, respectively HEA coatings with different Ti concentrations were produced on Q235 steel via laser cladding. The constituent phases, microstructure, hardness, and wear resistance of the coatings were investigated by XRD, SEM, microhardness tester and friction-wear tester, respectively. The results show that the structure of the coating is a eutectic microstructure of FCC and BCC1 at x = 0. The structure of coatings consists of both proeutectic FCC phase and the eutectic structure of BCC1 and BCC2. With the continuous addition of Ti, the amount of eutectic structure decreases. The average hardness of the FeCoCrNiAlTix HEA coatings at x = 0, 0.25, 0.5, 0.75, and 1 are 432.73 HV, 548.81 HV, 651.03 HV, 769.20 HV, and 966.29 HV, respectively. The hardness of coatings increases with the addition of Ti, where the maximum hardness is achieved for the HEA at x = 1. The wear resistance of the HEA coatings is enhanced with the addition of Ti, and the main worn mechanism is abrasive wear.

  6. Del acero a la diversión, Oscar Flores Torres, Monterrey Industrial 1890-2000, Ciudad Victoria, Tamaulipas, Universidad de Moneterey-CONACYT, 2000, pp 253 pp.

    OpenAIRE

    Flores Clair, Eduardo

    2005-01-01

    Este libro comprende más de un siglo de historia industrial donde se muestran las múltiples relaciones entre los empresarios (grupos familiares) y los gobiernos en turno. El humo lanzado por las largas chimeneas de la Fundidora de Monterrey se convirtió en el símbolo de la ciudad y trazó el camino de un constante crecimiento. Hoy en día, la región concentra a los grupos industriales más importantes de México. En los últimos años, los "regios", en diversos ámbitos, han aumentado su presencia e...

  7. Pion and nucleon structure as probed in the reaction π/sup +-/N → μ+μ-X at 253 GeV

    International Nuclear Information System (INIS)

    McDonald, K.T.

    1988-01-01

    New results are presented from Fermilab experiment E615, in which hadroproduction of muon pairs allows a determination of the quark structure of the initial-state hadrons in the context of a Drell-Yan model. Comparison of muon-pair production by π + and π - beams shows the cross-section ratio follows Drell-Yan model expectations, except for a dip in σ(π + )/σ(π - ) near x/sub π/ near 1. The same data are also used to extract the ratio of the sea to valence quark distributions in the nucleon, with improved accuracy for x/sub N/ 2 for the π - data sample. This provides stronger evidence of a rise in the nucleon structure function for x/sub N/ < 0.06 compared to that extracted in deep-inelastic lepton scattering. The issue is raised of the nonuniqueness of the definition of x/sub π/ and x/sub N/ used in the Drell-Yan analysis. A definition proposed by Soper has superior invariance properties to that commonly used. An analysis based on this definition yields generally similar results for the pion and nucleon structure function, compared to use of the common definition. However, the pion structure function shows a larger intercept at x/sub π/ = 1 when the definition of Soper is used. 21 refs., 6 figs

  8. A high-resolution whole genome radiation hybrid map of human chromosome 17q22-q25.3 across the genes for GH and TK

    Energy Technology Data Exchange (ETDEWEB)

    Foster, J.W.; Schafer, A.J.; Critcher, R. [Univ. of Cambridge (United Kingdom)] [and others

    1996-04-15

    We have constructed a whole genome radiation hybrid (WG-RH) map across a region of human chromosome 17q, from growth hormone (GH) to thymidine kinase (TK). A panel of 128 WG-RH hybrid cell lines generated by X-irradiation and fusion has been tested for the retention of 39 sequence-tagged site (STS) markers by the polymerase chain reaction. This genome mapping technique has allowed the integration of existing VNTR and microsatellite markers with additional new markers and existing STS markers previously mapped to this region by other means. The WG-RH map includes eight expressed sequence tag (EST) and three anonymous markers developed for this study, together with 23 anonymous microsatellites and five existing ESTs. Analysis of these data resulted in a high-density comprehensive map across this region of the genome. A subset of these markers has been used to produce a framework map consisting of 20 loci ordered with odds greater than 1000:1. The markers are of sufficient density to build a YAC contig across this region based on marker content. We have developed sequence tags for both ends of a 2.1-Mb YAC and mapped these using the WG-RH panel, allowing a direct comparison of cRay{sub 6000} to physical distance. 31 refs., 3 figs., 2 tabs.

  9. α-decay half-life of Es253 in metallic Fe at temperatures between 4 K and 50 mK

    Czech Academy of Sciences Publication Activity Database

    Severijns, N.; Zákoucký, Dalibor

    2007-01-01

    Roč. 76, č. 2 (2007), 024304-024304 ISSN 0556-2813 Institutional research plan: CEZ:AV0Z10480505 Keywords : radioactive nuclei Subject RIV: BF - Elementary Particles and High Energy Physics Impact factor: 3.302, year: 2007

  10. Pure partial monosomy 3p (3p25.3 → pter: Prenatal diagnosis and array comparative genomic hybridization characterization

    Directory of Open Access Journals (Sweden)

    Chih-Ping Chen

    2012-09-01

    Conclusion: In this case, aCGH has characterized a 3p deleted region with haploinsufficiency of the neurodevelopmental genes associated with cognitive deficit and mental retardation but without involvement of the congenital heart disease susceptibility locus, and QF-PCR has determined a paternal origin of the deletion. aCGH and QF-PCR help to delineate the genomic imbalance in prenatally detected de novo chromosome aberration, and the information acquired is useful for genetic counseling.

  11. FONSECA, Luciana Carvalho. Inglês Jurídico – Tradução e Terminologia. São Paulo: Lexema, 2014. 253 p.

    Directory of Open Access Journals (Sweden)

    Juliana Steil

    2014-07-01

    Full Text Available http://dx.doi.org/10.5007/2175-7968.2014v1n33p361 O livro, escrito em linguagem elegante e objetiva, é resultado da organização de uma série de textos originalmente publicados por Luciana Carvalho Fonseca em meio eletrônico, na página da Tradjuris – law, language & culture (empresa dirigida por Fonseca e na coluna Migalaw do portal jurídico Migalhas. A obra reflete a longa experiência teórica e prática da autora, que é advogada e tradutora, além de professora de tradução jurídica, cultura e interpretação consecutiva e simultânea da PUC-SP. Um dos aspectos mais interessantes da metodologia utilizada na proposta do livro é justamente o fato de a maior parte dos tópicos abordados ter partido de dúvidas sobre tradução e terminologia apresentadas por leitores dos referidos sites, conforme explica a autora (p. 07, indicando a pertinência do perfil prioritariamente aplicado do conteúdo da obra

  12. Rapid detection of de novo P253R mutation in FGFR2 using uncultured amniocytes in a pregnancy affected by polyhydramnios, Blake's pouch cyst, and Apert syndrome

    Directory of Open Access Journals (Sweden)

    Chih-Ping Chen

    2013-06-01

    Conclusion: Prenatal diagnosis of polyhydramnios, frontal bossing, and midface hypoplasia associated with brain and digital abnormalities should include a differential diagnosis of Apert syndrome. A molecular analysis of FGFR2 using uncultured amniocytes is useful for rapid confirmation of Apert syndrome at prenatal diagnosis.

  13. Marcus Sidonius Falx (mise en forme et commentaires de Jerry Toner), L’Art de gouverner ses esclaves, Paris, PUF, 2015, 253 p.

    OpenAIRE

    Maugeri, Salvatore

    2015-01-01

    Curieux ouvrage en vérité que celui-là, écrit par le Romain Marcus S. Falx, personnage fictif ayant vécu à une période imprécise de l’Antiquité (entre le premier et le deuxième siècle de notre ère), et dont les réflexions sont élaborées et mises au net par son assistant, un certain Jerry Toner, « professeur dans l’une de nos misérables provinces septentrionales », ainsi que le précise Falx (p. 13). Toner n’est autre que l’auteur, évidemment, et fait mine, à chaque fin de chapitre, de commente...

  14. 78 FR 43888 - Compliance Policy Guide Sec. 253.100-Use of Units of Plasma and Fresh Frozen Plasma Which Have...

    Science.gov (United States)

    2013-07-22

    ... and Fresh Frozen Plasma Which Have Been Thawed; Withdrawal of Compliance Policy Guide AGENCY: Food and... Units of Plasma and Fresh Frozen Plasma Which Have Been Thawed,'' issued October 1, 1980, and revised in... Plasma Which Have Been Thawed'' on October 1, 1980, and revised it in March 1995. FDA originally issued...

  15. 253. Experiencia en el puente al trasplante cardíaco con oxigenación de membrana extracorpórea en adultos

    Directory of Open Access Journals (Sweden)

    L. Doñate Bertolín

    2012-04-01

    Conclusiones: La asistencia tipo ECMO permite rescatar pacientes en shock cardiogénico refractario, asistiéndolos con éxito hasta el trasplante. Nuestros resultados postrasplante en pacientes en los que el puente al trasplante se hace sólo con ECMO, son suficientemente buenos como para aceptar esta estrategia, ya que la política nacional de trasplantes nos permite llevarlo a cabo en las primeras semanas de asistencia.

  16. 47 CFR 25.253 - Special requirements for ancillary terrestrial components operating in the 1626.5-1660.5 MHz/1525...

    Science.gov (United States)

    2010-10-01

    ... assignment. (2) Be operated in a fashion that takes all practicable steps to avoid causing interference to U... intermodulation product of these base stations falls on an L-band MSS band coordinated for use by another MSS... base station EIRP on the frequencies contributing to the third-order intermodulation products. The...

  17. Chemistry of the heaviest elements--one atom at a time

    International Nuclear Information System (INIS)

    Hoffman, Darleane C.; Lee, Diana M.

    2000-01-01

    In keeping with the goal of the Viewpoint series of the Journal of Chemical Education, this article gives a 75-year perspective of the chemistry of the heaviest elements, including a 50-year retrospective view of past developments, a summary of current research achievements and applications, and some predictions about exciting, new developments that might be envisioned within the next 25 years. A historical perspective of the importance of chemical separations in the discoveries of the transuranium elements from neptunium (Z=93) through mendelevium (Z=101) is given. The development of techniques for studying the chemical properties of mendelevium and still heavier elements on the basis of measuring the radioactive decay of a single atom (''atom-at-a-time'' chemistry) and combining the results of many separate experiments is reviewed. The influence of relativistic effects (expected to increase as Z 2 ) on chemical properties is discussed. The results from recent atom-at-a-time studies of the chemistry of the heaviest elements through seaborgium (Z=106) are summarized and show that their properties cannot be readily predicted based on simple extrapolation from the properties of their lighter homologues in the periodic table. The prospects for extending chemical studies to still heavier elements than seaborgium are considered and appear promising

  18. Discovery of a Perseus-like cloud in the early Universe : H I-to-H 2 transition, carbon monoxide and small dust grains at z abs ≈ 2.53 towards the quasar J0000+0048

    NARCIS (Netherlands)

    Noterdaeme, P.; Krogager, J. K.; Balashev, S.; Ge, J.; Gupta, N.; Krühler, T.; Ledoux, C.; Murphy, M.T.; Pâris, I.; Petitjean, P.; Rahmani, H.; Srianand, R.; Ubachs, W.

    2017-01-01

    We present the discovery of a molecular cloud at zabs ≈ 2.5255 along the line of sight to the quasar SDSS J 000015.17+004833.3. We use a high-resolution spectrum obtained with the Ultraviolet and Visual Echelle Spectrograph together with a deep multi-wavelength medium-resolution spectrum obtained

  19. Ten-vertex rhodadithiaborane chemistry:[8-{I(CH2)5}-3-(.eta.5-C5Me5)-arachno-3,7,8,-RhS2B8H9

    Czech Academy of Sciences Publication Activity Database

    Marcías, R.; Barrett, S. A.; Bould, J.; Dörfler, U.; Holub, Josef; Kennedy, J. D.; Thornton-Pett, M.; Štíbr, Bohumil

    2001-01-01

    Roč. 57, č. 5 (2001), s. 520-522 ISSN 0108-2701 R&D Projects: GA MŠk LN00A028 Institutional research plan: CEZ:AV0Z4032918 Keywords : boranes * heteroboranes * metalladithiaboranes Subject RIV: CA - Inorganic Chemistry Impact factor: 0.570, year: 2001

  20. Fusion of a novel gene, RCC17, to the TFE3 gene in t(X;17)(p11.2;q25.3)-bearing papillary renal cell carcinomas

    NARCIS (Netherlands)

    Heimann, P.; El Housni, H.; Ogur, G.; Weterman, M. A.; Petty, E. M.; Vassart, G.

    2001-01-01

    A subset of childhood and young adult renal cell carcinomas displays a recurrent translocation t(X;17)(p11;q25) as the sole cytogenetic abnormality. In two young girls, we demonstrate that this translocation results in the fusion of a novel gene, designated RCC17, at chromosome 17q25, to the

  1. Fusion of a novel gene, RCC17, to the TFE3 gene in t(X;17)(p11.2;q25.3)-bearing papillary renal cell carcinomas.

    NARCIS (Netherlands)

    Heimann, P.; Housni, H. El; Ogur, G.; Weterman, M.A.J.; Petty, E.M.; Vassart, G.

    2001-01-01

    A subset of childhood and young adult renal cell carcinomas displays a recurrent translocation t(X;17)(p11;q25) as the sole cytogenetic abnormality. In two young girls, we demonstrate that this translocation results in the fusion of a novel gene, designated RCC17, at chromosome 17q25, to the

  2. Erratum to ``Dynamics of sediment discharge in relation to land-use and hydro-climatology in a humid tropical watershed in Costa Rica'' [Journal of Hydrology 253 (2001) 91 109

    Science.gov (United States)

    Krishnaswamy, Jagdish; Halpin, Patrick N.; Richter, Daniel D.

    2002-02-01

    The Publisher regrets that in the above article the present address of the corresponding author was published incorrectly. The correct address for J. Krishnaswamy is as follows: *Ashoka Trust for Research in Ecology and the Environment (ATREE), Post Box 2402, Farm Post Hebbal, Bangalore 560024, India.

  3. Ethyl 2-{5-[(3-oxo-3,4-dihydro-2H-1,4-benzothiazin-4-ylmethyl]-1H-1,2,3-triazol-1-yl}acetate

    Directory of Open Access Journals (Sweden)

    Nada Kheira Sebbar

    2014-02-01

    Full Text Available In the title compound, C15H16N4O3S, the six-membered heterocycle of the benzothiazine fragment exhibits a screw boat conformation. The dihedral angle between the planes through the triazole ring and the benzene ring fused to the 1,4-thiazine ring is 62.98 (11°. The mean plane formed by the atoms belonging to the acetate group is nearly perpendicular to the triazole ring [dihedral angle = 74.65 (12°]. In the crystal, molecules are linked by pairs of C—H...O interactions, forming dimeric aggregates.

  4. A Response to Ages Past. Commentary on Harris, R. M., Michell, B.G. & Cooley. C. (1985) The Gender Gap in Library Education. (Journal of Education for Library and Information Science, 25(3), 167-176)

    Science.gov (United States)

    Wellstead, Peta

    2015-01-01

    Much has changed in the information environment since the years of Harris' review. It is important to mention the significance of the impact of technology that has rendered the work of librarians and information workers almost unknowable to those teaching in the period 1965-1983. As a result of these reviews and technological changes, many…

  5. Bruno Dorin, Frédéric Landy, Agriculture et alimentation de l’Inde : les vertes années (1947-2001, INRA Editions, Paris, 2002, 253 pages

    Directory of Open Access Journals (Sweden)

    Sylvain Ropital

    2004-12-01

    Full Text Available Considérée dès à présent comme l’un des premiers producteurs mondiaux de denrées alimentaires de la planète, l’Inde, outre son image moderne de géant mondial de la sous-traitance informatique, incarnera le futur « Ventre » agricole du monde en tant que premier exportateur de céréales, de lait et d’oléagineux du grand marché mondial. Parallèlement à ce visage de géant mondial de la production agricole, l’Inde apparaît aussi telle l’une des terres les plus touchées par la violence de la malnutr...

  6. Detection of recurrent 4p16.3 microdeletion with 2p25.3 microduplication by multiplex ligation-dependent probe amplification and array comparative genomic hybridization in a fetus from a family with Wolf–Hirschhorn syndrome

    Directory of Open Access Journals (Sweden)

    Wen-Xu Yang

    2016-02-01

    Conclusion: The combined use of MLPA and aCGH is an effective way to diagnose recurrent WHS. Although WHS is typically caused by a de novo deletion, prenatal diagnosis and genetic counseling are necessary in the next pregnancy in families that have suffered such cases.

  7. Report on the behalf of the Parliamentary Office for the Assessment of Scientific and Technological Choices on hydrogen: a vector for energy transition? - National Assembly Nr 1672, Senate Nr 253

    International Nuclear Information System (INIS)

    Kalinowski, Laurent; Pastor, Jean-Marc

    2013-01-01

    In its first part, this report describes the role and use hydrogen may have as a possible sustainable energy vector: description of its remarkable properties, description of various production modalities and processes, issues related to storage, transport and distribution. The second part proposes an overview of applications: fuel cells, hydrogen in transports, power-to-gas, co-generation, energy autonomy, mobile devices. The third part describes and discusses the role hydrogen may have in energy transition, notably for the integration of renewable energies, and in the substitution to fossil energies. The last chapter discusses the governance for a hydrogen energy sector in France: a sector with a high potential, a needed intervention by the State, the unavoidable role of territories, the issue of regulation. A description of the situation in foreign countries is provided in appendix

  8. "Requestioning" AIDS: An Ethical Reflection From 1993 to Today. Reflections on Claude Vandevyer's "Homosexuals and AIDS: A New Approach to the Illness" from Journal of Homosexuality 25(3).

    Science.gov (United States)

    Lau, Travis

    2016-01-01

    This article serves as one of the supplementary pieces of this special issue on "Mapping Queer Bioethics," in which we take a solipsistic turn to "map" the Journal of Homosexuality itself. Here, the author examines the first feature-length article to address the relationship between HIV status and homosexuality. Lingering on both the temporal gap between the dawn of AIDS in American discourse and its inclusion in this journal, the author asks us to consider (in hindsight) such a delay bearing in mind queer theoretical projects of the present such as gay shame, stigma, and queer biopolitics.

  9. Osteoclasts from patients with autosomal dominant osteopetrosis type I caused by a T253I mutation in low-density lipoprotein receptor-related protein 5 are normal in vitro, but have decreased resorption capacity in vivo

    DEFF Research Database (Denmark)

    Henriksen, Kim; Gram, Jeppe; Høegh-Andersen, Pernille

    2005-01-01

    of osteoclast markers, morphology, and localization of proteins involved in bone resorption, such as ClC-7 and cathepsin K. The ability to resorb bone was also normal. In vivo, we compared the bone resorption and bone formation response to T3 in ADOI patients and age- and sex-matched controls. We found...

  10. Fauna parasitária de peixes oriundos de “pesque-pague” do município de Guariba, São Paulo, Brasil - DOI: 10.4025/actascibiolsci.v28i3.253 Parasitic fauna of cultivated fishes in fee fishing farm of Guariba, São Paulo State, Brazil - DOI: 10.4025/actascibiolsci.v28i3.253

    Directory of Open Access Journals (Sweden)

    Julieta Rodini Engracia de Moraes

    2007-11-01

    Full Text Available Este trabalho descreve a ocorrência e a sazonalidade de parasitos em peixes de “pesque-pague” do município de Guariba, Estado de São Paulo, Brasil (21º15`22``S, 48º18`58``W e 595 m de altitude, durante o período de agosto de 2001 a julho de 2002. A presença de parasitos foi pesquisada em pacu Piaractus mesopotamicus (Characidae, carpa comum Cyprinus carpio (Cyprinidae, tilápia-do-Nilo Oreochromis niloticus (Cichlidae, híbrido tambacu (macho de P. mesopotamicus x fêmea de tambaqui-Colossoma macropomum e piraputanga Brycon hillari (Characidae. Os resultados demonstram que dos 100 peixes examinados, 15% estavam parasitados por pelo menos um dos seguintes parasitos: Trichodina sp.; helmintos monogenóides; copepoditos de Lernaea cyprinacea; L. cyprinacea adulta ou Dolops carvalhoi. Por ordem decrescente, o grau de suscetibilidade dos hospedeiros foi C. carpio, P. mesopotamicus, B. hillari, híbrido tambacu e O. niloticus. Por ordem decrescente, os parasitos encontrados foram helmintos monogenóides, Dolops carvalhoi, Trichodina sp., Lernaea cyprinacea adultas e suas formas jovens.This study describes the occurrence and the seasonality of parasites of cultivated fish from a fee fishing farm located in Guariba, São Paulo State, Brazil (21º15`22`` S, 48º18`58`` W and 595 m of altitude, from August, 2001 to July, 2002. The presence of parasites was researched in pacu Piaractus mesopotamicus (Characidae, common carp Cyprinus carpio (Cyprinidae, nile-tilapia Oreochromis niloticus (Cichlidae, tambacu hybrid (male of P. mesopotamicus x female of tambaqui-Colossoma macropomum and piraputanga Brycon hillari (Characidae. Results demonstrate that out of 100 fish examined, 15% were sponged for at least one of the following parasites: Trichodina sp.; monogenean helminths; copepodits of Lernaea cyprinacea; adults of L. cyprinacea; or Dolops carvalhoi. In decreasing order, the susceptibility degree of the hosts was C. carpio, P. mesopotamicus, B. hillari, tambacu hybrid and O. niloticus. In decreasing order the reported parasites were monogenean helminths, Dolops carvalhoi, Trichodina sp., adults of Lernaea cyprinacea and their young shapes.

  11. The discovery of 260Md and the decay properties of 258Fm, 258m,gMd and 259Md

    International Nuclear Information System (INIS)

    Lougheed, R.W.; Hulet, E.K.; Dougan, R.J.; Wild, J.F.; Dupzyk, R.J.; Henderson, C.M.; Moody, K.J.; Hahn, R.L.; Suemmerer, K.; Bethune, G.

    1986-01-01

    We have discovered a new neutron-rich isotope, 260 Md, from 18 O and 22 Ne bombardments of 254 Es. We observed a spontaneous-fission (SF) activity with a half-life of 32 days in electromagnetically separated fractions with mass number 260 from these bombardments and we measured the mass and kinetic energy distributions of this SF activity. The mass distribution was symmetric with the principal energy peak at a total kinetic energy (TKE) of 234 MeV, similar to previous observations for heavy fermium isotopes. Surprisingly, we also observed a smaller symmetric component with a TKE of 195 MeV. We interpret these two peaks in the TKE distribution as arising from two types of fission in the same nucleus, or bimodal fission. The observed fission activity may be either from the SF decay of 260 Md or from 260 Fm which would arise from electron-capture (EC) decay of 260 Md. We have eliminated the possible β - decay of 260 Md by measuring β - -SF time correlations for the decay of 260 Md and we plan to determine whether 260 Md decays by EC by measuring time correlations between fermium X-rays and SF events. We also measured various properties of the heavy fermium and mendelevium isotopes and obtained 1. more accurate cross-sections for the neutron-rich mendelevium isotopes which we use to predict the production rates of yet undiscovered nuclides, 2. improved half-life measurements for 258m,g Md and 259 Md, 3. confirmation of the EC decay of 258m Md by measurement of the fermium X-rays preceding the SF decay of 258 Fm and 4. very substantially improved mass and TKE distributions for the SF decay of 258 Fm and 259 Md. (orig.)

  12. Bright Light Therapy for Treatment of Sleep Problems Following Mild TBI https://www.dacspr.documentservices.dla.mil/dtic/livelink func=formwf.formedit and workid=4132484 and subworkid=4132484 and taskid=8 and formID=1 and viewname=jhg and editable=1176347093 and nexturl=%2Fdtic%2Flivelink%3Ffunc%3Dwork%2Etaskdone%26workid%3D4132484%26subworkid%3D4132484%26taskid%3D8%26xAction%3Dsave%26paneindex%3D1%26nexturl%3D%252Fdtic%252Flivelink%253Ffunc%253Dllworkspace and noredisplay=1#

    Science.gov (United States)

    2016-10-01

    daytime and nighttime exposure. Am J Physiol Regul Integr Comp Physiol 2006;290:R1413–20. 9. Viola AU, James LM, Schlangen LJ, Dijk D-J. Blue-enriched...visual perception of food. In Dube, L, Bechara, A, Dagher, A, Drewnowski, A, Lebel, J, James , P, & Yada, R. (Eds), Obesity Prevention: The Role of...on Schizophrenia Research. Whistler , British Columbia. April 2001. 27. Kanayama, G, Killgore, WD, Gruber, SA, & Yurgelun-Todd, DA. FMRI BOLD

  13. Efecto de los métodos populares de cocción en el contenido de aflotoxinas en el maíz,(Zea Mays L.) Variedad I.C.A H.207 de coloración amarilla, (Zea Mayz LO.), variedad I.C.A H.253 de coloración blanca y frijol (Phoseolus vulgaris L.) cargamanto

    OpenAIRE

    Molina de Kocsis, Blanca

    1981-01-01

    Las micotoxinas son compuestos producidos por el metabolismo de algunos hongos. Dichos compuestos se caracterizan por ser tóxicos o por que pueden ocasiona otro tipo de efecto biológico sobre los organismo vivos.

  14. Comment on Spracklandus Hoser, 2009 (Reptilia, Serpentes, ELAPIDAE): request for confirmation of availability of the generic name and for the nomenclatural validation of the journal in which it was published (Case 3601; BZN 70:234–237; 71:30–38; 133-135,181-182 ,252-253)

    Science.gov (United States)

    Rhodin, Anders G.J.; Kaiser, Hinrich; van Dijk, Peter Paul; Wüster, Wolfgang; O’Shea, Mark; Archer, Michael; Auliya, Mark; Boitani, Luigi; Bour, Roger; Clausnitzer, Viola; Contreras-MacBeath, Topiltzin; Crother, Brian I.; Daza, Juan M.; Driscoll, Carlos A.; Flores-Villela, Oscar; Frazier, Jack; Fritz, Uwe; Gardner, Alfred L.; Gascon, Claude; Georges, Arthur; Glaw, Frank; Grazziotin, Felipe G.; Groves, Colin P.; Haszprunar, Gerhard; Havaš, Peter; Hero, Jean-Marc; Hoffmann, Michael; Hoogmoed, Marinus S.; Horne, Brian D.; Iverson, John B.; Jäch, Manfred; Jenkins, Christopher L.; Jenkins, Richard K.B.; Kiester, A. Ross; Keogh, J. Scott; Lacher, Thomas E.; Lovich, Jeffrey E.; Luiselli, Luca; Mahler, D. Luke; Mallon, David P.; Mast, Roderic; McDiarmid, Roy W.; Measey, John; Mittermeier, Russell A.; Molur, Sanjay; Mosbrugger, Volker; Murphy, Robert W.; Naish, Darren; Niekisch, Manfred; Ota, Hidetoshi; Parham, James F.; Parr, Michael J.; Pilcher, Nicolas J.; Pine, Ronald H.; Rylands, Anthony B.; Sanderson, James G.; Savage, Jay M.; Schleip, Wulf; Scrocchi, Gustavo J.; Shaffer, H. Bradley; Smith, Eric N.; Sprackland, Robert; Stuart, Simon N.; Vetter, Holger; Vitt, Laurie J.; Waller, Tomás; Webb, Grahame; Wilson, Edward O.; Zaher, Hussam; Thomson, Scott

    2015-01-01

    In Case 3601 Raymond Hoser has asked the Commission to validate for the purposes of nomenclature the name Spracklandus Hoser, 2009, and ‘the journal in which it was published,’ issue 7 of the Australasian Journal of Herpetology (AJH). We note that the entire run of AJH has been written, edited, and published solely by Hoser. Although his requests to the Commission were presented as narrow and, in his words, ‘routine matters,’ we are convinced that they represent an important tipping-point with broad implications of major concern for zoological taxonomy and nomenclature as a whole and, by extension, the greater scientific community. Since Hoser’s actions and works have failed to follow scientific best practices (e.g. Turtle Taxonomy Working Group, 2007, 2014; Kaiser et al., 2013; Kaiser, 2014) and both the Commission’s general Recommendations and Code of Ethics in Appendix A, the global herpetological community has widely rejected his taxonomic decisions and resultant nomenclature. This has unfortunately caused a confusing dual nomenclature to develop in the herpetological community, with most boycotting or ignoring Hoser’s 700+ new names coined in the AJH, while he and a few personal followers actively promote their usage. We believe that suppression of the name Spracklandus, and all issues of AJH, is the only effective way to bring this contentious and confusing issue to resolution. The plenary power available under Article 81.1 of the Code exist specifically to allow the Commission to make rulings in individual cases that disturb stability and cause confusion, whether the works are Code-compliant or not. We maintain that it is in the interest of nomenclatural stability, not only for herpetology, but for all of zoological taxonomy, that the plenary power be invoked to declare the works in AJH unavailable, regardless of any narrow interpretation of their technical Code-compliance. We present our arguments for rejection of the validity of AJH in the following commentary. In view of the wide-reaching implications of this case for all of zoology, and reflecting the deep and broad-based community concern over these issues, our contributing authors include 70 global scientific leaders and accomplished amateurs from a wide variety of zoological disciplines.

  15. Questions Remain about Whether EBM Competencies Learned in Medical School are Retained in Residency. A review of: Dorsch, Josephine L., Meenakshy K. Aiyer, Krishna Gumidyala and Lynne E. Myer. “Retention of EBM Competencies.” Medical Reference Services Quarterly 25.3 (Fall 2006: 45‐57.

    Directory of Open Access Journals (Sweden)

    Suzanne Lewis

    2007-09-01

    Full Text Available Objective – To assess medical graduates’ use of evidence based medicine (EBM in residency, self‐perception of EBM skills, attitudes toward EBM, and the impact of a formal EBM curriculum in their third undergraduate year.Design – A longitudinal follow‐up study by self‐administered questionnaire.Setting – Internal medicine residency programs in US hospitals.Subjects – A convenience sample of 2001 and 2002 graduates of the University of Illinois College of Medicine at Peoria (UICOM‐P (n=78, and their respective residency program directors (n=72.Methods – A student graduate questionnaire (SGQ was sent to all members of UICOM‐P’s 2001 and 2002 graduating classes who had completed the EBM course during their M‐3 Internal Medicine clerkship. A program director questionnaire (PDQ, similar to the SGQ, was sent to the graduates’ residency program directors. The research instrument was tested with a pilot group prior to use, but not validated. The questionnaires consisted of 4 main sections. The first section examined formal and informal EBM programs in the graduates’ residency curriculum. The second section consisted of a self‐assessment of EBM skills by the residents and an assessment of those skills by their program directors. The third section asked graduates to compare their EBM skills to those of their fellow residents who had not been students at UICOM‐P. Similarly, in the third section of the PDQ, program directors were asked to compare the EBM skills of UICOM‐P graduates and non‐UICOM‐P graduates participating in the residency program. The last section concerned professional and demographic characteristics. Copies of the surveys were mailed out to non‐responders after 6 weeks. Results were collated but statistical analysis was not applied.Main results – The response rate was 32% for residents and 35% for program directors. The number of incomplete surveys was not reported. Forty‐four percent of all respondents reported having a formal EBM curriculum for residents, and 76% reported an informal curriculum. For both formal and informal programs, the most commonteaching formats were journal clubs, followed by lectures, teaching rounds, morning reports, bedside consultations, ambulatory clinics and seminars. In section two of the questionnaires, both residentsand program directors rated the residents’ EBM skills similarly. However, the residents rated their skills in searching the literatureand application of findings to clinical practice higher than the program directors. Program directors also rated the residents’ skills in understanding statistics and tests higher than the residents themselves. Twenty‐four percent of both residents and program directors rated the UICOM‐P graduates as “very competent” or“extremely competent” in EBM skills (50. Only 35% of program directors and 27% of residents rated the UICOM‐P graduates’ EBM skills as “usually better” or “always better” than their peers who were not UICOM‐P graduates (50.Conclusion ‐ The authors of this study conclude that, for UICOM‐P graduates, “it might be implied from these results that the EBM skills gained during medical school were retained through their medical school graduation and into their residency training” (51. However, this study has methodological weaknesses which make itdifficult to draw any definite conclusions from the results.

  16. Decision of the Constitutional Review Division of the National Court of The Republic of Estonia : 30 September 1994 : review of the constitutionality of § 25(3) of the Property Law Enforcement Act to the extent that it sought to repeal § 30(2) of t

    Index Scriptorium Estoniae

    1995-01-01

    Riigikohtu lahendi III-4/A-5/94 (Asjaõigusseaduse rakendamise seaduse § 25 lg. 3 Põhiseadusele vastavuse läbivaatamine Eesti NSV taluseaduse § 30 lg. 2 kehtetuks tunnistamise osas) tekst inglise keeles

  17. Choosing the Right Book: Factors that Affect Children’s Reading. A Review of: Maynard, S., Mackay, S., & Smyth, F. (2008. A survey of young people’s reading in England: Borrowing and choosing books. Journal of Librarianship and Information Science, 40(4, 239-253.

    Directory of Open Access Journals (Sweden)

    Gayle Bogel

    2011-03-01

    Full Text Available Objective – To analyze factors affecting book choice: reading recommendations, reasons for choosing series books, book reviews, and school libraries.Design – This secondary analysis of data is based on a selection of findings from a larger 2005 survey that monitored trends in youth reading habits. The large scale 2005 study was designed as a follow up to a 1996 survey. The 2005 survey used online questionnaires and formal statistical analysis to compare gender and age groups. The data on factors affecting book choice were derived from the original questions, responses, and analyses.Setting – Questionnaires were administered in22 primary and 24 secondary schools in the UK with access to computers and internet.Subjects – Almost 4,200 students from 4 to 16 years of age.Methods – Study authors invited approximately 150 schools to participate in the survey. Forty-six schools (31% responded. A total of 22 primary and 24 secondary schools participated in the original study between April and June 2005.This study used comparative analysis to examine factors affecting book choice between gender and age groups. Statistical significance was defined as one percent. Other demographic information was collected, such as ethnicity, language spoken at home, and religion, but was deemed insufficient for any meaningful analysis.There were 4,182 responses to the survey, separated into three age groups: ages 4 to 7 (KS1, ages 7 to 11 (KS2, and ages 11 to 16 (KS3&4.Students were asked to describe themselves as readers by responding to multiple choice questions, and then to provide specific information on the places or people most frequently used as book borrowing sources. Participants were considered “enthusiastic” readers if they “read a lot with pleasure” and “average” readers if they “read an ordinary amount”. Participants responded to additional multiple choice questions on specific factors related to borrowing books and book choices, the process of choosing series, fiction, and nonfiction books.Main Results – Readers: The number of children who described themselves as “enthusiastic” readers decreased with age, and approximately half of the children between 7 and 16 years of age described themselves as “average” readers, average rating increasing slightly through this age group. Investigators found a marked difference in gender within the 4 to 7 year olds: 49.7% percent of girls in this age group considered themselves “enthusiastic,” compared to 37.3% of boys. Only 18.5% of girls considered themselves “reluctant” readers, compared to 28.1% of boys.The longitudinal comparison to the earlier 1996 study found that although the percentage of boys from ages 7 to 16 who described themselves as reluctant readers stayed about the same, the percentage of girls who described themselves as reluctant increased. There was also a dramatic drop in the number of girls who described themselves as enthusiastic; from 51% in 1996 to 17% in 2005.Borrowing Books: Libraries of all types (school, classroom and public were the prime sources for borrowing books. Girls borrowed more books from schools than boys, and girls also borrowed more books from non-library sources (family members and friends than boys. Both boys and girls increasingly reported borrowing more books from friends than from libraries as they grew older.Over half of each age group rated the school library or classroom book corner as having “enough” books. The perception of “too many books” decreased with age. The perception of quality of the classroom or school library also decreased with age. The number of students in the younger age groups who rated the quality of books in the classroom or school library as “very good” was significantly higher than students in the older age groups. The number of student who rated the quality as “okay” doubled from the lower to the higher age group.Choosing Books: Children were asked six questions related to whether the physical book itself provided motivation to read, and six questions related to other factors for book recommendation. Younger readers were more likely to choose a book for its visual appeal, although this factor (interesting cover or illustrations inside was more consistent for boys of all age groups than girls. The author’s name and book blurb were stronger factors for girls in the 7 to 16 age group than for boys.The study authors sought to explore the idea of “shared reading” and asked children in the 7 to 11 and 11 to 16 age groups how often they chose a book based on a recommendation from a friend or family member, a public or school librarian, or other adults. Friends were the strongest recommendation source (43.2% for 7 to 11 year olds and 38.4% for 11to 16 year olds. Recommendations from school or public librarians rated only three to six percent for both age groups.All age groups were asked about choosing series books, and the questions were simplified for the younger age group. All students reported that appealing factors were the consistency of characters, familiar storylines, and familiar writing styles. Some students also noted that the availability of series books positively affected their choices.Print or online book reviews were used “hardly ever or never” by over 40% of the 7 to16 year old age groups, while television or magazine reviews or recommendations were highly rated by over 50% of respondents in the same age groups. Participants chose informational or non-fiction books because of personal interests, hobbies, or recommendations from friends, while they selected fiction or poetry for the blurb, title, or appearance and design of the cover. Celebrity recommendations and books about celebrities were popular reasons for choosing books.When asked who helped them choose books, 53.2% in the 7 to11 age group and 66.1% in the 11to 16 age group stated that no one ever helps them. Of the students who had help choosing books, “family members” was the most common response. Local librarians were not used as a source for recommendations.

  18. 10 CFR 110.23 - General license for the export of byproduct material.

    Science.gov (United States)

    2010-01-01

    ...) Actinium-225 and -227, americium-241 and -242m, californium-248, -249, -250, -251, -252, -253, and -254, curium-240, -241, -242, -243, -244, -245, -246 and -247, einsteinium-252, -253, -254 and -255, fermium...

  19. ORF Alignment: NC_004317 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available ... falciparum 3D7] ... Length = 69 ... Query: 253 ISIQIPDEFIGAVIGKNGSRLTNIMNSTGAQIRISRKGELVPGTTNRKVRII...GSXXXXXX 312 ... ISIQIPDEFIGAVIGKNGSRLTNIMNSTGAQIRISRKGELVPGTTNRKVRIIGS ... ... ... Sbjct: 1 ... ISIQIPDEFIGAVIGKNGSRLTNIMNSTGAQIRISRKGELVPGTTNRKVRIIGSVAAVHA 60 ...

  20. GETDB: 105121 [GETDB

    Lifescience Database Archive (English)

    Full Text Available f Genetics. FM7c Link to clone table - 1 253 Link to cluster table 253 1 Request - all epidermis in stg 17. ... 253 Num of clusters 1 Stock Request Request - Embryonic Expression all epidermis in stg 17. Larval GFP sg,

  1. Optical simulations for the S3 project - Super separator spectrometer - gamma-electron coincidence spectroscopy of a transfermium nucleus: the 251Md101

    International Nuclear Information System (INIS)

    Dechery, Fabien

    2012-01-01

    In analogy with the atomic closed shells giving rise to the stability and high ionisation energies of noble gases, nuclear physics also has its magic numbers of protons and neutrons which enhance nuclear structure stability. Knowledge of the structure of doubly-magic nuclei, both proton and neutron numbers, is crucial to parameterize theoretical models. The discovery of the next and ultimate magic numbers will provide a strong constraint on the many predictions. These two numbers are like the centre coordinates of an area of enhanced stability of the nuclear chart, well known as 'island of stability'. These superheavy nuclei only exist due to pure quantum shell effects. My thesis work deals with two distinct, but complementary, aspects of fundamental physics with the common goal of studying these extreme mass nuclei structure. The first part corresponds to the development of a next generation instrument for nuclear physics to allow synthesis and spectroscopy studies of superheavy nuclei: the Super Separator Spectrometer S 3 . This project will be installed at SPIRAL2 (GANIL) and has been approved by the French Research National Agency (ANR) within the EQUIPEX framework. It has been designed to take advantage of the high intensity heavy ion beam from the LINAC, giving access to a wide range of physical programs. The second part corresponds to the preparation, realisation and analysis of an experiment on 251-Mendelevium in which the very first prompt gamma-electron coincidence spectroscopy was performed for a transfermium nuclei. (author) [fr

  2. Gclust Server: 184040 [Gclust Server

    Lifescience Database Archive (English)

    Full Text Available 184040 TET_253.m00042 Cluster Sequences - 161 hypothetical protein chr_0_8254049_25...3; no annotation 1 1.00e-80 0.0 11.11 0.0 0.0 0.0 0.0 Show 184040 Cluster ID 184040 Sequence ID TET_253.m000...e annotation hypothetical protein chr_0_8254049_253; no annotation Number of Sequ

  3. 75 FR 43082 - National Oil and Hazardous Substances Pollution Contingency Plan; National Priorities List...

    Science.gov (United States)

    2010-07-23

    ... and Hazardous Substances Pollution Contingency Plan; National Priorities List: Partial Deletion of the... pertains to the soil and groundwater of parcels 24, 27, 28, 2-53, 2-53L, 2-54, 2-54L, 2-70, 2-70L, 3-89, 3... Priorities List (NPL). This partial deletion pertains to the soil and groundwater of parcels 24, 27, 28, 2-53...

  4. Application of alpha spectrometry to the discovery of new elements by heavy-ion-beam bombardment

    International Nuclear Information System (INIS)

    Nitschke, J.M.

    1983-05-01

    Starting with polonium in 1898, α-spectrometry has played a decisive role in the discovery of new, heavy elements. For even-even nuclei, α-spectra have proved simple to interpret and exhibit systematic trends that allow extrapolation to unknown isotopes. The early discovery of the natural α-decay series led to the very powerful method of genetically linking the decay of new elements to the well-established α-emission of daughter and granddaughter nuclei. This technique has been used for all recent discoveries of new elements including Z = 109. Up to mendelevium (Z = 101), thin samples suitable for α-spectrometry were prepared by chemical methods. With the advent of heavy-ion accelerators new sample preparation methods emerged. These were based on the large momentum transfer associated with heavy-ion reactions, which produced energetic target recoils that, when ejected from the target, could be thermalized in He gas. Subsequent electrical deposition or a He-jet technique yielded samples that were not only thin enough for α-spectroscopy, but also for α- and #betta#-recoil experiments. Many variations of these methods have been developed and are discussed. For the synthesis of element 106 an aerosol-based recoil transport technique was devised. In the most recent experiments, α-spectrometry has been coupled with the magnetic analysis of the recoils. The time from production to analysis of an isotope has thereby been reduced to 10 - 6 s; while it was 10 - 1 to 10 0 s for He-jets and 10 1 to 10 3 s for rapid chemical separations. Experiments are now in progress to synthesize super heavy elements (SHE) and to analyze them with these latest techniques. Again, α-spectrometry will play a major role since the expected signature for the decay of a SHE is a sequence of α-decays followed by spontaneous fission

  5. ORF Alignment: NC_005027 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available ASIAQTAVVDPRAQIGEGVQIGHFCVIGPNVKLGDRTRVGDHVTLDGVTSIGCDNQIFPH 60 ... Query: 123 DCNIGSRIVLANNCMIGGHAHIADDVTIAGGA...GVHQFVSIGTLSFVGAMTRILQDVPPFV 182 ... DCNIGSRIVLANNCMIGGHAHIADDVTIAGGAGVHQF...VSIGTLSFVGAMTRILQDVPPFV Sbjct: 121 DCNIGSRIVLANNCMIGGHAHIADDVTIAGGAGVHQFVSIGTLSFVGAMTRILQDVPPFV 180 ... Query: 243 LRHLFDCLDNS 253 ... LRHLFDCLDNS Sbjct: 241 LRHLFDCLDNS 251

  6. ORF Alignment: NC_003197 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available GEIWF 60 ... Query: 280 PERRWADRTQTVLAGQSLGGVTALMAARHAPESFGLVLSHSPSMWWTPDNRNRPNHFSAE 339 ... PERRWADRTQT...VLAGQSLGGVTALMAARHAPESFGLVLSHSPSMWWTPDNRNRPNHFSAE Sbjct: 121 PERRWADRTQTVLAGQSLGG...VTALMAARHAPESFGLVLSHSPSMWWTPDNRNRPNHFSAE 180 ... Query: 400 WWRGALIDGLRLL 412 ... WWRGALIDGLRLL Sbjct: 241 WWRGALIDGLRLL 253

  7. ORF Alignment: NC_006905 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available FTSEHRLAGQCRRVRLYLPDVPVVQPLGLLVLTDGEIWF 60 ... Query: 280 PERRWADRTQTVLAGQSLGGVTALMAARHAPESFGLVLSHSPSMWWTPDNRNR...PPHFSAE 339 ... PERRWADRTQTVLAGQSLGGVTALMAARHAPESFGLVLSHSPSMWWTPDNRNRPPHFSAE Sbjct: 121 PERRWADRTQTVL...AGQSLGGVTALMAARHAPESFGLVLSHSPSMWWTPDNRNRPPHFSAE 180 ... Query: 400 WWRGALIDGLRLL 412 ... WWRGALIDGLRLL Sbjct: 241 WWRGALIDGLRLL 253

  8. ORF Alignment: NC_002696 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available ... Length = 253 ... Query: 15 ... PVWVALRNQXXXXXXXXXXXXXXXNAVILSHDNLADALTFQLARKLGDQEMRAM...TARXXX 74 ... PVWVALRNQ ... NAVILSHDNLADALTFQLARKLGDQEMRAMTAR ... Sbjct: 1 ... PVWVALR...NQAEHAAKAEPALASLLNAVILSHDNLADALTFQLARKLGDQEMRAMTAREFA 60 ... Query: 135 LAFYLQSRSSEVFQVDINPAAKIGKGVFIDHGTGIVIGE

  9. ORF Alignment: NC_004578 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available ALADRYADVDCS 60 ... Query: 123 VTGKPVIIHTRGARADTLSLLREAALPQAGVLHCFTEDWDMAKAALDMGYYISLSGIVTF 182 ... VTGK...PVIIHTRGARADTLSLLREAALPQAGVLHCFTEDWDMAKAALDMGYYISLSGIVTF Sbjct: 121 VTGKPVIIHTRGA...RADTLSLLREAALPQAGVLHCFTEDWDMAKAALDMGYYISLSGIVTF 180 ... Query: 243 AEQTTANFARLFP 255 ... AEQTTANFARLFP Sbjct: 241 AEQTTANFARLFP 253

  10. ORF Alignment: NC_006085 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available RMIEELRRREIPVRFLSNNPTKDPDQYVDKLTRLGLPT 60 ... Query: 133 TFDYRKLQIAFDAIWFHKRAFLIQTNPDRFCPFPGGRGEPDCAAVTAAIEACTG...QQCKVS 192 ... TFDYRKLQIAFDAIWFHKRAFLIQTNPDRFCPFPGGRGEPDCAAVTAAIEACTGQQCKV...S Sbjct: 121 TFDYRKLQIAFDAIWFHKRAFLIQTNPDRFCPFPGGRGEPDCAAVTAAIEACTGQQCKVS 180 ... Query: 253 DVEHRPTWTLDRIDRL 268 ... DVEHRPTWTLDRIDRL Sbjct: 241 DVEHRPTWTLDRIDRL 256

  11. ORF Alignment: NC_005363 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available ... bacteriovorus HD100] ... Length = 116 ... Query: 253 SAIQFRSSQYAISGADNRKLQQVAKVLNENPDLVERVEIH...GYADATGTDEINQRISQARA 312 ... SAIQFRSSQYAISGADNRKLQQVAKVLNENPDLVERVEIHGYADA...TGTDEINQRISQARA Sbjct: 1 ... SAIQFRSSQYAISGADNRKLQQVAKVLNENPDLVERVEIHGYADATGTDEINQRISQARA 60 ...

  12. Les discours de la bourse et de la finance [Reseña

    OpenAIRE

    Olmo Cazevieille, Françoise Therese

    2014-01-01

    Reseña del libro "Les discours de la bourse et de la finance" de Laurent Gautier (ed). Olmo Cazevieille, FT. (2014). Les discours de la bourse et de la finance [Reseña]. Ibérica. (28):251-253. http://hdl.handle.net/10251/62367 Senia 251 253 28

  13. Body dimensions and coloration of the winter pelage of a Moravian population of sika deer, Cervus nippon

    Czech Academy of Sciences Publication Activity Database

    Heroldová, Marta; Zejda, J.

    2002-01-01

    Roč. 51, č. 3 (2002), s. 253-256 ISSN 0139-7893 R&D Projects: GA AV ČR IBS6093003 Institutional research plan: CEZ:AV0Z6093917 Keywords : sika deer * body dimensions * coloration Subject RIV: EG - Zoology Impact factor: 0.234, year: 2002 http://www.ivb.cz/folia/51/3/253-256.pdf

  14. 75 FR 67771 - Notice of Determinations Regarding Eligibility To Apply for Worker Adjustment Assistance

    Science.gov (United States)

    2010-11-03

    ...), Global Tech., Unix System, Support Disney, Teleworker. 74,253A International Business Costa Mesa and El June 3, 2009. Machines (IBM), Segundo, CA. Global Tech., Unix System, Support Disney, Teleworker. 74..., Support Disney, Teleworker. 74,253C International Business Lenexa, KS June 3, 2009. Machines (IBM), Global...

  15. Resonance – Journal of Science Education | Indian Academy of ...

    Indian Academy of Sciences (India)

    T Padmanabhan · More Details Fulltext PDF. pp 236-246 General Article. Ancient Indian Mathematics - A Conspectus · S G Dani · More Details Fulltext PDF. pp 247-252 General Article. Brahmagupta, Mathematician Par Excellence · C R Pranesachar · More Details Fulltext PDF. pp 253-253 Science Smiles. Science Smiles.

  16. 75 FR 43115 - National Oil and Hazardous Substances Pollution Contingency Plan; National Priorities List...

    Science.gov (United States)

    2010-07-23

    ..., as amended, is an appendix of the National Oil and Hazardous Substances Pollution Contingency Plan... the soil and groundwater of parcels 24, 27, 28, 2-53, 2-53L, 2-54, 2-54L, 2-70, 2-70L, 3-89, 3-90, and... and Hazardous Substances Pollution Contingency Plan; National Priorities List: Intent to Partially...

  17. Musik som analogi og metafor

    DEFF Research Database (Denmark)

    Bonde, Lars Ole

    2014-01-01

    Indeholder underkapitlerne: 2.5.1 Musik som analogi 2.5.2 Musik som metafor 2.5.3 Musikkens psykologiske funktioner - en taxonomi og metaforisk lytning til fire baroksatser......Indeholder underkapitlerne: 2.5.1 Musik som analogi 2.5.2 Musik som metafor 2.5.3 Musikkens psykologiske funktioner - en taxonomi og metaforisk lytning til fire baroksatser...

  18. Bulletin of Materials Science | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    Home; Journals; Bulletin of Materials Science; Volume 40; Issue 2. Issue front cover thumbnail. Volume 40, Issue 2. April 2017, pages 253-425. pp 253-262. Electrical and optical properties of ZnO–WO 3 nanocomposite and its application as a solid-state humidity sensor · VANDNA SHAKYA N K PANDEY SUNEET KUMAR ...

  19. 4-Chloro-N-(3,4,5-trimethoxybenzylidene)aniline

    Czech Academy of Sciences Publication Activity Database

    Khalaji, A.D.; Asghari, J.; Fejfarová, Karla; Dušek, Michal

    2009-01-01

    Roč. 65, - (2009), o253-o253 ISSN 1600-5368 R&D Projects: GA ČR GC202/07/J008 Institutional research plan: CEZ:AV0Z10100521 Keywords : X-ray diffraction * Jana 2006 Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 0.411, year: 2009

  20. Structures of BmrR-Drug Complexes Reveal a Rigid Multidrug Binding Pocket And Transcription Activation Through Tyrosine Expulsion

    Energy Technology Data Exchange (ETDEWEB)

    Newberry, K.J.; Huffman, J.L.; Miller, M.C.; Vazquez-Laslop, N.; Neyfakh, A.A.; Brennan, R.G.

    2009-05-22

    BmrR is a member of the MerR family and a multidrug binding transcription factor that up-regulates the expression of the bmr multidrug efflux transporter gene in response to myriad lipophilic cationic compounds. The structural mechanism by which BmrR binds these chemically and structurally different drugs and subsequently activates transcription is poorly understood. Here, we describe the crystal structures of BmrR bound to rhodamine 6G (R6G) or berberine (Ber) and cognate DNA. These structures reveal each drug stacks against multiple aromatic residues with their positive charges most proximal to the carboxylate group of Glu-253 and that, unlike other multidrug binding pockets, that of BmrR is rigid. Substitution of Glu-253 with either alanine (E253A) or glutamine (E253Q) results in unpredictable binding affinities for R6G, Ber, and tetraphenylphosphonium. Moreover, these drug binding studies reveal that the negative charge of Glu-253 is not important for high affinity binding to Ber and tetraphenylphosphonium but plays a more significant, but unpredictable, role in R6G binding. In vitro transcription data show that E253A and E253Q are constitutively active, and structures of the drug-free E253A-DNA and E253Q-DNA complexes support a transcription activation mechanism requiring the expulsion of Tyr-152 from the multidrug binding pocket. In sum, these data delineate the mechanism by which BmrR binds lipophilic, monovalent cationic compounds and suggest the importance of the redundant negative electrostatic nature of this rigid drug binding pocket that can be used to discriminate against molecules that are not substrates of the Bmr multidrug efflux pump.

  1. Život i djelo Dmitrija Ivanoviča Mendeljejeva - povodom 100. obljetnice smrti

    Directory of Open Access Journals (Sweden)

    Vaščić, V.

    2007-04-01

    Full Text Available The life and activities of D. I. Mendeleyev are presented primarily in view of his role in the progress of chemistry. Born in Tobolsk in 1834 to a numerous and poor family, burdened by the family's bad luck and his ill health, he graduated natural sciences in 1855 at St. Petersburg and was awarded a gold medal for exceptional success. In 1855/56 he was teacher at a secondary school in Odessa. He obtained his MSc degree in 1856 in St. Petersburg where he was appointed lecturer in 1857. He was guest scientist 1859-1861 at the University in Heidelberg where he investigated the behavior of gases under various pressures and temperatures and discovered the criticaltemperature of liquefaction. He achieved his PhD degree in 1865 in St. Petersburg with a thesis on ethanol/water mixtures. Therein he had proven the existence of alcohol hydrates. His work later enabled the elaboration of modern conceptions on solvate formation in solutions. In 1865 he was elected professor at the University in St. Petersburg where he worked until 1890 when he was forced to retire. Preparing his textbook "Fundamentals of Chemistry" in 1869, he discovered that properties of chemical elements depend periodically on atomic weights. This enabled the elaboration of a periodic system as the base for classification in chemistry, as well as for further research and development of chemical science and technology. The international scientific community accepted Mendeleyev's system with distrust and it was generally acknowledged not before three "prophecies" of Mendeleyev were realized by the discovery of gallium (1875, scandium (1879 and germanium (1886. Later, in verification of his predictions, other elements - including transuranics - were discovered. Hence, in honor of the creator of the periodic system, the element of atomic number 101 was named mendelevium (1955. Mendeleyev was reactivated in 1892 as director of the Central Bureau for Measures and Weights where he worked until

  2. Geochemical background in polluted river sediments: How to separate the effects of sediment provenance and grain size with statistical rigour?

    Czech Academy of Sciences Publication Activity Database

    Bábek, O.; Matys Grygar, Tomáš; Faměra, M.; Hron, K.; Nováková, Tereza; Sedláček, J.

    2015-01-01

    Roč. 135, DEC (2015), s. 240-253 ISSN 0341-8162 Institutional support: RVO:61388980 Keywords : Anthropogenic contamination * Geochemical background * Fluvial sediment s Subject RIV: DD - Geochemistry Impact factor: 2.612, year: 2015

  3. Active sites engineering of metal-organic frameworks for heterogeneous catalysis

    Energy Technology Data Exchange (ETDEWEB)

    Li, Xinle [Iowa State Univ., Ames, IA (United States)

    2016-12-17

    In conclusion, we have for the first time developed a novel solid base catalyst, Ndoped MOF-253 derived porous carbons (Cz-MOF-253). Cz-MOF-253 is highly porous and exhibit high efficiency in Knoevenagel condensation reaction. Furthermore, Cz-MOF-253 is robust and can be reused up to five times. In comparison, the analogous nitrogen-free catalyst-Cz-DUT-5, and other nitrogen- MOFs derived carbon showed an inferior performance. Moreover, the high basicity and porous nature enable the design of bifunctional catalyst and facilitate tandem condensation-hydrogenation reactions. This work delineates the first attempt that demonstrates MOF-derived carbons as solid base catalyst and its potential application in tandem catalysis. Future work on exploring new catalytic reactions based on such porous Lewis basic MOF-derived carbons is currently underway.

  4. Aviation security : TSA is increasing procurement and deployment of the advanced imaging technology, but challenges to this effort and other areas of aviation security remain : testimony before the Subcommittee on Transportation Security and Infrastructur

    Science.gov (United States)

    2010-03-17

    The attempted bombing of Northwest flight 253 highlighted the importance of detecting improvised explosive devices on passengers. This testimony focuses on (1) the Transportation Security Administrations (TSA) efforts to procure and deploy advance...

  5. Quenching of photoluminescence of Rhodamine 6G molecules on functionalized graphene

    Czech Academy of Sciences Publication Activity Database

    Valeš, Václav; Kovaříček, Petr; Ji, X.; Ling, X.; Kong, J.; Dresselhaus, M. S.; Kalbáč, Martin

    2016-01-01

    Roč. 253, č. 12 (2016), s. 2347-2350 ISSN 0370-1972 Institutional support: RVO:61388955 Keywords : atomic force microscopy * functionalized graphene * photoluminiscence quenching Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 1.674, year: 2016

  6. TAA1-Mediated Auxin Biosynthesis Is Essential for Hormone Crosstalk and Plant Development

    Czech Academy of Sciences Publication Activity Database

    Stepanova, A.N.; Robertson-Hoyt, J.; Yun, J.; Benavente, L.M.; Xie, D.Y.; Doležal, Karel; Schlereth, A.; Jürgens, G.; Alonso, J.M.

    2008-01-01

    Roč. 133, č. 1 (2008), s. 177-191 ISSN 0092-8674 Institutional research plan: CEZ:AV0Z50380511 Keywords : CELLBIO * SIGNALING * DEVBIO Subject RIV: CE - Biochemistry Impact factor: 31.253, year: 2008

  7. Éva Katalin Vámos (1950-2015)

    Czech Academy of Sciences Publication Activity Database

    Štrbáňová, Soňa

    2015-01-01

    Roč. 22, č. 2 (2015), s. 251-253 ISSN 1230-1159 Institutional support: RVO:68378114 Keywords : history of science and technology * hungarian history of science and technology * women in science Subject RIV: AB - History

  8. Anthropological perspectives on democratic citizenship education and globalization

    Czech Academy of Sciences Publication Activity Database

    Červinková, Hana

    2013-01-01

    Roč. 2013, č. 27 (2013), s. 253-262 ISSN 1233-6688 Institutional support: RVO:68378076 Keywords : citizenship education * anthropology of education * action research * youth * participation * globalization Subject RIV: AC - Archeology, Anthropology, Ethnology

  9. South African Journal of Education - Vol 24, No 4 (2004)

    African Journals Online (AJOL)

    Using teacher action research to promote constructivist learning environments in South Africa · EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. Jill M Aldridge, Barry J Fraser, Mokgoko P Sebela, 245-253 ...

  10. Structure and ecology of freshwater benthic diatom communities from Byers Peninsula, Livingston Island, South Shetland Islands

    Czech Academy of Sciences Publication Activity Database

    Kopalová, Kateřina; Van de Vijver, B.

    2013-01-01

    Roč. 25, č. 2 (2013), s. 239-253 ISSN 0954-1020 Institutional support: RVO:67985939 Keywords : Bacillariophyta * lakes * Maritime Antarctic Region Subject RIV: EF - Botanics Impact factor: 1.417, year: 2013

  11. 75 FR 5925 - Proposed Flood Elevation Determinations

    Science.gov (United States)

    2010-02-05

    ... Spring County. Martin Luther King Boulevard. Approximately 1,300 None +263 feet downstream of Martin Luther King Boulevard. Town Creek Approximately 2,300 None +253 Unincorporated Areas of feet downstream...

  12. Knocking down expression of the auxin-amidohydrolase IAR3 alters defense responses in Solanaceae family plants

    Czech Academy of Sciences Publication Activity Database

    D'Ippolito, S.; Vaňková, Radomíra; Joosten, M.H.A.J.; Casalongue, C.A.; Fiol, D.F.

    2016-01-01

    Roč. 253, DEC (2016), s. 31-39 ISSN 0168-9452 Institutional support: RVO:61389030 Keywords : Auxin * Biotic stress * Cladosporium fulvum Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 3.437, year: 2016

  13. STOOKE SMALL BODY SHAPE MODELS V2.0

    Data.gov (United States)

    National Aeronautics and Space Administration — This data set contains Philip Stooke shape models for 243 Ida, 253 Mathilde, 951 Gaspra, comet Halley, J5 Amalthea, J14 Thebe, N7 Larissa, N8 Proteus, S10 Janus, S11...

  14. Archeologický výzkum zaniklého těžebního areálu u kostela sv. Václava v Pněvicích (okr. Kutná Hora)

    Czech Academy of Sciences Publication Activity Database

    Končelová, Markéta; Velímský, Filip

    2012-01-01

    Roč. 12, prosinec (2012), s. 253-256 ISSN 1801-5972 Institutional research plan: CEZ:AV0Z80020508 Keywords : Kutná Hora * archaeology * Middle Ages * silver mining Subject RIV: AC - Archeology, Anthropology, Ethnology

  15. All projects related to | Page 371 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    2013-06-09

    End Date: June 9, 2013. Topic: LATIN AMERICA, Poverty alleviation, SMALL ENTERPRISES, INFORMATION TECHNOLOGY, RURAL ECONOMY, ECONOMIC DISPARITY, AGRICULTURE. Region: South America, Uruguay, North and Central America. Program: Networked Economies. Total Funding: CA$ 253,854.00 ...

  16. Application of random amplified polymorphic DNA (RAPD) markers ...

    African Journals Online (AJOL)

    SAM

    2014-06-11

    1998). DNA fingerprinting of strawberry (Fragaria X ananassa) cultivars using randomly amplified polymorphic DNA (RAPD) markers. Euphytica. 102:247-253. Doyle JJ, Doyle LJ (1990). Isolation of plant DNA from fresh tissue.

  17. Ecotoxicity and genotoxicity assessment of cytotoxic antineoplastic drugs and their metabolites

    Czech Academy of Sciences Publication Activity Database

    Zounková, R.; Kovalová, L.; Bláha, Luděk; Dott, W.

    2010-01-01

    Roč. 81, č. 2 (2010), s. 253-260 ISSN 0045-6535 Institutional research plan: CEZ:AV0Z60050516 Keywords : cytotoxic drugs * ecotoxicity * metabolite Subject RIV: EF - Botanics Impact factor: 3.155, year: 2010

  18. Microsporidia and ‘The Art of Living Together’

    Czech Academy of Sciences Publication Activity Database

    Vávra, Jiří; Lukeš, Julius

    2013-01-01

    Roč. 82, č. 2013 (2013), s. 253-319 ISSN 0065-308X Institutional support: RVO:60077344 Keywords : Microsporidia * polar tube protein * ribosomal RNA Subject RIV: EE - Microbiology, Virology Impact factor: 4.360, year: 2013

  19. ORF Alignment: NC_002947 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available s ... putida KT2440] ... Length = 122 ... Query: 132 IELNSSLLFGSGDAMPSDKAFAIIEKVASILKPFANPVHVEGFT...DNLPIRTAQYPTNWEL 191 ... IELNSSLLFGSGDAMPSDKAFAIIEKVASILKPFANPVHVEGFTDNLPI...RTAQYPTNWEL Sbjct: 1 ... IELNSSLLFGSGDAMPSDKAFAIIEKVASILKPFANPVHVEGFTDNLPIRTAQYPTNWEL 60 ... Query: 252 SL 253 ... SL Sbjct: 121 SL 122

  20. Krajina jako prostředí k rekreaci - na příkladu Šuamvy

    Czech Academy of Sciences Publication Activity Database

    Kušová, Drahomíra; Těšitel, Jan; Bartoš, Michael

    2001-01-01

    Roč. 35, č. 5 (2001), s. 253-256 ISSN 0044-4863 Institutional research plan: CEZ:AV0Z6087904 Keywords : tourism * leisure time activities * sociological survey Subject RIV: AO - Sociology, Demography

  1. Original Research

    African Journals Online (AJOL)

    home

    2014-12-21

    Samapundo et al., 2007; Amiri ... contamination of foods and feeds by mycotoxins should be minimized by designing a series of ..... Innovative Food Science and Emerging Technologies. 8: 253-258. Velluti, A., Marin, S., Gonzalez, ...

  2. Taking notes as an interactive process

    OpenAIRE

    Hornig, Wolfgang

    1984-01-01

    Taking notes as an interactive process : how to improve students´ notes / Hornig W. ; Nowak, J. - In: Nowak, Johann: Textverstehen und Textrekonstruktion in Vorlesungen. - Augsburg : HDZ, 1984. - S. 227-253. - (Augsburger Studien zur Hochschuldidaktik ; 12)

  3. Dealing with food allergies in babies and children

    National Research Council Canada - National Science Library

    Joneja, Janice M. Vickerstaff

    2007-01-01

    ... . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 231 CHAPTER 14 CornAllergy ...243 CHAPTER 15 SeafoodAllergy ...253 CHAPTER 16 The Top Ten Allergens: Avoidance of Milk, Egg, Wheat, Corn, Peanuts, Soy, Tree Nuts...

  4. 19 CFR 10.254 - Certificate of Origin.

    Science.gov (United States)

    2010-04-01

    ... Eradication Act Extension of Atpa Benefits to Tuna and Certain Other Non-Textile Articles § 10.254 Certificate... article described in § 10.253(a) being exported from an ATPDEA beneficiary country to the United States...

  5. Subsurface geology off Bombay with paleoclimatic inferences interpreted from shallow seismic profiles

    Digital Repository Service at National Institute of Oceanography (India)

    Bhattacharya, G.C.; Almeida, F.; Vora, K.H.; Siddiquie, H.N.

    sediment, early Holocene layered sediment (about 7 m thick) and Modern Clay (2.5-3 m thick). An unconformity probably due to subaerial erosion during the Pleistocene lowered sea level stand separates the consolidated sediments from the overlying layered...

  6. Apoptosis and necrosis during the circadian cycle in the centipede midgut

    Czech Academy of Sciences Publication Activity Database

    Rost-Roszkowska, M.M.; Chajec, Ł.; Vilímová, J.; Tajovský, Karel

    2016-01-01

    Roč. 253, č. 4 (2016), s. 1051-1061 ISSN 0033-183X Institutional support: RVO:60077344 Keywords : cell death * centipede * digestive cells * midgut epithelium * ultrastructure Subject RIV: EG - Zoology Impact factor: 2.870, year: 2016

  7. 75 FR 38467 - Procurement List: Proposed Additions

    Science.gov (United States)

    2010-07-02

    ...: 7520-00-NIB-2084--Shoulder Rest, Telephone, Black, Softak II. NSN: 7520-00-NIB-2085--Shoulder Rest... Services Administration. NSN: 7520-01-253-1283--Shoulder Rest, Telephone, Beige, 2\\1/4\\ W x 7'' L. NSN...

  8. Medical Countermeasure Models. Volume 4. Francisella tularensis

    Science.gov (United States)

    2013-04-12

    reported. 223 Kaiser AB et al. "Tularemia and rhabdomyolysis ." JAMA. 253(2). 1985. 224 Lovell...Relapse and Fever Notes Kaiser 1985223 1 58 Ulcer, lymphadenopathy Penicillin G potassium Rhabdomyolysis Oxacillin sodium

  9. Personal neutron dosemeter of the Czech Republic: Review of basic properties, results of recent tests

    Czech Academy of Sciences Publication Activity Database

    Trousil, J.; Spurný, František; Plichta, J.

    2006-01-01

    Roč. 14, 7/8 (2006), s. 246-253 ISSN 1210-7085 Institutional research plan: CEZ:AV0Z10480505 Keywords : detectors * dosemeters * personal dosimetry Subject RIV: DN - Health Impact of the Environment Quality

  10. J. Podoba: Vývoj staviteľstva a spôsobu bývania v dedinskom prostredí v 20. storočí

    Czech Academy of Sciences Publication Activity Database

    Frolcová, Věra

    -, č. 3 (2014), s. 252-253 ISSN 0862-8351 Institutional support: RVO:68378076 Keywords : village environment * 20th century * housing * development and engineering Subject RIV: AC - Archeology, Anthropology, Ethnology

  11. Microcellular open porous monoliths for cell growth by thiol-ene polymerization of low-toxicity monomers in high internal phase emulsions

    Czech Academy of Sciences Publication Activity Database

    Sušec, M.; Liska, R.; Russmüller, G.; Kotek, Jiří; Krajnc, P.

    2015-01-01

    Roč. 15, č. 2 (2015), s. 253-261 ISSN 1616-5187 Institutional support: RVO:61389013 Keywords : divinyl adipate * polyHIPE * porous polymers Subject RIV: CD - Macromolecular Chemistry Impact factor: 3.680, year: 2015

  12. DDN (Defence Data Network) Protocol Implementations and Vendors Guide

    Science.gov (United States)

    1988-08-01

    Artificial Intelligence Laboratory Room NE43-723 545 Technology Square Cambridge, MA 02139 (617) 253-8843 S John Wroclawski, (JTW@AI.AJ.MIT.EDU...Massachusetts Institute of Technology Artificial Intelligence Laboratory Room NE43-743 545 Technology Square 0 Cambridge, MA 02139 (617) 253-7885 ORDERING...TCP/IP Network Software for PC-DOS Systems CPU: IBM-PC/XT/AT/compatible in conjunction with EXOS 205 Inteligent Ethernet Controller for PCbus 0/s

  13. Activation of non-canonical Wnt/JNK pathway by Wnt3a is associated with differentiation fate determination of human bone marrow stromal (mesenchymal) stem cells

    DEFF Research Database (Denmark)

    Qiu, Weimin; Chen, Li; Kassem, Moustapha

    2011-01-01

    patterns induced by Wnt3a treatment in two hMSC lines: hMSC-LRP5(T253) and hMSC-LRP5(T244) cells carrying known mutations of Wnt co-receptor LRP5 (T253I or T244M) that either enhances or represses canonical Wnt signaling, respectively. Wnt3a treatment of hMSC activated not only canonical Wnt signaling...

  14. Evaluation of dietary patterns among Norwegian postmenopausal women using plasma carotenoids as biomarkers

    OpenAIRE

    Markussen, Marianne S.; Veierød, Marit B.; Sakhia, Amrit K.; Ellingjord-Dale, Merete; Blomhoff, Rune; Ursin, Giske; Andersen, Lene F.

    2015-01-01

    A number of studies have examined dietary patterns in various populations. However, to study to what extent such patterns capture meaningful differences in consumption of foods is of interest. In the present study, we identified important dietary patterns in Norwegian postmenopausal women (age 50–69 years, n 361), and evaluated these patterns by examining their associations with plasma carotenoids. Diet was assessed by a 253-item FFQ. These 253 food items were categorised into forty-six food ...

  15. Study of the effect of moisture content and bending rate on the fracture toughness of rocks

    Czech Academy of Sciences Publication Activity Database

    Vavro, Leona; Souček, Kamil

    2013-01-01

    Roč. 10, č. 2 (2013), s. 247-253 ISSN 1214-9705 R&D Projects: GA MŠk ED2.1.00/03.0082 Institutional support: RVO:68145535 Keywords : fracture toughness * bending rate * tensile strength Subject RIV: DB - Geology ; Mineralogy Impact factor: 0.667, year: 2013 http://www.irsm.cas.cz/materialy/acta_content/2013_02/acta_170_14_Vavro_Soucek_247-253.pdf

  16. Protein interactions with quaternized chitosan/heparin multilayers

    Czech Academy of Sciences Publication Activity Database

    Kumorek, Marta M.; Kubies, Dana; Riedel, Tomáš

    2016-01-01

    Roč. 65, Suppl. 2 (2016), S253-S261 ISSN 0862-8408 R&D Projects: GA MŠk(CZ) LQ1604 Institutional support: RVO:61389013 Keywords : heparin * chitosan * protein Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 1.461, year: 2016 http://www.biomed.cas.cz/physiolres/pdf/65%20Suppl%202/65_S253.pdf

  17. Acute Cannabis Intoxication and the Brain's Response to Visual Erotica: An Fmri Study

    Czech Academy of Sciences Publication Activity Database

    Androvičová, R.; Horáček, J.; Tintěra, J.; Rydlo, J.; Ježová, D.; Balíková, M.; Hložek, T.; Mikšátková, P.; Kuchař, M.; Hlinka, Jaroslav; Roman, M.; Tomíček, P.; Viktorínová, M.; Tylš, F.; Páleníček, T.

    2017-01-01

    Roč. 14, č. 5 (2017), e253-e253 ISSN 1743-6095. [Congress of the World Association for Sexual Health /23./. 28.05.2017-31.05.2017, Prague] Grant - others:GA MV(CZ) VG20122015080; GA MZd NT13145; GA MŠk(CZ) LO1611 Institutional support: RVO:67985807 Keywords : fMRI * cannabis * sexuality Subject RIV: FH - Neurology http://www.jsm.jsexmed.org/article/S1743-6095(17)30689-6/pdf

  18. Common TMPRSS6 mutations and iron, erythrocyte, and pica phenotypes in 48 women with iron deficiency or depletion.

    Science.gov (United States)

    Lee, Pauline L; Barton, J Clayborn; Khaw, Peter L; Bhattacharjee, Sarah Y; Barton, James C

    2012-02-15

    TMPRSS6 A736V is associated with lower transferrin saturation (TS), hemoglobin (Hb), and mean corpuscular volume (MCV) levels in general adult populations. We sought to identify relationships of TMPRSS6 K253E, A736V, and Y739Y to iron, erythrocyte, and pica phenotypes in women with iron deficiency or depletion. We tabulated observations on 48 outpatient non-pregnant women who had iron deficiency (serum ferritin (SF) pagophagia, each case). Allele frequencies were 41.7% (K253E), 36.5% (A736V), and 39.6% (Y739Y). K253E frequency was greater in women with TS ≥10% (p=0.0001). Y739Y was more frequent in women with TS <10% (p=0.0135). Mean TS was also lower in women positive for Y739Y (6±4% vs. 13±16%, respectively; p=0.0021). In multiple regressions, neither K253E, A736V, nor Y739Y genotypes were significantly associated with other variables. TMPRSS6 K253E frequency was greater in women with TS ≥10%. Frequency of Y739 was greater in women with TS <10%. Mean TS was lower in women with Y739Y. We observed no other significant relationship of TMPRSS6 K253E, A736V, or Y739Y with iron, erythrocyte, or pica phenotypes. Copyright © 2011 Elsevier Inc. All rights reserved.

  19. 1α,25(OH)2D3 differentially regulates miRNA expression in human bladder cancer cells.

    Science.gov (United States)

    Ma, Yingyu; Hu, Qiang; Luo, Wei; Pratt, Rachel N; Glenn, Sean T; Liu, Song; Trump, Donald L; Johnson, Candace S

    2015-04-01

    Bladder cancer is the fourth most commonly diagnosed cancer in men and eighth leading cause of cancer-related death in the US. Epidemiological and experimental studies strongly suggest a role for 1α,25(OH)2D3 in cancer prevention and treatment. The antitumor activities of 1α,25(OH)2D3 are mediated by the induction of cell cycle arrest, apoptosis, differentiation and the inhibition of angiogenesis and metastasis. miRNAs play important regulatory roles in cancer development and progression. However, the role of 1α,25(OH)2D3 in the regulation of miRNA expression and the potential impact in bladder cancer has not been investigated. Therefore, we studied 1α,25(OH)2D3-regulated miRNA expression profiles in human bladder cancer cell line 253J and the highly tumorigenic and metastatic derivative line 253J-BV by miRNA qPCR panels. 253J and 253J-BV cells express endogenous vitamin D receptor (VDR), which can be further induced by 1α,25(OH)2D3. VDR target gene 24-hydroxylase was induced by 1α,25(OH)2D3 in both cell lines, indicating functional 1α,25(OH)2D3 signaling. The miRNA qPCR panel assay results showed that 253J and 253J-BV cells have distinct miRNA expression profiles. Further, 1α,25(OH)2D3 differentially regulated miRNA expression profiles in 253J and 253J-BV cells in a dynamic manner. Pathway analysis of the miRNA target genes revealed distinct patterns of contribution to the molecular functions and biological processes in the two cell lines. In conclusion, 1α,25(OH)2D3 differentially regulates the expression of miRNAs, which may contribute to distinct biological functions, in human bladder 253J and 253J-BV cells. This article is part of a Special Issue entitled '17th Vitamin D Workshop'. Copyright © 2014 Elsevier Ltd. All rights reserved.

  20. A Hard X-Ray Study of the Normal Star-Forming Galaxy M83 with NuSTAR

    DEFF Research Database (Denmark)

    Yukita, M.; Hornschemeier, A. E.; Lehmer, B. D.

    2016-01-01

    , including a previously discovered ultraluminous X-ray source, are detected in our NuSTAR observations. The X-ray hardnesses and luminosities of the majority of the point sources are consistent with hard X-ray sources resolved in the starburst galaxy NGC 253. We infer that the hard X-ray emission is most...... XLF in NGC 253, which is consistent with previous measurements by Chandra at softer X-ray energies. The NuSTAR integrated galaxy spectrum of M83 drops quickly above 10 keV, which is also seen in the starburst galaxies NGC 253, NGC 3310, and NGC 3256. The NuSTAR observations constrain any active...

  1. Two CYP716A subfamily cytochrome P450 monooxygenases of sweet basil play similar but nonredundant roles in ursane- and oleanane-type pentacyclic triterpene biosynthesis.

    Science.gov (United States)

    Misra, Rajesh Chandra; Sharma, Shubha; Sandeep; Garg, Anchal; Chanotiya, Chandan Singh; Ghosh, Sumit

    2017-04-01

    The medicinal plant sweet basil (Ocimum basilicum) accumulates bioactive ursane- and oleanane-type pentacyclic triterpenes (PCTs), ursolic acid and oleanolic acid, respectively, in a spatio-temporal manner; however, the biosynthetic enzymes and their contributions towards PCT biosynthesis remain to be elucidated. Two CYP716A subfamily cytochrome P450 monooxygenases (CYP716A252 and CYP716A253) are identified from a methyl jasmonate-responsive expression sequence tag collection and functionally characterized, employing yeast (Saccharomyces cerevisiae) expression platform and adapting virus-induced gene silencing (VIGS) in sweet basil. CYP716A252 and CYP716A253 catalyzed sequential three-step oxidation at the C-28 position of α-amyrin and β-amyrin to produce ursolic acid and oleanolic acid, respectively. Although CYP716A253 was more efficient than CYP716A252 for amyrin C-28 oxidation in yeast, VIGS revealed essential roles for both of these CYP716As in constitutive biosynthesis of ursolic acid and oleanolic acid in sweet basil leaves. However, CYP716A253 played a major role in elicitor-induced biosynthesis of ursolic acid and oleanolic acid. Overall, the results suggest similar as well as distinct roles of CYP716A252 and CYP716A253 for the spatio-temporal biosynthesis of PCTs. CYP716A252 and CYP716A253 might be useful for the alternative and sustainable production of PCTs in microbial host, besides increasing plant metabolite content through genetic modification. © 2017 The Authors. New Phytologist © 2017 New Phytologist Trust.

  2. Special Inspector General for Iraq Reconstruction. Quarterly Report to the United States Congress

    Science.gov (United States)

    2007-10-30

    provincial-level agronomic systems. The Inma Agribusiness Program, a $208.6 million effort, works with PRTs to promote agribusiness and value-added...177,389,598 38,443,901 Education, Science , and Culture 333,555,524 232,254,236 Energy 26,164,177 23,333,989 Environment 253,294,917 158,363,057 Governance...Infrastructure $1.005 27% Environment $.253 7% Education, Science , and Culture $.334 9% Energy $.026 1% Unallocated $.008 ə% Unspecied/Unclassied

  3. Strouhal number of bridge cables with ice accretion at low flow turbulence

    Czech Academy of Sciences Publication Activity Database

    Górski, P.; Pospíšil, Stanislav; Kuznetsov, Sergeii; Tatara, M.; Marušić, Ante

    2016-01-01

    Roč. 22, č. 2 (2016), s. 253-272 ISSN 1226-6116 R&D Projects: GA MŠk(CZ) LO1219; GA ČR(CZ) GC13-34405J; GA ČR(CZ) GA14-12892S Keywords : bridge cable * ice accretion * Strouhal number * angle of attack * vortex shedding frequency Subject RIV: JM - Building Engineering Impact factor: 0.868, year: 2016 http://koreascience.or.kr/article/ArticleFullRecord.jsp?cn=KJKHCF_2016_v22n2_253

  4. Use of On-Site GC/MS Analysis to Distinguish Between Vapor Intrusion and Indoor Sources of VOCs

    Science.gov (United States)

    2013-11-01

    Trimethylpentane ( Iso Methyl Methacrylate n-Heptane cis-1,3-Dichloropropene 4-Methyl-2-pentanone trans-1,3-Dichloropropene l,l,2-Trichloroethane...1,4-Dioxane 2,2,4-Trimethylpentane ( Iso Methyl Methacrylate n Heptane eis-1,3-Diehloropropene 4-Methyl-2-pentanone trans-1,3-Dichloropropene 1...16.8 9470 MW‐139 3000 ‐16.2 9469 MW‐156 450 ‐25.3 9471 MW‐156 450 ‐25.3 9468 MW‐CP‐IV‐1 25000 ‐20.9 9462 TCE standard 3 ‐29.9 9463 TCE standard 3 ‐30.1

  5. Ring Chromosome 17 Not Involving the Miller-Dieker Region: A Case with Drug-Resistant Epilepsy.

    Science.gov (United States)

    Coppola, Antonietta; Morrogh, Deborah; Farrell, Fiona; Balestrini, Simona; Hernandez-Hernandez, Laura; Krithika, S; Sander, Josemir W; Waters, Jonathan J; Sisodiya, Sanjay M

    2017-12-01

    Chromosomal abnormalities are often identified in people with neurodevelopmental disorders including intellectual disability, autism, and epilepsy. Ring chromosomes, which usually involve gene copy number loss, are formed by fusion of subtelomeric or telomeric chromosomal regions. Some ring chromosomes, including ring 14, 17, and 20, are strongly associated with seizure disorders. We report an individual with a ring chromosome 17, r(17)(p13.3q25.3), with a terminal 17q25.3 deletion and no short arm copy number loss, and with a phenotype characterized by intellectual disability and drug-resistant epilepsy, including a propensity for nonconvulsive status epilepticus.

  6. Genetic Testing for Wolfram Syndrome Mutations in a Sample of 71 Patients with Hereditary Optic Neuropathy and Negative Genetic Test Results for OPA1/OPA3/LHON.

    Science.gov (United States)

    Galvez-Ruiz, Alberto; Galindo-Ferreiro, Alicia; Schatz, Patrik

    2018-04-01

    In this study, the authors present a sample of 71 patients with hereditary optic neuropathy and negative genetic test results for OPA1/OPA3/LHON. All of these patients later underwent genetic testing to rule out WFS. As a result, 53 patients (74.7%) were negative and 18 patients (25.3%) were positive for some type of mutation or variation in the WFS gene. The authors believe that this study is interesting because it shows that a sizeable percentage (25.3%) of patients with hereditary optic 25 neuropathy and negative genetic test results for OPA1/OPA3/LHON had WFS mutations or variants.

  7. Complexes of membrane-associated gamma-tubulin with Fyn kinase and phosphoinositide 3-kinase in differentiating cells

    Czech Academy of Sciences Publication Activity Database

    Sulimenko, Vadym; Macůrek, Libor; Dráberová, Eduarda; Richterová, Věra; Sulimenko, Tetyana; Dráberová, Lubica; Marková, Vladimíra; Dráber, Pavel

    2009-01-01

    Roč. 276, č. 1 (2009), s. 253-253 ISSN 1742-464X. [FEBS Congress /34/. 04.07.2009-09.07.2009, Praha] R&D Projects: GA MŠk 1M0506; GA MŠk LC545; GA ČR GA204/05/2375; GA ČR GA304/04/1273 Institutional research plan: CEZ:AV0Z50520514 Keywords : detergent -resistant membrane * Fyn * PI3K gamma-tubulin Subject RIV: EB - Genetics ; Molecular Biology

  8. Frequency distribution 0f ABO, RH blood groups and blood ...

    African Journals Online (AJOL)

    One hundred and fifty students (150) were randomly selected from the Department of Cell Biology and Genetics of University of Lagos, Akoka, Nigeria for ABO, RH blood groups and 6 haemoglobin genotypes studies. Blood group O was the highest with the percentage frequency of 55.3%, followed by blood group A (25.3%) ...

  9. Untitled

    African Journals Online (AJOL)

    spectrum on a Corning 253 colorimeter. The . (660mm) and the corresponding absorbance for the effluent before and after treatment with the cotton wol modification products are indicated in Table. 1. Table 1. Test effluent characteristics. Untreated After treatment. Absorbance at 0.68 0.20 022005 000508. 660nm.

  10. Journal of Earth System Science | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    Articles written in Journal of Earth System Science. Volume 120 Issue 2 April 2011 pp 253-262. Ficus palaeoracemosa sp. .... 5 October 2013 pp 1373-1386. Emergence and extinction of Dipterocarpaceae in western India with reference to climate change: Fossil wood evidences · Anumeha Shukla R C Mehrotra J S Guleria.

  11. The effect of photochemical internalization of bleomycin in the treatment of urothelial carcinoma of the bladder: an in vitro study

    NARCIS (Netherlands)

    Arentsen, H.C.; Falke, J.; Hogset, A.; Oosterwijk, E.; Witjes, J.A.

    2014-01-01

    OBJECTIVES: In this in vitro study, we determined whether meso-tetraphenyl chlorin disulphonate (TPCS2a)-based photochemical delivery of bleomycin was able to potentiate the cytotoxicity of bleomycin on bladder cancer cells. MATERIALS AND METHODS: The human RT4, RT112, 253J, T24, and rat AY-27

  12. The Relationship Between Life Course Factors, Parental ...

    African Journals Online (AJOL)

    RESULTS: Out of the 324 adolescents who completed the questionnaire, 25.3% reported visiting a dentist within a period of one year. Childhood dental visit, childhood dental experience, housing, internal and external locus of control and self-efficacy were significantly associated with recent dental visit (p<0.05). Participants ...

  13. On a generalization of B1( ) on C∗ -algebras

    Indian Academy of Sciences (India)

    Proc. Indian Acad. Sci. (Math. Sci.) Vol. 124, No. 2, May 2014, pp. 243–253. c Indian Academy of Sciences. On a generalization of B1( ) on C∗. -algebras. KUI JI. Department of Mathematics, Hebei Normal University, Shijiazhuang, ...... [4] Clark D N and Misra G, The curvature function and similarity of operators, International.

  14. Relationship between the Religious Attitude, Self-Efficacy, and Life Satisfaction in High School Teachers of Mahshahr City

    Science.gov (United States)

    Bigdeloo, Masoomeh; Bozorgi, Zahra Dasht

    2016-01-01

    This study aims to investigate the relationship between the religious attitude, self-efficacy, and life satisfaction in high school teachers of Mahshahr City. To this end, 253 people of all high school teachers in Mahshahr City, in Iran were selected as the sample using the multistage cluster sampling method. For data collection, Glock and Stark's…

  15. Humor Climate of the Primary Schools

    Science.gov (United States)

    Sahin, Ahmet

    2018-01-01

    The aim of this study is to determine the opinions primary school administrators and teachers on humor climates in primary schools. The study was modeled as a convergent parallel design, one of the mixed methods. The data gathered from 253 administrator questionnaires, and 651 teacher questionnaires was evaluated for the quantitative part of the…

  16. Prevention of bone bridge formation using transplantation of the autogenous mesenchymal stem cells to physeal defects: An experimental study in rabbits

    Czech Academy of Sciences Publication Activity Database

    Plánka, L.; Nečas, A.; Gál, P.; Kecová, H.; Filová, Eva; Křen, L.; Kroupa, P.

    2007-01-01

    Roč. 76, - (2007), s. 253-263 ISSN 0001-7213 R&D Projects: GA MŠk 2B06130 Institutional research plan: CEZ:AV0Z50390512 Keywords : Growth plate injury * Physis * Growth arrest Subject RIV: FI - Traumatology, Orthopedics Impact factor: 0.687, year: 2007

  17. Short-term impact of dry olive mill residue addition to soil on the resident microbiota

    Czech Academy of Sciences Publication Activity Database

    Sampedro, I.; Giubilei, M. A.; Cajthaml, Tomáš; Federici, E.; Federici, F.; Petruccioli, M.; D´Annibale, A.

    2009-01-01

    Roč. 100, č. 23 (2009), s. 6098-6106 ISSN 0960-8524 R&D Projects: GA MŠk LC06066 Institutional research plan: CEZ:AV0Z50200510 Keywords : Dry olive mill residue * Microbial community profiling * Toxicity Subject RIV: EE - Microbiology, Virology Impact factor: 4.253, year: 2009

  18. Polarization volume holograms in layers of polymethylmethacrylate with phenanthrenequinone

    Science.gov (United States)

    Marmysh, D. N.; Mahilny, U. V.

    2013-11-01

    Polarization volume holograms are recorded in the polymethylmethacrylate layers that contain phenanthrenequinone at a molar content of 2.5-3%. The effect of the polarization of recording beams on the kinetics of diffraction efficiency and properties of holograms is analyzed. Polarization hologram recording in the polymethylmethacrylate layers with phenanthrenequinone and a relatively high optical stability of the holograms are demonstrated.

  19. Predicting Educational Outcomes and Psychological Well-Being in Adolescents Using Time Attitude Profiles

    Science.gov (United States)

    Andretta, James R.; Worrell, Frank C.; Mello, Zena R.

    2014-01-01

    Using cluster analysis of Adolescent Time Attitude Scale (ATAS) scores in a sample of 300 adolescents ("M" age = 16 years; "SD" = 1.25; 60% male; 41% European American; 25.3% Asian American; 11% African American; 10.3% Latino), the authors identified five time attitude profiles based on positive and negative attitudes toward…

  20. Sadhana | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    Indian practice on estimation of scour around bridge piers—A comment · Umesh C Kothyari ... Investigation of stress–strain models for confined high strength concrete · Metin Husem Selim Pul ... model. pp 253-275. TCP with header checksum option for wireless links: An analytical approach towards performance evaluation.

  1. Light Noble Gases and a Cosmic Ray Exposure Age for the Bunburra Rockhole Meteorite

    Czech Academy of Sciences Publication Activity Database

    Meier, M.M.M.; Bland, P.A.; Welten, K.C.; Spurný, Pavel; Baur, H.; Wieler, R.

    2009-01-01

    Roč. 44, Supplement (2009), A138-A138 ISSN 1086-9379. [Annual Meeting of the Meteoritical Society /72./. Nancy, 13.06.2009-18.06.2009] Institutional research plan: CEZ:AV0Z10030501 Keywords : Bunburra Rockhole * light noble gas * concentration Subject RIV: BN - Astronomy, Celestial Mechanics, Astrophysics Impact factor: 3.253, year: 2009

  2. Understanding Women\\'s Economic And Social Human Rights ...

    African Journals Online (AJOL)

    This article considers the evolution of women\\'s rights in international human rights law. It then moves on to consider the gender dimension of economic, social and cultural rights before examining constraints to their enjoyment and enforcement. East African Journal of Peace and Human Rights Vol. 12 (2) 2006: pp. 232-253 ...

  3. Novel antagonistic interactions associated with plant polyploidization influence trait selection and habitat preference

    Czech Academy of Sciences Publication Activity Database

    Arvanitis, L.; Wiklund, C.; Münzbergová, Zuzana; Dahlgren, J. P.; Ehrlén, J.

    2010-01-01

    Roč. 13, č. 3 (2010), s. 330-337 ISSN 1461-023X R&D Projects: GA ČR GA526/08/0706 Institutional research plan: CEZ:AV0Z60050516 Keywords : herbivore * trait * selection Subject RIV: EF - Botanics Impact factor: 15.253, year: 2010

  4. "Českoslovenství" na konci světa: krajané na Tasmánii.

    Czech Academy of Sciences Publication Activity Database

    Brouček, Stanislav

    2013-01-01

    Roč. 23, č. 4 (2013), s. 241-253 ISSN 0862-8351 R&D Projects: GA MZV(CZ) RM01/15/04 Institutional support: RVO:68378076 Keywords : emigration * migration policy * Czech-Slovakian relations * Czechs and Slovaks in Tasmania Subject RIV: AC - Archeology, Anthropology, Ethnology

  5. Bulletin of Materials Science | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    Home; Journals; Bulletin of Materials Science. N K PANDEY. Articles written in Bulletin of Materials Science. Volume 40 Issue 2 April 2017 pp 253-262. Electrical and optical properties of ZnO–WO 3 nanocomposite and its application as a solid-state humidity sensor · VANDNA SHAKYA N K PANDEY SUNEET KUMAR ...

  6. Probing the localization of charge and the extent of disorder through electronic transport on Au nanoparticle–copper phthalocyanine multijunction networks

    Czech Academy of Sciences Publication Activity Database

    Balliou, A.; Kazim, Samrana; Pfleger, Jiří; Rakušan, J.; Skoulatakis, G.; Kennou, S.; Glezos, N.

    2016-01-01

    Roč. 253, č. 5 (2016), s. 1009-1019 ISSN 0370-1972 R&D Projects: GA MŠk(CZ) 7AMB12GR022; GA ČR(CZ) GAP108/12/1143 Institutional support: RVO:61389013 Keywords : Au nanoparticles * carrier localization * electrical transport Subject RIV: JA - Electronics ; Optoelectronics, Electrical Engineering Impact factor: 1.674, year: 2016

  7. Factors Affecting the Job Satisfaction of Latino/a Immigrants in the Midwest

    Science.gov (United States)

    Valdivia, Corinne; Flores, Lisa Y.

    2012-01-01

    This study examined the job satisfaction of 253 Latino/a newcomers in three rural communities in the Midwest. Specifically, the authors explored the effects of ethnic identity, Anglo acculturation, Latino/a acculturation, perceptions of the community (social relations, discrimination/racism, and language pressures), job tenure, work hours, and…

  8. The purine derivative PI-55 blocks cytokinin action via receptor inhibition

    Czech Academy of Sciences Publication Activity Database

    Spíchal, Lukáš; Werner, T.; Popa, Igor; Riefler, M.; Schmülling, T.; Strnad, Miroslav

    2009-01-01

    Roč. 276, č. 1 (2009), s. 244-253 ISSN 1742-464X R&D Projects: GA ČR(CZ) GP522/07/P197; GA MŠk(CZ) LC06034 Institutional research plan: CEZ:AV0Z50380511 Keywords : anticytokinin * cytokinin * cytokinin receptor Subject RIV: ED - Physiology Impact factor: 3.042, year: 2009

  9. A Fascination with Folk Art. Modernism and the Avant-Garde in Munich, Prague and Moscow around 1913

    Czech Academy of Sciences Publication Activity Database

    Winter, Tomáš

    2016-01-01

    Roč. 64, 3/4 (2016), s. 240-253 ISSN 0049-5123 R&D Projects: GA ČR GA15-07456S Institutional support: RVO:68378033 Keywords : primitivism * cosmopolitanism * 20th-century art Subject RIV: AL - Art, Architecture, Cultural Heritage

  10. 78 FR 52548 - The National Children's Study, Vanguard (Pilot) Study Proposed Collection; 60-day Comment Request

    Science.gov (United States)

    2013-08-23

    ... project, contact: Ms. Sarah L. Glavin, Deputy Director, Office of Science Policy, Analysis and.... Physical Measures: BIA, or bioelectrical impedance analysis, is a non-invasive method for estimation of... Blood, Breast Milk, Caregiver, & Placenta. Secondary Caregiver. Child 253 1 3/60 13 Child-Focused...

  11. 78 FR 76629 - The National Children's Study, Vanguard (Pilot) Study; Submission for OMB Review; 30-Day Comment...

    Science.gov (United States)

    2013-12-18

    ..., Analysis and Communication, Eunice Kennedy Shriver National Institute of Child Health and Human Development... noise they encounter at home. Physical Measures: BIA, or bioelectrical impedance analysis, is a non..., Breast Milk, Placenta, & Microbiome Swab. Child-Focused Biospecimen Child 253 1 3/60 13 Collection...

  12. Synthesis and Catalytic Activity of [Cp′Co(COD)] Complexes Bearing Pendant N-Containing Groups

    Czech Academy of Sciences Publication Activity Database

    Thiel, I.; Lamač, Martin; Jiao, H.; Spannenberg, A.; Hapke, M.

    2013-01-01

    Roč. 32, č. 11 (2013), s. 3415-3418 ISSN 0276-7333 R&D Projects: GA ČR GPP207/10/P200 Institutional support: RVO:61388955 Keywords : FUNCTIONALIZED CYCLOPENTADIENYL LIGANDS * SANDWICH COBALT COMPLEXES * METALLOCENE COMPLEXES Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 4.253, year: 2013

  13. Synthesis of C3-symmetric tri(alkylamino) guests and their interaction with cyclodextrins

    Czech Academy of Sciences Publication Activity Database

    Bednaříková, T.; Tošner, Z.; Horský, Jiří; Jindřich, J.

    2015-01-01

    Roč. 81, 1-2 (2015), s. 141-152 ISSN 0923-0750 Institutional support: RVO:61389013 Keywords : cyclodextrin * supramolecular interactions * C3-symmetric guests Subject RIV: CB - Analytical Chemistry, Separation Impact factor: 1.253, year: 2015

  14. Sadhana – Academy Proceedings in Engineering Sciences: A ...

    Indian Academy of Sciences (India)

    Abstract. This study presents a scientometric analysis of 253 articles published in Sadhana during the year 2005–2009. Five volumes of the journal are taken up to observe the distribution of contribution, authorship pattern, institution-wise distribu- tion, geographical distribution of contribution, average length of paper, tables ...

  15. Laboratory for Computer Science Progress Report 24, July 1986-June 1987

    Science.gov (United States)

    1987-06-01

    shown that bisimulation in SCCS with unguarded recursion is not arithmetical, and trace congruence is f7 ; therefore the two differ for that language... BPP , December 1983 TM-253 Chor, B., Leiserson, C., Rivest, R. and Shearer, J. An Application of Number Theory to the Organization of Raster Graphics

  16. Immigrants from Russia, Ukraine and the Caucasus Region: Differential Drug Use, Infectious Disease, and Related Outcomes

    Science.gov (United States)

    Isralowitz, Richard; Reznik, Alexander; Rawson, Richard A.; Hasson, Albert

    2009-01-01

    This study examined drug use patterns, HIV/AIDS, and related outcomes among former Soviet Union (FSU) immigrants from Russia, Ukraine and the Caucasus mountain region in Israel who reported heroin use. A total of 253 FSU heroin users were interviewed from 2002 to 2007 as part of a large drug use surveillance study in Israel. Individuals were…

  17. Cultural Resource Reconnaissance of U.S. Army Corps of Engineers Land Alongside Lake Sakakawea in Mountrail County, North Dakota. Volume 1. Main Report

    Science.gov (United States)

    1987-02-11

    point analysis .............................................. 554 252 Diagram of two generalized projectile point forms indicating the measurements taken...253 Diagram of a generalized transverse scraper indicating the five measurements taken (adapted from Lee and Lovick 1979...and towns resulted in numerous changes to the environment, including deforestation, increased pressure on the local floral and faunal resources and the

  18. Riddhi Shah

    Indian Academy of Sciences (India)

    Home; Journals; Resonance – Journal of Science Education. Riddhi Shah. Articles written in Resonance – Journal of Science Education. Volume 23 Issue 3 March 2018 pp 253-262 General Article. Maryam Mirzakhani: The Master Artist of Curved Surfaces · Nikita Agarwal Riddhi Shah Geetha Venkataraman · More Details ...

  19. Nikita Agarwal

    Indian Academy of Sciences (India)

    Home; Journals; Resonance – Journal of Science Education. Nikita Agarwal. Articles written in Resonance – Journal of Science Education. Volume 23 Issue 3 March 2018 pp 253-262 General Article. Maryam Mirzakhani: The Master Artist of Curved Surfaces · Nikita Agarwal Riddhi Shah Geetha Venkataraman.

  20. Resonance – Journal of Science Education | Indian Academy of ...

    Indian Academy of Sciences (India)

    Home; Journals; Resonance – Journal of Science Education; Volume 10; Issue 12. Einstein's Last Dream: The Space - Time Unification of Fundamental Forces. Abdus Salam. Volume 10 Issue 12 December 2005 pp 246-253. Fulltext. Click here to view fulltext PDF. Permanent link:

  1. Transactors, Transformers and Beyond. A Multi-Method Development of a Theoretical Typology of Leadership.

    Science.gov (United States)

    Pearce, Craig L.; Sims, Henry P., Jr.; Cox, Jonathan F.; Ball, Gail; Schnell, Eugene; Smith, Ken A.; Trevino, Linda

    2003-01-01

    To extend the transactional-transformational model of leadership, four theoretical behavioral types of leadership were developed based on literature review and data from studies of executive behavior (n=253) and subordinate attitudes (n=208). Confirmatory factor analysis of a third data set (n=702) support the existence of four leadership types:…

  2. Quality Improvement: Appropriate episiotomies in a district hospital ...

    African Journals Online (AJOL)

    A multidisciplinary team did a quality improvement project to reduce the number of episiotomies. The results of the project were positive: the episiotomy rate decreased from 66,2% to 25,3% and the episiotomy dehiscence rate dropped from 2.28% to 0.7%. This had a positive impact also on patient satisfaction and staff ...

  3. Data ingestion and assimilation in ionospheric models

    Czech Academy of Sciences Publication Activity Database

    Burešová, Dalia; Nava, B.; Galkin, I.; Angling, M.; Stankov, S. M.; Coisson, P.

    2009-01-01

    Roč. 52, 3/4 (2009), s. 235-253 ISSN 1593-5213 R&D Projects: GA ČR GA205/08/1356; GA MŠk OC 091 Institutional research plan: CEZ:AV0Z30420517 Keywords : ionosphere * models * data assimilation * data ingestion Subject RIV: DG - Athmosphere Sciences, Meteorology Impact factor: 0.548, year: 2009

  4. Search for anomalous Wtb couplings in single top quark production ...

    Indian Academy of Sciences (India)

    2012-11-08

    Nov 8, 2012 ... CDF Collaboration: T Aaltonen et al, Phys. Rev. Lett. 103, 092002 (2009). [2] S Cortese and R Petronzio, Phys. Lett. B253, 494 (1991). [3] C-P Yuan, Phys. Rev. D41, 42 (1990). [4] N Kidonakis, Phys. Rev. D74, 114012 (2006). [5] D0 Collaboration: V M Abazov et al, Nucl. Instrum. Meth. in Phys. Res. Sect.

  5. International Journal of Health Research

    African Journals Online (AJOL)

    Erah

    attending Alexandria University hostels reported that 33.8% of the studied sample were physically inactive and 25.3% were overweight or at risk of being overweight [15]. Overweight students showed lower physical activity levels compared to normal weight students. It appears that the higher the physical activity level, the ...

  6. Product ion distributions for the reactions of NO+ with some physiologically significant volatile organosulfur and organoselenium compounds obtained using a selective reagent ionization time-of-flight mass spectrometer

    Czech Academy of Sciences Publication Activity Database

    Mochalski, P.; Unterkofler, K.; Španěl, Patrik; Smith, D.; Amann, A.

    2014-01-01

    Roč. 28, č. 15 (2014), s. 1683-1690 ISSN 0951-4198 Institutional support: RVO:61388955 Keywords : TRACE GAS-ANALYSIS * ORGANIC-COMPOUNDS * EXHALED-BREATH Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 2.253, year: 2014

  7. Lifetime and baseline alcohol intake and risk of cancer of the upper aero-digestive tract in the European prospective investigation into cancer and nutrition (EPIC) study

    NARCIS (Netherlands)

    Weikert, Cornelia; Dietrich, Thomas; Boeing, Heiner; Bergmann, Manuela M.; Boutron-Ruault, Marie Christine; Clavel-Chapelon, Francoise; Allen, Naomi; Key, Tim; Lund, Eiliv; Olsen, Anja; Tjonneland, Anne; Overvad, Kim; Rohrmann, Sabine; Linseisen, Jakob; Pischon, Tobias; Trichopoulou, Antonia; Weinehall, Lars; Johansson, Ingegerd; Sanchez, Maria-Jose; Agudo, Antonio; Barricarte, Aurelio; Amiano, Pilar; Chirlaque, Maria-Dolores; Ramon Quiros, J.; Wirfalt, Elisabet; Peeters, Petra H.; Bueno-de-Mesquita, H. Bas; Vrieling, Alina; Pala, Valeria; Palli, Domenico; Vineis, Paolo; Tumino, Rosario; Panico, Salvatore; Bingham, Sheila; Khaw, Kay-Tee; Norat, Teresa; Jenab, Mazda; Ferrari, Pietro; Slimani, Nadia; Riboli, Elio

    2009-01-01

    Recent alcohol consumption is all established risk factor for squamous cell carcinoma (SCC) or the upper aero-digestive tract. In contrast, the role or lifetime exposure to alcohol with regard to risk of SCC is not well established. Historical data oil alcohol use are available in 271,253

  8. Nad edicí Kochemova Velikého života aneb Znovu k metodám vydávání raněnovověké literatury

    Czech Academy of Sciences Publication Activity Database

    Malura, Jan

    2009-01-01

    Roč. 57, č. 2 (2009), s. 253-265 ISSN 0009-0468 Institutional research plan: CEZ:AV0Z90560517 Keywords : Czech literature * Early Modern Period * von Cochem, Martin Subject RIV: AJ - Letters, Mass-media, Audiovision

  9. Supercritical Fluid Spray Application Process for Adhesives and Primers

    Science.gov (United States)

    2003-03-01

    Electrochem. Soc. 1999, 146(9), 3485-3488. 29 27. Kiran, E. NATO Sci. Ser. E, 2000, 366, 253. 28. Kendall, J. L.; Canelas , D. A.; Young, J. L...Menceloglu, Y. Z.; DeSimone, J. M. Macromolecules, 1993, 26, 2663-2669. 45. van Herk, A. M.; Manders, B. G.; Canelas , D. A.; Quadir, M.; DeSimone, J

  10. Psychological Well-Being and Social Participation Assessment in Visually Impaired Subjects Playing Torball: A Controlled Study

    Science.gov (United States)

    Di Cagno, A.; Iuliano, E.; Aquino, G.; Fiorilli, G.; Battaglia, C.; Giombini, A.; Calcagno, G.

    2013-01-01

    The aim of this study was to evaluate the differences in psychological well-being, symptomatic psychological disorders and social participation, between blind Torball players and non-players. Thirty blind male participants were recruited, 17 Torball players (aged 36.27 plus or minus 3.46) and 13 non-players (aged 34.80 plus or minus 2.53), and…

  11. Household measures for river flood risk reduction in the Czech Republic

    Czech Academy of Sciences Publication Activity Database

    Duží, B.; Vikhrov, Dmytro; Kelman, I.; Stojanov, R.; Juřička, D.

    2017-01-01

    Roč. 10, č. 2 (2017), s. 253-266 ISSN 1753-318X Institutional support: Progres-Q24 Keywords : Becva river basin * Czech Republic * flood damage Subject RIV: AH - Economics OBOR OECD: Applied Economics, Econometrics Impact factor: 3.121, year: 2016

  12. Daily and Momentary Mood and Stress Are Associated with Binge Eating and Vomiting in Bulimia Nervosa Patients in the Natural Environment

    Science.gov (United States)

    Smyth, Joshua M.; Wonderlich, Stephen A.; Heron, Kristin E.; Sliwinski, Martin J.; Crosby, Ross D.; Mitchell, James E.; Engel, Scott G.

    2007-01-01

    The relation of mood and stress to binge eating and vomiting in the natural environments of patients with bulimia nervosa (BN) was examined using real-time data collection. Women (n = 131; mean age = 25.3 years) with BN carried a palmtop computer for 2 weeks and completed ratings of positive affect (PA), negative affect (NA), anger/hostility (AH),…

  13. Mõne läänemeresoome sufiksi taustast / Ago Künnap

    Index Scriptorium Estoniae

    Künnap, Ago, 1941-

    2009-01-01

    Vastukaja artiklile: Grünthal, Riho. The Mordvinic languages between bush and tree : a historical reappraisal // Sámit, sánit, sátnehámit : riepmočála Pekka Sammallahtii miessemánu 21. beaivve 2007. Helsinki : Suomalais-Ugrilainen Seura, 2007. (Suomalais-Ugrilaisen Seuran toimituksia ; 253)

  14. Double Ramp Loss Based Reject Option Classifier

    Science.gov (United States)

    2015-05-22

    Dataset Description We report experimental results on 1 synthetic datasets and 2 datasets taken from UCI ML repository [2]. 1. Synthetic Dataset...constrained indefinite quadratic problems by d.c. algorithms. Journal of Global Optimization 11, 253–285 (1997) 2. Bache, K., Lichman, M.: UCI machine

  15. Caesarian Section Rate at Federal Medical Centre, Makudi, Revisited

    African Journals Online (AJOL)

    Results: The overall caesarean section (CS) rate was 15.2%. The CS rate in 2010, 2011 and 2012 showed a steady increase of 14.2%, 14.6% and 16.8% respectively. Cephalopelvic disproportion ( 25.3%) was the commonest indication for CS, followed by fetal distress (16.6%) and previous CS for booked patients.

  16. Acidic and Catalytic Properties of Mo-MCM-22 in Methane Aromatization: An FTIR Study

    Czech Academy of Sciences Publication Activity Database

    Sobalík, Zdeněk; Tvarůžková, Zdenka; Wichterlová, Blanka; Fíla, V.; Špatenka, Š.

    2003-01-01

    Roč. 253, - (2003), s. 271-282 ISSN 0926-860X R&D Projects: GA ČR GA104/99/0432 Institutional research plan: CEZ:AV0Z4040901 Keywords : methane aromatization * FTIR technique * MCM-22 Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 2.825, year: 2003

  17. 7 CFR 1710.303 - Power cost studies-power supply borrowers.

    Science.gov (United States)

    2010-01-01

    ... conservation alternatives as set forth in §§ 1710.253 and 1710.254; (2) A present-value analysis of the costs... contracts or revisions to existing contracts, and an analysis of the effects on power costs; (4) Use of sensitivity analyses to determine the vulnerability of the alternatives to a reasonable range of assumptions...

  18. A Low-Molecular Weight Dialyzable Leukocyte Extract Selectively Enhances the Development of CD4+RORt+ T Cells and IL-17 Production

    Czech Academy of Sciences Publication Activity Database

    Zajícová, Alena; Javorková, Eliška; Trošan, Peter; Chudíčková, Milada; Krulová, Magdaléna; Holáň, Vladimír

    2014-01-01

    Roč. 60, č. 6 (2014), s. 253-260 ISSN 0015-5500 R&D Projects: GA MŠk LO1309 Institutional support: RVO:68378041 Keywords : enzyme-linked immunosorbent assay * interferon * interleukin Subject RIV: EC - Immunology Impact factor: 1.000, year: 2014

  19. Organic amendment optimization for treatment of hydrocarbon ...

    African Journals Online (AJOL)

    Jane

    2010-10-18

    Oct 18, 2010 ... Houston, Texas 7-11 Nov. Adams RH, Domínguez VI, Vinalay L (2002). Evaluation of microbial respiration and ecotoxicity in contaminated soils representative of the pretroleum producing region of southeastern México. TERRA. Latinoamericana, 20(3): 253-265. Adams RH, Guzmán FJ (2008). Evaluation ...

  20. Predictors of Emotional Eating during Adolescents' Transition to College: Does Body Mass Index Moderate the Association between Stress and Emotional Eating?

    Science.gov (United States)

    Wilson, Shana M.; Darling, Katherine E.; Fahrenkamp, Amy J.; D'Auria, Alexandra L.; Sato, Amy F.

    2015-01-01

    Objective: This study sought to (1) examine perceived stress and resources to cope with stress as predictors of emotional eating during the transition to college and (2) determine whether body mass index (BMI) moderated the emotional eating-stress relationship. Participants: Participants were 97 college freshmen (73% female; BMI: M = 25.3

  1. Specific language impairment is associated with maternal and family factors

    NARCIS (Netherlands)

    Diepeveen, F.B.; Dommelen, P. van; Oudesluys-Murphy, A.M.; Verkerk, P.H.

    2017-01-01

    Background: This study aimed to identify risk factors associated with specific language impairment (SLI). Methods: In a nested case–control design, 253 children attending special needs schools for severe speech and language difficulties in the Netherlands were matched for sex and date of birth with

  2. The birth weight of apparently healthy Nigerian newborns in Sokoto ...

    African Journals Online (AJOL)

    . 253 babies were enrolled. Results: There were 131 males and 122 females giving a male: female ratio of 1.1:1. Gestational age by maternal dates ranged from 28 to 44 weeks. There was a consistent increase in mean values of weight as the ...

  3. Effect of eucalyptus (Eucalyptus camaldulensis) and maize (Zea ...

    African Journals Online (AJOL)

    soumare

    Editorial FAN, Bolivia. Soumare et al. 16001. Gareca EE, Martinez YY, Bustamante RO, Aguirre LF, Siles MM (2007). Regeneration patterns of Polylepis subtusalbida growing with the exotic trees Pinus radiata and Eucalyptus globulus at Parque. Nacional Tunari, Bolivia. Plant Ecol. 193:253-263. Hopkinsa AA, Malinowskic ...

  4. Bulletin of Materials Science | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    Articles written in Bulletin of Materials Science. Volume 26 Issue 2 February 2003 pp 247-253 Electrical Properties. Impedance spectroscopy ... the a.c. conductivity data. Volume 26 Issue 7 December 2003 pp 745-747 Electrical Properties. Dielectric properties of piezoelectric 3–0 composites of lithium ferrite/barium titanate.

  5. Indication of Importance of Including Soil Microbial Characteristics into Biotope Valuation Method.

    Czech Academy of Sciences Publication Activity Database

    Trögl, J.; Pavlorková, Jana; Packová, P.; Seják, J.; Kuráň, P.; Kuráň, J.; Popelka, J.; Pacina, J.

    2016-01-01

    Roč. 8, č. 3 (2016), č. článku 253. ISSN 2071-1050 Institutional support: RVO:67985858 Keywords : biotope assessment * biotope valuation method * soil microbial communities Subject RIV: DJ - Water Pollution ; Quality Impact factor: 1.789, year: 2016

  6. Vliv podmínek sladování na obsah dextrinů v meziproduktech výroby piva

    Czech Academy of Sciences Publication Activity Database

    Psota, V.; Čmelík, Richard; Sachambula, L.

    2011-01-01

    Roč. 57, 7-8 (2011), 253-259 ISSN 0023-5830 R&D Projects: GA MŠk 2B06037 Institutional research plan: CEZ:AV0Z40310501 Keywords : malting * dextrin * beer Subject RIV: CB - Analytical Chemistry, Separation

  7. Factors affecting growth and viability of natural diatom populations in the meso-eutrophic Římov Reservoir (Czech Republic)

    Czech Academy of Sciences Publication Activity Database

    Znachor, Petr; Rychtecký, Pavel; Nedoma, Jiří; Visocká, Veronika

    2015-01-01

    Roč. 762, č. 1 (2015), s. 253-265 ISSN 0018-8158 R&D Projects: GA ČR(CZ) GAP504/11/2177; GA ČR(CZ) GAP504/11/2182 Institutional support: RVO:60077344 Keywords : diatom * growth rate * viability * PDMPO * SYTOX green * reservoir Subject RIV: DA - Hydrology ; Limnology Impact factor: 2.051, year: 2015

  8. Distribution of the common hamster in the Czech Republic after 2000: retreating to optimum lowland habitats

    Czech Academy of Sciences Publication Activity Database

    Tkadlec, Emil; Heroldová, Marta; Víšková, V.; Bednář, M.; Zejda, Jan

    2012-01-01

    Roč. 61, 3-4 (2012), s. 246-253 ISSN 0139-7893 R&D Projects: GA MZe QH72075 Institutional support: RVO:68081766 Keywords : Cricetus cricetus * questionnaire * Rodentia Subject RIV: EG - Zoology Impact factor: 0.494, year: 2012

  9. Experimental evaluation of mechanical and electrical properties of RBC suspensions under flow. Role of RBC aggregating agent

    Czech Academy of Sciences Publication Activity Database

    Antonova, N.; Říha, Pavel; Ivanov, I.

    2010-01-01

    Roč. 45, 2-4 (2010), s. 253-261 ISSN 1386-0291 R&D Projects: GA AV ČR IAA200600803 Institutional research plan: CEZ:AV0Z20600510 Keywords : apparent viscosity * conductivity * unsteady flow * RBC suspensions * dextrans * PEG Subject RIV: BK - Fluid Dynamics Impact factor: 2.838, year: 2010

  10. Seasonal variation in particulate organic matter and its cnstituent fractions under the ice covered sea near the shelf, Antarctica

    Digital Repository Service at National Institute of Oceanography (India)

    Dhargalkar, V.K.

    discrete depths. Chl @ia@@ concentration at all the 3 depths varied from 0.026 to 0.253 mu g l@u-1@@ showing minimum values during August-September. POC values varied from 280 to 1058 mu g l@u-1@@ while its constituent fractions such as particulate...

  11. Conductivity study of solid polyelectrolytes based on hydroiodide ...

    Indian Academy of Sciences (India)

    reviews (London: Elsevier Applied Science) Vols. 1–2. Moulic M and Dutta A 2002 J. Polym. Mater. 19 253. Pradhan D K, Choudhary R N P and Samantary B K 2008 Int. J. Electrochem. Sci. 3 597. Ratner M A and Shriver D F 1988 Chem. Rev. 88 109. Silverstein R M and Webster F X 1998 Spectroscopic identification.

  12. Cultivation of soybean with swine wastewater

    African Journals Online (AJOL)

    Fiskadm

    2014-01-15

    Jan 15, 2014 ... which 25.3% are in the state of Paraná, 32.6% in Rio. Grande do Sul and 42.2% in Santa Catarina (ABIPECS,. 2008). This activity generates high amount of waste liquids and solids, which could result in serious problems for the environment if discharged especially into water bodies in the region in large ...

  13. Mukhopadhyay, Prof. Dhrubajyoti

    Indian Academy of Sciences (India)

    Date of birth: 19 September 1938. Specialization: Structural Geology, Precambrian Geology Address: G-7, MIG Housing Colony, 25/3, Raja Manindra Road, Kolkata 700 037, W.B.. Contact: Residence: (033) 2556 8099. Mobile: 94330 92581. Email: dhruba_38@yahoo.co.uk. YouTube; Twitter; Facebook; Blog ...

  14. MASSIVE PROTOPLANETARY DISKS IN ORION BEYOND THE TRAPEZIUM CLUSTER

    International Nuclear Information System (INIS)

    Mann, Rita K.; Williams, Jonathan P.

    2009-01-01

    We present Submillimeter Array 1 The Submillimeter Array is a joint project between the Submillimeter Astrophysical Observatory and the Academica Sinica Institute of Astronomy and Astrophysics and is funded by the Smithsonian Institution and the Academica Sinica. observations of the 880 μm continuum emission from three circumstellar disks around young stars in Orion that lie several arcminutes (∼> 1 pc) north of the Trapezium cluster. Two of the three disks are in the binary system 253-1536. Silhouette disks 216-0939 and 253-1536a are found to be more massive than any previously observed Orion disks, with dust masses derived from their submillimeter emission of 0.045 M sun and 0.066 M sun , respectively. The existence of these massive disks reveals that the disk mass distribution in Orion does extend to high masses, and that the truncation observed in the central Trapezium cluster is a result of photoevaporation due to the proximity of O-stars. 253-1536b has a disk mass of 0.018 M sun , making the 253-1536 system the first optical binary in which each protoplanetary disk is massive enough to potentially form solar systems.

  15. Association of NFKB1A and microRNAs variations and the ...

    Indian Academy of Sciences (India)

    TUBA ONER

    2017-06-20

    Jun 20, 2017 ... subjects carrying the GG genotype and G allele of rs2910164 were found to have an increased risk against AT. The results of combined ..... allelic and genotype distribution. Mann–Whitney U test. (not normally distributed variables). Significance values. Journal of Genetics, Vol. 96, No. 2, June 2017. 253 ...

  16. Infective endocarditis - the effect of liposomes as carrier substance ...

    African Journals Online (AJOL)

    1991-05-18

    May 18, 1991 ... Infective endocarditis has a high mortality and morbidity rate despite all available treatment. Little attention has ... Infective endocarditis (lE) is an uncommon but important disease with a rising incidence in .... bacterial endocarditis in infancy, childhood and adolescence. Eur] Pediatr. 1983; 140: 253-259. 6.

  17. Child and Adult Reports of Graphic Strategies Used to Portray Figures with Contrasting Emotional Characteristics

    Science.gov (United States)

    Burkitt, Esther; Barrett, Martyn

    2010-01-01

    This study assessed children's graphic flexibility and their ability to report on their use of drawing strategies when drawing characterized figures. 253 children (129 boys, 124 girls) aged between 4 years 3 months and 11 year 10 months formed three groups, either drawing a man, a dog or a tree. Each group was asked to draw three emotionally…

  18. Fe-Zn intermetallic phases prepared by diffusion annealing and spark-plasma sintering

    Czech Academy of Sciences Publication Activity Database

    Pokorný, P.; Cinert, Jakub; Pala, Zdeněk

    2016-01-01

    Roč. 50, č. 2 (2016), s. 253-256 ISSN 1580-2949 R&D Projects: GA ČR GB14-36566G Institutional support: RVO:61389021 Keywords : Fe-Zn intermetallics * spark-plasma sintering * diffusion annealing * phase composition * hardness Subject RIV: JK - Corrosion ; Surface Treatment of Materials Impact factor: 0.436, year: 2016

  19. Journal of Earth System Science | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    Home; Journals; Journal of Earth System Science. M Janga Reddy. Articles written in Journal of Earth System Science. Volume 122 Issue 1 February 2013 pp 253-269. Analysis of ENSO-based climate variability in modulating drought risks over western Rajasthan in India · Poulomi Ganguli M Janga Reddy · More Details ...

  20. Giardiasis

    Science.gov (United States)

    2011-06-01

    5f. WORK UNIT NUMBER 7. PERFORMING ORGANIZATION NAME(S) AND ADDRESS(ES) Naval Medical Research Detachment,Lima, Peru, 8. PERFORMING ORGANIZATION...molecular evidence supports the zoonotic transmission of Giardia among humans and dogs living in the same community. Parasitology . 2004;128:253-262. 7

  1. Safer Amputations: A review o f 158 cases | Unegbu | Nigerian ...

    African Journals Online (AJOL)

    A total of 253 amputations were carried out but only 158 case records were available for review. The age range of study population was 9days-78years.; 46.83% of study population fell within the age bracket of 21-40 years. Trauma related causes were the commonest indications, accounting for 77.58% of cases. Only 2 ...

  2. Primary School Students' Strategies in Early Algebra Problem Solving Supported by an Online Game

    Science.gov (United States)

    van den Heuvel-Panhuizen, Marja; Kolovou, Angeliki; Robitzsch, Alexander

    2013-01-01

    In this study we investigated the role of a dynamic online game on students' early algebra problem solving. In total 253 students from grades 4, 5, and 6 (10-12 years old) used the game at home to solve a sequence of early algebra problems consisting of contextual problems addressing covarying quantities. Special software monitored the…

  3. Environmental influences on age at first lambing and lambing ...

    African Journals Online (AJOL)

    The effects of different environmental factors on age at first lambing and lambing interval of Yankasa sheep kept at the National Animal Production Research Institute, Shika, were studied. Least-squares means ( ± SE) for age at first lambing and lambing interval were respectively, 597.2 ±12.6 days and 253.1± 2.9 days.

  4. Star formation in extreme environments : The effects of cosmic rays and mechanical heating

    NARCIS (Netherlands)

    Meijerink, R.; Spaans, M.; Loenen, A. F.; van der Werf, Paul P.

    Context. The molecular interstellar medium in extreme environments, such as Arp 220, but also NGC 253 appears to have extremely high cosmic ray (CR) rates (10(3)-10(4) x Milky Way) and substantial mechanical heating from supernova driven turbulence. Aims. We explore the consequences of high CR rates

  5. Dissolved petroleum hydrocarbons along the oil tanker route in the southern Bay of Bengal

    Digital Repository Service at National Institute of Oceanography (India)

    Topgi, R.S.; Noronha, R.J.; Fondekar, S.P.; SenGupta, R.

    Concentrations of dissolved petroleum hydrocarbons during 3 cruises (Nos. 51, 66 and 68) of R V Gaveshani, along the oil tanker route, in the southern Bay of Bengal at 0, 10 and 20 m were 19.95 + or - 3.38, 16.78 + or - 2.53 and 13.45 + or - 2.17 mu...

  6. A Lattice-Structured Proof Technique Applied to a Minimum Spanning Tree Algorithm

    Science.gov (United States)

    1988-06-01

    Area Code) 22c. OFFICE SYMBOL Judy Little. Publications Coordinator (617) 253-5894 DO FORM 1473, 84 MAR 83 APR edition may be used until exhausted...schedules, GHS solves MST(G). 0 Acknowledgments We thank Yehuda Afek, Steve Garland , Michael Merritt, Liuba Shrira and members of the Theory of

  7. The International Diversification of Banks and the Value of their Cross-Border M&A Advice

    NARCIS (Netherlands)

    de Jong, A.; Ongena, S.; van der Poel, M.

    2010-01-01

    This paper investigates the effects of international diversification of banks on the value of their M&A advice. We study bidder returns to 1,253 cross-border M&A announcements. We find that acquirers engaging a more internationally diversified financial advisor generate lower excess returns.

  8. Tick-borne encephalitis virus neutralization by high dose intravenous immunoglobulin

    Czech Academy of Sciences Publication Activity Database

    Elsterová, Jana; Palus, Martin; Širmarová, J.; Kopecký, J.; Niller, H.H.; Růžek, Daniel

    2017-01-01

    Roč. 8, č. 2 (2017), s. 253-258 ISSN 1877-959X R&D Projects: GA MZd(CZ) NV16-34238A Institutional support: RVO:60077344 Keywords : flavivirus * ticks * neutralizing antibodies * ivig * antibody-dependent enhancement * ammunotherapy Subject RIV: EE - Microbiology, Virology OBOR OECD: Microbiology Impact factor: 3.230, year: 2016

  9. Impact of Robotic Dispensing Machines in German Pharmacies on ...

    African Journals Online (AJOL)

    To assess the impact of robotic dispensing machines in community pharmacies on staff efficiency and sales of over-the-counter drugs. Setting: The study was done on 253 community pharmacies in Germany that use a robotic dispensing machine manufactured by ROWA during 2008. Method: Data concerning the financial ...

  10. Structure and spectra of photochemically obtained nanosized silver particles in presence of modified porous silica

    OpenAIRE

    Galina Krylova; Anna Eremenko; Natalia Smirnova; Susie Eustis

    2005-01-01

    Mesoporous silica powders and films modified with organic sensitizer benzophenone were used as photocatalysts in the reaction of silver ion reduction by isopropyl alcohol under UV-irradiation with λ= 253.7 nm and 365 nm in presence of colloidal silica as stabilizer. Morphological changes of silver colloids during irradiation were studied using transmission electron microscopy, and correlated to the absorption spectra.

  11. Investigating Primary School Teachers' Perception about Democracy through Metaphor Analysis

    Science.gov (United States)

    Nasirci, Hasan; Sadik, Fatma

    2018-01-01

    The aim of this study is to examine democracy perception of classroom teachers via metaphor analysis. Study group for research is formed of 253 classroom teachers. "Democracy Metaphors Questionnaire" (DMQ) has been used in collecting data. Content analysis has been used on analysis of qualitative data of research and descriptive…

  12. The Association of Latino Children's Kindergarten School Readiness Profiles with Grade 2-5 Literacy Achievement Trajectories

    Science.gov (United States)

    Quirk, Matthew; Grimm, Ryan; Furlong, Michael J.; Nylund-Gibson, Karen; Swami, Sruthi

    2016-01-01

    This study utilized latent class analysis (LCA) to identify 5 discernible profiles of Latino children's (N = 1,253) social-emotional, physical, and cognitive school readiness at the time of kindergarten entry. In addition, a growth mixture modeling (GMM) approach was used to identify 3 unique literacy achievement trajectories, across Grades 2-5,…

  13. Spurious Additional Warming Reconstructed From Borehole\

    Czech Academy of Sciences Publication Activity Database

    Šafanda, Jan

    2018-01-01

    Roč. 45, č. 6 (2018), s. 2780-2785 ISSN 0094-8276 R&D Projects: GA MŠk(CZ) EF16_013/0001792 Institutional support: RVO:67985530 Subject RIV: DC - Siesmology, Volcanology, Earth Structure OBOR OECD: Volcanology Impact factor: 4.253, year: 2016

  14. Lightcurve Analsyis of 774 Armor and 3161 Beadell

    Science.gov (United States)

    Oey, Julian; Han, Xianming L.; Gipson, Kevin

    2013-04-01

    Photometric studies of the asteroids 774 Armor and 3161 Beadell and were carried out by observers from Australia and USA. The data were combined and the following periods were obtained: 774 Amor, 25.107 ± 0.005 h; 3161 Beadell, 36.253 ± 0.004 h.

  15. Fecundity and fertility of ladybird beetle Harmonia axyridis after prolonged cold storage

    Czech Academy of Sciences Publication Activity Database

    Awad, Mona; Kalushkov, P.; Nedvědová, T.; Nedvěd, Oldřich

    2013-01-01

    Roč. 58, č. 5 (2013), s. 657-666 ISSN 1386-6141 Grant - others:MZe ČR(CZ) QH82047 Institutional support: RVO:60077344 Keywords : ladybird * hatching rate * overwintering Subject RIV: ED - Physiology Impact factor: 2.253, year: 2013 http://link.springer.com/article/10.1007%2Fs10526-013-9512-4#

  16. The Relationship between Organizational Support, Work-Family Conflict, and the Job-Life Satisfaction of University Coaches

    Science.gov (United States)

    Dixon, Marlene A.; Sagas, Michael

    2007-01-01

    This study examined the relationship between organizational support, work-family conflict, and job and life satisfaction among coaches. Data from collegiate head coaches with families (N = 253) were gathered through a mailed questionnaire. Results from a series of covariance structure models indicated that a partially mediated model was the best…

  17. Normative Values for a Functional Capacity Evaluation

    NARCIS (Netherlands)

    Soer, Remko; van der Schans, Cees P.; Geertzen, Jan H.; Groothoff, Johan W.; Brouwer, Sandra; Dijkstra, Pieter U.; Reneman, Michiel F.

    2009-01-01

    Objective: To establish normative values for a functional capacity evaluation (FCE) of healthy working subjects. Design: Descriptive. Setting: Rehabilitation center. Participants: Healthy working subjects (N=701; 448 men, 253 women) between 20 and 60 years of age, working in more than 180

  18. Architecture of European Plastic Surgery

    NARCIS (Netherlands)

    Nicolai, J. -P. A.; Banic, A.; Molea, G.; Mazzola, R.; Poell, J. G.

    2006-01-01

    The architecture of European Plastic Surgery was published in 1996 [Nicolai JPA, Scuderi N. Plastic surgical Europe in an organogram. Eur J Plast Surg 1996; 19: 253-6.] It is the objective of this paper to update information of that article. Continuing medical education (CME), science, training,

  19. Voluntary respiratory control and cerebral blood flow velocity upon ice-water immersion

    DEFF Research Database (Denmark)

    Mantoni, Teit; Rasmussen, Jakob Højlund; Belhage, Bo

    2008-01-01

    in respiratory rate (from 12 +/- 3 to 21 +/- 5 breaths, min(-1)) and tidal volume (1022 +/- 142 to 1992 +/- 253 ml). Though end-tidal carbon dioxide tension decreased from 4.9 +/- 0.13 to 3.9 +/- 0.21 kPa, CBFV was insignificantly reduced by 7 +/- 4% during immersion with a brief nadir of 21 +/- 4%. DISCUSSION...

  20. 78 FR 4978 - Proposed Agency Information Collection Activities; Comment Request

    Science.gov (United States)

    2013-01-23

    ... hours 100 Recent Records. 213.118--Continuous Weld Rail 728 railroads...... 728 revised plans.. 4 hours... hours 260 213.341--Initial Inspection--New 2 railroads........ 2 reports 16 hours 32 Rail and Welds...--Continuous Weld Rail-- 2 railroads........ 150 records........ 10 minutes........ 253 History--Records. 213...

  1. Palaeoecology of a medieval fishpond system (Vajgar, Czech Republic)

    Czech Academy of Sciences Publication Activity Database

    Jankovská, Vlasta; Pokorný, Jan

    2002-01-01

    Roč. 37, - (2002), s. 253-273 ISSN 0015-5551 R&D Projects: GA ČR GA206/94/1821; GA ČR GA206/99/0774 Institutional research plan: CEZ:AV0Z6005908 Keywords : chemical composition of sediment * palaeoalgology * pollen analysis Subject RIV: EF - Botanics Impact factor: 0.564, year: 2002

  2. Skyrme–Hartree–Fock approach to the change of level occupancy of ...

    Indian Academy of Sciences (India)

    pp. 247–253. Skyrme–Hartree–Fock approach to the change of level occupancy of low mass halo nuclei. RUPAYAN BHATTACHARYA. Gurudas College, Narikeldanga, Calcutta 700 054, India. MS received 29 January 1999. Abstract. With a new parameterization of potential parameters which reproduces the ground state.

  3. Approaching the Affective Factors of Information Seeking: The Viewpoint of the Information Search Process Model

    Science.gov (United States)

    Savolainen, Reijo

    2015-01-01

    Introduction: The article contributes to the conceptual studies of affective factors in information seeking by examining Kuhlthau's information search process model. Method: This random-digit dial telephone survey of 253 people (75% female) living in a rural, medically under-serviced area of Ontario, Canada, follows-up a previous interview study…

  4. Identification and functionality of proteomes secreted by rat cardiac stem cells and neonatal cardiomyocytes

    Czech Academy of Sciences Publication Activity Database

    Šťastná, Miroslava; Chimenti, I.; Marban, E.; Van Eyk, J.E.

    2010-01-01

    Roč. 10, č. 2 (2010), s. 245-253 ISSN 1615-9853 Institutional research plan: CEZ:AV0Z40310501 Keywords : animal proteomics * cardiac stem cells * neonatal cardiomyocytes Subject RIV: CB - Analytical Chemistry, Separation Impact factor: 4.815, year: 2010

  5. A new species of the Camponotus aureopilus VIEHMEYER, 1914 species-group (Hymenoptera: Formicidae) from Papua New Guinea

    Czech Academy of Sciences Publication Activity Database

    Shattuck, S.; Janda, Milan

    2009-01-01

    Roč. 12, - (2009), s. 251-253 ISSN 1994-4136 R&D Projects: GA MŠk LC06073; GA AV ČR KJB612230701 Grant - others:U.S. National Science Foundation(US) DEB-02-11591 Institutional research plan: CEZ:AV0Z50070508 Keywords : taxonomic description * Hymenoptera * Formicidae Subject RIV: EG - Zoology

  6. Sadhana | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    Home; Journals; Sadhana; Volume 35; Issue 3. Issue front cover thumbnail. Volume 35, Issue 3. June 2010, pages 241-392. pp 241-253. An approximate method for lateral stability analysis of wall-frame buildings including shear deformations of walls · Kanat Burak Bozdogan Duygu Ozturk · More Details Abstract Fulltext ...

  7. PLASMA SPRAYING OF REFRACTORY CERMETS BY THE WATER-STABILIZED SPRAY (WSP®) SYSTEM

    Czech Academy of Sciences Publication Activity Database

    Ctibor, Pavel; Brožek, V.; Cheong, D.-I.; Chráska, Pavel

    2009-01-01

    Roč. 54, č. 3 (2009), s. 241-253 ISSN 0001-7043 Institutional research plan: CEZ:AV0Z20430508 Keywords : Plasma spraying * cermet coatings * microhardness * zirconium carbide * tungsten Subject RIV: JH - Ceramics, Fire-Resistant Materials and Glass

  8. Zvířecí skelet z laténského objektu v Nových Dvorech, okr. Kutná Hora

    Czech Academy of Sciences Publication Activity Database

    Kyselý, René

    2011-01-01

    Roč. 63, č. 2 (2011), s. 253-255 ISSN 0323-1267 Institutional research plan: CEZ:AV0Z80020508 Keywords : ritual * La Tène period * osteology * Bos taurus * cattle Subject RIV: AC - Archeology, Anthropology, Ethnology

  9. Mixed infection of black currant (Ribes Nigrum L.) plants with blackcurrant reversion associated virus and rhabdovirus-like particles with symptoms of black currant reversion disease

    Czech Academy of Sciences Publication Activity Database

    Přibylová, Jaroslava; Špak, Josef; Kubelková, Darina

    2002-01-01

    Roč. 46, - (2002), s. 253-256 ISSN 0001-723X R&D Projects: GA ČR GA522/02/0040 Institutional research plan: CEZ:AV0Z5051902 Keywords : plant diseases * viruses * black currant Subject RIV: EE - Microbiology, Virology Impact factor: 0.660, year: 2002

  10. Trace element geochemistry of Amba Dongar carbonatite complex ...

    Indian Academy of Sciences (India)

    R. Narasimhan (Krishtel eMaging) 1461 1996 Oct 15 13:05:22

    multi-source evolution; J. Petrol. 42 377–405. Gwalani L G, Rock N M S, Chang W-J, Fernandez S,. All`egre C J and Prinzhofer A 1993 Alkaline rocks and carbonatites of Amba Dongar and adjacent areas,. Deccan Igneous Province, Gujarat, India. 1. Geology, petrography and petrochemistry; Mineral. Petrol. 47. 219–253.

  11. Strategies for improving library user education programme in ...

    African Journals Online (AJOL)

    This study determines strategies for improving library user education in universities in Benue State. The main purpose of this study is to determine the strategies for students' positive attitudes towards library user education. The study adopted a descriptive survey research design. Population of the study was 6,253 and ...

  12. TMFunction data: 663 [TMFunction[Archive

    Lifescience Database Archive (English)

    Full Text Available Lambert G, Forster IC, Stange G, Biber J, Murer H. J Gen Physiol. 1999 Nov;114(5):637-52 cysteine mutagenesi...s -25.3 Electrogenic Activity (Ip) electrophysiological ... NPT2A_RAT (Q06496) Helix ... mutagenesis; phosphate transport; electrophysiology; Xenopus laevis oocyte

  13. 78 FR 53479 - Notice of Lodging of Consent Decree Under the Clean Air Act (“CAA”)

    Science.gov (United States)

    2013-08-29

    ... several pollutants at multiple units, requires improved flaring efficiency, and enhanced controls for leak... supplemental environmental project requiring Big West Oil to install, at a cost of approximately $253,000, a... public comment on the Decree. Comments should be addressed to the Assistant Attorney General, Environment...

  14. Cross-Cultural Comparison of Anxiety Symptoms in Colombian and Australian Children

    Science.gov (United States)

    Amaya, Andrea Crane; Campbell, Marilyn

    2010-01-01

    Introduction: This cross-cultural study compared both the symptoms of anxiety and their severity in a community sample of children from Colombia and Australia. Method: The sample comprised 516 children (253 Australian children and 263 Colombian children), aged 8 to 12-years-old. The Spence Children's Anxiety Scale (SCAS) was used to measure both…

  15. The impact of European antitrust policy : Evidence from the stock market

    NARCIS (Netherlands)

    A. Günster (Andrea); M.A. van Dijk (Mathijs)

    2016-01-01

    markdownabstractWe evaluate the impact of European antitrust policy by analyzing the stock market response to investiga-tion announcements, infringement decisions, and appeals for 253 companies involved in 118 Europeanantitrust cases over 1974–2004. We find significantly negative stock price

  16. Kinetics of the photochromic reaction in a polymer containing azobenzene groups

    Czech Academy of Sciences Publication Activity Database

    Mancheva, I.; Zhivkov, I.; Nešpůrek, Stanislav

    2005-01-01

    Roč. 7, č. 1 (2005), s. 253-256 ISSN 1454-4164 R&D Projects: GA MŠk 1P04OCD14.30 Grant - others:Bulgarian Ministry of Education and Science(BG) x-1322 Keywords : photochromism * azobenzene * relaxation properties Subject RIV: BG - Nuclear, Atomic and Molecular Physics, Colliders Impact factor: 1.138, year: 2005

  17. Common Purpose Liability versus Joint Enterprise: A Practical View on the ICC's Hierarchy of Liability Theories

    NARCIS (Netherlands)

    Cupido, M.

    2016-01-01

    On 7 March 2014, Trial Chamber II of the International Criminal Court (ICC) convicted Germain Katanga for war crimes and crimes against humanity. Katanga's conviction is based on the concept of common purpose liability as regulated in Article 25(3)(d) of the Rome Statute. This liability theory

  18. Koolera paneb Haiti valmiduse proovile / Hendrik Vosman

    Index Scriptorium Estoniae

    Vosman, Hendrik

    2010-01-01

    Haitis puhkenud koolerapuhang on nõudnud juba 253 inimelu, nakatunute arv ületab 3100 piiri, bakter võib sealsete ebahügieeniliste olude tõttu kaasa tuua teise humanitaarkatastroofi pärast 12. jaanuari maavärinat. Kaart

  19. The quest for truth, particularly in mechanics

    Czech Academy of Sciences Publication Activity Database

    Okrouhlík, Miloslav

    2013-01-01

    Roč. 19, č. 4 (2013), s. 253-272 ISSN 1736-6038 Institutional support: RVO:61388998 Keywords : continuum mechanics of solids * finite element analysis * validity of models * definitions of terms Subject RIV: BI - Acoustics http://www.kirj.ee/23324/

  20. Genome-wide association analysis identifies six new loci associated with forced vital capacity

    NARCIS (Netherlands)

    D.W. Loth (Daan); M.S. Artigas; S.A. Gharib (Sina); L.V. Wain (Louise); N. Franceschini (Nora); B. Koch (Beate); T.D. Pottinger (Tess); G.D. Smith; Q. Duan (Qing); C. Oldmeadow (Christopher); M.K. Lee (Mi Kyeong); D.P. Strachan (David); A.L. James (Alan); J.E. Huffman (Jennifer); V. Vitart (Veronique); A. Ramasamy (Adaikalavan); N.J. Wareham (Nick); J. Kaprio (Jaakko); X.-Q. Wang (Xin-Qun); H. Trochet (Holly); M. Kähönen (Mika); C. Flexeder (Claudia); E. Albrecht (Eva); L.M. Lopez (Lorna); B. Thyagarajan (Bharat); A.C. Alves (Alexessander Couto); S. Enroth (Stefan); E. Omenaas (Ernst); P.K. Joshi (Peter); M. Fall (Magnus); A. Viñuela (Ana); L.J. Launer (Lenore); L.R. Loehr (Laura); M. Fornage (Myriam); G. Li (Guo); J.B. Wilk (Jemma); W. Tang (Wenbo); A. Manichaikul (Ani); L. Lahousse (Lies); T.B. Harris (Tamara); K.E. North (Kari); A.R. Rudnicka (Alicja); J. Hui (Jennie); X. Gu (Xiangjun); T. Lumley (Thomas); A.F. Wright (Alan); N. Hastie (Nick); S. Campbell (Susan); R. Kumar (Rajesh); I. Pin (Isabelle); R.A. Scott (Robert); K.H. Pietilainen (Kirsi Hannele); I. Surakka (Ida); Y. Liu (YongMei); E.G. Holliday (Elizabeth); H. Schulz (Holger); J. Heinrich (Joachim); G. Davies (Gail); J.M. Vonk (Judith); M.K. Wojczynski (Mary ); A. Pouta (Anneli); A. Johansson (Åsa); S.H. Wild (Sarah); E. Ingelsson (Erik); F. Rivadeneira Ramirez (Fernando); H. Völzke (Henry); P.G. Hysi (Pirro); G. Eiriksdottir (Gudny); A.C. Morrison (Alanna); J.I. Rotter (Jerome); W. Gao (Wei); D.S. Postma (Dirkje); W.B. White (Wendy); S.S. Rich (Stephen); A. Hofman (Albert); T. Aspelund (Thor); D. Couper (David); L.J. Smith (Lewis); B.M. Psaty (Bruce); K. Lohman (Kurt); E.G. Burchard (Esteban); A.G. Uitterlinden (André); M. Garcia (Melissa); B.R. Joubert (Bonnie); W.L. McArdle (Wendy); A.W. Musk (Arthur); C.R.W. Hansel (Christian); S.R. Heckbert (Susan); L. Zgaga (Lina); J.B.J. van Meurs (Joyce); P. Navarro (Pau); I. Rudan (Igor); Y.-M. Oh (Yeon-Mok); S. Redline (Susan); D.L. Jarvis (Deborah); J.H. Zhao (Jing Hua); T. Rantanen (Taina); G.T. O'Connor (George); S. Ripatti (Samuli); R.J. Scott (Rodney); S. Karrasch (Stefan); H. Grallert (Harald); N.C. Gaddis (Nathan); J.M. Starr (John); C. Wijmenga (Cisca); R.L. Minster (Ryan); C.W. Lederer (Carsten); J. Pekkanen (Juha); U. Gyllensten (Ulf); H. Campbell (Harry); A.P. Morris (Andrew); S. Gläser (Sven); C.J. Hammond (Christopher); K.M. Burkart (Kristin); J.P. Beilby (John); S.B. Kritchevsky (Stephen); V. Gudnason (Vilmundur); D.B. Hancock (Dana); O.D. Williams (Dale); O. Polasek (Ozren); T. Zemunik (Tatijana); I. Kolcic (Ivana); M.F. Petrini (Marcy); K.T. de Jong (Kim); M. Wjst (Matthias); W.H. Kim (Woo); D.J. Porteous (David J.); G. Scotland (Generation); B.H. Smith (Blair); A. Viljanen (Anne); M. Heliovaara (Markku); J. Attia (John); I. Sayers (Ian); R. Hampel (Regina); C. Gieger (Christian); I.J. Deary (Ian); H.M. Boezen (Marike); A.B. Newman (Anne); M.-R. Jarvelin (Marjo-Riitta); J.F. Wilson (James); L. Lind (Lars); B.H.Ch. Stricker (Bruno); A. Teumer (Alexander); T.D. Spector (Timothy); E. Melén (Erik); M.J. Peters (Marjolein); L.A. Lange (Leslie); R.G. Barr (Graham); K.R. Bracke (Ken); F.M. Verhamme (Fien); J. Sung (Joohon); P.S. Hiemstra (Pieter); P.A. Cassano (Patricia); A. Sood (Akshay); C. Hayward (Caroline); J. Dupuis (Josée); I.P. Hall (Ian); G.G. Brusselle (Guy); M.D. Tobin (Martin); S.J. London (Stephanie)

    2014-01-01

    textabstractForced vital capacity (FVC), a spirometric measure of pulmonary function, reflects lung volume and is used to diagnose and monitor lung diseases. We performed genome-wide association study meta-analysis of FVC in 52,253 individuals from 26 studies and followed up the top associations in

  1. Genome-wide association analysis identifies six new loci associated with forced vital capacity

    NARCIS (Netherlands)

    Loth, Daan W.; Artigas, Maria Soler; Gharib, Sina A.; Wain, Louise V.; Franceschini, Nora; Koch, Beate; Pottinger, Tess D.; Smith, Albert Vernon; Duan, Qing; Oldmeadow, Chris; Lee, Mi Kyeong; Strachan, David P.; James, Alan L.; Huffman, Jennifer E.; Vitart, Veronique; Ramasamy, Adaikalavan; Wareham, Nicholas J.; Kaprio, Jaakko; Wang, Xin-Qun; Trochet, Holly; Kaonen, Mika; Flexeder, Claudia; Albrecht, Eva; Lopez, Lorna M.; de Jong, Kim; Thyagarajan, Bharat; Alves, Alexessander Couto; Enroth, Stefan; Omenaas, Ernst; Joshi, Peter K.; Fall, Tove; Vinuela, Ana; Launer, Lenore J.; Loehr, Laura R.; Fornage, Myriam; Li, Guo; Wik, Jemma B.; Tang, Wenbo; Manichaikul, Ani; Lahousse, Lies; Harris, Tamara B.; North, Kari E.; Rudnicka, Alicja R.; Hui, Jennie; Gu, Xiangjun; Lumley, Thomas; Wright, Alan F.; Hastie, Nicholas D.; Campbell, Susan; Kumar, Rajesh; Pin, Isabelle; Scott, Robert A.; Pietilainen, Kirsi H.; Surakka, Ida; Liu, Yongmei; Holliday, Elizabeth G.; Schulz, Holger; Heinrich, Joachim; Davies, Gail; Vonk, Judith M.; Wojczynski, Mary; Pouta, Anneli; Johansson, Asa; Wild, Sarah H.; Ingelsson, Erik; Rivadeneira, Fernando; Voezke, Henry; Hysi, Pirro G.; Eiriksdottir, Gudny; Morrison, Alanna C.; Rotter, Jerome I.; Gao, Wei; Postma, Dirkje S.; White, Wendy B.; Rich, Stephen S.; Hofman, Albert; Aspelund, Thor; Couper, David; Smith, Lewis J.; Psaty, Bruce M.; Lohman, Kurt; Burchard, Esteban G.; Uitterlinden, Andre G.; Garcia, Melissa; Joubert, Bonnie R.; McArdle, Wendy L.; Musk, A. Bill; Hansel, Nadia; Heckbert, Susan R.; Zgaga, Lina; van Meurs, Joyce B. J.; Navarro, Pau; Rudan, Igor; Oh, Yeon-Mok; Redline, Susan; Jarvis, Deborah L.; Rantanen, Taina; O'Connor, George T.; Ripatti, Samuli; Scott, Rodney J.; Karrasch, Stefan; Grallert, Harald; Gaddis, Nathan C.; Starr, John M.; Wijmenga, Cisca; Minster, Ryan L.; Lederer, David J.; Pekkanen, Juha; Gyllensten, Ulf; Campbe, Harry; Morris, Andrew P.; Glaeser, Sven; Hammond, Christopher J.; Burkart, Kristin M.; Beilby, John; Kritchevsky, Stephen B.; Gucinason, Vilrnundur; Hancock, Dana B.; Williams, Dale; Polasek, Ozren; Zemunik, Tatijana; Kolcic, Ivana; Petrini, Marcy F.; Wjst, Matthias; Kim, Woo Jin; Porteous, David J.; Scotland, Generation; Smith, Blair H.; Villanen, Anne; Heliovaara, Markku; Attia, John R.; Sayers, Ian; Hampel, Regina; Gieger, Christian; Deary, Ian J.; Boezen, Hendrika; Newman, Anne; Jarvelin, Marjo-Riitta; Wilson, James F.; Lind, Lars; Stricker, Bruno H.; Teumer, Alexander; Spector, Timothy D.; Melen, Erik; Peters, Marjolein J.; Lange, Leslie A.; Barr, R. Graham; Bracke, Ken R.; Verhamme, Fien M.; Sung, Joohon; Hiemstra, Pieter S.; Cassano, Patricia A.; Sood, Akshay; Hayward, Caroline; Dupuis, Josee; Hall, Ian P.; Brusselle, Guy G.; Tobin, Martin D.; London, Stephanie J.

    Forced vital capacity (FVC), a spirometric measure of pulmonary function, reflects lung volume and is used to diagnose and monitor lung diseases. We performed genome-wide association study meta-analysis of FVC in 52,253 individuals from 26 studies and followed up the top associations in 32,917

  2. Separation of yttrium from strontium in the aqueous phase of the water/nitrobenzene system

    Czech Academy of Sciences Publication Activity Database

    Vaňura, P.; Makrlík, E.; Vobecký, Miloslav

    2002-01-01

    Roč. 253, č. 1 (2002), s. 171-172 ISSN 0236-5731 Institutional research plan: CEZ:AV0Z4031919 Keywords : stroncium * yttrium * separation Subject RIV: CB - Analytical Chemistry, Separation Impact factor: 0.502, year: 2002

  3. Separation of microamounts of yttrium from strontium in the two-phase water/nitrobenzene system

    Czech Academy of Sciences Publication Activity Database

    Makrlík, E.; Vaňura, P.; Vobecký, Miloslav

    2002-01-01

    Roč. 253, č. 1 (2002), s. 153-155 ISSN 0236-5731 Institutional research plan: CEZ:AV0Z4031919 Keywords : separation * stroncium * yttrium Subject RIV: CB - Analytical Chemistry, Separation Impact factor: 0.502, year: 2002

  4. Investigation of the bonding strength and bonding mechanisms of SOFCs interconnector-electrode interfaces

    Czech Academy of Sciences Publication Activity Database

    Boccaccini, D. N.; Ševeček, O.; Frandsen, L. H.; Dlouhý, Ivo; Molin, S.; Cannio, M.; Hjelm, J.; Hendriksen, P. V.

    2016-01-01

    Roč. 162, č. 1 (2016), s. 250-253 ISSN 0167-577X Institutional support: RVO:68081723 Keywords : Metal-ceramic bond strength * Schwickerath crack -initiation test * SOC interfaces Subject RIV: JL - Materials Fatigue, Friction Mechanics Impact factor: 2.572, year: 2016

  5. Effect of stress on structural brain asymmetry

    Czech Academy of Sciences Publication Activity Database

    Zach, P.; Valeš, Karel; Stuchlík, Aleš; Čermáková, P.; Mrzílková, J.; Koutella, A.; Kutová, M.

    2016-01-01

    Roč. 37, č. 4 (2016), s. 253-264 ISSN 0172-780X R&D Projects: GA ČR(CZ) GBP304/12/G069 Institutional support: RVO:67985823 Keywords : laterality * asymmetry * brain * evolution * stress * neuropsychiatric disorders Subject RIV: FH - Neurology Impact factor: 0.918, year: 2016

  6. Exposure of Postnatal Rats to a Static Magnetic Field of 0.14 T Influences Functional Laterality of the Hippocampal High-Affinity Choline Uptake System in Adulthood; In Vitro Test With Magnetic Nanoparticles

    Czech Academy of Sciences Publication Activity Database

    Krištofíková, Z.; Čermák, M.; Benešová, O.; Klaschka, Jan; Zach, P.

    2005-01-01

    Roč. 30, č. 2 (2005), s. 253-262 ISSN 0364-3190 R&D Projects: GA MZd NF7576 Keywords : magnetic nanoparticles * choline transport * cholinergic * functional impairment * hippocampus * laterality * magnetoreception * static magnetic field Subject RIV: BB - Applied Statistics, Operational Research Impact factor: 2.187, year: 2005

  7. Settlement problems in the Czech borderland

    Czech Academy of Sciences Publication Activity Database

    Vaishar, Antonín; Dvořák, Petr; Nováková, Eva; Zapletalová, Jana

    2008-01-01

    Roč. 60, č. 3 (2008), s. 241-253 ISSN 0016-7193 R&D Projects: GA MŠk 2D06001 Institutional research plan: CEZ:AV0Z30860518 Keywords : borderland * social infrastructure * education * micro-regions Subject RIV: DE - Earth Magnetism, Geodesy, Geography

  8. Sadhana | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    Volume 35, Issue 3. June 2010, pages 241-392. pp 241-253. An approximate method for lateral stability analysis of wall-frame buildings including shear deformations of walls ... Size effect in self consolidating concrete beams with and without notches · H Eskandari S Muralidhara B K Raghu Prasad B V Venkatarama Reddy.

  9. A Review on the Effects of Supercritical Carbon Dioxide on Enzyme Activity

    Czech Academy of Sciences Publication Activity Database

    Wimmer, Zdeněk; Zarevúcka, Marie

    2010-01-01

    Roč. 11, č. 1 (2010), s. 233-253 E-ISSN 1422-0067 R&D Projects: GA MŠk 2B06024 Institutional research plan: CEZ:AV0Z50380511; CEZ:AV0Z40550506 Keywords : enzyme * supercritical carbon dioxide * synthesis Subject RIV: CC - Organic Chemistry Impact factor: 2.279, year: 2010

  10. Construction of PVX virus-expression vector to express enterotoxin ...

    African Journals Online (AJOL)

    user

    2011-02-07

    Feb 7, 2011 ... systems for transient production of recombinant tallergens in. Nicotiana benthamiana. Methods, 32: 227-234. Xu CG. Wang WZ (1999). High level expression of fusion gene of. Heat-stable enterotoxin(ST1) and Heat-Labile enterotoxin B subunit(LTB). Acta Veterinaria et Zootechnica Sinic, 30: 249-253.

  11. Resonance – Journal of Science Education | Indian Academy of ...

    Indian Academy of Sciences (India)

    Home; Journals; Resonance – Journal of Science Education. Riddhi Shah. Articles written in Resonance – Journal of Science Education. Volume 23 Issue 3 March 2018 pp 253-262 General Article. Maryam Mirzakhani: The Master Artist of Curved Surfaces · Nikita Agarwal Riddhi Shah Geetha Venkataraman · More Details ...

  12. Emphysematous cystitis – a case report | Rao | African Journal of ...

    African Journals Online (AJOL)

    S Rao, JV Dhabalia, Girish G Nelivigi, NK Jain, M Suryavanshi, S Goel. Abstract. No Abstract. African Journal of Urology Vol. 11(3) 2005: 253-255. Full Text: EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT · DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT · AJOL African Journals Online. HOW TO USE AJOL.

  13. Why testes are resistant to hydatidosis: Is blood-testis-barrier ...

    African Journals Online (AJOL)

    Testes are extremely rare sites for echinococcosis. To our knowledge only three cases of testicular hydatid disease have been reported so far. In this laboratory animal model, we studied hydatidosis in rabbit testis. Fourteen male albino rabbits (body weight 2.5-3 kg) were randomized into two groups: Group A (study group), ...

  14. Florae Malesianae Precursores III. Dialium L. (Caesalpiniaceae)

    NARCIS (Netherlands)

    Wit, de H.C.D.

    1953-01-01

    Dialium hydnocarpoides, sp. nov. — Foliola (15)17—19, elliptice oblonga, 4.5—6.5(8.5) cm longa, 2—2.5(3) cm lata, apice abrupte breviter acuminata. Sepala extus pubescentia, intus puberula. Stamina 2, raro 3. Ovarium in receptaculo plano, lato, strigoso excentrice insertum. Stylus glaber. Legumen

  15. The Enigmatic Nature of the Israeli Legal System

    African Journals Online (AJOL)

    NWUuser

    See Art III(c) of the Genocide Convention and Art 25(3)(e) of the Rome Statute of the ... It is submitted that the amendment of existing national legislation, namely .... 14. ICTR Prosecutor v Nahimana et al (Trial Chamber: Judgment) Case No ICTR-99-52-T, 3. December 2003 para 1101 (hereafter Nahimana (Trail Chamber)).

  16. Secondary queens in the parthenogenetic termite Cavitermes tuberosus develop through a transitional helper stage

    Czech Academy of Sciences Publication Activity Database

    Hellemans, S.; Fournier, D.; Hanus, Robert; Roisin, Y.

    2017-01-01

    Roč. 19, č. 6 (2017), s. 253-262 ISSN 1520-541X Institutional support: RVO:61388963 Keywords : facultative parthenogenesis * replacement queens * termites * asexual queen succession * ontogeny * Cavitermes Subject RIV: EG - Zoology OBOR OECD: Developmental biology Impact factor: 2.243, year: 2016

  17. Primary school students’ strategies in early algebra problem solving supported by an online game

    NARCIS (Netherlands)

    van den Heuvel-Panhuizen, M.H.A.M|info:eu-repo/dai/nl/069266255; Kolovou, A.|info:eu-repo/dai/nl/313715947; Robitzsch, A.

    2013-01-01

    In this study we investigated the role of a dynamic online game on students’ early algebra problem solving. In total 253 students from grades 4, 5, and 6 (10–12 years old) used the game at home to solve a sequence of early algebra problems consisting of contextual problems addressing covarying

  18. Normal blood pressure and preserved diurnal variation in offspring of type 2 diabetic patients characterized by features of the metabolic syndrome: the Fredericia Study

    DEFF Research Database (Denmark)

    Foss, Anne-Catherine; Vestbo, Else; Frøland, Anders

    2000-01-01

    OBJECTIVE: To examine whether an elevated blood pressure (BP) level and an impaired reduction in nocturnal BP are already present in nondiabetic first-degree relatives of type 2 diabetic patients. RESEARCH DESIGN AND METHODS: We examined 253 offspring of type 2 diabetic patients using ambulatory ...

  19. Comparative Study of the Spherical Downward Continuation

    Czech Academy of Sciences Publication Activity Database

    Sebera, Josef; Pitoňák, M.; Hamáčková, E.; Novák, P.

    2015-01-01

    Roč. 36, č. 2 (2015), s. 253-267 ISSN 0169-3298 Grant - others:GA MŠk(CZ) CZ.1.05/1.1.00/02.0090 Institutional support: RVO:67985815 Keywords : limited airborne gravity * potential-field data * horizontal plane Subject RIV: DE - Earth Magnetism, Geodesy, Geography Impact factor: 3.622, year: 2015

  20. 1531-IJBCS-Article-Petemagnan Jean Marie

    African Journals Online (AJOL)

    hp

    state anaerobic digestion of Korean food wastes. Bioressource Technology, 22: 245-253. Chynoweth DP, Owens JM, Legrand R. 2001. Renewable methane from anaerobic digestion of biomass. Renewable Energy,. 22: 1-8. Duncker LC, Matsebe GN, Moilwa N. 2007. The social/cultural acceptability of using human excreta ...

  1. Geomorphological inventory of rock landforms on Mt. Kamenec in the Novohradské hory Mts. (the Czech Republic)

    Czech Academy of Sciences Publication Activity Database

    Rypl, J.; Kirchner, Karel; Dvořáčková, S.

    2014-01-01

    Roč. 9, č. 3 (2014), s. 253-260 ISSN 1842-4090 Institutional support: RVO:68145535 Keywords : Novohradské hory Mts. * large protection * Mt. Kamenec * GPS mapping * geomorphological inventory Subject RIV: DE - Earth Magnetism, Geodesy, Geography Impact factor: 0.630, year: 2014 http://www.ubm.ro/sites/CJEES/viewTopic.php?topicId=464

  2. Long-term variability of temperature and precipitation in the Czech Lands: an attribution analysis

    Czech Academy of Sciences Publication Activity Database

    Mikšovský, J.; Brázdil, Rudolf; Štěpánek, Petr; Zahradníček, Pavel; Pišoft, P.

    2014-01-01

    Roč. 125, č. 2 (2014), s. 253-264 ISSN 0165-0009 Institutional support: RVO:67179843 Keywords : north-atlantic oscillacion * souothern oscillacion * global climate * neutral network * Europe * fluctuations * extensions * trends * periods * signal Subject RIV: EH - Ecology, Behaviour Impact factor: 3.430, year: 2014

  3. Gas hydrate contribution to Late Permian global warming

    Czech Academy of Sciences Publication Activity Database

    Majorowicz, J.; Grasby, S. E.; Šafanda, Jan; Beauchamp, B.

    2014-01-01

    Roč. 393, May (2014), s. 243-253 ISSN 0012-821X Institutional support: RVO:67985530 Keywords : Latest Permian extinction * gas hydrates * carbon isotope shift Subject RIV: DC - Siesmology, Volcanology, Earth Structure Impact factor: 4.734, year: 2014

  4. Lichens of the virgin forest reserve Žofínský prales (Czech Republic) and surrounding woodlands

    Czech Academy of Sciences Publication Activity Database

    Malíček, J.; Palice, Zdeněk

    2013-01-01

    Roč. 26, č. 2 (2013), s. 253-292 ISSN 0018-0971 R&D Projects: GA MK(CZ) DF12P01OVV025 Keywords : epiphytic and epixylic lichen s * biodiversity * old-growth forest Subject RIV: EF - Botanics Impact factor: 0.919, year: 2013

  5. Flore vasculaire rare et endemique de la peninsule de l'Edough ...

    African Journals Online (AJOL)

    Dans cette optique, la diversite floristique de la peninsule de l'Edough, a revele ... les plantes endemiques, rares ou menacees. La categorie des rares represente 7.86 % de la flore etudiee, soit 31 taxons, et 2.53 % des especes sont tres rares .... terres entourant la peninsule de l 'Edough et formant une ile temporaire [10].

  6. Dynamic temperature fields under Mars landing sites and implications for supporting microbial life.

    Science.gov (United States)

    Ulrich, Richard; Kral, Tim; Chevrier, Vincent; Pilgrim, Robert; Roe, Larry

    2010-01-01

    While average temperatures on Mars may be too low to support terrestrial life-forms or aqueous liquids, diurnal peak temperatures over most of the planet can be high enough to provide for both, down to a few centimeters beneath the surface for some fraction of the time. A thermal model was applied to the Viking 1, Viking 2, Pathfinder, Spirit, and Opportunity landing sites to demonstrate the dynamic temperature fields under the surface at these well-characterized locations. A benchmark temperature of 253 K was used as a lower limit for possible metabolic activity, which corresponds to the minimum found for specific terrestrial microorganisms. Aqueous solutions of salts known to exist on Mars can provide liquid solutions well below this temperature. Thermal modeling has shown that 253 K is reached beneath the surface at diurnal peak heating for at least some parts of the year at each of these landing sites. Within 40 degrees of the equator, 253 K beneath the surface should occur for at least some fraction of the year; and, within 20 degrees , it will be seen for most of the year. However, any life-form that requires this temperature to thrive must also endure daily excursions to far colder temperatures as well as periods of the year where 253 K is never reached at all.

  7. History, Identity, and the School Curriculum in Northern Ireland: An Empirical Study of Secondary Students' Ideas and Perspectives

    Science.gov (United States)

    Barton, Keith C.; McCully, Alan W.

    2005-01-01

    This study reports results of an empirical investigation of secondary students' conceptions of history and identity in Northern Ireland. Interviews with 253 students from a variety of backgrounds indicate that they initially identify with a wide range of historical themes, but that these identifications narrow as they study the required national…

  8. The Predictive Degree of University Students' Levels of Metacognition and Need for Cognition on Their Academic Achievement

    Science.gov (United States)

    Akpur, Ugur

    2017-01-01

    The purpose of this study is to find out the predictive degree of university students' levels of need for cognition and metacognition on their academic achievement. A total of 253 university students formed the study group. To collect the data of the study, "The Metacognition Awareness Inventory" (MAI) and "The Need for Cognition…

  9. Tracking dinosaurs in Spain

    Directory of Open Access Journals (Sweden)

    Neil D.L. Clark

    2015-12-01

    Full Text Available Book review: Félix Pérez-Lorente 2015. Dinosaur Footprints and Trackways of La Rioja. 376 pp. Indiana University Press. Hardcover. ISBN: 978-0-253-01515-0. Price $85.00/£61.00; e-book $84.99.

  10. Synchrony in the life-history parameters of different seabirds ...

    African Journals Online (AJOL)

    spamer

    Calif. coop. ocean. Fish. Invest. 36: 72–77. BOERSMA, P. D. 1978 — Breeding patterns of Galapagos penguins as an indicator of oceanographic conditions. Science 200: 1489–1493. BOERSMA, P. D. 1998 — Population trends of the Galápagos penguin: impacts of El Niño and La Niña. Condor 100: 245–253. BROWN ...

  11. Factorial Structure of the New Ecological Paradigm Scale in Two French Samples

    Science.gov (United States)

    Fleury-Bahi, Ghozlane; Marcouyeux, Aurore; Renard, Elise; Roussiau, Nicolas

    2015-01-01

    The principal objective of this research is to test the factorial structure of the New Ecological Paradigm scale on a population of men and women residing in France. The tested model is a second-order factorial model. This factorial structure is evaluated on two separate samples to test the stability of the solution (a first sample of 253

  12. Optimization of special inductor for induction pre-heating

    Czech Academy of Sciences Publication Activity Database

    Pánek, D.; Kotlan, V.; Doležel, Ivo

    2014-01-01

    Roč. 2014, č. 12 (2014), s. 253-256 ISSN 0033-2097 R&D Projects: GA ČR(CZ) GAP102/11/0498 Grant - others:GA TA ČR(CZ) TA03010354 Institutional support: RVO:61388998 Keywords : induction heating * shape optimization * hard-coupled formulation Subject RIV: JA - Electronics ; Optoelectronics, Electrical Engineering

  13. Graphene–An Exciting Two-Dimensional Material for Science and ...

    Indian Academy of Sciences (India)

    Home; Journals; Resonance – Journal of Science Education; Volume 16; Issue 3. Graphene-An Exciting Two-Dimensional Material for Science and Technology. Mandar M Deshmukh Vibhor Singh. General Article Volume 16 Issue 3 March 2011 pp 238-253 ...

  14. 2238-IJBCS-Article-Akodogbo Hervé

    African Journals Online (AJOL)

    admin

    Mémoire de DEA. Université Nationale de Côte-d'Ivoire,. Côte-d'Ivoire, p. 55. Tavares LHS, Santeiro RM, Coelho RMP,. Braga FM. 2009. Effect of fertilization in water quality and in zooplankton community in open plankton-culture ponds. Bioscience Journal, 25(3): 172-. 180. Vanni MJ, Findlay DL. 1990. Trophic cascade.

  15. Ponded infiltration in a grid of permanent single-ring infiltrometers: Spatial versus temporal variability

    Czech Academy of Sciences Publication Activity Database

    Votrubová, J.; Dohnal, M.; Vogel, T.; Tesař, Miroslav; Jelínková, V.; Cislerova, M.

    2017-01-01

    Roč. 65, č. 3 (2017), s. 244-253 ISSN 0042-790X R&D Projects: GA ČR GA16-05665S Institutional support: RVO:67985874 Keywords : soil infiltrability * infiltration instability * infiltration modes * burrowing animals * preferential flow Subject RIV: DA - Hydrology ; Limnology OBOR OECD: Hydrology Impact factor: 1.654, year: 2016

  16. Low-Level Turbulence Forecasts From Fine-Scale Models

    Science.gov (United States)

    2014-02-01

    Obviously, it is the “big picture ” that influences the “small picture ” so additional development in model initialization and model physics will also serve...241–253. 15. Keller, J. L. Clear air turbulence as a response to meso- and synoptic -scale dynamic processes. Mon. Wea. Rev., 1990, 118, 2228–2242

  17. The Physician-Patient Relationship and its Association with Self-Efficacy in Female Patients Managing Chronic Diseases in Riyadh, Saudi Arabia

    DEFF Research Database (Denmark)

    Alghabiwi, Reem; Palianopoulou, Maria; Eklund Karlsson, Leena

    2018-01-01

    -efficacy in self-managing chronic disease in 253 female patients aged 18-55 years from six primary care clinics in Riyadh, Saudi Arabia. The data were collected using two standard questionnaires (PDRQ-9 and SEMCD) and analysis was performed using the Kruskal-Wallis test (SPSS Software). Our findings showed...

  18. Nuclear orientation of radioactive nuclei the spin program

    Czech Academy of Sciences Publication Activity Database

    Dupák, Jan; Finger, M.; Finger jr., M.; Janata, A.; Kracíková, T. I.; Lebedev, N. A.; Nováková, D.; Ota, J.; Rotter, M.; Slunečka, M.; Slunečková, V.; Virus, M.; Yushkevich, Y. V.

    2000-01-01

    Roč. 50, Supp. S1 (2000), s. 253-268 ISSN 0011-4626. [Symmetry and Spin. Praha, 05.09.1999-12.09.1999] R&D Projects: GA AV ČR KSK1067601 Institutional research plan: CEZ:AV0Z2065902 Subject RIV: JR - Other Machinery Impact factor: 0.298, year: 2000

  19. Substituted 2-hydroxy-N-(arylalkyl)benzamides induce apoptosis in cancer cell lines

    Czech Academy of Sciences Publication Activity Database

    Imramovský, A.; Jorda, Radek; Pauk, K.; Řezníčková, Eva; Dušek, J.; Hanousek, J.; Kryštof, Vladimír

    2013-01-01

    Roč. 68, č. 2013 (2013), s. 253-259 ISSN 0223-5234 R&D Projects: GA ČR GAP305/12/0783; GA ČR GA301/08/1649 Institutional research plan: CEZ:AV0Z50380511 Keywords : Diamides * Apoptosis * Cytotoxicity Subject RIV: CE - Biochemistry Impact factor: 3.432, year: 2013

  20. Three Isomers of Aryl-Substituted Twelve-Vertex Ferratricarbollides

    Czech Academy of Sciences Publication Activity Database

    Bakardjiev, Mario; Štíbr, Bohumil; Holub, Josef; Grüner, Bohumír; Padělková, Z.; Růžička, A.

    2013-01-01

    Roč. 32, č. 2 (2013), s. 377-379 ISSN 0276-7333 R&D Projects: GA ČR(CZ) GAP207/11/0705 Institutional support: RVO:61388980 Keywords : tricarbon carborane chemistry * structural characterizations * metallatricarbaborane complexes Subject RIV: CA - Inorganic Chemistry Impact factor: 4.253, year: 2013

  1. effects of some physico-chemical parameters on prevalence of ...

    African Journals Online (AJOL)

    Usman et al.

    /10.1016/S0140-6736(12)61728-0. Ndifon, G. T. and Ukoli F. M. (1989). Ecology of Fresh Water. Snails in South – Western Nigeria. Distribution and. Habitat Preferences. Hydrobiologia 171:231-253. Njoku-Tony, R.F. (2007) Ecological Studies ...

  2. Development of a Small-Scale, High Efficiency Bioremediation System for Removing Nitrate from Nursery Runoff Water

    Science.gov (United States)

    Nitrate concentrations in runoff water from the nursery ranged from 70 to 253 mg NO3-N/L. An estimated 62 to 67% of the nitrate applied during fertigation events left the production site in runoff water. Irrigation losses during these events accounted for 36 to 49% of the amount applied, with flow r...

  3. 41 CFR 101-25.302 - Office furniture, furnishings, and equipment.

    Science.gov (United States)

    2010-07-01

    ... 41 Public Contracts and Property Management 2 2010-07-01 2010-07-01 true Office furniture...-GENERAL 25.3-Use Standards § 101-25.302 Office furniture, furnishings, and equipment. (a) Each executive agency shall establish criteria for the use of office furniture, furnishings, and equipment. Such...

  4. 41 CFR 109-25.302 - Office furniture, furnishings, and equipment.

    Science.gov (United States)

    2010-07-01

    ... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false Office furniture... SUPPLY AND PROCUREMENT 25-GENERAL 25.3-Use Standards § 109-25.302 Office furniture, furnishings, and... contractors shall establish criteria for the use of office furniture, furnishings, and equipment. ...

  5. A Ligand-Bridged Heterotetranuclear (Fe2Cu2) Redox System with Fc/Fc(+) and Radical Ion Intermediates

    Czech Academy of Sciences Publication Activity Database

    Jana, R.; Lissner, F.; Schwederski, B.; Fiedler, Jan; Kaim, W.

    2013-01-01

    Roč. 32, č. 20 (2013), s. 5879-5886 ISSN 0276-7333 R&D Projects: GA ČR GA203/09/0705 Institutional support: RVO:61388955 Keywords : CHARGE-TRANSFER * COMPLEXES * ELECTRON Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 4.253, year: 2013

  6. Cerium(IV) phenylphosphonates and para-substituted phenylphosphonates: preparation and characterization.

    Czech Academy of Sciences Publication Activity Database

    Melánová, Klára; Beneš, L.; Svoboda, Jan; Zima, Vítězslav; Trchová, Miroslava; Vlček, Milan; Almanosy, N.

    2017-01-01

    Roč. 87, 3-4 (2017), s. 331-339 ISSN 0923-0750 R&D Projects: GA ČR(CZ) GA14-13368S Institutional support: RVO:61389013 Keywords : cerium (IV) phenylphosphonate * layered phosphonates * IR spectra Subject RIV: CA - Inorganic Chemistry OBOR OECD: Inorganic and nuclear chemistry Impact factor: 1.253, year: 2015

  7. Probing into the diversity of trypanosomatid flagellates parasitizing insect hosts in South-West China reveals both endemism and global dispersal

    Czech Academy of Sciences Publication Activity Database

    Votýpka, Jan; Maslov, D. A.; Yurchenko, V.; Jirků, Milan; Kment, P.; Lun, Z.-R.; Lukeš, Julius

    2010-01-01

    Roč. 54, č. 1 (2010), s. 243-253 ISSN 1055-7903 Institutional research plan: CEZ:AV0Z60220518 Keywords : trypanosomatids * phylogeny * diversity * insects Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 3.889, year: 2010

  8. Time Scales of the European Surface Air Temperature Variability: The Role of the 7-8 Year Cycle

    Czech Academy of Sciences Publication Activity Database

    Jajcay, Nikola; Hlinka, Jaroslav; Kravtsov, S.; Tsonis, A.A.; Paluš, Milan

    2016-01-01

    Roč. 43, č. 2 (2016), s. 902-909 ISSN 0094-8276 R&D Projects: GA MŠk LH14001 Institutional support: RVO:67985807 Keywords : 7-8 year cycle * air temperature variability * annual cycle amplitude * cross-scale interactions * seasonality * time scales Subject RIV: DG - Athmosphere Sciences, Meteorology Impact factor: 4.253, year: 2016

  9. Estimates of biological nitrogen fixation by Pterocarpus lucens in a ...

    African Journals Online (AJOL)

    TonukariJ

    2002-11-15

    Nov 15, 2002 ... Nitrogen fixation in Pterocarpus erinaceus and P. lucens using the. 15N labelling methods. Ar. Soil Res. Rehabil. 12:257-253. Unkovich MJ, Pate JS, Sanford P, Amstrong EL (1994). Potential precision of the 15N natural abundance method in field estimates of nitrogen fixation by crop and pasture legumes.

  10. Age-Related DNA Methylation Changes and Neoplastic Transformation of the Human Prostate

    Science.gov (United States)

    2011-07-01

    airways. Cell 1998 Jan 23;92(2):253-63. (3) Casci T, Vinos J, Freeman M. Sprouty, an intracellular inhibitor of Ras signaling. Cell 1999 Mar 5;96...63. 3. Casci T, Vinos J, Freeman M. Sprouty, an intracellular inhibitor of Ras signaling. Cell 1999; 96:655-65. 4. Kramer S, Okabe M, Hacohen N

  11. Associative Ionization of Excited Sodium Species with Various Ligands: Assessing Relative Bonding Strengths of Ion-ligand Interactions

    Czech Academy of Sciences Publication Activity Database

    Gilligan, J. J.; McCunn, L. R.; Leskiw, B. D.; Herman, Zdeněk; Castleman Jr., A. W.

    2001-01-01

    Roč. 204, 1/3 (2001), s. 247-253 ISSN 1387-3806 Institutional research plan: CEZ:AV0Z4040901 Keywords : associative ionization * cluster ions * sodium bonding energies Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 2.176, year: 2001

  12. Vapor Pressure of Selected Aliphatic Alcohols by Ebulliometry. Part 1

    Czech Academy of Sciences Publication Activity Database

    Čenský, M.; Roháč, V.; Růžička, K.; Fulem, M.; Aim, Karel

    2010-01-01

    Roč. 298, č. 2 (2010), s. 192-198 ISSN 0378-3812 R&D Projects: GA AV ČR IAA400720710 Institutional research plan: CEZ:AV0Z40720504 Keywords : vapor pressure * ebulliometry * aliphatic alcohols Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 2.253, year: 2010

  13. An overview of some recent results on the Euler system of isentropic gas dynamics

    Czech Academy of Sciences Publication Activity Database

    Chiodaroli, E.; Kreml, Ondřej

    2016-01-01

    Roč. 47, č. 1 (2016), s. 241-253 ISSN 1678-7544 Institutional support: RVO:67985840 Keywords : hyperbolic system s of conservation laws * Riemann problem * admissible solutions Subject RIV: BA - General Mathematics Impact factor: 0.400, year: 2016 http://link.springer.com/article/10.1007%2Fs00574-016-0135-0

  14. Avian basal metabolic rates : their association with body composition and energy expenditure in nature

    NARCIS (Netherlands)

    Daan, Serge; Masman, Dirkjan; Groenewold, Alex

    Measurements of basal metabolic rate (BMR), body water, fat, and lean dry mass of different organs were obtained in 22 bird species, ranging from 10.8 to 1,253 g body mass. Residuals of BMR (after subtracting BMR allometrically predicted from body mass) were positively correlated with residuals of

  15. Rate of erosion and exhumation of crystalline rocks in the Hunza Karakoram defined by apatite fission track analysis

    Czech Academy of Sciences Publication Activity Database

    Kořínková, Dagmar; Svojtka, Martin; Kalvoda, J.

    2014-01-01

    Roč. 11, č. 3 (2014), s. 235-253 ISSN 1214-9705 Institutional research plan: CEZ:AV0Z30130516 Institutional support: RVO:67985831 Keywords : apatite fission-track analysis * erosion * exhumation of rocks * Karakoram Subject RIV: DB - Geology ; Mineralogy Impact factor: 0.389, year: 2014

  16. Social aspects of conservation in the Eastern Arc Mountain forests ...

    African Journals Online (AJOL)

    Social aspects of conservation in the Eastern Arc Mountain forests. CSL Chachage. Abstract. Journal of East African Natural History Vol. 87 (1&2) 1998: 253-263. Full Text: EMAIL FULL TEXT EMAIL FULL TEXT · DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT.

  17. Phase morphology of PP/COC blends

    Czech Academy of Sciences Publication Activity Database

    Šlouf, Miroslav; Kolařík, Jan; Fambri, L.

    2003-01-01

    Roč. 91, č. 1 (2003), s. 253-259 ISSN 0021-8995 R&D Projects: GA ČR GP106/02/P029 Institutional research plan: CEZ:AV0Z4050913 Keywords : polypropylene * norbornene * polyolefin Subject RIV: CD - Macromolecular Chemistry Impact factor: 1.017, year: 2003

  18. El espíritu de Dostoyevski. [Reseña

    OpenAIRE

    García-Cuadrado, J.A. (José Ángel)

    2010-01-01

    Reseña de Nikolay BERDIAEV, El espíritu de Dostoyevski, traducción Olga Trankova Tabatadze; prólogo Artur Mrówczynski-Van Allen, Publicaciones del Centro Internacional para el Estudio del Oriente Cristiano, Granada: Editorial Nuevo Inicio, 2008, 253 pp., 15,5 x 21,5, ISBN 978-84-936102-1-0.

  19. Griechische Tragödie als Medium der Erfahrung

    Czech Academy of Sciences Publication Activity Database

    Kouba, Petr

    2013-01-01

    Roč. 22, 84-85 (2013), s. 235-253 ISSN 1318-3362 R&D Projects: GA ČR(CZ) GAP401/10/1164 Institutional support: RVO:67985955 Keywords : tragedy * destiny * exteriority * event Subject RIV: AA - Philosophy ; Religion

  20. Brno (k.ú. Bystrc, okr. Brno-město). Rokle. Neolit. Ojedinělý nález. Povrchový průzkum

    Czech Academy of Sciences Publication Activity Database

    Kirchner, Karel; Kuča, M.

    2009-01-01

    Roč. 50, 1-2 (2009), s. 253-254 ISSN 1211-7250 R&D Projects: GA ČR GA205/06/1024 Institutional research plan: CEZ:AV0Z30860518 Keywords : Brno Reservoir * neolithic * surface survey Subject RIV: AC - Archeology, Anthropology, Ethnology

  1. Download this PDF file

    African Journals Online (AJOL)

    Reprint Requests to: Dr. O.M. Oluwatosin, Division of Plastic Surgery, Department of. Surgery, University ... were popularized in Europe by Gilles3 and in the .... Plastic surgery of the face. London Oxford 1920. 4. Brown JB, Cannon B. Composite free grafts and cartilage from the ear. Surg Gynecol Obst 1946; 32: 253-255. 5.

  2. African Crop Science Journal - Vol 14, No 3 (2006)

    African Journals Online (AJOL)

    Short communication- Development of efficient solar heaters for storage insect pest management · EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. C Mekasha, O Dzolkifli, S Yusuf, M Rita, O Noorma, 253-261 ...

  3. Resonance – Journal of Science Education | Indian Academy of ...

    Indian Academy of Sciences (India)

    Home; Journals; Resonance – Journal of Science Education; Volume 13; Issue 3. Zoopharmacognosy - Self-Medication in Wild Animals. Rajasekar Raman Sripathi Kandula. General Article Volume 13 Issue 3 March 2008 pp 245-253. Fulltext. Click here to view fulltext PDF. Permanent link:

  4. Resonance – Journal of Science Education | Indian Academy of ...

    Indian Academy of Sciences (India)

    Home; Journals; Resonance – Journal of Science Education. Rajasekar Raman. Articles written in Resonance – Journal of Science Education. Volume 13 Issue 3 March 2008 pp 245-253 General Article. Zoopharmacognosy - Self-Medication in Wild Animals · Rajasekar Raman Sripathi Kandula · More Details Fulltext PDF ...

  5. Micro and nanohardness testing of laser welds

    Czech Academy of Sciences Publication Activity Database

    Šebestová, H.; Čtvrtlík, Radim; Chmelíčková, H.; Tomáštík, J.

    2014-01-01

    Roč. 15, č. 3 (2014), s. 247-253 ISSN 1454-9069 R&D Projects: GA TA ČR TA01010517 Institutional support: RVO:68378271 Keywords : Vickers microhardness * depth sensing indentation * laser welding Subject RIV: JP - Industrial Processing Impact factor: 1.658, year: 2014

  6. Mukhopadhyay, Prof. Dhrubajyoti

    Indian Academy of Sciences (India)

    Home; Fellowship. Fellow Profile. Elected: 1988 Section: Earth & Planetary Sciences. Mukhopadhyay, Prof. Dhrubajyoti Ph.D. (London), FNA, FNASc. Date of birth: 19 September 1938. Specialization: Structural Geology, Precambrian Geology Address: G-7, MIG Housing Colony, 25/3, Raja Manindra Road, Kolkata 700 037, ...

  7. Bacterial response to nanodiamonds and graphene oxide sheets

    Czech Academy of Sciences Publication Activity Database

    Kromka, Alexander; Jíra, Jaroslav; Štenclová, Pavla; Kříha, V.; Kozak, Halyna; Beranová, J.; Vretenár, V.; Skakalova, V.; Rezek, Bohuslav

    2016-01-01

    Roč. 253, č. 12 (2016), 2481-2485 ISSN 0370-1972 R&D Projects: GA MŠk LM2015087; GA ČR GA15-01687S Institutional support: RVO:68378271 Keywords : diamond nanoparticles * graphene oxide * antibacterial properties * Escherichia coli Subject RIV: EE - Microbiology, Virology Impact factor: 1.674, year: 2016

  8. 78 FR 66056 - Sunkhaze Meadows National Wildlife Refuge and Carlton Pond Waterfowl Production Area, Penobscot...

    Science.gov (United States)

    2013-11-04

    ... McLaughlin, Planning Team Leader, 413-253-8575 (phone); [email protected] (email). SUPPLEMENTARY... alternatives B and C. These include establishing climate change monitoring, expanding partnerships, and... alternative A, this alternative includes more inventory and monitoring, as well as research and active...

  9. Use of [SbF.sub.6./sub.] .sup.-./sup. to isolate cationic copper and silver adducts with more than one ethylene on the metal center

    Czech Academy of Sciences Publication Activity Database

    Fianchini, M.; Campana, C.F.; Chilukuri, B.; Cundari, T.R.; Petříček, Václav; Dias, H.V.

    2013-01-01

    Roč. 32, č. 10 (2013), s. 3034-3041 ISSN 0276-7333 Institutional support: RVO:68378271 Keywords : organometallic compounds * X-ray structure analysis Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 4.253, year: 2013

  10. 4. Managing Children with Spina Bifida in sub-Saharan Africa

    African Journals Online (AJOL)

    Esem

    ABSTRACT. Purpose:To investigate the management of children with SB and outcome measures used in Zambia. Methods: A retrospective cross-sectional study was done. Between 2001 and 2010, a total number of 253 children with SB who were managed at both the. University Teaching Hospital (UTH) and Beit Cure.

  11. Fragmentation model of meteoroid motion, mass loss, and radiation in the atmosphere

    Czech Academy of Sciences Publication Activity Database

    Ceplecha, Zdeněk; ReVelle, D.O.

    2005-01-01

    Roč. 40, č. 1 (2005), s. 35-54 ISSN 1086-9379 Institutional research plan: CEZ:AV0Z10030501 Keywords : luminous efficiency * innisfree meteorite Subject RIV: BN - Astronomy, Celestial Mechanics, Astrophysics Impact factor: 2.253, year: 2005

  12. Quantum coherent control of the vibrational dynamics of a ...

    Indian Academy of Sciences (India)

    2014-02-12

    Feb 12, 2014 ... Home; Journals; Pramana – Journal of Physics; Volume 82; Issue 2. Quantum coherent ... H J Strydom. Contributed Papers Volume 82 Issue 2 February 2014 pp 249-253 ... A second laser would then allow for mode selective chemistry to interact selectively with the excited population. Alternatively the ...

  13. Biohydrology research after Landau 2013 conference

    Czech Academy of Sciences Publication Activity Database

    Lichner, Ľ.; Cerdà, A.; Rajkai, K.; Tesař, Miroslav

    Roč. 62, č. 4 ( 2014 ), s. 253-257 ISSN 0042-790X Institutional support: RVO:67985874 Keywords : biohydrology * hydrological research * biological and hydrological systems * hydrological processes Subject RIV: DA - Hydrology ; Limnology Impact factor: 1.486, year: 2014

  14. Fabrication and Characterization of Novel Refractory Coatings Using Combinatorial Nanocalorimetry

    Science.gov (United States)

    2015-07-21

    term in Eq. (A2), is automatically eliminated, although some care needs to be exercised if the solid-state reaction changes the emissivity of the CV...in Key Engineering Materials. 253-255 (Trans Tech Publ). 55 Pastor , H. in Boron and Refractory Borides (ed VladoI Matkovich) Ch. 25, 457- 493

  15. Journal of Biosciences | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    Home; Journals; Journal of Biosciences. J P Bhatt. Articles written in Journal of Biosciences. Volume 26 Issue 2 June 2001 pp 253-263 Articles. Ovarian steroid sulphate functions as priming pheromone in male Barilius bendelisis (Ham.) J P Bhatt M S Sajwan · More Details Abstract Fulltext PDF. The study reveals that ...

  16. 42 CFR 447.255 - Related information.

    Science.gov (United States)

    2010-10-01

    ... 42 Public Health 4 2010-10-01 2010-10-01 false Related information. 447.255 Section 447.255 Public... Facility Services Payment Rates § 447.255 Related information. The Medicaid agency must submit, with the assurances described in § 447.253(a), the following information: (a) The amount of the estimated average...

  17. A mitleidsethik e os animais ou schopenhauer como precursos da ética animal

    Directory of Open Access Journals (Sweden)

    Jair Barboza

    2010-12-01

    Full Text Available http://dx.doi.org/10.5007/1677-2954.2008v7n2p253Este artifo tem por objetivo mostrar que Schopenhauer, mediante sua Mitleidsethik (ética da compaixão, baseada numa metafísica da Vontade de vida, pode ser visto como um precursor da ética animal.

  18. A novel sheet topology in the structure of kamitugaite, PbAl[(UO.sub.2./sub.).sub.5./sub.(PO.sub.4./sub.).sub.2.38./sub.(AsO.sub.4./sub.).sub.0.62./sub.O.sub.2./sub.(OH).sub.2./sub.](H.sub.2./sub.O).sub.11.5./sub.

    Czech Academy of Sciences Publication Activity Database

    Plášil, Jakub

    2017-01-01

    Roč. 62, č. 4 (2017), s. 253-260 ISSN 1802-6222 R&D Projects: GA ČR GA17-09161S Institutional support: RVO:68378271 Keywords : kamitugaite * uranyl phosphate * crystal structure * topology Subject RIV: DB - Geology ; Mineralogy OBOR OECD: Geology Impact factor: 0.609, year: 2016

  19. Sexuality Education Beliefs among Sexually Experienced Youth: Differences by Gender and Birth Control Use

    Science.gov (United States)

    Tolma, Eleni L.; Vesely, Sara K.; Oman, Roy F.; Aspy, Cheryl B.; Rodine, Sharon

    2006-01-01

    Purpose: To examine whether gender and birth control use are associated with premarital sexual attitudes, beliefs about peers, family communication about sexual relationships, and sexuality education among sexually experienced youth. Methods: Data were collected from a randomly selected ethnically diverse youth sample (N = 1,253). Only the…

  20. Journal of Astrophysics and Astronomy | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    2016-01-27

    Jan 27, 2016 ... pp 253-256 Part II: Blazar Observations in Infrared and Optical. Error Analysis of Ia Supernova and Query on Cosmic Dark Energy · Qiuhe Peng Yiming Hu Kun Wang Yu Liang Jie Zha Zhi-qian Luo · More Details Abstract Fulltext PDF. Some serious faults in error analysis of observations for SNIa have been ...