WorldWideScience

Sample records for mendelevium 251

  1. Symposium commemorating the 25th anniversary of the discovery of mendelevium

    Energy Technology Data Exchange (ETDEWEB)

    Seaborg, G.T. (ed.)

    1980-01-01

    The Symposium honoring the 25th Anniversary of the discovery of mendelevium was held at the Lawrence Berkeley Laboratory on March 28, 1980. The following three papers were presented: Chemical Properties of Mendelevium; Nuclear Properties of Mendelevium; and Radioactive Decay of Md Isotopes. Besides these papers there were introductory remarks, reminiscences, and concluding remarks.

  2. Studies on some physico-chemical properties of the monovalent mendelevium

    International Nuclear Information System (INIS)

    Kamenskaya, A.N.; Mikheev, N.B.; Novichenko, V.L.

    1979-01-01

    It was established that Md 3+ reduced by Yb 2+ or Eu 2+ co-crystallizes with NaCl in water-ethanol solutions. The co-crystallization coefficient is independent of the relative quantities of the solid and liquid phase, of the concentration of the reducing agent in the concentration range from 1 to 8 mg/ml, and of the concentration of the chloride ion in the solution. Basing on the knowledge of anomalous mixed crystals and on the thermodynamical analysis of the formation of truly isomorphical solid solutions and anomalous mixed crystals, it was shown that mendelevium co-crystallizing with NaCl is in its monovalent state. Besides, it was concluded that up to 1.5 M chloride concentration the monovalent mendelevium does not form stable chloride complexes in water-ethanol solutions. (author)

  3. Chemical properties of mendelevium

    Energy Technology Data Exchange (ETDEWEB)

    Hulet, E.K.

    1980-11-01

    Even with the most intense ion beams and the largest available quantities of target isotope, about 10/sup 6/ atoms at a time is all the Md that can be produced for chemical studies. This lack of sufficient sample size coupled with the very short lifetimes of the few atoms produced has severely restricted the gathering and the broadness of our knowledge concerning the properties of Md and the heavier elements. To illustrate, the literature contains a mere eleven references to the chemical studies of Md, and none of these deal with bulk properties associated with the element bound in solid phases. Some of these findings are: Md was found to be more volatile than other actinide metals which lead to the belief that it is divalent in the metallic state; separation of Md from the other actinides can be accomplished either by reduction of Md/sup 3 +/ to the divalent state or by chromatographic separations with Md remaining in the tripositive state; extraction of Md/sup 2 +/ with bis(2-ethylhexyl)phosphoric acid is much poorer than the extraction of the neighboring tripositive actinides; attempts to oxidize Md/sup 3 +/ with sodium bismuthate failed to show any evidence for Md/sup 4 +/; reduction potential of Md/sup 3 +/ was found to be close to -0.1 volt; Md/sup 3 +/ can be reduced to Md(Hg) by sodium amalgams and by electrolysis; the electrochemical behavior of Md is very similar to that of Fm and can be summarized in the equation, Md/sup 2 +/ + 2e/sup -/ = Md(Hg) and E/sup 0/ = -1.50 V.; and Md cannot be reduced to a monovalent ion with Sm/sup 2 +/.

  4. Chemical properties of mendelevium

    International Nuclear Information System (INIS)

    Hulet, E.K.

    1980-01-01

    The isotope 256 Md is nearly always employed for chemical studies of this element. This nuclide can be made by bombardment of fractions of a microgram of 254 Es with intense alpha-particle beams which will produce about 10 6 atoms of 256 Md with a half-life of 77 minutes. Even with the most intense ion beams and the largest available quantities of target isotope, about 10 6 atoms at a time is all the Md that can be produced for chemical studies. This lack of sufficient sample size coupled with the very short lifetimes of the few atoms produced has severly restricted the gathering and broadening of our knowledge concerning the properties of Md and the heavier elements. To illustrate, the literature contains a mere eleven references to the chemical studies of Md, and none of these deal with bulk properties associated with element found in solid phases. Some of these findings are: Md was found to be more volatile than other actinide metals which lead to the belief that it is divalent in the metallic state; separation of Md from the other actinides can be accomplished either by reduction of Md to the divalent state or by chromatographic separations with Md remaining in the tripositive state; extraction of Md with bis(2-ethylhexyl)phosphoric acid is much poorer than the extraction of the neighboring tripositive actinides; attempts to oxidize Md wih sodium bismuthate failed to show any evidence of Md 4+ ; standard reduction potential of Md 3+ was found to be close to -0.1 volt; Md 3+ can be reduced to Md(Hg) by sodium amalgams and by electrolysis; the electrochemical behavior of Md is very similar to that of Fm and can be summarized in the equation, Md 2+ + 2e - = Md(Hg), and E 0 = 1.5 V

  5. Chemical properties of mendelevium

    International Nuclear Information System (INIS)

    Hulet, E.K.

    1980-11-01

    Even with the most intense ion beams and the largest available quantities of target isotope, about 10 6 atoms at a time is all the Md that can be produced for chemical studies. This lack of sufficient sample size coupled with the very short lifetimes of the few atoms produced has severely restricted the gathering and the broadness of our knowledge concerning the properties of Md and the heavier elements. To illustrate, the literature contains a mere eleven references to the chemical studies of Md, and none of these deal with bulk properties associated with the element bound in solid phases. Some of these findings are: Md was found to be more volatile than other actinide metals which lead to the belief that it is divalent in the metallic state; separation of Md from the other actinides can be accomplished either by reduction of Md 3+ to the divalent state or by chromatographic separations with Md remaining in the tripositive state; extraction of Md 2+ with bis(2-ethylhexyl)phosphoric acid is much poorer than the extraction of the neighboring tripositive actinides; attempts to oxidize Md 3+ with sodium bismuthate failed to show any evidence for Md 4+ ; reduction potential of Md 3+ was found to be close to -0.1 volt; Md 3+ can be reduced to Md(Hg) by sodium amalgams and by electrolysis; the electrochemical behavior of Md is very similar to that of Fm and can be summarized in the equation, Md 2+ + 2e - = Md(Hg) and E 0 = -1.50 V.; and Md cannot be reduced to a monovalent ion with Sm 2+

  6. Optical simulations for the S3 project - Super separator spectrometer - gamma-electron coincidence spectroscopy of a transfermium nucleus: the 251Md101

    International Nuclear Information System (INIS)

    Dechery, Fabien

    2012-01-01

    In analogy with the atomic closed shells giving rise to the stability and high ionisation energies of noble gases, nuclear physics also has its magic numbers of protons and neutrons which enhance nuclear structure stability. Knowledge of the structure of doubly-magic nuclei, both proton and neutron numbers, is crucial to parameterize theoretical models. The discovery of the next and ultimate magic numbers will provide a strong constraint on the many predictions. These two numbers are like the centre coordinates of an area of enhanced stability of the nuclear chart, well known as 'island of stability'. These superheavy nuclei only exist due to pure quantum shell effects. My thesis work deals with two distinct, but complementary, aspects of fundamental physics with the common goal of studying these extreme mass nuclei structure. The first part corresponds to the development of a next generation instrument for nuclear physics to allow synthesis and spectroscopy studies of superheavy nuclei: the Super Separator Spectrometer S 3 . This project will be installed at SPIRAL2 (GANIL) and has been approved by the French Research National Agency (ANR) within the EQUIPEX framework. It has been designed to take advantage of the high intensity heavy ion beam from the LINAC, giving access to a wide range of physical programs. The second part corresponds to the preparation, realisation and analysis of an experiment on 251-Mendelevium in which the very first prompt gamma-electron coincidence spectroscopy was performed for a transfermium nuclei. (author) [fr

  7. 14 CFR 29.251 - Vibration.

    Science.gov (United States)

    2010-01-01

    ... 14 Aeronautics and Space 1 2010-01-01 2010-01-01 false Vibration. 29.251 Section 29.251... STANDARDS: TRANSPORT CATEGORY ROTORCRAFT Flight Miscellaneous Flight Requirements § 29.251 Vibration. Each part of the rotorcraft must be free from excessive vibration under each appropriate speed and power...

  8. 14 CFR 27.251 - Vibration.

    Science.gov (United States)

    2010-01-01

    ... 14 Aeronautics and Space 1 2010-01-01 2010-01-01 false Vibration. 27.251 Section 27.251... STANDARDS: NORMAL CATEGORY ROTORCRAFT Flight Miscellaneous Flight Requirements § 27.251 Vibration. Each part of the rotorcraft must be free from excessive vibration under each appropriate speed and power...

  9. 49 CFR 234.251 - Standby power.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 4 2010-10-01 2010-10-01 false Standby power. 234.251 Section 234.251 Transportation Other Regulations Relating to Transportation (Continued) FEDERAL RAILROAD ADMINISTRATION..., Inspection, and Testing Inspections and Tests § 234.251 Standby power. Standby power shall be tested at least...

  10. 37 CFR 2.51 - Drawing required.

    Science.gov (United States)

    2010-07-01

    ... 37 Patents, Trademarks, and Copyrights 1 2010-07-01 2010-07-01 false Drawing required. 2.51... COMMERCE RULES OF PRACTICE IN TRADEMARK CASES Drawing § 2.51 Drawing required. (a) In an application under section 1(a) of the Act, the drawing of the mark must be a substantially exact representation of the mark...

  11. 24 CFR 203.251 - Definitions.

    Science.gov (United States)

    2010-04-01

    ... reasonable consideration of risk and credit worthiness. Direct Endorsement mortgagees using TOTAL remain... 24 Housing and Urban Development 2 2010-04-01 2010-04-01 false Definitions. 203.251 Section 203.251 Housing and Urban Development Regulations Relating to Housing and Urban Development (Continued...

  12. 36 CFR 251.51 - Definitions.

    Science.gov (United States)

    2010-07-01

    ... 36 Parks, Forests, and Public Property 2 2010-07-01 2010-07-01 false Definitions. 251.51 Section... Uses § 251.51 Definitions. Applicant—any individual or entity that applies for a special use... creation of a product for sale, or the use of models, actors, sets, or props, but not including activities...

  13. 36 CFR 251.121 - Definitions.

    Science.gov (United States)

    2010-07-01

    ... 36 Parks, Forests, and Public Property 2 2010-07-01 2010-07-01 false Definitions. 251.121 Section... Revenue-Producing Visitor Services in Alaska § 251.121 Definitions. In addition to the definitions in..., have the intention of returning to it. (2) For corporations, partnerships, limited partnerships, joint...

  14. 7 CFR 251.6 - Distribution plan.

    Science.gov (United States)

    2010-01-01

    ... Regulations of the Department of Agriculture (Continued) FOOD AND NUTRITION SERVICE, DEPARTMENT OF AGRICULTURE GENERAL REGULATIONS AND POLICIES-FOOD DISTRIBUTION THE EMERGENCY FOOD ASSISTANCE PROGRAM § 251.6..., 2009, § 251.6 was amended by revising paragraph (b), effective March 1, 2010. For the convenience of...

  15. 7 CFR 251.2 - Administration.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 4 2010-01-01 2010-01-01 false Administration. 251.2 Section 251.2 Agriculture... Administration. (a) Food and Nutrition Service. Within the United States Department of Agriculture (the... this section, any information on changes in program administration, including any changes resulting...

  16. 50 CFR 665.251 - Closed areas.

    Science.gov (United States)

    2010-10-01

    ..., DEPARTMENT OF COMMERCE (CONTINUED) FISHERIES IN THE WESTERN PACIFIC Hawaii Fisheries § 665.251 Closed areas. All lobster fishing is prohibited: (a) Within 20 nm of Laysan Island. (b) Within the EEZ landward of...

  17. 47 CFR 0.251 - Authority delegated.

    Science.gov (United States)

    2010-10-01

    ... investigations or audits. (g) The General Counsel is delegated authority to issue rulings on whether violations... § 0.251, see the List of CFR Sections Affected, which appears in the Finding Aids section of the...

  18. 42 CFR 441.251 - Definitions.

    Science.gov (United States)

    2010-10-01

    ....251 Definitions. As used in this subpart: Hysterectomy means a medical procedure or operation for the... confined or detained, under a civil or criminal statute, in a correctional or rehabilitative facility... incompetent by a Federal, State, or local court of competent jurisdiction for any purpose, unless the...

  19. 30 CFR 206.251 - Definitions.

    Science.gov (United States)

    2010-07-01

    ... applied to coal, also includes but is not limited to reimbursements for royalties, taxes or fees, and... VALUATION Federal Coal § 206.251 Definitions. Ad valorem lease means a lease where the royalty due to the lessor is based upon a percentage of the amount or value of the coal. Allowance means a deduction used in...

  20. 27 CFR 25.251 - Authorized removals.

    Science.gov (United States)

    2010-04-01

    ..., DEPARTMENT OF THE TREASURY LIQUORS BEER Removal of Brewer's Yeast and Other Articles § 25.251 Authorized... Brewing Chemists), from the brewery in barrels, tank trucks, in other suitable containers, or by pipeline. (b) Containers. Containers will bear a label giving the name and location of the brewery and...

  1. 36 CFR 251.97 - Oral presentation.

    Science.gov (United States)

    2010-07-01

    ... presentations may be open to public attendance, but participation is limited to parties to the appeal. The... 36 Parks, Forests, and Public Property 2 2010-07-01 2010-07-01 false Oral presentation. 251.97... presentation. (a) Purpose. An oral presentation provides an additional opportunity for an appellant, and other...

  2. 7 CFR 251.3 - Definitions.

    Science.gov (United States)

    2010-01-01

    ... Regulations of the Department of Agriculture (Continued) FOOD AND NUTRITION SERVICE, DEPARTMENT OF AGRICULTURE GENERAL REGULATIONS AND POLICIES-FOOD DISTRIBUTION THE EMERGENCY FOOD ASSISTANCE PROGRAM § 251.3... kitchens); (ii) Charitable institutions (including hospitals and retirement homes); (iii) Summer camps for...

  3. 29 CFR 1910.251 - Definitions.

    Science.gov (United States)

    2010-07-01

    ... Relating to Labor (Continued) OCCUPATIONAL SAFETY AND HEALTH ADMINISTRATION, DEPARTMENT OF LABOR OCCUPATIONAL SAFETY AND HEALTH STANDARDS Welding, Cutting and Brazing § 1910.251 Definitions. As used in this subpart: (a) Welder and welding operator mean any operator of electric or gas welding and cutting...

  4. 27 CFR 25.1 - Production and removal of beer.

    Science.gov (United States)

    2010-04-01

    ... beer. 25.1 Section 25.1 Alcohol, Tobacco Products and Firearms ALCOHOL AND TOBACCO TAX AND TRADE BUREAU, DEPARTMENT OF THE TREASURY LIQUORS BEER Scope of Regulations § 25.1 Production and removal of beer. The regulations in this part relate to beer and cereal beverages and cover the location, construction, equipment...

  5. 37 CFR 251.23 - FOIA and Privacy Act.

    Science.gov (United States)

    2010-07-01

    ... 37 Patents, Trademarks, and Copyrights 1 2010-07-01 2010-07-01 false FOIA and Privacy Act. 251.23 Section 251.23 Patents, Trademarks, and Copyrights COPYRIGHT OFFICE, LIBRARY OF CONGRESS COPYRIGHT... Access to and Inspection of Records § 251.23 FOIA and Privacy Act. Freedom of Information Act and Privacy...

  6. 7 CFR 251.1 - General purpose and scope.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 4 2010-01-01 2010-01-01 false General purpose and scope. 251.1 Section 251.1... AGRICULTURE GENERAL REGULATIONS AND POLICIES-FOOD DISTRIBUTION THE EMERGENCY FOOD ASSISTANCE PROGRAM § 251.1 General purpose and scope. This part announces the policies and prescribes the regulations necessary to...

  7. 34 CFR 75.251 - The budget period.

    Science.gov (United States)

    2010-07-01

    ... 34 Education 1 2010-07-01 2010-07-01 false The budget period. 75.251 Section 75.251 Education... Multi-Year Projects § 75.251 The budget period. (a) The Secretary usually approves a budget period of... budget period; and (2) Indicates his or her intention to make contination awards to fund the remainder of...

  8. 38 CFR 17.251 - The Subcommittee on Academic Affairs.

    Science.gov (United States)

    2010-07-01

    ... Academic Affairs. 17.251 Section 17.251 Pensions, Bonuses, and Veterans' Relief DEPARTMENT OF VETERANS AFFAIRS MEDICAL Grants for Exchange of Information § 17.251 The Subcommittee on Academic Affairs. There is... Subcommittee on Academic Affairs, and the Subcommittee shall advise the Secretary, through the Under Secretary...

  9. 36 CFR 251.52 - Delegation of authority.

    Science.gov (United States)

    2010-07-01

    ... 36 Parks, Forests, and Public Property 2 2010-07-01 2010-07-01 false Delegation of authority. 251.52 Section 251.52 Parks, Forests, and Public Property FOREST SERVICE, DEPARTMENT OF AGRICULTURE LAND USES Special Uses § 251.52 Delegation of authority. Special use authorizations shall be issued, granted, amended, renewed, suspended, terminated, or...

  10. 48 CFR 952.251-70 - Contractor employee travel discounts.

    Science.gov (United States)

    2010-10-01

    ... discounts. 952.251-70 Section 952.251-70 Federal Acquisition Regulations System DEPARTMENT OF ENERGY CLAUSES... Contractor employee travel discounts. As prescribed in 951.7002, insert the following clause: Contractor Employee Travel Discounts (AUG 2009) (a) The Contractor shall take advantage of travel discounts offered to...

  11. 5 CFR 251.302 - All other organizations.

    Science.gov (United States)

    2010-01-01

    ... 5 Administrative Personnel 1 2010-01-01 2010-01-01 false All other organizations. 251.302 Section... RELATIONSHIPS WITH ORGANIZATIONS REPRESENTING FEDERAL EMPLOYEES AND OTHER ORGANIZATIONS Dues Withholding § 251.302 All other organizations. Under 5 CFR 550.311(b), an agency may permit an employee to make an...

  12. 14 CFR 23.251 - Vibration and buffeting.

    Science.gov (United States)

    2010-01-01

    ... 14 Aeronautics and Space 1 2010-01-01 2010-01-01 false Vibration and buffeting. 23.251 Section 23... Requirements § 23.251 Vibration and buffeting. There must be no vibration or buffeting severe enough to result in structural damage, and each part of the airplane must be free from excessive vibration, under any...

  13. 40 CFR 265.251 - Protection from wind.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 25 2010-07-01 2010-07-01 false Protection from wind. 265.251 Section... FACILITIES Waste Piles § 265.251 Protection from wind. The owner or operator of a pile containing hazardous waste which could be subject to dispersal by wind must cover or otherwise manage the pile so that wind...

  14. 7 CFR 251.4 - Availability of commodities.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 4 2010-01-01 2010-01-01 false Availability of commodities. 251.4 Section 251.4... Availability of commodities. (a) General. The Department shall make commodities available for distribution and... receiving commodities under this part shall not diminish their normal expenditures for food because of...

  15. Protein engineering of cyclodextrin glycosyltransferase from Bacillus circulans strain 251

    NARCIS (Netherlands)

    Penninga, Dirk

    1996-01-01

    An enormous diversity of molecular functions in living organisms is carried out by proteins. Our studies have focussed on the functional analysis of a starch-converting enzyme, cyclodextrin glycosyltransferase (CGTase) from Bacillus circulans strain 251. Zie: Summary

  16. 48 CFR 2452.251-70 - Contractor employee travel.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 6 2010-10-01 2010-10-01 true Contractor employee travel... 2452.251-70 Contractor employee travel. As prescribed in 2451.7001, insert the following clause in all cost-reimbursement solicitations and contracts involving travel: Contractor Employee Travel (OCT 1999...

  17. 14 CFR 25.251 - Vibration and buffeting.

    Science.gov (United States)

    2010-01-01

    ... 14 Aeronautics and Space 1 2010-01-01 2010-01-01 false Vibration and buffeting. 25.251 Section 25... Vibration and buffeting. (a) The airplane must be demonstrated in flight to be free from any vibration and... airplane must be demonstrated in flight to be free from excessive vibration under any appropriate speed and...

  18. 36 CFR 251.93 - Resolution of issues.

    Science.gov (United States)

    2010-07-01

    ... 36 Parks, Forests, and Public Property 2 2010-07-01 2010-07-01 false Resolution of issues. 251.93... issues. (a) Authorized Forest Service officers shall, to the extent practicable and consistent with the... meetings is to discuss any issues or concerns related to the authorized use and to reach a common...

  19. Phenotype abnormality: 251 [Arabidopsis Phenome Database[Archive

    Lifescience Database Archive (English)

    Full Text Available lant flowering stage in environment of long day length regimen in environment of long day length regimen htt... 251 http://metadb.riken.jp/db/SciNetS_ria224i/cria224u1ria224u757i delayed whole p

  20. 36 CFR 251.56 - Terms and conditions.

    Science.gov (United States)

    2010-07-01

    ... subject to State regulatory or conservation laws governing its purchase by pipeline companies is offered... standards established by or pursuant to applicable Federal or State law; and (D) Require compliance with... making explicit its preexisting understanding of § 251.56(a)(1)(ii)(G) of this subpart in the context of...

  1. 28 CFR 25.1 - Purpose and authority.

    Science.gov (United States)

    2010-07-01

    ... Instant Criminal Background Check System § 25.1 Purpose and authority. The purpose of this subpart is to... Instant Criminal Background Check System (NICS) to be contacted by any licensed importer, licensed... procedures for persons who have been denied the right to obtain a firearm as a result of a NICS background...

  2. 36 CFR 251.9 - Management of Municipal Watersheds.

    Science.gov (United States)

    2010-07-01

    ... LAND USES Miscellaneous Land Uses Natural Resources Control § 251.9 Management of Municipal Watersheds... forth in subpart B of this part. (e) Any municipal watershed management agreements, special use... 36 Parks, Forests, and Public Property 2 2010-07-01 2010-07-01 false Management of Municipal...

  3. 27 CFR 28.251 - Railway express receipts.

    Science.gov (United States)

    2010-04-01

    ... 27 Alcohol, Tobacco Products and Firearms 1 2010-04-01 2010-04-01 false Railway express receipts... § 28.251 Railway express receipts. Where the exportation is to a contiguous foreign country and the shipment is by railway express, a receipt issued by the railway express agency may be accepted in lieu of...

  4. 43 CFR 17.251 - Drug and alcohol addicts.

    Science.gov (United States)

    2010-10-01

    ... 43 Public Lands: Interior 1 2010-10-01 2010-10-01 false Drug and alcohol addicts. 17.251 Section... Drug and alcohol addicts. A recipient that operates a general hospital or outpatient facility may not discriminate in admission or treatment against a drug or alcohol abuser or addict who is suffering from a...

  5. 37 CFR 251.54 - Assessment of costs of arbitration panels.

    Science.gov (United States)

    2010-07-01

    ... arbitration panels. 251.54 Section 251.54 Patents, Trademarks, and Copyrights COPYRIGHT OFFICE, LIBRARY OF CONGRESS COPYRIGHT ARBITRATION ROYALTY PANEL RULES AND PROCEDURES COPYRIGHT ARBITRATION ROYALTY PANEL RULES OF PROCEDURE Procedures of Copyright Arbitration Royalty Panels § 251.54 Assessment of costs of...

  6. 37 CFR 251.2 - Purpose of Copyright Arbitration Royalty Panels.

    Science.gov (United States)

    2010-07-01

    ... Arbitration Royalty Panels. 251.2 Section 251.2 Patents, Trademarks, and Copyrights COPYRIGHT OFFICE, LIBRARY OF CONGRESS COPYRIGHT ARBITRATION ROYALTY PANEL RULES AND PROCEDURES COPYRIGHT ARBITRATION ROYALTY PANEL RULES OF PROCEDURE Organization § 251.2 Purpose of Copyright Arbitration Royalty Panels. The...

  7. 37 CFR 251.64 - Disposition of petition; initiation of arbitration proceeding.

    Science.gov (United States)

    2010-07-01

    ...; initiation of arbitration proceeding. 251.64 Section 251.64 Patents, Trademarks, and Copyrights COPYRIGHT OFFICE, LIBRARY OF CONGRESS COPYRIGHT ARBITRATION ROYALTY PANEL RULES AND PROCEDURES COPYRIGHT ARBITRATION ROYALTY PANEL RULES OF PROCEDURE Rate Adjustment Proceedings § 251.64 Disposition of petition...

  8. 37 CFR 251.6 - Composition and selection of Copyright Arbitration Royalty Panels.

    Science.gov (United States)

    2010-07-01

    ... Copyright Arbitration Royalty Panels. 251.6 Section 251.6 Patents, Trademarks, and Copyrights COPYRIGHT OFFICE, LIBRARY OF CONGRESS COPYRIGHT ARBITRATION ROYALTY PANEL RULES AND PROCEDURES COPYRIGHT ARBITRATION ROYALTY PANEL RULES OF PROCEDURE Organization § 251.6 Composition and selection of Copyright...

  9. 37 CFR 251.7 - Actions of Copyright Arbitration Royalty Panels.

    Science.gov (United States)

    2010-07-01

    ... Arbitration Royalty Panels. 251.7 Section 251.7 Patents, Trademarks, and Copyrights COPYRIGHT OFFICE, LIBRARY OF CONGRESS COPYRIGHT ARBITRATION ROYALTY PANEL RULES AND PROCEDURES COPYRIGHT ARBITRATION ROYALTY PANEL RULES OF PROCEDURE Organization § 251.7 Actions of Copyright Arbitration Royalty Panels. Any...

  10. 37 CFR 251.72 - Declaration of controversy: Initiation of arbitration proceeding.

    Science.gov (United States)

    2010-07-01

    ...: Initiation of arbitration proceeding. 251.72 Section 251.72 Patents, Trademarks, and Copyrights COPYRIGHT OFFICE, LIBRARY OF CONGRESS COPYRIGHT ARBITRATION ROYALTY PANEL RULES AND PROCEDURES COPYRIGHT ARBITRATION ROYALTY PANEL RULES OF PROCEDURE Royalty Fee Distribution Proceedings § 251.72 Declaration of...

  11. Impact of pEGFP mediated ING4 gene on growth of glioma U251 ...

    African Journals Online (AJOL)

    To investigate the impact of the inhibitor of growth family 4 (ING4) on growth of glioma cells (U251 cells) and its potential molecular mechanism, total RNA was extracted from the embryonic tissues and ING4 was amplified by RT-PCR and cloned into pEGFP-C2 vector. U251 cells were transfected with eukaryotic expression ...

  12. 7 CFR 2.51 - Deputy Under Secretary for Food Safety.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 1 2010-01-01 2010-01-01 false Deputy Under Secretary for Food Safety. 2.51 Section 2... Safety § 2.51 Deputy Under Secretary for Food Safety. Pursuant to § 2.18, and subject to policy guidance... Secretary for Food Safety to the Deputy Under Secretary for Food Safety, to be exercised only during the...

  13. 37 CFR 251.36 - Pre-arbitration and post-arbitration employment restrictions.

    Science.gov (United States)

    2010-07-01

    ... 37 Patents, Trademarks, and Copyrights 1 2010-07-01 2010-07-01 false Pre-arbitration and post-arbitration employment restrictions. 251.36 Section 251.36 Patents, Trademarks, and Copyrights COPYRIGHT OFFICE, LIBRARY OF CONGRESS COPYRIGHT ARBITRATION ROYALTY PANEL RULES AND PROCEDURES COPYRIGHT...

  14. 30 CFR 251.13 - Reimbursement for the costs of reproducing data and information and certain processing costs.

    Science.gov (United States)

    2010-07-01

    ... and information and certain processing costs. 251.13 Section 251.13 Mineral Resources MINERALS... third party for the reasonable costs of processing geophysical information (which does not include cost... OUTER CONTINENTAL SHELF § 251.13 Reimbursement for the costs of reproducing data and information and...

  15. Main alkaloids from the Brazilian dendrobatidae frog Epipedobates flavopictus: pumiliotoxin 251D, histrionicotoxin and decahydroquinolines.

    Science.gov (United States)

    Mortari, Márcia Renata; Schwartz, Elisabeth N Ferroni; Schwartz, Carlos Alberto; Pires, Osmindo Rodrigues; Santos, Marcello Moreira; Bloch, Carlos; Sebben, Antonio

    2004-03-01

    Epipedobates flavopictus, Dendrobatidae, is a small aposematic frog found in Brazilian Cerrado bioma. In the present work, we isolated and characterized chemically the most abundant alkaloids present in the cutaneous extract of E. flavopictus. The specimens were collected in Pirenópolis (Goiás, Brazil), their skins were removed and extracted with methanol, and submitted to purification by HPLC and identification by gas chromatography and mass spectrometry. Pumiliotoxin 251D, histrionicotoxin 285Da and two decahydroquinolines, 219A and 243A, were identified. The pumiliotoxin 251D was tested on isolated frog sciatic nerve and on isolated guinea pig ileum muscle. The pumiliotoxin 251D slightly reduced the action potentials amplitude of frog sciatic nerve. The crude skin extract of E. flavopictus and the pumiliotoxin 251D produced rhythmic contractions and increased the muscular tension on isolated guinea pig ileum.

  16. 29 CFR 779.251 - Goods that have lost their out-of-State identity.

    Science.gov (United States)

    2010-07-01

    ... 29 Labor 3 2010-07-01 2010-07-01 false Goods that have lost their out-of-State identity. 779.251... Coverage Interstate Inflow Test Under Prior Act § 779.251 Goods that have lost their out-of-State identity... been processed or manufactured so as to have lost their identity as out-of-State goods before they are...

  17. Downregulation of HIF-1a sensitizes U251 glioma cells to the temozolomide (TMZ) treatment

    Energy Technology Data Exchange (ETDEWEB)

    Tang, Jun-Hai [Department of Neurosurgery, Xinqiao Hospital, Third Military Medical University, Chongqing 400037 (China); Ma, Zhi-Xiong [National Institute of Biological Sciences, Beijing 102206 (China); Huang, Guo-Hao; Xu, Qing-Fu; Xiang, Yan [Department of Neurosurgery, Xinqiao Hospital, Third Military Medical University, Chongqing 400037 (China); Li, Ningning; Sidlauskas, Kastytis [Division of Neuropathology and Department of Neurodegenerative Disease, Institute of Neurology, University College London, London WC1N 3BG (United Kingdom); Zhang, Eric Erquan [National Institute of Biological Sciences, Beijing 102206 (China); Lv, Sheng-Qing, E-mail: lvsq0518@hotmail.com [Department of Neurosurgery, Xinqiao Hospital, Third Military Medical University, Chongqing 400037 (China)

    2016-05-01

    Purpose: The aim of this study was to investigate the effect of downregulation of HIF-1α gene on human U251 glioma cells and examine the consequent changes of TMZ induced effects and explore the molecular mechanisms. Methods: U251 cell line stably expressing HIF-1α shRNA was acquired via lentiviral vector transfection. The mRNA and protein expression alterations of genes involved in our study were determined respectively by qRT-PCR and Western blot. Cell proliferation was measured by MTT assay and colony formation assay, cell invasion/migration capacity was determined by transwell invasion assay/wound healing assay, and cell apoptosis was detected by flow cytometry. Results: We successfully established a U251 cell line with highly efficient HIF-1α knockdown. HIF-1a downregulation sensitized U251 cells to TMZ treatment and enhanced the proliferation-inhibiting, invasion/migration-suppressing, apoptosis-inducing and differentiation-promoting effects exerted by TMZ. The related molecular mechanisms demonstrated that expression of O{sup 6}-methylguanine DNA methyltransferase gene (MGMT) and genes of Notch1 pathway were significantly upregulated by TMZ treatment. However, this upregulation was abrogated by HIF-1α knockdown. We further confirmed important regulatory roles of HIF-1α in the expression of MGMT and activation of Notch1 pathways. Conclusion: HIF-1α downregulation sensitizes U251 glioma cells to the temozolomide treatment via inhibiting MGMT expression and Notch1 pathway activation. - Highlights: • TMZ caused more significant proliferation inhibition and apoptosis in U251 cells after downregulating HIF-1α. • Under TMZ treatment, HIF-1 downregulated U251 cells exhibited weaker mobility and more differentiated state. • TMZ caused MGMT over-expression and Notch1 pathway activation, which could be abrogated by HIF-1α downregulation.

  18. AM251 Suppresses Epithelial-Mesenchymal Transition of Renal Tubular Epithelial Cells.

    Directory of Open Access Journals (Sweden)

    Tomoyo Yoshinaga

    Full Text Available Epithelial-mesenchymal transition (EMT of renal tubular epithelial cells is one of the causative mechanisms of kidney fibrosis. In our study, we screened lipophilic compounds using a lipid library including approximately 200 lipids to identify those that suppressed EMT induced by a transforming growth factor (TGF-β1 stimulus. Initial screening was performed with the immortalized HK-2 renal tubule epithelial cell line. The most promising compounds were further tested in RPTEC primary renal tubule epithelial cells. We found that the synthetic lipid AM251 suppressed two hallmark events associated with EMT, the upregulation of collagen 1A1 (COL1A1 and downregulation of E-cadherin. Though AM251 is known to act as an antagonist for the cannabinoid receptor type 1 (CB1 and an agonist for the G protein-coupled receptor 55 (GRP55, the suppression of EMT by AM251 was not mediated through either receptor. Microarray analyses revealed that AM251 inhibited induction of several EMT transcription factors such as SNAIL1, which is the key inducer of EMT, and the AP-1 transcription factors FOSB and JUNB. Activation of SMAD2/3 and p38 mitogen-activated protein kinase (MAPK was inhibited by AM251, with greater inhibition of the latter, indicating that AM251 acted upstream of SMAD/p38 MAPK in the TGF-β signaling pathway. Our findings regarding the effects of AM251 on the TGF-β signaling pathway may inform development of a novel therapeutic agent suppressing EMT, thus preventing kidney fibrosis.

  19. Risk modification of colorectal cancer susceptibility by interleukin-8 -251T>A polymorphism in Malaysians.

    Science.gov (United States)

    Mustapha, Mohd Aminudin; Shahpudin, Siti Nurfatimah Mohd; Aziz, Ahmad Aizat Abdul; Ankathil, Ravindran

    2012-06-07

    To investigate the allele and genotype frequencies and associated risk of interleukin (IL)-8 -251T>A polymorphism on colorectal cancer (CRC) susceptibility risk. Peripheral blood samples of 255 normal controls and 255 clinically and histopathologically confirmed CRC patients were genotyped for IL-8 -251T>A polymorphism employing allele-specific polymerase chain reaction. The relative association of variant allele and genotypes with CRC susceptibility risk was determined by calculating the odds ratios (ORs). Corresponding χ² tests on the CRC patients and controls were carried out and 95% confidence intervals (CIs) were determined using Fisher's exact test. The allele frequencies and its risk association were calculated using FAMHAP, haplotype association analysis software. On comparing the frequencies of genotypes of patients and controls, the homozygous variant AA was significantly higher in CRC patients (P = 0.002) compared to controls. Investigation on the association of the polymorphic genotypes with CRC susceptibility risk, showed that the homozygous variant IL-8 -251AA had a significantly increased risk with OR 3.600 (95% CI: 1.550-8.481, P = 0.001). In the case of allele frequencies, variant allele A of IL-8 -251 showed a significantly increased risk of CRC predisposition with OR 1.32 (95% CI: 1.03-1.69, P = 0.003). Variant allele and genotype of IL-8 (-251T>A) was significantly associated with CRC susceptibility risk and could be considered as a high-risk variant for CRC predisposition.

  20. Pengaruh Bionematisida Berbahan Aktif Jamur Paecilomyces lilacinus Strain 251 terhadap Serangan Pratylenchus coffeae pada Kopi Robusta

    Directory of Open Access Journals (Sweden)

    Soekadar Wiryadiputra

    2002-07-01

    Full Text Available Experiment on the effect of P. lilacinus on the infestation of P. coffeae on robusta coffee was conducted in Sumber Asin Experimental Garden, Malang. The treatments were dosages of bionematicide i.e. : 0 (control, 0.25, 0.50, 1.00, 2.00, and 4.00 g; carbofuran (3 % active ingredient 50 g/plant and organic soil treatment (OST at 100 g/plant. Each treatment was replicated four times, and each replication consists of five coffee trees. The results in second year observation revealed that the population of P. coffeae in the roots on PL 251 treatments was not significantly different compared to the control, whereas in soil samples the population of both P. coffeae and Rotylenchulus reniformis inclined to be lower than the control, although they were not statistically significant. The lowest infestation was observed on PL 251 treatment at a dosage level of 4.00 g/tree. On nematode infestation, no significant difference on treatments of carbofuran and OST compared to the control. The yield of green coffee (market coffee was the highest on the treatment of PL 251 at a dosage of 4.00 g/tree and significantly higher than the control and carbofuran treatments, with increasing levels of 225.3 and 198.9%, respectively. Keywords: bionematicide Paecilomyces lilacinus strain 251 (PL 251, Pratylenchus coffeae, Rotylenchulus reniformis

  1. U-251 revisited: genetic drift and phenotypic consequences of long-term cultures of glioblastoma cells

    International Nuclear Information System (INIS)

    Torsvik, Anja; Stieber, Daniel; Enger, Per Øyvind; Golebiewska, Anna; Molven, Anders; Svendsen, Agnete; Westermark, Bengt; Niclou, Simone P; Olsen, Thale Kristin; Chekenya Enger, Martha; Bjerkvig, Rolf

    2014-01-01

    It is well known that in vitro subculture represents a selection pressure on cell lines, and over time this may result in a genetic drift in the cancer cells. In addition, long-term cultures harbor the risk of cross-contamination with other cell lines. The consequences may have major impact on experimental results obtained in various laboratories, where the cell lines no longer reflect the original tumors that they are supposed to represent. Much neglected in the scientific community is a close monitoring of cell cultures by regular phenotypic and genetic characterization. In this report, we present a thorough characterization of the commonly used glioblastoma (GBM) model U-251, which in numerous publications has been wrongly identified as U-373, due to an earlier cross-contamination. In this work, the original U-251 and three subclones of U-251, commonly referred to as U-251 or U-373, were analyzed with regard to their DNA profile, morphology, phenotypic expression, and growth pattern. By array comparative genomic hybridization (aCGH), we show that only the original low-passaged U-251 cells, established in the 1960s, maintain a DNA copy number resembling a typical GBM profile, whereas all long-term subclones lost the typical GBM profile. Also the long-term passaged subclones displayed variations in phenotypic marker expression and showed an increased growth rate in vitro and a more aggressive growth in vivo. Taken together, the variations in genotype and phenotype as well as differences in growth characteristics may explain different results reported in various laboratories related to the U-251 cell line

  2. 48 CFR 52.251-2 - Interagency Fleet Management System Vehicles and Related Services.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 2 2010-10-01 2010-10-01 false Interagency Fleet... CLAUSES Text of Provisions and Clauses 52.251-2 Interagency Fleet Management System Vehicles and Related Services. As prescribed in 51.205, insert the following clause: Interagency Fleet Management System...

  3. 36 CFR 251.123 - Most directly affected Native Corporation determination.

    Science.gov (United States)

    2010-07-01

    ... 36 Parks, Forests, and Public Property 2 2010-07-01 2010-07-01 false Most directly affected Native..., DEPARTMENT OF AGRICULTURE LAND USES Revenue-Producing Visitor Services in Alaska § 251.123 Most directly... give them an opportunity to submit an application to be considered the Native Corporation most directly...

  4. Rational Design of Cyclodextrin Glycosyltransferase from Bacillus circulans Strain 251 to Increase α-Cyclodextrin Production

    NARCIS (Netherlands)

    Veen, Bart A. van der; Uitdehaag, Joost C.M.; Penninga, Dirk; Alebeek, Gert-Jan W.M. van; Smith, Loraine M.; Dijkstra, Bauke W.; Dijkhuizen, Lubbert

    2000-01-01

    Cyclodextrin glycosyltransferases (CGTase) (EC 2.4.1.19) are extracellular bacterial enzymes that generate cyclodextrins from starch. All known CGTases produce mixtures of α, β, and γ-cyclodextrins. A maltononaose inhibitor bound to the active site of the CGTase from Bacillus circulans strain 251

  5. 49 CFR 40.251 - What are the first steps in an alcohol confirmation test?

    Science.gov (United States)

    2010-10-01

    ... FOR TRANSPORTATION WORKPLACE DRUG AND ALCOHOL TESTING PROGRAMS Alcohol Confirmation Tests § 40.251 What are the first steps in an alcohol confirmation test? As the BAT for an alcohol confirmation test... 49 Transportation 1 2010-10-01 2010-10-01 false What are the first steps in an alcohol...

  6. The raw starch binding domain of cyclodextrin glycosyltransferase from Bacillus circulans strain 251

    NARCIS (Netherlands)

    Penninga, Dirk; Veen, Bart A. van der; Knegtel, Ronald M.A.; Hijum, Sacha A.F.T. van; Rozeboom, Henriëtte J.; Kalk, Kor H.; Dijkstra, Bauke W.; Dijkhuizen, Lubbert

    1996-01-01

    The E-domain of cyclodextrin glycosyltransferase (CGTase) (EC 2.4.1.19) from Bacillus circulans strain 251 is a putative raw starch binding domain. Analysis of the maltose-dependent CGTase crystal structure revealed that each enzyme molecule contained three maltose molecules, situated at contact

  7. 5 CFR 251.201 - Associations of management officials and/or supervisors.

    Science.gov (United States)

    2010-01-01

    ... SERVICE REGULATIONS AGENCY RELATIONSHIPS WITH ORGANIZATIONS REPRESENTING FEDERAL EMPLOYEES AND OTHER ORGANIZATIONS Relationships With Organizations Representing Federal Employees and Other Organizations § 251.201... timely basis. Each agency must establish and maintain a system for intra-management communication and...

  8. 36 CFR 251.103 - Mediation of term grazing permit disputes.

    Science.gov (United States)

    2010-07-01

    ... 36 Parks, Forests, and Public Property 2 2010-07-01 2010-07-01 false Mediation of term grazing... Lands § 251.103 Mediation of term grazing permit disputes. (a) Decisions subject to mediation. In those States with Department of Agriculture certified mediation programs, any holder of a term grazing permit...

  9. 76 FR 16038 - Proposed Collection; Comment Request for Prepaid Card Marketing Customer Survey, CS-10-251.

    Science.gov (United States)

    2011-03-22

    ... of social marketing. Social marketing principles and practices apply marketing principles to social... Prepaid Card Marketing Customer Survey, CS-10-251. AGENCY: Internal Revenue Service (IRS), Treasury..., the IRS is soliciting comments concerning Prepaid Card Marketing Customer Survey, CS-10-251 DATES...

  10. Radiosensitization and relative mechanisms of vanillin derivative BVAN08 on human glioma U-251 cells

    International Nuclear Information System (INIS)

    Wang Shubin; Zhang Bo; Sun Weijian; Wang Yu; Liu Xiaodan; Xu Qinzhi; Zhou Pingkun

    2010-01-01

    Objective: To provide more convincing evidences and experimental data for exploring vanillin derivative BVAN08, 6-bromine-5-hydroxy-4-methoxy-benzaldehyde, as a new anticancer drug, and to investigate the effect on the growth, radiosensitization of human glioma cell line U-251 and the relative mechanism. Methods: The effect of BVAN08 on cell proliferation of U-251 and radiosensitivity to 60 Co γ-rays (irradiation dose rate 2.3 Gy/min) were analyzed with MTT and colony-forming ability assay. Change in cellular morphology was observed by using light microscope. Change in cell cycle and apoptosis was detected with flow cytometry. The autophagy was observed by using TEM (irradiation dose rate is transmission electron microscope). DNA-PKcs protein level was detected through Western blot analysis. Results: BVAN08 exhibited a dose- and time-dependent inhibition on the proliferation of U-251 cells during the concentration range of 10-100 mol/L (t=1.83-3.07, P 50 at 48 h and 72 h after administration with BVAN08 were 55.3 and 52.7 mol/L, respectively. Obvious G 2 /M arrest was induced in U-251 cells after 4 h administration with BVAN08, and reached peck at 12 h. The G 2 /M population reached 63.3% in U-251 cells after 12 h administration of 60 μmol/L BVAN08 and kept increasing with the time, while both apoptosis and autophagic cell death were induced. The most effective radiosensitization time for BVAN08 treatment was 12 h before irradiation. The enhancement ratio of radiosensitivity was 3.14 for 20 μmol/L of BVAN08 12 h before 2 Gy irradiation. Conclusions: BVAN08 can induce apoptosis as radiosensitizing effect might be associated with the induction of G 2 /M arrest and inhibition of DNA-PKcs expression. BVAN08 seemed to be a promising radiosensitizing anticancer drug. (authors)

  11. Study of the 249-251Cf + 48Ca reactions: recent results and outlook

    Science.gov (United States)

    Voinov, A. A.; Oganessian, Yu Ts; Abdullin, F. Sh; Brewer, N. T.; Dmitriev, S. N.; Grzywacz, R. K.; Hamilton, J. H.; Itkis, M. G.; Miernik, K.; Polyakov, A. N.; Roberto, J. B.; Rykaczewski, K. P.; Sabelnikov, A. V.; Sagaidak, R. N.; Shirokovsky, I. V.; Shumeiko, M. V.; Stoyer, M. A.; Subbotin, V. G.; Sukhov, A. M.; Tsyganov, Yu S.; Utyonkov, V. K.; Vostokin, G. K.

    2018-02-01

    Experiment aiming at the synthesis of heavy isotopes of Z=118 (Og) using beam of 48Ca and a target of 249-251Cf was undertaken in October 2015 - April 2016 employing the Dubna Gas-Filled Recoil Separator (FLNR JINR). The target of mixed isotopes of 249-251Cf (50.7% of 249Cf, 12.9% of 250Cf, and 36.4% of 251Cf) was irradiated by 48Ca ions at two beam energies of 252 and 258 MeV with the corresponding accumulated beam doses of 1.6×1019 and 1.1×1019. A single event observed at lower beam energy was assigned to the isotope 294Og, the product of the reaction 249Cf(48Ca, 3n); its decay pattern and the observed radioactive properties of the nuclides in the decay chain reproduce in full those observed for 294Og in our earlier experiments of 2002-2005 and 2012. At higher beam energy we observed no decay chains that could be attributed to the isotopes of Og. The possibility of renewal of this experiment in the future is discussed.

  12. AM-251 and rimonabant act as direct antagonists at mu-opioid receptors: implications for opioid/cannabinoid interaction studies.

    Science.gov (United States)

    Seely, Kathryn A; Brents, Lisa K; Franks, Lirit N; Rajasekaran, Maheswari; Zimmerman, Sarah M; Fantegrossi, William E; Prather, Paul L

    2012-10-01

    Mu-opioid and CB1-cannabinoid agonists produce analgesia; however, adverse effects limit use of drugs in both classes. Additive or synergistic effects resulting from concurrent administration of low doses of mu- and CB1-agonists may produce analgesia with fewer side effects. Synergism potentially results from interaction between mu-opioid receptors (MORs) and CB1 receptors (CB1Rs). AM-251 and rimonabant are CB1R antagonist/inverse agonists employed to validate opioid-cannabinoid interactions, presumed to act selectively at CB1Rs. Therefore, the potential for direct action of these antagonists at MORs is rarely considered. This study determined if AM-251 and/or rimonabant directly bind and modulate the function of MORs. Surprisingly, AM-251 and rimonabant, but not a third CB1R inverse agonist AM-281, bind with mid-nanomolar affinity to human MORs with a rank order of affinity (K(i)) of AM-251 (251 nM) > rimonabant (652 nM) > AM281 (2135 nM). AM-251 and rimonabant, but not AM-281, also competitively antagonize morphine induced G-protein activation in CHO-hMOR cell homogenates (K(b) = 719 or 1310 nM, respectively). AM-251 and rimonabant block morphine inhibition of cAMP production, while only AM-251 elicits cAMP rebound in CHO-hMOR cells chronically exposed to morphine. AM-251 and rimonabant (10 mg/kg) attenuate morphine analgesia, whereas the same dose of AM-281 produces little effect. Therefore, in addition to high CB1R affinity, AM-251 and rimonabant bind to MORs with mid-nanomolar affinity and at higher doses may affect morphine analgesia via direct antagonism at MORs. Such CB1-independent of these antagonists effects may contribute to reported inconsistencies when CB1/MOR interactions are examined via pharmacological methods in CB1-knockout versus wild-type mice. Copyright © 2012 Elsevier Ltd. All rights reserved.

  13. The CB1 receptor antagonist AM251 impairs reconsolidation of pavlovian fear memory in the rat basolateral amygdala.

    Science.gov (United States)

    Ratano, Patrizia; Everitt, Barry J; Milton, Amy L

    2014-10-01

    We have investigated the requirement for signaling at CB1 receptors in the reconsolidation of a previously consolidated auditory fear memory, by infusing the CB1 receptor antagonist AM251, or the FAAH inhibitor URB597, directly into the basolateral amygdala (BLA) in conjunction with memory reactivation. AM251 disrupted memory restabilization, but only when administered after reactivation. URB597 produced a small, transient enhancement of memory restabilization when administered after reactivation. The amnestic effect of AM251 was rescued by coadministration of the GABAA receptor antagonist bicuculline at reactivation, indicating that the disruption of reconsolidation was mediated by altered GABAergic transmission in the BLA. These data show that the endocannabinoid system in the BLA is an important modulator of fear memory reconsolidation and that its effects on memory are mediated by an interaction with the GABAergic system. Thus, targeting the endocannabinoid system may have therapeutic potential to reduce the impact of maladaptive memories in neuropsychiatric disorders such as posttraumatic stress disorder.

  14. Synergistic Effects of thein cisT251I and P587L Mitochondrial DNA Polymerase γ Disease Mutations.

    Science.gov (United States)

    DeBalsi, Karen L; Longley, Matthew J; Hoff, Kirsten E; Copeland, William C

    2017-03-10

    Human mitochondrial DNA (mtDNA) polymerase γ (Pol γ) is the only polymerase known to replicate the mitochondrial genome. The Pol γ holoenzyme consists of the p140 catalytic subunit (POLG) and the p55 homodimeric accessory subunit (POLG2), which enhances binding of Pol γ to DNA and promotes processivity of the holoenzyme. Mutations within POLG impede maintenance of mtDNA and cause mitochondrial diseases. Two common POLG mutations usually found in cis in patients primarily with progressive external ophthalmoplegia generate T251I and P587L amino acid substitutions. To determine whether T251I or P587L is the primary pathogenic allele or whether both substitutions are required to cause disease, we overproduced and purified WT, T251I, P587L, and T251I + P587L double variant forms of recombinant Pol γ. Biochemical characterization of these variants revealed impaired DNA binding affinity, reduced thermostability, diminished exonuclease activity, defective catalytic activity, and compromised DNA processivity, even in the presence of the p55 accessory subunit. However, physical association with p55 was unperturbed, suggesting intersubunit affinities similar to WT. Notably, although the single mutants were similarly impaired, a dramatic synergistic effect was found for the double mutant across all parameters. In conclusion, our analyses suggest that individually both T251I and P587L substitutions functionally impair Pol γ, with greater pathogenicity predicted for the single P587L variant. Combining T251I and P587L induces extreme thermal lability and leads to synergistic nucleotide and DNA binding defects, which severely impair catalytic activity and correlate with presentation of disease in patients. © 2017 by The American Society for Biochemistry and Molecular Biology, Inc.

  15. Ultra-low dose cannabinoid antagonist AM251 enhances cannabinoid anticonvulsant effects in the pentylenetetrazole-induced seizure in mice.

    Science.gov (United States)

    Gholizadeh, Shervin; Shafaroodi, Hamed; Ghasemi, Mehdi; Bahremand, Arash; Sharifzadeh, Mohammad; Dehpour, Ahmad Reza

    2007-11-01

    Several lines of evidence suggest that cannabinoid compounds are anticonvulsant since they have inhibitory effects at micromolar doses, which are mediated by activated receptors coupling to Gi/o proteins. Surprisingly, both the analgesic and anticonvulsant effects of opioids are enhanced by ultra-low doses (nanomolar to picomolar) of the opioid antagonist naltrexone and as opioid and cannabinoid systems interact, it has been shown that ultra-low dose naltrexone also enhances cannabinoid-induced antinociception. However, regarding the seizure modulating properties of both classes of receptors this study investigated whether ultra-low dose cannabinoid antagonist AM251 influences cannabinoid anticonvulsant effects. The clonic seizure threshold (CST) was tested in separate groups of male NMRI mice following injection of vehicle, the cannabinoid selective agonist arachidonyl-2-chloroethylamide (ACEA) and ultra-low doses of the cannabinoid CB1 antagonist AM251 and a combination of ACEA and AM251 doses in a model of clonic seizure induced by pentylenetetrazole (PTZ). Systemic administration of ultra-low doses of AM251 (10 fg/kg-100 ng/kg) significantly potentiated the anticonvulsant effect of ACEA at 0.5 and 1 mg/kg. Moreover, inhibition of cannabinoid induced excitatory signaling by AM251 (100 pg/kg) unmasked a strong anticonvulsant effect for very low doses of ACEA (100 ng/kg-100 microg/kg), suggesting that a presumed inhibitory component of cannabinoid receptor signaling can exert strong seizure-protective effects even at very low levels of cannabinoid receptor activation. A similar potentiation by AM251 (100 pg/kg and 1 ng/kg) of anticonvulsant effects of non-effective dose of ACEA (0.5 and 1 mg/kg) was also observed in the generalized tonic-clonic model of seizure. The present data suggest that ultra-low doses of cannabinoid receptor antagonists may provide a potent strategy to modulate seizure susceptibility, especially in conjunction with very low doses of

  16. Evaluation of potential regulatory function of breast cancer risk locus at 6q25.1.

    Science.gov (United States)

    Sun, Yaqiong; Ye, Chuanzhong; Guo, Xingyi; Wen, Wanqing; Long, Jirong; Gao, Yu-Tang; Shu, Xiao Ou; Zheng, Wei; Cai, Qiuyin

    2016-02-01

    In a genome-wide association study conducted among Chinese women, we identified the single nucleotide polymorphism (SNP) rs2046210 at 6q25.1 for breast cancer risk. To explore a potential regulatory role for this risk locus, we measured expression levels of nine genes at the locus in breast cancer tissue and adjacent normal tissue samples obtained from 67 patients recruited in the Shanghai Breast Cancer Study. We found that rs2046210 had a statistically significant association with the expression levels of the AKAP12 and ESR1 genes in adjacent normal breast tissues. Women who carry the AA/AG risk genotypes had higher expressions of these two genes compared to those who carry G/G genotypes (P = 0.02 and 0.04 for the AKAP12 and ESR1, respectively). However, no significant differences of SNP rs2046210 with gene expression levels were found in tumor tissues. In The Cancer Genome Atlas samples, the AA/AG risk genotypes of SNP rs2046210 were associated with a significantly higher expression level of the AKAP12 gene and a lower level of the ESR1 gene in tumor tissue. Functional analysis using ENCODE data revealed that SNP rs7763637, which is in strong linkage disequilibrium with SNP rs2046210, is likely a potential functional variant, regulating the AKAP12 gene. Taken together, these results from our study suggest that the association between the 6q25.1 locus and breast cancer risk may be mediated through SNPs that regulate expressions of the AKAP12 gene. © The Author 2015. Published by Oxford University Press. All rights reserved. For Permissions, please email: journals.permissions@oup.com.

  17. 48 CFR 252.251-7001 - Use of Interagency Fleet Management System (IFMS) vehicles and related services.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false Use of Interagency Fleet... Fleet Management System (IFMS) vehicles and related services. As prescribed in 251.205, use the following clause: Use of Interagency Fleet Management System (IFMS) Vehicles and Related Services (DEC 1991...

  18. Earth System Chemistry integrated Modelling (ESCiMo) with the Modular Earth Submodel System (MESSy) version 2.51

    NARCIS (Netherlands)

    Jockel, P.; Tost, H.; Pozzer, A.; Kunze, M.; Kirner, O.; Brenninkmeijer, C.A.M.; Brinkop, S.; Cai, D.S.; Dyroff, C.; Eckstein, J.; Frank, F.; Garny, H.; Gottschald, K.D.; Graf, P.; Grewe, V.; Kerkweg, A.; Kern, B.; Matthes, S; Mertens, M; Meul, S.; Neumaier, M.; Nützel, M; Oberländer-Hayn, S; Ruhnke, R.; Runde, T.; Sander, R.; Scharffe, D; Zahn, A.

    2016-01-01

    Three types of reference simulations, as recommended by the Chemistry–Climate Model Initiative (CCMI), have been performed with version 2.51 of the European Centre for Medium-Range Weather Forecasts – Hamburg (ECHAM)/Modular Earth Submodel System (MESSy) Atmospheric Chemistry (EMAC) model: hindcast

  19. 36 CFR 251.14 - Conditions, rules and regulations to govern exercise of timber rights reserved in conveyance to...

    Science.gov (United States)

    2010-07-01

    ... precautions to prevent pollution of the air, soil, and water, in operation hereunder. (12) All activities by... perform currently as weather and soil conditions permit, the following erosion control work on portions of... regulations to govern exercise of timber rights reserved in conveyance to the United States. 251.14 Section...

  20. Adjuvant-dependent innate and adaptive immune signatures of risk of SIVmac251 acquisition.

    Science.gov (United States)

    Vaccari, Monica; Gordon, Shari N; Fourati, Slim; Schifanella, Luca; Liyanage, Namal P M; Cameron, Mark; Keele, Brandon F; Shen, Xiaoying; Tomaras, Georgia D; Billings, Erik; Rao, Mangala; Chung, Amy W; Dowell, Karen G; Bailey-Kellogg, Chris; Brown, Eric P; Ackerman, Margaret E; Vargas-Inchaustegui, Diego A; Whitney, Stephen; Doster, Melvin N; Binello, Nicolo; Pegu, Poonam; Montefiori, David C; Foulds, Kathryn; Quinn, David S; Donaldson, Mitzi; Liang, Frank; Loré, Karin; Roederer, Mario; Koup, Richard A; McDermott, Adrian; Ma, Zhong-Min; Miller, Christopher J; Phan, Tran B; Forthal, Donald N; Blackburn, Matthew; Caccuri, Francesca; Bissa, Massimiliano; Ferrari, Guido; Kalyanaraman, Vaniambadi; Ferrari, Maria G; Thompson, DeVon; Robert-Guroff, Marjorie; Ratto-Kim, Silvia; Kim, Jerome H; Michael, Nelson L; Phogat, Sanjay; Barnett, Susan W; Tartaglia, Jim; Venzon, David; Stablein, Donald M; Alter, Galit; Sekaly, Rafick-Pierre; Franchini, Genoveffa

    2016-07-01

    A recombinant vaccine containing Aventis Pasteur's canarypox vector (ALVAC)-HIV and gp120 alum decreased the risk of HIV acquisition in the RV144 vaccine trial. The substitution of alum with the more immunogenic MF59 adjuvant is under consideration for the next efficacy human trial. We found here that an ALVAC-simian immunodeficiency virus (SIV) and gp120 alum (ALVAC-SIV + gp120) equivalent vaccine, but not an ALVAC-SIV + gp120 MF59 vaccine, was efficacious in delaying the onset of SIVmac251 in rhesus macaques, despite the higher immunogenicity of the latter adjuvant. Vaccine efficacy was associated with alum-induced, but not with MF59-induced, envelope (Env)-dependent mucosal innate lymphoid cells (ILCs) that produce interleukin (IL)-17, as well as with mucosal IgG to the gp120 variable region 2 (V2) and the expression of 12 genes, ten of which are part of the RAS pathway. The association between RAS activation and vaccine efficacy was also observed in an independent efficacious SIV-vaccine approach. Whether RAS activation, mucosal ILCs and antibodies to V2 are also important hallmarks of HIV-vaccine efficacy in humans will require further studies.

  1. Protection of cynomolgus macaque against cervicovaginal transmission of SIVmac251 by the spermicide benzalkonium chloride.

    Science.gov (United States)

    Tévi-Benissan, C; Makuva, M; MorelliA; Georges-Courbot, M C; Matta, M; Georges, A; Bélec, L

    2000-06-01

    We evaluated the potential effectiveness of a spermicide cationic surfactant, benzalkonium chloride (BZK), to prevent the transmission of simian immunodeficiency virus (SIV) after intravaginal inoculation in 12 cynomolgus macaques. The inoculation procedure involved deposition of 6.7 ivag-AID50 of cell-free SIVmac251 into the receiving vagina, four times over a 2-week period, at the end of the luteal phase of the menstrual cycle. Six randomly selected females received vaginally foam containing BZK (7.37%, wt/wt) before each inoculation (BZK group), whereas the remaining were not pretreated (control group). In controls, 5 animals presented persistent SIV infection and 1 had a transient viremia. The number of uninfected animals was higher in the BZK group (6 of 6) than in controls (0 of 6). These findings demonstrate that BZK placed in the vaginal receptacle prior to SIV inoculation provides a significant protection in vivo. The wide spectrum of antimicrobial activities of BZK (including HIV) in addition to its efficiency to block the transmucosal passage of SIV in the macaque model qualifies this drug as an attractive topical microbicide to prevent sexually transmitted infections in humans.

  2. Quantitative Proteomic Profiling of Tachyplesin I Targets in U251 Gliomaspheres

    Directory of Open Access Journals (Sweden)

    Xuan Li

    2017-01-01

    Full Text Available Tachyplesin I is a cationic peptide isolated from hemocytes of the horseshoe crab and its anti-tumor activity has been demonstrated in several tumor cells. However, there is limited information providing the global effects and mechanisms of tachyplesin I on glioblastoma multiforme (GBM. Here, by using two complementary proteomic strategies (2D-DIGE and dimethyl isotope labeling-based shotgun proteomics, we explored the effect of tachyplesin I on the proteome of gliomaspheres, a three-dimensional growth model formed by a GBM cell line U251. In total, the expression levels of 192 proteins were found to be significantly altered by tachyplesin I treatment. Gene ontology (GO analysis revealed that many of them were cytoskeleton proteins and lysosomal acid hydrolases, and the mostly altered biological process was related to cellular metabolism, especially glycolysis. Moreover, we built protein–protein interaction network of these proteins and suggested the important role of DNA topoisomerase 2-alpha (TOP2A in the signal-transduction cascade of tachyplesin I. In conclusion, we propose that tachyplesin I might down-regulate cathepsins in lysosomes and up-regulate TOP2A to inhibit migration and promote apoptosis in glioma, thus contribute to its anti-tumor function. Our results suggest tachyplesin I is a potential candidate for treatment of glioma.

  3. Antiviral activities of extracts of Euphorbia hirta L. against HIV-1, HIV-2 and SIVmac251.

    Science.gov (United States)

    Gyuris, Agnes; Szlávik, László; Minárovits, János; Vasas, Andrea; Molnár, Joseph; Hohmann, Judit

    2009-01-01

    The antiretroviral activities of extracts of Euphorbia hirta were investigated in vitro on the MT4 human T lymphocyte cell line. The cytotoxicities of the extracts were tested by means of the MTT cell proliferation assay, and then the direct effects of the aqueous extract on HIV-1, HIV-2 and SIV(mac251) reverse transcriptase (RT) activity were determined. A dose-dependent inhibition of RT activity was observed for all three viruses. The HIV-1 inhibitory potency of E. hirta was studied further, and the activities of the aqueous and 50% methanolic extracts were compared. The 50% methanolic extract was found to exert a higher antiretroviral effect than that of the aqueous extract. The 50% MeOH extract was subjected to liquid-liquid partition with dichloromethane, ethyl acetate and water. Only the remaining aqueous phase exhibited significant antiviral activity; all the lipophilic extracts appeared to be inactive. After removal of the tannins from the aqueous extract, the viral replication inhibitory effect was markedly decreased, and it was therefore concluded that tannins are most probably responsible for the high antiretroviral activity.

  4. Eosinophilic esophagitis: analysis of food impaction and perforation in 251 adolescent and adult patients.

    Science.gov (United States)

    Straumann, Alex; Bussmann, Christian; Zuber, Markus; Vannini, Simone; Simon, Hans-Uwe; Schoepfer, Alain

    2008-05-01

    Eosinophilic esophagitis is a rapidly emerging, chronic inflammatory disorder. Prolonged inflammation evokes structural alterations and a fragile esophageal wall prone to perforation/rupture and food impaction. This report assesses the risk of spontaneously arising and procedure-induced complications and proposes practical recommendations. The Swiss Esophageal Esophagitis Database documented 251 confirmed cases. A chart review identified which patients had required endoscopic bolus removal and/or experienced transmural esophageal perforation/rupture. In addition, a MEDLINE search for "eosinophilic esophagitis" with "esophageal perforation" or "esophageal rupture" was undertaken. During an 18-year period, 87 patients (34.7%) experienced 134 food impactions requiring flexible (124, 92.5%) or rigid (10, 7.5%) endoscopic bolus removal. Transmural perforation occurred in 20% (2/10) of rigid procedures, and 1 esophageal rupture (Boerhaave's syndrome) was observed. Bolus removal by rigid endoscopy is a high-risk procedure and should be avoided in eosinophilic esophagitis patients who require a gentler approach. Whether food impaction and esophageal wall remodeling can be prevented with anti-inflammatory medication is still undetermined. All Boerhaave's syndrome cases should be evaluated for underlying eosinophilic esophagitis.

  5. Downregulation of ROCK2 through nanocomplex sensitizes the cytotoxic effect of temozolomide in U251 glioma cells.

    Directory of Open Access Journals (Sweden)

    Xiaojun Wen

    Full Text Available Rho-associated coiled-coil kinase 2 (ROCK2 is an attractive therapeutic target because it is overexpressed in many malignancies, including glioma. Therefore, we designed the current study to determine whether the downregulation of ROCK2 would sensitize the cytotoxic effect of temozolomide (TMZ in U251 cells.Glycol-polyethyleneimine (PEG-PEI was used to deliver siROCK2 to U251 cells, and the physical characteristics of the PEG-PEI/siROCK2 complex (referred to as the siROCK2 complex were investigated. The transfection efficiency and cell uptake were determined by flow cytometry (FCM and confocal laser microscopy (CLSM, respectively. U251 cells were then treated with 100 μM TMZ, siROCK2 complexes or their combination. The apoptosis rate and cell migration were measured by FCM and wound-healing assay, respectively. The levels of Bax, Bcl-2, cleaved caspase-3, MMP-2, and MMP-9 were detected to analyze the degrees of apoptosis and migration.Our results revealed that the characteristics of the siROCK2 complexes depended closely on the N/P ratios. PEG-PEI served as a good vector for siROCK2 and exhibited low cytotoxicity toward U251 cells. The CLSM assay showed that the siROCK2 complexes were successfully uptaken and that both the protein and mRNA levels of ROCK2 were significantly suppressed. Furthermore, the combination treatment induced a higher apoptosis rate and markedly increased the gap distance of U251 cells in the wound-healing assay. Levels of the proapoptotic proteins Bax and cleaved caspase-3 were significantly increased, whereas levels of the antiapoptotic protein Bcl-2 and the migration-related proteins MMP-2 and MMP-9 were significantly reduced by the combination treatment compared with either treatment alone.In conclusion, our results demonstrate that the combination of TMZ and siROCK2 effectively induces apoptosis and inhibits the migration of U251 cells. Therefore, the combination of TMZ and siROCK2 complex is a potential therapeutic

  6. Effects of a Commercial Formulation of Paecilomyces lilacinus Strain 251 on Overseeded Bermudagrass Infested with Belonolaimus longicaudatus

    Science.gov (United States)

    Crow, William T.

    2013-01-01

    Belonolaimus longicaudatus is an important parasite of both warm-season bermudagrass and winter overseed grasses used on golf courses in the southeastern United States. Field trials were conducted to study the effects of a commercial formulation of Paecilomyces lilacinus strain 251 applied to overseed grasses during the winter and early spring on population density of B. longicaudatus and bermudagrass health in late spring after bermudagrass broke dormancy. These studies found that P. lilacinus reduced numbers of B. longicaudatus in most cases, but not below damaging levels. Multiple applications of 1 × 1010 spores/m2 were generally more effective than 2 × 1010 spores/m2 in reducing nematode numbers and improving turf roots. These results indicate that application of this formulation of P. lilacinus strain 251 to overseeded turf in the spring may be a useful integrated pest management tool for B. longicaudatus on bermudagrass, but is not sufficient as a stand-alone nematode management tactic. PMID:24115787

  7. Involvement of opioid system in antidepressant-like effect of the cannabinoid CB1 receptor inverse agonist AM-251 after physical stress in mice.

    Science.gov (United States)

    Ostadhadi, Sattar; Haj-Mirzaian, Arya; Nikoui, Vahid; Kordjazy, Nastaran; Dehpour, Ahmad-Reza

    2016-02-01

    Cannabinoid inverse agonists possess antidepressant-like properties, but the mechanism of this action is unknown. Numerous studies have reported the interaction between opioid and cannabinoid pathways. In this study, acute foot-shock stress was used in mice to investigate the involvement of the opioid pathway in the antidepressant-like effect of the cannabinoid CB1 receptor inverse agonist AM-251. Stress was induced by intermittent foot-shock stimulation for 30 min. Then, using the forced swimming test (FST) and tail suspension test (TST), the immobility time was measured. Results show that the immobility time was significantly prolonged in animals subjected to foot-shock stress, compared with non-stressed controls (P AM-251 (0.5 and 0.3 mg/kg, intraperitoneally (i.p.)), significantly decreased the immobility time of stressed mice in the FST (P AM-251 (0.1 mg/kg), naltrexone (0.3 mg/kg), and morphine (1.0 mg/kg) did not show any significant effect on stressed animals (P > 0.05). Co-administration of AM-251 with sub-effective dose of naltrexone decreased the effective dose of this cannabinoid inverse agonist, to 0.1 mg/kg (P AM-251 (0.5 mg/kg; P AM-251 in a foot-shock stress model. © 2016 John Wiley & Sons Australia, Ltd.

  8. Rapid detection, differentiation and typing of methicillin-resistant Staphylococcus aureus harbouring either mecA or the new mecA homologue mecA(LGA251).

    Science.gov (United States)

    Stegger, M; Andersen, P S; Kearns, A; Pichon, B; Holmes, M A; Edwards, G; Laurent, F; Teale, C; Skov, R; Larsen, A R

    2012-04-01

    The recent finding of a new mecA homologue, mecA(LGA251) , with only 70% nucleotide homology to the conventional mecA gene has brought the routine testing for mecA as a confirmatory test for methicillin-resistant Staphylococcus aureus (MRSA) into question. A multiplex PCR was designed to differentiate mecA(LGA251) from the known mecA together with detection of lukF-PV and the spa gene fragments, enabling direct spa typing by sequencing of the PCR amplicons. The PCR analysis and subsequent spa typing were validated on a large collection (n=185) of contemporary MRSA and methicillin-sensitive S. aureus isolates, including 127 isolates carrying mecA(LGA251) . The mecA(LGA251) gene was situated in staphylococcal cassette chromosome mec type XI elements, and sequence variation within a 631-bp fragment of mecA(LGA251) in 79 isolates indicated a very conserved gene sequence. Following a successful validation, the multiplex PCR strategy was implemented in the routine testing of MRSA for national surveillance. Over a 2-month period, among 203 samples tested, 12 new MRSA cases caused by isolates carrying mecA(LGA251) were identified, emphasizing the clinical importance of testing for these new MRSA isolates. © 2011 STATENS SERUM INSTITUT. Clinical Microbiology and Infection © 2011 European Society of Clinical Microbiology and Infectious Diseases.

  9. Preparation of iodine-123 labeled AM251: a potential SPECT radioligand for the brain cannabinoid CB1 receptor

    Energy Technology Data Exchange (ETDEWEB)

    Lan, Ruoxi; Makriyannis, Alexandros [Connecticut Univ., Molecular and Cell Biology Dept., Storrs, CT (United States); Gatley, S.J. [Brookhaven National Lab., Medical Dept., Upton, NY (United States)

    1996-10-01

    We report the synthesis and labeling with iodine-123 of N-(piperidin-1-yl)-5-(4-iodophenyl)-1-(2, 4-dichlorophenyl)-4-methyl-1H-pyrazole-3-carboxamide (AM251). This compound is an analog of the recently described cannabinoid receptor antagonist, SR141716A, in which a 4-chlorophenyl group is replaced by 4-iodophenyl. Labeling in good yield (62%) and radiochemical purity (> 95%), and high specific activity (> 2500 Ci/mmol) was achieved by an iododestannylation reaction using the tributyltin precursor, no carrier added I-123 iodide, and chloramine-T. (author).

  10. Acquired temozolomide resistance in human glioblastoma cell line U251 is caused by mismatch repair deficiency and can be overcome by lomustine.

    Science.gov (United States)

    Stritzelberger, J; Distel, L; Buslei, R; Fietkau, R; Putz, F

    2018-04-01

    Glioblastoma multiforme (GBM) is the most common malignant primary brain tumor in adults. While the alkylating agent temozolomide (TMZ) has prolonged overall survival, resistance evolution represents an important clinical problem. Therefore, we studied the effectiveness of radiotherapy and CCNU in an in vitro model of acquired TMZ resistance. We studied the MGMT-methylated GBM cell line U251 and its in vitro derived TMZ-resistant subline, U251/TMZ-R. Cytotoxicity of TMZ, CCNU, and radiation was tested. Both cell lines were analyzed for MGMT promotor status and expression of mismatch repair genes (MMR). The influence of MMR inhibition by cadmium chloride (CdCl 2 ) on the effects of both drugs was evaluated. During the resistance evolution process in vitro, U251/TMZ-R developed MMR deficiency, but MGMT status did not change. U251/TMZ-R cells were more resistant to TMZ than parental U251 cells (cell viability: 92.0% in U251/TMZ-R/69.2% in U251; p = 0.032) yet more sensitive to CCNU (56.4%/80.8%; p = 0.023). The effectiveness of radiotherapy was not reduced in the TMZ-resistant cell line. Combination of CCNU and TMZ showed promising results for both cell lines and overcame resistance. CdCl 2 -induced MMR deficiency increased cytotoxicity of CCNU. Our results confirm MMR deficiency as a crucial process for resistance evolution to TMZ. MMR-deficient TMZ-resistant GBM cells were particularly sensitive to CCNU and to combined CCNU/TMZ. Effectiveness of radiotherapy was preserved in TMZ-resistant cells. Consequently, CCNU might be preferentially considered as a treatment option for recurrent MGMT-methylated GBM and may even be suitable for prevention of resistance evolution in primary treatment.

  11. Effect of plant resistance and BioAct WG (Purpureocillium lilacinum strain 251) on Meloidogyne incognita in a tomato-cucumber rotation in a greenhouse.

    Science.gov (United States)

    Giné, Ariadna; Sorribas, Francisco J

    2017-05-01

    The effectiveness of combining resistant tomato with BioAct WG (Purpureocillium lilacinum strain 251, Pl251) against Meloidogyne incognita was assessed in a tomato-cucumber rotation in a greenhouse over 2 years. Additionally, the enzymatic activity of the fungus, the percentage of fungal egg and juvenile parasitism, cardinal temperatures and the effect of water potential on mycelial growth and the soil receptivity to Pl251 were determined in vitro. Plant resistance was the only factor that suppressed nematode and crop yield losses. Percentage of egg parasitism in plots treated with BioAct WG was less than 2.6%. However, under in vitro conditions, Pl251 showed protease, lipase and chitinase activities and parasitised 94.5% of eggs, but no juveniles. Cardinal temperatures were 14.2, 24-26 and 35.4 °C. The maximum Pl251 mycelial growth was at -0.25 MPa and 25 °C. Soil temperatures and water potential in the greenhouse were in the range of the fungus. However, soil receptivity was lower in greenhouse soil, irrespective of sterilisation, than in sterilised sand. Plant resistance was the only factor able to suppress nematode densities, disease severity and yield losses, and to protect the following cucumber crop. Environmental factors involved in soil receptivity could have negatively affected fungus effectiveness. © 2016 Society of Chemical Industry. © 2016 Society of Chemical Industry.

  12. PTEN-induction in U251 glioma cells decreases the expression of insulin-like growth factor binding protein-2

    International Nuclear Information System (INIS)

    Levitt, Randy J.; Georgescu, Maria-Magdalena; Pollak, Michael

    2005-01-01

    PTEN is a tumor suppressor gene whose loss of function is observed in ∼40-50% of human cancers. Although insulin-like growth factor binding protein-2 (IGFBP-2) was classically described as a growth inhibitor, multiple recent reports have shown an association of overexpression and/or high serum levels of IGFBP-2 with poor prognosis of several malignancies, including gliomas. Using an inducible PTEN expression system in the PTEN-null glioma cell line U251, we demonstrate that PTEN-induction is associated with reduced proliferation, increased apoptosis, and a substantial reduction of the high levels of IGFBP-2 expression. The PTEN-induced decrease in IGFBP-2 expression could be mimicked with the PI3-kinase inhibitor LY294002, indicating that the lipid phosphatase activity of PTEN is responsible for the observed effect. However, the rapamycin analog CCI-779 did not affect IGFBP-2 expression, suggesting that the PTEN-induced decrease in IGFBP-2 expression is not attributable to decreased mTOR signalling. Recombinant human IGFBP-2 was unable to rescue U251-PTEN cells from the antiproliferative effects of PTEN, and IGFBP-2 siRNA did not affect the IGF-dependent or -independent growth of this cell line. These results suggest that the clinical data linking IGFBP-2 expression to poor prognosis may arise, at least in part, because high levels of IGFBP-2 expression correlate with loss of function of PTEN, which is well known to lead to aggressive behavior of gliomas. Our results motivate translational research regarding the relationship between IGFBP-2 expression and loss of function of PTEN

  13. Two-dimensional Langevin modeling of fission dynamics of the excited compound nuclei 188Pt, 227Pa and 251Es

    Science.gov (United States)

    Eslamizadeh, H.

    2016-02-01

    A stochastic approach based on one- and two-dimensional Langevin equations is applied to calculate the pre-scission neutron multiplicity, fission probability, anisotropy of fission fragment angular distribution, fission cross section and the evaporation cross section for the compound nuclei 188Pt, 227Pa and 251Es in an intermediate range of excitation energies. The chaos weighted wall and window friction formula are used in the Langevin equations. The elongation parameter, c, is used as the first dimension and projection of the total spin of the compound nucleus onto the symmetry axis, K, considered as the second dimension in Langevin dynamical calculations. A constant dissipation coefficient of K, γK = 0.077(MeV zs)-1/2, is used in two-dimensional calculations to reproduce the above mentioned experimental data. Comparison of the theoretical results of the pre-scission neutron multiplicity, fission probability, fission cross section and the evaporation cross section with the experimental data shows that the results of two-dimensional calculations are in better agreement with the experimental data. Furthermore, it is shown that the two-dimensional Langevin equations together with a dissipation coefficient of K, γK = 0.077(MeV zs)-1/2, can satisfactorily reproduce the anisotropy of fission fragment angular distribution for the heavy compound nucleus 251Es. However, a larger value of γK = 0.250(MeV zs)-1/2 is needed to reproduce the anisotropy of fission fragment angular distribution for the lighter compound nucleus 227Pa.

  14. THE COLLABORATIVE OCULAR TUBERCULOSIS STUDY (COTS)-1: A Multinational Review of 251 Patients With Tubercular Retinal Vasculitis.

    Science.gov (United States)

    Gunasekeran, Dinesh V; Agrawal, Rupesh; Agarwal, Aniruddha; Carreño, Ester; Raje, Dhananjay; Aggarwal, Kanika; Kon, Onn M; Nguyen, Quan Dong; Pavesio, Carlos; Gupta, Vishali

    2018-04-24

    Tubercular retinal vasculitis (TRV) is a heterogeneous disease that can be difficult to manage because of nonspecific presentation and limitations of confirmatory tests for tuberculosis. This is a big data analysis on phenotypes and treatment outcomes for TRV. Multicentre retrospective study of patients with TRV between January 2004 and December 2014 and a minimum follow-up of 1 year. Two hundred and fifty-one patients with TRV with a mean age of 38.9 ± 14.4 years (range, 9-86 years) were included. The patients were predominantly males (n = 167/251; 66.5%) of Asian ethnicity (n = 174/246; 70.7%), and geographical origin (n = 137/251; 54.6%). Most patients had features of occlusive type of RV (n = 113/185; 61.1%) except Caucasians (n = 11; 28.2%). There was no significant difference in treatment failure whether patients received antitubercular therapy (ATT) (P = 0.29), although treatment failure was less frequent in patients who received ATT (13.6%; n = 31/228) compared with those who did not (21.7%, n = 5/23). Less treatment failures were observed in patients with occlusive type RV who received ATT; however, this was not significant on survival analysis (P = 0.09). Treatment with ATT was associated with higher failure rates in patients of Hispanic and African American race and those with TRV associated with panuveitis (compared with posterior uveitis). In this multinational study of TRV, there was no significant therapeutic effect of ATT. However, a definitive conclusion about the role of ATT could not be made because of a few patients who did not receive ATT. Because this is a retrospective study with a limited 1-year follow-up, the effect of ATT may have been overestimated (or underestimated) in the duration of follow-up.

  15. Common alleles at 6q25.1 and 1p11.2 are associated with breast cancer risk for BRCA1 and BRCA2 mutation carriers

    NARCIS (Netherlands)

    Antoniou, Antonis C.; Kartsonaki, Christiana; Sinilnikova, Olga M.; Soucy, Penny; McGuffog, Lesley; Healey, Sue; Lee, Andrew; Peterlongo, Paolo; Manoukian, Siranoush; Peissel, Bernard; Zaffaroni, Daniela; Cattaneo, Elisa; Barile, Monica; Pensotti, Valeria; Pasini, Barbara; Dolcetti, Riccardo; Giannini, Giuseppe; Putignano, Anna Laura; Varesco, Liliana; Radice, Paolo; Mai, Phuong L.; Greene, Mark H.; Andrulis, Irene L.; Glendon, Gord; Ozcelik, Hilmi; Thomassen, Mads; Gerdes, Anne-Marie; Kruse, Torben A.; Birk Jensen, Uffe; Crüger, Dorthe G.; Caligo, Maria A.; Laitman, Yael; Milgrom, Roni; Kaufman, Bella; Paluch-Shimon, Shani; Friedman, Eitan; Loman, Niklas; Harbst, Katja; Lindblom, Annika; Arver, Brita; Ehrencrona, Hans; Melin, Beatrice; Nathanson, Katherine L.; Domchek, Susan M.; Rebbeck, Timothy; Jakubowska, Ania; Lubinski, Jan; Gronwald, Jacek; Huzarski, Tomasz; Byrski, Tomasz; Cybulski, Cezary; Gorski, Bohdan; Osorio, Ana; Ramón Y Cajal, Teresa; Fostira, Florentia; Andrés, Raquel; Benitez, Javier; Hamann, Ute; Hogervorst, Frans B.; Rookus, Matti A.; Hooning, Maartje J.; Nelen, Marcel R.; van der Luijt, Rob B.; van Os, Theo A. M.; van Asperen, Christi J.; Devilee, Peter; Meijers-Heijboer, Hanne E. J.; Gómez Garcia, Encarna B.; Peock, Susan; Cook, Margaret; Frost, Debra; Platte, Radka; Leyland, Jean; Evans, D. Gareth; Lalloo, Fiona; Eeles, Ros; Izatt, Louise; Adlard, Julian; Davidson, Rosemarie; Eccles, Diana; Ong, Kai-Ren; Cook, Jackie; Douglas, Fiona; Paterson, Joan; Kennedy, M. John; Miedzybrodzka, Zosia; Godwin, Andrew; Stoppa-Lyonnet, Dominique; Buecher, Bruno; Belotti, Muriel; Tirapo, Carole; Mazoyer, Sylvie; Barjhoux, Laure; Lasset, Christine; Leroux, Dominique; Faivre, Laurence; Bronner, Myriam; Prieur, Fabienne; Nogues, Catherine; Rouleau, Etienne; Pujol, Pascal; Coupier, Isabelle; Frénay, Marc; Hopper, John L.; Daly, Mary B.; Terry, Mary B.; John, Esther M.; Buys, Saundra S.; Yassin, Yosuf; Miron, Alexander; Goldgar, David; Singer, Christian F.; tea, Muy-Kheng; Pfeiler, Georg; Dressler, Anne Catharina; Hansen, Thomas v O.; Jønson, Lars; Ejlertsen, Bent; Barkardottir, Rosa Bjork; Kirchhoff, Tomas; Offit, Kenneth; Piedmonte, Marion; Rodriguez, Gustavo; Small, Laurie; Boggess, John; Blank, Stephanie; Basil, Jack; Azodi, Masoud; Toland, Amanda Ewart; Montagna, Marco; Tognazzo, Silvia; Agata, Simona; Imyanitov, Evgeny; Janavicius, Ramunas; Lazaro, Conxi; Blanco, Ignacio; Pharoah, Paul D. P.; Sucheston, Lara; Karlan, Beth Y.; Walsh, Christine S.; Olah, Edith; Bozsik, Aniko; teo, Soo-Hwang; Seldon, Joyce L.; Beattie, Mary S.; van Rensburg, Elizabeth J.; Sluiter, Michelle D.; Diez, Orland; Schmutzler, Rita K.; Wappenschmidt, Barbara; Engel, Christoph; Meindl, Alfons; Ruehl, Ina; Varon-Mateeva, Raymonda; Kast, Karin; Deissler, Helmut; Niederacher, Dieter; Arnold, Norbert; Gadzicki, Dorothea; Schönbuchner, Ines; Caldes, Trinidad; de la Hoya, Miguel; Nevanlinna, Heli; Aittomäki, Kristiina; Dumont, Martine; Chiquette, Jocelyne; Tischkowitz, Marc; Chen, Xiaoqing; Beesley, Jonathan; Spurdle, Amanda B.; Neuhausen, Susan L.; Chun Ding, Yuan; Fredericksen, Zachary; Wang, Xianshu; Pankratz, Vernon S.; Couch, Fergus; Simard, Jacques; Easton, Douglas F.; Chenevix-Trench, Georgia; Gregory, Helen; Morrison, Patrick; Jeffers, Lisa; Cole, Trevor; McKeown, Carole; Hoffman, Jonathan; Donaldson, Alan; Downing, Sarah; Taylor, Amy; Murray, Alexandra; Rogers, Mark T.; McCann, Emma; John Kennedy, M.; Barton, David; East, South; Porteous, Mary; Drummond, Sarah; Brewer, Carole; Kivuva, Emma; Searle, Anne; Goodman, Selina; Hill, Kathryn; Murday, Victoria; Bradshaw, Nicola; Snadden, Lesley; Longmuir, Mark; Watt, Catherine; Gibson, Sarah; Haque, Eshika; Tobias, Ed; Duncan, Alexis; Jacobs, Chris; Langman, Caroline; Whaite, Anna; Dorkins, Huw; Barwell, Julian; Chu, Carol; Miller, Julie; Ellis, Ian; Gareth Evans, D.; Taylor, Jane; Thames, N. E.; Side, Lucy; Male, Alison; Berlin, Cheryl; Eason, Jacqueline; Collier, Rebecca; Claber, Oonagh; Jobson, Irene; Walker, Lisa; McLeod, Diane; Halliday, Dorothy; Durell, Sarah; Stayner, Barbara; Shanley, Susan; Rahman, Nazneen; Houlston, Richard; Bancroft, Elizabeth; D'Mello, Lucia; Page, Elizabeth; Ardern-Jones, Audrey; Kohut, Kelly; Wiggins, Jennifer; Castro, Elena; Mitra, Anita; Robertson, Lisa; Quarrell, Oliver; Bardsley, Cathryn; Hodgson, Shirley; Goff, Sheila; Brice, Glen; Winchester, Lizzie; Eddy, Charlotte; Tripathi, Vishakha; Attard, Virginia; Lucassen, Anneke; Crawford, Gillian; McBride, Donna; Smalley, Sarah; Sutter, Christian; Preisler-Adams, Sabine; Fiebig, Britta; Heinritz, Wolfram; Schäfer, Dieter; Köhler, Juliane; Bérard, Léon; Sinilnikova, Olga; Verny-Pierre, Carole; Giraud, Sophie; Léone, Mélanie; Gauthier-Villars, Marion; Houdayer, Claude; Moncoutier, Virginie; de Pauw, Antoine; Bressac-de-Paillerets, Brigitte; Remenieras, Audrey; Byrde, Véronique; Caron, Olivier; Lenoir, Gilbert; Bignon, Yves-Jean; Uhrhammer, Nancy; Bonadona, Valérie; Hardouin, Agnés; Berthet, Pascaline; Sobol, Hagay; Bourdon, Violaine; Noguchi, Tetsuro; Eisinger, François; Coulet, Florence; Colas, Chrystelle; Soubrier, Florent; Peyrat, Jean-Philippe; Fournier, Joëlle; Révillion, Françoise; Vennin, Philippe; Adenis, Claude; Lidereau, Rosette; Demange, Liliane; Muller, Daniéle; Fricker, Jean-Pierre; Longy, Michel; Sevenet, Nicolas; Toulas, Christine; Guimbaud, Rosine; Gladieff, Laurence; Feillel, Viviane; Dreyfus, Hélène; Rebischung, Christine; Coron, Fanny; Lebrun, Marine; Ferrer, Sandra Fert; Vénat-Bouvet, Laurence; Delnatte, Capucine; Mortemousque, Isabelle; Lynch, Henry T.; Snyder, Carrie L.; Hogervorst, F. B. L.; Verhoef, S.; Verheus, M.; van ‘t Veer, L. J.; van Leeuwen, F. E.; Rookus, M. A.; Collée, M.; van den Ouweland, A. M. W.; Jager, A.; Hooning, M. J.; Tilanus-Linthorst, M. M. A.; Seynaeve, C.; van Asperen, C. J.; Wijnen, J. T.; Vreeswijk, M. P.; Tollenaar, R. A.; Devilee, P.; Ligtenberg, M. J.; Hoogerbrugge, N.; Ausems, M. G.; van der Luijt, R. B.; Aalfs, C. M.; Gille, J. J. P.; Waisfisz, Q.; Gomez-Garcia, E. B.; van Roozendaal, C. E.; Blok, Marinus J.; Caanen, B.; Oosterwijk, J. C.; van der Hout, A. H.; Mourits, M. J.; Vasen, H. F.; Karlsson, Per; Nordling, Margareta; Bergman, Annika; Einbeigi, Zakaria; Stenmark-Askmalm, Marie; Liedgren, Sigrun; Borg, Åke; Olsson, Håkan; Kristoffersson, Ulf; Jernström, Helena; Henriksson, Karin; von Wachenfeldt, Anna; Liljegren, Annelie; Barbany-Bustinza, Gisela; Rantala, Johanna; Grönberg, Henrik; Stattin, Eva-Lena; Emanuelsson, Monica; Brandell, Richard Rosenquist; Dahl, Niklas

    2011-01-01

    Two single nucleotide polymorphisms (SNPs) at 6q25.1, near the ESR1 gene, have been implicated in the susceptibility to breast cancer for Asian (rs2046210) and European women (rs9397435). A genome-wide association study in Europeans identified two further breast cancer susceptibility variants:

  16. Common alleles at 6q25.1 and 1p11.2 are associated with breast cancer risk for BRCA1 and BRCA2 mutation carriers

    NARCIS (Netherlands)

    A.C. Antoniou (Antonis); C. Kartsonaki (Christiana); O. Sinilnikova (Olga); P. Soucy (Penny); L. McGuffog (Lesley); S. Healey (Sue); A. Lee (Andrew); P. Peterlongo (Paolo); S. Manoukian (Siranoush); B. Peissel (Bernard); D. Zaffaroni (D.); E. Cattaneo (Elisa); M. Barile (Monica); V. Pensotti (Valeria); B. Pasini (Barbara); R. Dolcetti (Riccardo); G. Giannini (Giuseppe); A.L. Putignano; L. Varesco (Liliana); P. Radice (Paolo); P.L. Mai (Phuong); M.H. Greene (Mark); I.L. Andrulis (Irene); G. Glendon (Gord); H. Ozcelik (Hilmi); M. Thomassen (Mads); A-M. Gerdes (Anne-Marie); T.A. Kruse (Torben); U.B. Jensen; D. Cruger (Dorthe); M.A. Caligo (Maria); Y. Laitman (Yael); R. Milgrom (Roni); B. Kaufman (Bella); S. Paluch-Shimon (Shani); E. Friedman (Eitan); N. Loman (Niklas); K. Harbst (Katja); A. Lindblom (Annika); B. Melin (Beatrice); K.L. Nathanson (Katherine); S.M. Domchek (Susan); R. Rebbeck (Timothy); A. Jakubowska (Anna); J. Lubinski (Jan); J. Gronwald (Jacek); T. Huzarski (Tomasz); T. Byrski (Tomasz); C. Cybulski (Cezary); B. Górski (Bohdan); A. Osorio (Ana); T.R. Cajal; F. Fostira (Florentia); R. Andres (Raquel); J. Benitez (Javier); U. Hamann (Ute); F.B.L. Hogervorst (Frans); M.A. Rookus (Matti); M.J. Hooning (Maartje); M.R. Nelen (Marcel); R.B. van der Luijt (Rob); T.A.M. van Os (Theo); C.J. van Asperen (Christi); P. Devilee (Peter); H. Meijers-Heijboer (Hanne); E.B.G. Garcia; S. Peock (Susan); M. Cook (Margaret); D. Frost; R. Platte (Radka); J. Leyland (Jean); D.G. Evans (Gareth); F. Lalloo (Fiona); R. Eeles (Rosalind); L. Izatt (Louise); R. Davidson (Rosemarie); D. Eccles (Diana); K.-R. Ong; F. Douglas (Fiona); J. Paterson (Joan); M.J. Kennedy (John); Z. Miedzybrodzka (Zosia); A.K. Godwin (Andrew); D. Stoppa-Lyonnet (Dominique); B. Buecher (Bruno); M. Belotti (Muriel); C. Tirapo (Carole); S. Mazoyer (Sylvie); L. Barjhoux (Laure); C. Lasset (Christine); D. Leroux (Dominique); L. Faivre (Laurence); M. Bronner (Myriam); F. Prieur (Fabienne); C. Nogues (Catherine); E. Rouleau (Etienne); P. Pujol (Pascal); I. Coupier (Isabelle); M. Frenay (Marc); J. Hopper (John); M.J. Daly (Mark); M-B. Terry (Mary-beth); E.M. John (Esther); S.S. Buys (Saundra); Y. Yassin (Yosuf); A. Miron (Alexander); D. Goldgar (David); C.F. Singer (Christian); M.-K. Tea; G. Pfeiler (Georg); C. Dressler (Catherina); T.V.O. Hansen (Thomas); L. Jønson (Lars); B. Ejlertsen (Bent); R.B. Barkardottir (Rosa); T. Kircchoff (Tomas); K. Offit (Kenneth); M. Piedmonte (Marion); G.C. Rodriguez (Gustavo); L. Small (Laurie); J.F. Boggess (John); S.V. Blank (Stephanie); J. Basil (Jack); M. Azodi (Masoud); A.E. Toland (Amanda); M. Montagna (Marco); S. Tognazzo (Silvia); S. Agata (Simona); E.N. Imyanitov (Evgeny); R. Janavicius (Ramunas); C. Lazaro (Conxi); I. Blanco (Ignacio); P.D.P. Pharoah (Paul); L. Sucheston (Lara); B.Y. Karlan (Beth); C.S. Walsh (Christine); E. Olah (Edith); A. Bozsik (Aniko); S.-H. Teo (Soo-Hwang); J.L. Seldon (Joyce); M.S. Beattie (Mary); E.J. van Rensburg (Elizabeth); M.D. Sluiter (Michelle); O. Diez (Orland); R.K. Schmutzler (Rita); B. Wapenschmidt (Barbara); C.W. Engel (Christoph); A. Meindl (Alfons); I. Ruehl (Ina); R. Varon-Mateeva (Raymonda); K. Kast (Karin); H. Deissler (Helmut); D. Niederacher (Dieter); N. Arnold (Norbert); D. Gadzicki (Dorothea); I. Schönbuchner (Ines); T. Caldes (Trinidad); M. de La Hoya (Miguel); H. Nevanlinna (Heli); K. Aittomäki (Kristiina); M. Dumont (Martine); J. Chiquette (Jocelyne); M. Tischkowitz (Marc); G. Chenevix-Trench (Georgia); J. Beesley (Jonathan); A.B. Spurdle (Amanda); S.L. Neuhausen (Susan); Y.C. Ding (Yuan); Z. Fredericksen (Zachary); X. Wang (Xing); V.S. Pankratz (Shane); F.J. Couch (Fergus); J. Simard (Jacques); D.F. Easton (Douglas); G. Chenevix-Trench (Georgia); P. Karlsson (Per); M. Nordling (Margareta); A. Bergman (Annika); Z. Einbeigi (Zakaria); M. Stenmark-Askmalm (M.); S. Liedgren (Sigrun); Å. Borg (Åke); H. Olsson (Hans); U. Kristoffersson (Ulf); H. Jernström (H.); K. Henriksson (Karin); A. von Wachenfeldt (Anna); A. Liljegren (Annelie); G. Barbany-Bustinza (Gisela); J. Rantala (Johanna); H. Grönberg (Henrik); E.-L. Stattin; M. Emanuelsson (Monica); R.R. Brandell; N. Dahl (Niklas); S. Verhoef; M. Verheus (Martijn); L.J. van 't Veer (Laura); F.E. van Leeuwen; J.M. Collée (Margriet); A.M.W. van den Ouweland (Ans); A. Jager (Agnes); M.M.A. Tilanus-Linthorst (Madeleine); C.M. Seynaeve (Caroline); J.T. Wijnen (Juul); M.P. Vreeswijk (Maaike); R.A.E.M. Tollenaar (Rob); M.J. Ligtenberg (Marjolijn); N. Hoogerbrugge (Nicoline); M.G.E.M. Ausems (Margreet); C.M. Aalfs (Cora); J.J.P. Gille (Jan); Q. Waisfisz (Quinten); E.B. Gómez García (Encarna); C.E. van Roozendaal (Cees); M.J. Blok (Marinus); B. Caanen; J.C. Oosterwijk; A.H. van der Hout (Annemarie); M.J. Mourits; H.F. Vasen (Hans); H. Gregory (Helen); P.J. Morrison (Patrick); L. Jeffers (Lisa); T.J. Cole (Trevor); C. McKeown (Carole); J. Hoffman (Jonathan); A. Donaldson (Alan); S. Downing (Sarah); A. Taylor (Amy); A. Murray (Alexandra); M.T. Rogers (Mark); E. McCann (Emma); M.E. Porteous (Mary); S. Drummond (Sarah); C. Brewer (Carole); E. Kivuva (Emma); A. Searle (Anne); S. Goodman (Selina); K. Hill (Kathryn); V. Murday (Victoria); N. Bradshaw (Nicola); L. Snadden (Lesley); M. Longmuir (Mark); C. Watt (Catherine); S. Gibson (Sarah); E. Haque (Eshika); E. Tobias (Ed); A. Duncan (Alexis); C. Jacobs (Chris); C. Langman (Caroline); A. Whaite (Anna); H. Dorkins (Huw); J. Barwell (Julian); C. Chu (Chengbin); J. Miller (Julie); I.O. Ellis (Ian); C. Houghton (Catherine); L. Side (Lucy); A. Male (Alison); C. Berlin (Cheryl); J. Eason (Jacqueline); R. Collier (Rebecca); O. Claber (Oonagh); I. Jobson (Irene); L.J. Walker (Lisa); D. McLeod (Diane); D. Halliday (Dorothy); S. Durell (Sarah); B. Stayner (Barbara); S. Shanley (Susan); N. Rahman (Nazneen); R. Houlston (Richard); E.K. Bancroft (Elizabeth); L. D'Mello (Lucia); E. Page (Elizabeth); A. Ardern-Jones (Audrey); K. Kohut (Kelly); J. Wiggins (Jennifer); E. Castro (Elena); A. Mitra (Anita); L. Robertson (Lisa); O. Quarrell (Oliver); C. Bardsley (Cathryn); H. Ehrencrona (Hans); S.V. Hodgson (Shirley); D.E. Barton (David); S. Goff (Sheila); G. Brice (Glen); L. Winchester (Lizzie); C. Eddy (Charlotte); V. Tripathi (Vishakha); V. Attard (Virginia); A. Lucassen (Anneke); G. Crawford (Gillian); D. McBride (Donna); S. Smalley (Sarah); J.W. Adlard (Julian); B. Arver (Brita Wasteson)

    2011-01-01

    textabstractTwo single nucleotide polymorphisms (SNPs) at 6q25.1, near the ESR1 gene, have been implicated in the susceptibility to breast cancer for Asian (rs2046210) and European women (rs9397435). A genome-wide association study in Europeans identified two further breast cancer susceptibility

  17. 76 FR 61558 - Airworthiness Directives; Dowty Propellers Type R212/4-30-4/22 and R251/4-30-4/49 Propeller...

    Science.gov (United States)

    2011-10-05

    ... Airworthiness Directives; Dowty Propellers Type R212/4-30-4/22 and R251/4-30-4/49 Propeller Assemblies AGENCY... 49 of the United States Code specifies the FAA's authority to issue rules on aviation safety...--AIRWORTHINESS DIRECTIVES 0 1. The authority citation for part 39 continues to read as follows: Authority: 49 U.S...

  18. 76 FR 27281 - Airworthiness Directives; Dowty Propellers Type R212/4-30-4/22 and R251/4-30-4/49 Propeller...

    Science.gov (United States)

    2011-05-11

    ... Airworthiness Directives; Dowty Propellers Type R212/4-30-4/22 and R251/4-30-4/49 Propeller Assemblies AGENCY... Rulemaking Title 49 of the United States Code specifies the FAA's authority to issue rules on aviation safety... authority citation for part 39 continues to read as follows: Authority: 49 U.S.C. 106(g), 40113, 44701. Sec...

  19. Common alleles at 6q25.1 and 1p11.2 are associated with breast cancer risk for BRCA1 and BRCA2 mutation carriers

    DEFF Research Database (Denmark)

    Antoniou, Antonis C; Kartsonaki, Christiana; Sinilnikova, Olga M

    2011-01-01

    Two single nucleotide polymorphisms (SNPs) at 6q25.1, near the ESR1 gene, have been implicated in the susceptibility to breast cancer for Asian (rs2046210) and European women (rs9397435). A genome-wide association study in Europeans identified two further breast cancer susceptibility variants: rs...... to a better understanding of the biology of tumour development in these women....

  20. Two patients with intellectual disability, overlapping facial features, and overlapping deletions in 6p25.1p24.3

    NARCIS (Netherlands)

    Kuipers, B.C.; Vulto-van Silfhout, A.T.; Marcelis, C.L.M.; Pfundt, R.P.; Leeuw, N. de; Vries, B. de

    2013-01-01

    The clinical and molecular characterizations of two patients with a 1.4 Mb overlapping deletion in the 6p25.1p24.3 region are reported. In addition to the mild intellectual disability, they shared feeding problems in infancy and several dysmorphic facial features including a prominent forehead,

  1. Down-regulation of Connexin43 expression reveals the involvement of caveolin-1 containing lipid rafts in human U251 glioblastoma cell invasion.

    Science.gov (United States)

    Strale, Pierre-Olivier; Clarhaut, Jonathan; Lamiche, Coralie; Cronier, Laurent; Mesnil, Marc; Defamie, Norah

    2012-11-01

    Glioblastoma cells are characterized by high proliferation and invasive capacities. Tumor development has been associated with a decrease of gap-junctional intercellular communication, but the concrete involvement of gap junction proteins, connexins, remains elusive since they are also suspected to promote cell invasion. In order to better understand how connexins control the glioma cell phenotype, we studied the consequences of inhibiting the intrinsic expression of the major astrocytic connexin, Connexin43, in human U251 glioblastoma cells by the shRNA strategy. The induced down-regulation of Cx43 expression has various effects on the U251 cells such as increased clonogenicity, angiogenesis and decreased adhesion on specific extracellular matrix proteins. We demonstrate that the invasion capacity measured in vitro and ex vivo correlates with Cx43 expression level. For the first time in a cancer cell context, our work demonstrates that Cx43 cofractionates, colocalizes and coimmunoprecipitates with a lipid raft marker, caveolin-1 and that this interaction is inversely correlated to the level of Cx43. This localization of Cx43 in these lipid raft microdomains regulates both homo- and heterocellular gap junctional communications (respectively between U251 cells, or between U251 cells and astrocytes). Moreover, the adhesive and invasive capacities are not dependent, in our model, on Cav-1 expression level. Our results tend to show that heterocellular gap junctional communication between cancer and stroma cells may affect the behavior of the tumor cells. Altogether, our data demonstrate that Cx43 controls the tumor phenotype of glioblastoma U251 cells and in particular, invasion capacity, through its localization in lipid rafts containing Cav-1. Copyright © 2011 Wiley Periodicals, Inc.

  2. Modulation of voltage-gated Na+ and K+ channels by pumiliotoxin 251D: a "joint venture" alkaloid from arthropods and amphibians.

    Science.gov (United States)

    Vandendriessche, Thomas; Abdel-Mottaleb, Yousra; Maertens, Chantal; Cuypers, Eva; Sudau, Alexander; Nubbemeyer, Udo; Mebs, Dietrich; Tytgat, Jan

    2008-03-01

    Certain amphibians provide themselves with a chemical defense by accumulating lipophilic alkaloids into skin glands from dietary arthropods. Examples of such alkaloids are pumiliotoxins (PTXs). In general, PTXs are known as positive modulators of voltage-gated sodium channels (VGSCs). Unlike other PTXs, PTX 251D does not share this characteristic. However, mice and insect studies showed that PTX 251D is highly toxic and to date the basis of its toxicity remains unknown. In this work, we searched for the possible target of PTX 251D. The toxin was therefore made synthetically and tested on four VGSCs (mammalian rNa(v)1.2/beta(1), rNa(v)1.4/beta(1), hNa(v)1.5/beta(1) and insect Para/tipE) and five voltage-gated potassium channels (VGPCs) (mammalian rK(v)1.1-1.2, hK(v)1.3, hK(v)11.1 (hERG) and insect Shaker IR) expressed heterologously in Xenopus laevis oocytes, using the two-electrode voltage clamp technique. PTX 251D not only inhibited the Na(+) influx through the mammalian VGSCs but also affected the steady-state activation and inactivation. Interestingly, in the insect ortholog, the inactivation process was dramatically affected. Additionally, PTX 251D inhibited the K(+) efflux through all five tested VGPCs and slowed down the deactivation kinetics of the mammalian VGPCs. hK(v)1.3 was the most sensitive channel, with an IC(50) value 10.8+/-0.5 microM. To the best of our knowledge this is the first report of a PTX affecting VGPCs.

  3. Spectroscopy of odd Z trans-fermium nuclei: the nuclear structure of Md{sup 251}; Spectroscopie des transfermiums impairs en proton: la structure du noyau de {sup 251}Md

    Energy Technology Data Exchange (ETDEWEB)

    Chatillon, A

    2005-10-01

    The objective of this thesis was to determine the structure of trans-fermium nuclei (Z 100) with odd proton number, which remained largely unexplored. These nuclei were produced in fusion-evaporation reactions with small cross sections below 1 {mu}b. The experimental methods of Recoil-Tagging and Recoil-Decay-Tagging were used for their identification. In order to identify the active orbitals in this mass region, {sup 255}Lr, {sup 251}M1d and {sup 247}Es nuclei have been studied by decay spectroscopy at the University of Jyvaskyla and at GANIL with the LISE spectrometer and the {alpha}-electron detector BEST coupled to four CLover detectors from the EXOGAM array. New states have been observed in each of the isotopes, and their configuration has been proposed. The collective properties were also studied in two experiments using prompt {gamma} and electron spectroscopy, combining the JUROGAM and SACRED arrays, respectively, with the recoil separator RITU and the GREAT spectrometer at its focal plane. A rotational band has been observed for the first time in a proton-odd trans-fermium nucleus. The interpretation of this collective structure is based on the theoretical HFB calculations. (author)

  4. Low dose rectal inoculation of rhesus macaques by SIV smE660 or SIVmac251 recapitulates

    Energy Technology Data Exchange (ETDEWEB)

    Hraber, Peter [Los Alamos National Laboratory; Giorgi, Elena E [Los Alamos National Laboratory; Keele, Brandon [UNIV OF ALABAMA; Li, Hui [UNIV OF ALABAMA; Learn, Gerald [UNIV OF ALABAMA

    2008-01-01

    We recently developed a novel strategy to identify transmitted HIV-1 genomes in acutely infected humans using single-genome amplification and a model of random virus evolution. Here, we used this approach to determine the molecular features of simian immunodeficiency virus (SIV) transmission in 18 experimentally infected Indian rhesus macaques. Animals were inoculated intrarectally (i.r.) or intravenously (i.v.) with stocks of SIVmac251 or SIVsmE660 that exhibited sequence diversity typical of early-chronic HIV-1 infection. 987 full-length SIV env sequences (median of 48 per animal) were determined from plasma virion RNA 1--5 wk after infection. i.r. inoculation was followed by productive infection by one or a few viruses (median 1; range 1--5) that diversified randomly with near starlike phylogeny and a Poisson distribution of mutations. Consensus viral sequences from ramp-up and peak viremia were identical to viruses found in the inocula or differed from them by only one or a few nucleotides, providing direct evidence that early plasma viral sequences coalesce to transmitted/founder viruses. i.v. infection was >2,000-fold more efficient than i.r. infection, and viruses transmitted by either route represented the full genetic spectra of the inocula. These findings identify key similarities in mucosal transmission and early diversification between SIV and HIV-1, and thus validate the SIV-macaque mucosal infection model for HIV-1 vaccine and microbicide research.

  5. A clinical epidemiological study of 251 cases of amyotrophic lateral sclerosis in the south of Brazil Estudo clínico epidemiológico de 251 casos de esclerose lateral amiotrófica no sul do Brasil

    Directory of Open Access Journals (Sweden)

    Lineu Cesar Werneck

    2007-06-01

    Full Text Available OBJECTIVE: To study the clinical forms of amyotrophic lateral sclerosis (ALS and the possible presence of risk factors in order to verify if there is any difference between cases in Paraná, Brazil. METHOD: We studied 251 cases, all of which fulfilled the diagnosis criteria proposed in El Escorial (WFN. Between 1977 and 2004, 157 male and 94 female patients were examined. RESULTS: 220 cases were classified as ALS-Spinal Onset (ALS-SO, 24 as ALS-Bulbar Onset (ALS-BO and 7 as Familial ALS. The mean age at time of evaluation was 54.4±12.3 years, and symptoms had started 17.9±15.7months previously. In the group studied, statistical relationships were found between heavy occupations and males; previous surgeries and females; ALS-BO and dysphagia and dysarthria in females; and ALS-SO and males, cramps, weakness, muscle atrophy, hypertonia, increased deep tendon reflex and abnormal gait. CONCLUSION: The average age at time of evaluation was lower than that registered in the literature but similar to the Brazilian series. Domestic work and heavy occupations appear to be related to precocious perception of the symptoms by interference with daily functions. The socioeconomically higher classes seek medical care early. There was no relationship with exposure to toxic agents or trauma.OBJETIVO: Estudar as formas clínicas de esclerose lateral amiotrófica (ELA e possíveis fatores de risco, a fim de verificar se existem diferenças entre os casos do Paraná, Brasil. MÉTODO: Estudamos 251 casos entre 1977 e 2004, que preencheram os critérios propostos em El Escorial (WFN, sendo 157 do sexo masculino e 94 do feminino. RESULTADOS: Foram classificados como ELA de início espinhal (ELA-IE 220 casos, ELA de início bulbar (ELA-IB 24 casos e 7 casos como ELA familiar. A idade média na avaliação foi 54,4±12,3 anos cujos sintomas iniciaram 17,9 ±15,7 meses antes. Foram encontradas relações estatísticas entre ocupação que demandam esforços físicos com

  6. Identification of a 251 gene expression signature that can accurately detect M. tuberculosis in patients with and without HIV co-infection.

    Directory of Open Access Journals (Sweden)

    Noor Dawany

    Full Text Available BACKGROUND: Co-infection with tuberculosis (TB is the leading cause of death in HIV-infected individuals. However, diagnosis of TB, especially in the presence of an HIV co-infection, can be limiting due to the high inaccuracy associated with the use of conventional diagnostic methods. Here we report a gene signature that can identify a tuberculosis infection in patients co-infected with HIV as well as in the absence of HIV. METHODS: We analyzed global gene expression data from peripheral blood mononuclear cell (PBMC samples of patients that were either mono-infected with HIV or co-infected with HIV/TB and used support vector machines to identify a gene signature that can distinguish between the two classes. We then validated our results using publically available gene expression data from patients mono-infected with TB. RESULTS: Our analysis successfully identified a 251-gene signature that accurately distinguishes patients co-infected with HIV/TB from those infected with HIV only, with an overall accuracy of 81.4% (sensitivity = 76.2%, specificity = 86.4%. Furthermore, we show that our 251-gene signature can also accurately distinguish patients with active TB in the absence of an HIV infection from both patients with a latent TB infection and healthy controls (88.9-94.7% accuracy; 69.2-90% sensitivity and 90.3-100% specificity. We also demonstrate that the expression levels of the 251-gene signature diminish as a correlate of the length of TB treatment. CONCLUSIONS: A 251-gene signature is described to (a detect TB in the presence or absence of an HIV co-infection, and (b assess response to treatment following anti-TB therapy.

  7. Neonatal Caffeine Treatment and Respiratory Function at 11 Years in Children under 1,251 g at Birth.

    Science.gov (United States)

    Doyle, Lex W; Ranganathan, Sarath; Cheong, Jeanie L Y

    2017-11-15

    Caffeine in the newborn period shortens the duration of assisted ventilation and reduces the incidence of bronchopulmonary dysplasia, but its effects on respiratory function in later childhood are unknown. To determine if children born with birth weight less than 1,251 g who were treated with neonatal caffeine had improved respiratory function at 11 years of age compared with children treated with placebo. Children enrolled in the CAP (Caffeine for Apnea of Prematurity) randomized controlled trial and assessed at the Royal Women's Hospital in Melbourne at 11 years of age had expiratory flow rates measured according to the standards of the American Thoracic Society. Values were converted to z-scores predicted for age, height, ethnicity, and sex. Parents completed questionnaires related to their child's respiratory health. A total of 142 children had expiratory flows measured. Expiratory flows were better in the caffeine group, by approximately 0.5 SD for most variables (e.g., FEV 1 ; mean z-score, -1.00 vs. -1.53; mean difference, 0.54; 95% confidence interval, 0.14-0.94; P = 0.008). Fewer children in the caffeine group had values for FVC below the fifth centile (11% vs. 28%; odds ratio, 0.31; 95% confidence interval, 0.12-0.77; P = 0.012). When adjusted for bronchopulmonary dysplasia, the difference in flow rates between groups diminished. Caffeine treatment in the newborn period improves expiratory flow rates in midchildhood, which seems to be achieved by improving respiratory health in the newborn period. Follow-up lung function testing in adulthood is vital for these individuals. Future placebo-controlled randomized trials of neonatal caffeine are unlikely. Clinical trial registered with www.clinicaltrials.gov (NCT00182312).

  8. Polysaccharide peptide isolated from grass-cultured Ganoderma lucidum induces anti-proliferative and pro-apoptotic effects in the human U251 glioma cell line.

    Science.gov (United States)

    Wang, Chunhua; Lin, Dongmei; Chen, Quan; Lin, Shuqian; Shi, Songsheng; Chen, Chunmei

    2018-04-01

    The Ganoderma lucidum ( G. lucidum ) mushroom is one of the most extensively studied functional foods, known for its numerous health benefits, including the inhibition of tumor cell growth. The present study assessed the anti-proliferative and pro-apoptotic activity of a novel G. lucidum polysaccharide peptide (GL-PP) in human glioma U251 cells, which was purified from grass-cultured G. lucidum . GL-PP is a glycopeptide with an average molecular weight of 42,635 Da and a polysaccharide-to-peptide ratio of 88.70:11.30. The polysaccharides were composed of l-arabinose, d-mannose and d-glucose at a molar ratio of 1.329:0.372:2.953 and a total of 17 amino acids were detected. The results of the current study demonstrated that GL-PP significantly inhibited U251 cellular proliferation. The proportion of G 0 /G 1 phase cells and sub-G 1 phase cells significantly increased as the concentration of GL-PP increased, as did the activity of caspase-3. These results indicate that GL-PP directly inhibited human glioma U251 proliferation by inducing cell cycle arrest and promoting apoptosis.

  9. Polysaccharide peptide isolated from grass-cultured Ganoderma lucidum induces anti-proliferative and pro-apoptotic effects in the human U251 glioma cell line

    Science.gov (United States)

    Wang, Chunhua; Lin, Dongmei; Chen, Quan; Lin, Shuqian; Shi, Songsheng; Chen, Chunmei

    2018-01-01

    The Ganoderma lucidum (G. lucidum) mushroom is one of the most extensively studied functional foods, known for its numerous health benefits, including the inhibition of tumor cell growth. The present study assessed the anti-proliferative and pro-apoptotic activity of a novel G. lucidum polysaccharide peptide (GL-PP) in human glioma U251 cells, which was purified from grass-cultured G. lucidum. GL-PP is a glycopeptide with an average molecular weight of 42,635 Da and a polysaccharide-to-peptide ratio of 88.70:11.30. The polysaccharides were composed of l-arabinose, d-mannose and d-glucose at a molar ratio of 1.329:0.372:2.953 and a total of 17 amino acids were detected. The results of the current study demonstrated that GL-PP significantly inhibited U251 cellular proliferation. The proportion of G0/G1 phase cells and sub-G1 phase cells significantly increased as the concentration of GL-PP increased, as did the activity of caspase-3. These results indicate that GL-PP directly inhibited human glioma U251 proliferation by inducing cell cycle arrest and promoting apoptosis. PMID:29541200

  10. A miR-21 inhibitor enhances apoptosis and reduces G2-M accumulation induced by ionizing radiation in human glioblastoma U251 cells

    International Nuclear Information System (INIS)

    Li, Yi; Li, Qiang; Asai, Akio; Kawamoto, Keiji; Zhao Shiguang; Zhen Yunbo; Teng Lei

    2011-01-01

    MicroRNAs (miRNAs) are small noncoding RNAs that take part in diverse biological processes by suppressing target gene expression. Elevated expression of miR-21 has been reported in many types of human cancers. Radiotherapy is a standard adjuvant treatment for patients with glioblastoma. However, the resistance of glioblastoma cells to radiation limits the success of this treatment. In this study, we found that miR-21 expression was upregulated in response to ionizing radiation (IR) in U251 cells, which suggested that miR-21 could be involved in the response of U251 cells to radiation. We showed that a miR-21 inhibitor enhanced IR-induced glioblastoma cell growth arrest and increased the level of apoptosis, which was probably caused by abrogation of the G 2 -M arrest induced by IR. Further research demonstrated that the miR-21 inhibitor induced the upregulation of Cdc25A. Taken together, these findings suggest that miR-21 inhibitor can increase IR-induced growth arrest and apoptosis in U251 glioblastoma cells, at least in part by abrogating G 2 -M arrest, and that Cdc25A is a potential target of miR-21. (author)

  11. PDF 25(1)

    African Journals Online (AJOL)

    AISA

    les plus grands marchés locaux de vivres tels que Mokolo, Mfoundi, Mvog-Mbi et Essos. Pour les trois .... marchés, les légumes feuilles ne sont pas convenablement stockés du fait d'un manque d'infrastructures .... des secteurs publics (l'Etat, les services de vulgarisation) et privés (les institutions de recherche et les ONG) ...

  12. MicroRNA-21 inhibitor sensitizes human glioblastoma cells U251 (PTEN-mutant) and LN229 (PTEN-wild type) to taxol

    International Nuclear Information System (INIS)

    Ren, Yu; Kang, Chun-Sheng; Zhou, Xuan; Mei, Mei; Yuan, Xu-Bo; Han, Lei; Wang, Guang-Xiu; Jia, Zhi-Fan; Xu, Peng; Pu, Pei-Yu

    2010-01-01

    Substantial data indicate that the oncogene microRNA 21 (miR-21) is significantly elevated in glioblastoma multiforme (GBM) and regulates multiple genes associated with cancer cell proliferation, apoptosis, and invasiveness. Thus, miR-21 can theoretically become a target to enhance the chemotherapeutic effect in cancer therapy. So far, the effect of downregulating miR-21 to enhance the chemotherapeutic effect to taxol has not been studied in human GBM. Human glioblastoma U251 (PTEN-mutant) and LN229 (PTEN wild-type) cells were treated with taxol and the miR-21 inhibitor (in a poly (amidoamine) (PAMAM) dendrimer), alone or in combination. The 50% inhibitory concentration and cell viability were determined by the MTT assay. The mechanism between the miR-21 inhibitor and the anticancer drug taxol was analyzed using the Zheng-Jun Jin method. Annexin V/PI staining was performed, and apoptosis and the cell cycle were evaluated by flow cytometry analysis. Expression of miR-21 was investigated by RT-PCR, and western blotting was performed to evaluate malignancy related protein alteration. IC(50) values were dramatically decreased in cells treated with miR-21 inhibitor combine with taxol, to a greater extent than those treated with taxol alone. Furthermore, the miR-21 inhibitor significantly enhanced apoptosis in both U251 cells and LN229 cells, and cell invasiveness was obviously weakened. Interestingly, the above data suggested that in both the PTEN mutant and the wild-type GBM cells, miR-21 blockage increased the chemosensitivity to taxol. It is worth noting that the miR-21 inhibitor additively interacted with taxol on U251cells and synergistically on LN229 cells. Thus, the miR-21 inhibitor might interrupt the activity of EGFR pathways, independently of PTEN status. Meanwhile, the expression of STAT3 and p-STAT3 decreased to relatively low levels after miR-21 inhibitor and taxol treatment. The data strongly suggested that a regulatory loop between miR-21 and STAT3 might

  13. A variant of the H6 homeobox gene maps to the 10q25.1-q26.2 region of human chromosome 10

    Energy Technology Data Exchange (ETDEWEB)

    Stadler, H.S.; Solursh, M. [Univ. of Iowa, Iowa City, IA (United States); Goodfellow, P.J. [Washington Univ. School of Medicine, St. Louis, MO (United States)] [and others

    1994-09-01

    Homeobox genes represent a class of transcription factors which play a major role in the regulation of embryogenesis. Utilizing primers based on the conserved regions of the H6 homeobox gene, we were able to amplify several H6-like homeobox sequences from human genomic DNA. Analysis of these sequences indicated that at least 3 distinct H6-like homeobox regions may be present in Homo sapiens. From these distinct homeobox regions, primers were selected to screen a CEPH mega-YAC library for genomic clones containing the variant H6-like sequences. These screenings identified a YAC clone (YH6var) which contained the variant H6-like homeobox sequence. Utilizing a human/rodent somatic cell panel (Coriell B), the end clones from YH6var were chromosomally mapped to human chromosomes 10 and 16, indicating that YH6var was chimeric. An additional sequence flanking the H6 variant homeobox region was derived by inverse-PCR using YH6var as a template. From this flanking sequence, Homo sapien-specific primers were selected to assign the H6 variant to human chromosome 10 using the same Coriell B panel. The H6 variant gene was sublocalized to the 10q25.1-q26.2 region using a panel of somatic cell hybrids that retain well-characterized deletions/derivatives of chromosome 10. We are currently screening for STS-based markers for genetic linkage studies to confirm our physical mapping to the 10q25.1-q26.2 region as well as for use in linkage studies with developmental defects mapping to the same chromosomal region.

  14. Prevention of drug priming- and cue-induced reinstatement of MDMA-seeking behaviors by the CB1 cannabinoid receptor antagonist AM251.

    Science.gov (United States)

    Nawata, Yoko; Kitaichi, Kiyoyuki; Yamamoto, Tsuneyuki

    2016-03-01

    3,4-Methylenedioxymethamphetamine (MDMA), a methamphetamine (METH) derivative, exhibits METH-like actions at monoamine transporters and positive reinforcing effects in rodents and primates. The purposes of the present study were to determine whether cross-reinstatement would be observed between MDMA and METH and if the cannabinoid receptor, a receptor known to play critical roles in the brain reward system, could modulate MDMA craving. Rats were trained to press a lever for intravenous MDMA (0.3mg/infusion) or METH (0.02mg/infusion) infusions under a fixed ratio 1 schedule paired with drug-associated cues (light and tone). Following drug self-administration acquisition training, rats underwent extinction training (an infusion of saline). Reinstatement tests were performed once the extinction criteria were achieved. In MDMA-trained rats, the MDMA-priming injection (3.2mg/kg, i.p.) or re-exposure to MDMA-associated cues reinstated MDMA-seeking behavior. Additionally, a priming injection of METH (1.0mg/kg, i.p.) also reinstated MDMA-seeking behavior. In contrast, none of the MDMA doses reinstated METH-seeking behavior in the METH-trained rats. The CB1 cannabinoid receptor antagonist AM251 markedly attenuated the MDMA-seeking behaviors induced by MDMA-priming injection or re-exposure to MDMA-associated cues in a dose-dependent manner. These findings show that MDMA has obvious addictive potential for reinstating drug-seeking behavior and that METH can be an effective stimulus for reinstating MDMA-seeking behaviors. Furthermore, based on the attenuating effect of AM251 in the reinstatement of MDMA-seeking behaviors, drugs that suppress CB1 receptors may be used in treatment of MDMA dependence. Copyright © 2016. Published by Elsevier Ireland Ltd.

  15. Replication and functional genomic analyses of the breast cancer susceptibility locus at 6q25.1 generalize its importance in women of chinese, Japanese, and European ancestry.

    Science.gov (United States)

    Cai, Qiuyin; Wen, Wanqing; Qu, Shimian; Li, Guoliang; Egan, Kathleen M; Chen, Kexin; Deming, Sandra L; Shen, Hongbing; Shen, Chen-Yang; Gammon, Marilie D; Blot, William J; Matsuo, Keitaro; Haiman, Christopher A; Khoo, Ui Soon; Iwasaki, Motoki; Santella, Regina M; Zhang, Lina; Fair, Alecia Malin; Hu, Zhibin; Wu, Pei-Ei; Signorello, Lisa B; Titus-Ernstoff, Linda; Tajima, Kazuo; Henderson, Brian E; Chan, Kelvin Y K; Kasuga, Yoshio; Newcomb, Polly A; Zheng, Hong; Cui, Yong; Wang, Furu; Shieh, Ya-Lan; Iwata, Hiroji; Le Marchand, Loic; Chan, Sum Yin; Shrubsole, Martha J; Trentham-Dietz, Amy; Tsugane, Shoichiro; Garcia-Closas, Montserrat; Long, Jirong; Li, Chun; Shi, Jiajun; Huang, Bo; Xiang, Yong-Bing; Gao, Yu-Tang; Lu, Wei; Shu, Xiao-Ou; Zheng, Wei

    2011-02-15

    We evaluated the generalizability of a single nucleotide polymorphism (SNP), rs2046210 (A/G allele), associated with breast cancer risk that was initially identified at 6q25.1 in a genome-wide association study conducted among Chinese women. In a pooled analysis of more than 31,000 women of East-Asian, European, and African ancestry, we found a positive association for rs2046210 and breast cancer risk in Chinese women [ORs (95% CI) = 1.30 (1.22-1.38) and 1.64 (1.50-1.80) for the AG and AA genotypes, respectively, P for trend = 1.54 × 10⁻³⁰], Japanese women [ORs (95% CI) = 1.31 (1.13-1.52) and 1.37 (1.06-1.76), P for trend = 2.51 × 10⁻⁴], and European-ancestry American women [ORs (95% CI) = 1.07 (0.99-1.16) and 1.18 (1.04-1.34), P for trend = 0.0069]. No association with this SNP, however, was observed in African American women [ORs (95% CI) = 0.81 (0.63-1.06) and 0.85 (0.65-1.11) for the AG and AA genotypes, respectively, P for trend = 0.4027]. In vitro functional genomic studies identified a putative functional variant, rs6913578. This SNP is 1,440 bp downstream of rs2046210 and is in high linkage disequilibrium with rs2046210 in Chinese (r(2) = 0.91) and European-ancestry (r² = 0.83) populations, but not in Africans (r² = 0.57). SNP rs6913578 was found to be associated with breast cancer risk in Chinese and European-ancestry American women. After adjusting for rs2046210, the association of rs6913578 with breast cancer risk in African Americans approached borderline significance. Results from this large consortium study confirmed the association of rs2046210 with breast cancer risk among women of Chinese, Japanese, and European ancestry. This association may be explained in part by a putatively functional variant (rs6913578) identified in the region. ©2011 AACR.

  16. Common alleles at 6q25.1 and 1p11.2 are associated with breast cancer risk for BRCA1 and BRCA2 mutation carriers

    DEFF Research Database (Denmark)

    Antoniou, Antonis C; Kartsonaki, Christiana; Sinilnikova, Olga M

    2011-01-01

    11249433 at 1p11.2 and rs999737 in RAD51L1 at 14q24.1. Although previously identified breast cancer susceptibility variants have been shown to be associated with breast cancer risk for BRCA1 and BRCA2 mutation carriers, the involvement of these SNPs to breast cancer susceptibility in mutation carriers...... is currently unknown. To address this, we genotyped these SNPs in BRCA1 and BRCA2 mutation carriers from 42 studies from the Consortium of Investigators of Modifiers of BRCA1/2. In the analysis of 14 123 BRCA1 and 8053 BRCA2 mutation carriers of European ancestry, the 6q25.1 SNPs (r(2) = 0.14) were...... for BRCA2 carriers (HR = 1.14, 95% CI: 1.01-1.28, P-trend = 0.031). SNP rs11249433 (1p11.2) was associated with the risk of breast cancer for BRCA2 mutation carriers (HR = 1.09, 95% CI: 1.02-1.17, P-trend = 0.015), but was not associated with breast cancer risk for BRCA1 mutation carriers (HR = 0.97, 95...

  17. Common alleles at 6q25.1 and 1p11.2 are associated with breast cancer risk for BRCA1 and BRCA2 mutation carriers

    DEFF Research Database (Denmark)

    Antoniou, Antonis C; Kartsonaki, Christiana; Sinilnikova, Olga M

    2011-01-01

    11249433 at 1p11.2 and rs999737 in RAD51L1 at 14q24.1. Although previously identified breast cancer susceptibility variants have been shown to be associated with breast cancer risk for BRCA1 and BRCA2 mutation carriers, the involvement of these SNPs to breast cancer susceptibility in mutation carriers...... is currently unknown. To address this, we genotyped these SNPs in BRCA1 and BRCA2 mutation carriers from 42 studies from the Consortium of Investigators of Modifiers of BRCA1/2. In the analysis of 14 123 BRCA1 and 8053 BRCA2 mutation carriers of European ancestry, the 6q25.1 SNPs (r(2) = 0.14) were...... independently associated with the risk of breast cancer for BRCA1 mutation carriers [hazard ratio (HR) = 1.17, 95% confidence interval (CI): 1.11-1.23, P-trend = 4.5 × 10(-9) for rs2046210; HR = 1.28, 95% CI: 1.18-1.40, P-trend = 1.3 × 10(-8) for rs9397435], but only rs9397435 was associated with the risk...

  18. Low dose rectal inoculation of rhesus macaques by SIV SME660 or SIV MAC251 recapitulates human mucosal infection by HIV-1

    Energy Technology Data Exchange (ETDEWEB)

    Koraber, Bette [Los Alamos National Laboratory; Perelson, Alan [Los Alamos National Laboratory; Hraber, Peter [Los Alamos National Laboratory; Giorgi, E [Los Alamos National Laboratory; Bhattacharya, T [Los Alamos National Laboratory

    2009-01-01

    Recently, we developed a novel approach to the identification of transmitted or early founder HIV -1 genomes in acutely infected humans based on single genome amplification and sequencing. Here we tested this approach in 18 acutely infected Indian rhesus macaques to determine the molecular features of SIV transmission. Animals were inoculated intrarectally (IR) or intravenously (IV) with stocks of SIVmac251 or SIVsmE660 that exhibited sequence diversity typical of early-chronic HIV -1 infection. 987 full-length SIV env sequences (median of 48 per animal) were determined from plasma virion RNA one to five weeks after infection. IR inoculation was followed by productive infection by one or few viruses (median 1; range 1-5) that diversified randomly with near star-like phylogeny and a Poisson distribution of mutations. Consensus viral sequences from ramp-up and peak viremia were identical to viruses found in the inocula or differed from them by only one or few nuc1eotides, providing direct evidence that early plasma viral sequences coalesce to transmitted/founder virus( es). IV infection was approximately 10,000-fold more efficient than IR infection, and viruses transmitted by either route represented the full genetic spectra of the inocula. These findings identify key similarities in mucosal transmission and early diversification between SIV and HIV -1.

  19. Response of a simian immunodeficiency virus (SIVmac251 to raltegravir: a basis for a new treatment for simian AIDS and an animal model for studying lentiviral persistence during antiretroviral therapy

    Directory of Open Access Journals (Sweden)

    Greenhouse Jack

    2010-03-01

    Full Text Available Abstract Background In this study we successfully created a new approach to ART in SIVmac251 infected nonhuman primates. This drug regimen is entirely based on drugs affecting the pre-integration stages of replication and consists of only two nucleotidic/nucleosidic reverse transcriptase inhibitors (Nt/NRTIs and raltegravir, a promising new drug belonging to the integrase strand transfer inhibitor (INSTI class. Results In acutely infected human lymphoid CD4+ T-cell lines MT-4 and CEMx174, SIVmac251 replication was efficiently inhibited by raltegravir, which showed an EC90 in the low nanomolar range. This result was confirmed in primary macaque PBMCs and enriched CD4+ T cell fractions. In vivo monotherapy with raltegravir for only ten days resulted in reproducible decreases in viral load in two different groups of animals. When emtricitabine (FTC and tenofovir (PMPA were added to treatment, undetectable viral load was reached in two weeks, and a parallel increase in CD4 counts was observed. In contrast, the levels of proviral DNA did not change significantly during the treatment period, thus showing persistence of this lentiviral reservoir during therapy. Conclusions In line with the high conservation of the three main amino acids Y143, Q148 and N155 (responsible for raltegravir binding and molecular docking simulations showing similar binding modes of raltegravir at the SIVmac251 and HIV-1 IN active sites, raltegravir is capable of inhibiting SIVmac251 replication both in tissue culture and in vivo. This finding may help to develop effective ART regimens for the simian AIDS model entirely based on drugs adopted for treatment in humans. This ART-treated AIDS nonhuman primate model could be employed to find possible strategies for virus eradication from the body.

  20. Assessment of the toll-like receptor 4 Asp299Gly, Thr399Ile and interleukin-8 -251 polymorphisms in the risk for the development of distal gastric cancer

    Directory of Open Access Journals (Sweden)

    Maldonado-Garza Hector J

    2007-04-01

    Full Text Available Abstract Background The intensity of the inflammation induced by Helicobacter pylori colonization is associated with the development of distal gastric cancer (GC. The host response to H. pylori has been related to genetic polymorphisms that influence both innate and adaptive immune responses. Our aim was to investigate whether the presence of the TLR4 Asp299Gly, TLR4 Thr399Ile and IL-8-251 A/T polymorphisms had any influence in the development of distal GC in a Mexican population. Methods We studied 337 patients that were divided in two groups: 78 patients with histologically confirmed distal GC and 259 non-cancer controls. The presence of H. pylori in the control population was defined by positive results of at least two of four diagnostic tests: serology, histology, rapid urease test and culture. Human DNA was purified and genotyped for TLR4 Asp299Gly polymorphism by pyrosequencing, for TLR4 Thr399Ile by PCR-RFLP and for IL8-251 by the amplification refractory mutation system (ARMS-PCR. Results The non-cancer control group was found to be in Hardy-Weinberg equilibrium at the polymorphic loci studied (chi-square H-W = 0.58 for IL8-251, 0.42 for TLR4 Asp299Gly and 0.17 for TLR4 Thr399Ile. The frequencies of mutated alleles (homozygous plus heterozygous were compared between cases and controls. We found no significant difference for TLR4- Asp299Gly [the 7.7% of distal GC patients and 7.7 % non-cancer controls (p = 0.82] and for TLR4 Thr399Ile [the 1.3% of GC patients and the 5% of the control population (p = 0.2]. In contrast, for IL-8-251 A/T, 80.77% of the GC patients and 66.4% in the control group age and gender matched had at least one copy of mutated allele (OR = 2.12, 95% CI = 1.1–4.2 (p = 0.023. Conclusion This study showed that the IL8-251*A allele could be related to the development of distal gastric cancer in this Mexican population.

  1. The Process and Reason of the Change of Oil-Water Contact of Shahejie Formation in BZ25-1 Oilfield

    Science.gov (United States)

    Cong, F.; Liu, J.

    2015-12-01

    Due to the influence of Neo-tectonic movement, the Shahejie reservoirs in Bohai Bay Basin has undergone late-stage transformation and adjustment, causing the oil-water contact to change. Through studying the changing history of oil-water contact, we can better restore petroleum accumulation process and analyze oil distribution pattern. Based on reservoir geochemistry theory and drilling and logging data, grains with oil inclusion was analyzed, and oil-bearing property, organic extracts and biomarkers was used to determine the present and paleo-oil water contact of Shahejie formation in BZ25-1 oilfield. It suggested that the paleo and present oil-water contact in Shahejie formation locates in different depth, and that Shahejie formation has gone through three petroleum charging stages and has also undergone reservoir adjustment. The POWC(paleo-oil-water contact) of E2S2 reservoirs in BZ25-1-5 well and E2S2 reservoirs in BZ25-1-3 well is lower than OWC(present oil-water contact) at least for 9m and at most for 400m, but the POWC of E2S3 reservoirs in BZ25-1-5 well is higher than OWC at least for 20m and at most for 27.5m. The petroleum accumulation process and the reason for oil-water contact adjustment were studied based on burial history, petroleum generation history, fault re-activation rate and petroleum charging history. It suggested that the three petroleum charging stages are Mid-Miocene(11.5Ma), Late Miocene-Pliocene(6.5-3.5Ma) and Quaternary(2.5Ma-present), among which the second~third charging episode is seen as the major petroleum accumulation stage. The re-activeted faults in several different periods not only served as preferential path for petroleum vertical migration, but also caused petroleum leakage through faults. The petroleum leakage mainly occurred in Neo-tectonic movement period(after 3.5Ma), during which petroleum vertically leaked through re-activated faults and migrated to shallow reservoirs or spilled over surface, meanwhile due to constant

  2. Mucosal B Cells Are Associated with Delayed SIV Acquisition in Vaccinated Female but Not Male Rhesus Macaques Following SIVmac251 Rectal Challenge.

    Science.gov (United States)

    Tuero, Iskra; Mohanram, Venkatramanan; Musich, Thomas; Miller, Leia; Vargas-Inchaustegui, Diego A; Demberg, Thorsten; Venzon, David; Kalisz, Irene; Kalyanaraman, V S; Pal, Ranajit; Ferrari, Maria Grazia; LaBranche, Celia; Montefiori, David C; Rao, Mangala; Vaccari, Monica; Franchini, Genoveffa; Barnett, Susan W; Robert-Guroff, Marjorie

    2015-08-01

    Many viral infections, including HIV, exhibit sex-based pathogenic differences. However, few studies have examined vaccine-related sex differences. We compared immunogenicity and protective efficacy of monomeric SIV gp120 with oligomeric SIV gp140 in a pre-clinical rhesus macaque study and explored a subsequent sex bias in vaccine outcome. Each immunization group (16 females, 8 males) was primed twice mucosally with replication-competent Ad-recombinants encoding SIVsmH4env/rev, SIV239gag and SIV239nefΔ1-13 and boosted twice intramuscularly with SIVmac239 monomeric gp120 or oligomeric gp140 in MF59 adjuvant. Controls (7 females, 5 males) received empty Ad and MF59. Up to 9 weekly intrarectal challenges with low-dose SIVmac251 were administered until macaques became infected. We assessed vaccine-induced binding, neutralizing, and non-neutralizing antibodies, Env-specific memory B cells and plasmablasts/plasma cells (PB/PC) in bone marrow and rectal tissue, mucosal Env-specific antibodies, and Env-specific T-cells. Post-challenge, only one macaque (gp140-immunized) remained uninfected. However, SIV acquisition was significantly delayed in vaccinated females but not males, correlated with Env-specific IgA in rectal secretions, rectal Env-specific memory B cells, and PC in rectal tissue. These results extend previous correlations of mucosal antibodies and memory B cells with protective efficacy. The gp140 regimen was more immunogenic, stimulating elevated gp140 and cyclic V2 binding antibodies, ADCC and ADCP activities, bone marrow Env-specific PB/PC, and rectal gp140-specific IgG. However, immunization with gp120, the form of envelope immunogen used in RV144, the only vaccine trial to show some efficacy, provided more significant acquisition delay. Further over 40 weeks of follow-up, no gp120 immunized macaques met euthanasia criteria in contrast to 7 gp140-immunized and 2 control animals. Although males had higher binding antibodies than females, ADCC and ADCP

  3. Mucosal B Cells Are Associated with Delayed SIV Acquisition in Vaccinated Female but Not Male Rhesus Macaques Following SIVmac251 Rectal Challenge.

    Directory of Open Access Journals (Sweden)

    Iskra Tuero

    2015-08-01

    Full Text Available Many viral infections, including HIV, exhibit sex-based pathogenic differences. However, few studies have examined vaccine-related sex differences. We compared immunogenicity and protective efficacy of monomeric SIV gp120 with oligomeric SIV gp140 in a pre-clinical rhesus macaque study and explored a subsequent sex bias in vaccine outcome. Each immunization group (16 females, 8 males was primed twice mucosally with replication-competent Ad-recombinants encoding SIVsmH4env/rev, SIV239gag and SIV239nefΔ1-13 and boosted twice intramuscularly with SIVmac239 monomeric gp120 or oligomeric gp140 in MF59 adjuvant. Controls (7 females, 5 males received empty Ad and MF59. Up to 9 weekly intrarectal challenges with low-dose SIVmac251 were administered until macaques became infected. We assessed vaccine-induced binding, neutralizing, and non-neutralizing antibodies, Env-specific memory B cells and plasmablasts/plasma cells (PB/PC in bone marrow and rectal tissue, mucosal Env-specific antibodies, and Env-specific T-cells. Post-challenge, only one macaque (gp140-immunized remained uninfected. However, SIV acquisition was significantly delayed in vaccinated females but not males, correlated with Env-specific IgA in rectal secretions, rectal Env-specific memory B cells, and PC in rectal tissue. These results extend previous correlations of mucosal antibodies and memory B cells with protective efficacy. The gp140 regimen was more immunogenic, stimulating elevated gp140 and cyclic V2 binding antibodies, ADCC and ADCP activities, bone marrow Env-specific PB/PC, and rectal gp140-specific IgG. However, immunization with gp120, the form of envelope immunogen used in RV144, the only vaccine trial to show some efficacy, provided more significant acquisition delay. Further over 40 weeks of follow-up, no gp120 immunized macaques met euthanasia criteria in contrast to 7 gp140-immunized and 2 control animals. Although males had higher binding antibodies than females, ADCC

  4. The effects of leptin in combination with a cannabinoid receptor 1 antagonist, AM 251, or cannabidiol on food intake and body weight in rats fed a high-fat or a free-choice high sugar diet.

    Science.gov (United States)

    Wierucka-Rybak, M; Wolak, M; Bojanowska, E

    2014-08-01

    High intake of fats and sugars has prompted a rapid growth in the number of obese individuals worldwide. To further investigate whether simultaneous pharmacological intervention in the leptin and cannabinoid system might change food and water intake, preferences for palatable foods, and body weight, we have examined the effects of concomitant intraperitoneal administration of leptin and AM 251, a cannabinoid 1 (CB1) receptor antagonist, or cannabidiol (CBD), a plant cannabinoid, in rats maintained on either a high-fat (HF) diet (45% energy from fat) or free-choice (FC) diet consisting of high-sucrose and normal rat chow (83% and 61% energy from carbohydrates, respectively). Leptin at a dose of 100 μg/kg injected individually for 3 subsequent days to rats fed a HF diet reduced significantly the daily caloric intake and inhibited body weight gain. The hormone had no significant effects, however, on either caloric intake, body weight or food preferences in rats fed an FC diet. Co-injection of leptin and 1 mg/kg AM 251 resulted in a further significant decrease in HF diet intake and a profound reduction in body weight gain both in HF diet- and FC diet-fed rats. This drug combination, however, had no effect on the consumption of high-sucrose chow. In contrast, 3mg/kg of CBD co-injected with leptin did not modify leptin effects on food intake in rats maintained on an FC or HF diet. None of the drug combinations affected water consumption. It is concluded that the concomitant treatment with leptin and AM 251 attenuated markedly body weight gain in rats maintained on high-calorie diets rich in fat and carbohydrates but did not affect preferences for sweet food.

  5. A t(3;9)(q25.1;q34.3) translocation leading to OLFM1 fusion transcripts in Gilles de la Tourette syndrome, OCD and ADHD

    DEFF Research Database (Denmark)

    Bertelsen, Birgitte; Melchior, Linea; Jensen, Lars Riff

    2015-01-01

    compulsive disorder, attention-deficit/hyperactivity-disorder, as well as other comorbidities, and a translocation t(3;9)(q25.1;q34.3) inherited from a mother with tics. Mate-pair sequencing revealed that the translocation breakpoints truncated the olfactomedin 1 (OLFM1) gene and two uncharacterized......Gilles de la Tourette syndrome (GTS) is a neuropsychiatric disorder with a strong genetic etiology; however, finding of candidate genes is hampered by its genetic heterogeneity and the influence of non-genetic factors on disease pathogenesis. We report a case of a male patient with GTS, obsessive...... transcripts. Reverse-transcription PCR identified several fusion transcripts in the carriers, and OLFM1 expression was found to be high in GTS-related human brain regions. As OLFM1 plays a role in neuronal development it is a likely candidate gene for neuropsychiatric disorders and haploinsufficiency of OLFM1...

  6. Differences in time of virus appearance in the blood and virus-specific immune responses in intravenous and intrarectal primary SIVmac251 infection of rhesus macaques; a pilot study

    Directory of Open Access Journals (Sweden)

    Washington Parks Robyn

    2001-07-01

    Full Text Available Abstract Background HIV-I can be transmitted by intravenous inoculation of contaminated blood or blood product or sexually through mucosal surfaces. Here we performed a pilot study in the SIVmac251 macaque model to address whether the route of viral entry influences the kinetics of the appearance and the size of virus-specific immune in different tissue compartments. Methods For this purpose, of 2 genetically defined Mamu-A*01-positive macaques, 1 was exposed intravenously and the other intrarectally to the same SIVmac251 viral stock and virus-specific CD8+ T-cells were measured within the first 12 days of infection in the blood and at day 12 in several tissues following euthanasia. Results Virus-specific CD8+ T-cell responses to Gag, Env, and particularly Tat appeared earlier in the blood of the animal exposed by the mucosal route than in the animal exposed intravenously. The magnitude of these virus-specific responses was consistently higher in the systemic tissues and GALT of the macaque exposed by the intravenous route, suggesting a higher viral burden in the tissues as reflected by the faster appearance of virus in plasma. Differences in the ability of the virus-specific CD8+ T-cells to respond in vitro to specific peptide stimulation were also observed and the greatest proliferative ability was found in the GALT of the animal infected by the intrarectal route. Conclusions These data may suggest that the natural mucosal barrier may delay viral spreading. The consequences of this observation, if confirmed in studies with a larger number of animals, may have implications in vaccine development.

  7. Prior DNA immunization enhances immune response to dominant and subdominant viral epitopes induced by a fowlpox-based SIVmac vaccine in long-term slow-progressor macaques infected with SIVmac251

    International Nuclear Information System (INIS)

    Radaelli, Antonia; Nacsa, Janos; Tsai, W.-P.; Edghill-Smith, Yvette; Zanotto, Carlo; Elli, Veronica; Venzon, David; Tryniszewska, Elzbieta; Markham, Phil; Mazzara, Gail P.; Panicali, Dennis; Morghen, Carlo De Giuli; Franchini, Genoveffa

    2003-01-01

    A therapeutic vaccine for individuals infected with HIV-1 and treated with antiretroviral therapy (ART) should be able to replenish virus-specific CD4+ T-cells and broaden the virus-specific CD8+ T-cell response in order to maintain CD8+ T-cell function and minimize viral immune escape after ART cessation. Because a combination of DNA and recombinant poxvirus vaccine modalities induces high levels of virus-specific CD4+ T-cell response and broadens the cytolytic activity in naive macaques, we investigated whether the same results could be obtained in SIVmac251-infected macaques. The macaques studied here were long-term nonprogressors that naturally contained viremia but were nevertheless treated with a combination of antiviral drugs to assess more carefully the effect of vaccination in the context of ART. The combination of a DNA expressing the gag and pol genes (DNA-SIV-gp) of SIVmac239 followed by a recombinant fowlpox expressing the same SIVmac genes (FP-SIV-gp) was significantly more immunogenic than two immunizations of FP-SIV-gp in SIVmac251-infected macaques treated with ART. The DNA/FP combination significantly expanded and broadened Gag-specific T-cell responses measured by tetramer staining, ELISPOT, and intracellular cytokine staining and measurement of ex vivo cytolytic function. Importantly, the combination of these vaccine modalities also induced a sizeable expansion in most macaques of Gag-specific CD8-(CD4+) T-cells able to produce TNF-α. Hopefully, this modality of vaccine combination may be useful in the clinical management of HIV-1-infected individuals

  8. Comparative evaluation of oral and intranasal priming with replication-competent adenovirus 5 host range mutant (Ad5hr)-simian immunodeficiency virus (SIV) recombinant vaccines on immunogenicity and protective efficacy against SIV(mac251).

    Science.gov (United States)

    Zhou, Qifeng; Hidajat, Rachmat; Peng, Bo; Venzon, David; Aldrich, M Kristine; Richardson, Ersell; Lee, Eun Mi; Kalyanaraman, V S; Grimes, George; Gómez-Román, V Raúl; Summers, L Ebonita; Malkevich, Nina; Robert-Guroff, Marjorie

    2007-11-19

    Oral, replication-competent Ad-HIV vaccines are advancing to human trials. Previous evaluation of protective efficacy in non-human primates has primarily followed upper respiratory tract administrations. Here we compared sequential oral (O/O) versus intranasal/oral (I/O) priming of rhesus macaques with Ad5 host range mutant-SIV recombinants expressing SIV env/rev, gag, and nef genes followed by boosting with SIV gp120 protein. Cellular immune responses in PBMC were stronger and more frequent after I/O administration. Both groups developed mucosal immunity, including memory cells in bronchial alveolar lavage, and gut-homing receptors on PBMC. Following intrarectal SIV(mac251) challenge, both groups exhibited equivalent, significant protection and robust post-challenge cellular immunity. Our results illustrate the promise of oral replication-competent Ad-recombinant vaccines. Pre-challenge PBMC ELISPOT and proliferative responses did not predict protection in the O/O group, highlighting the need for simple, non-invasive methods to reliably assess mucosal immunity.

  9. Changes in soluble factor-mediated CD8+ cell-derived antiviral activity in cynomolgus macaques infected with simian immunodeficiency virus SIVmac251: relationship to biological markers of progression.

    Science.gov (United States)

    Dioszeghy, Vincent; Benlhassan-Chahour, Kadija; Delache, Benoit; Dereuddre-Bosquet, Nathalie; Aubenque, Celine; Gras, Gabriel; Le Grand, Roger; Vaslin, Bruno

    2006-01-01

    Cross-sectional studies have shown that the capacity of CD8+ cells from human immunodeficiency virus (HIV)-infected patients and simian immunodeficiency virus (SIV) SIVmac-infected macaques to suppress the replication of human and simian immunodeficiency viruses in vitro depends on the clinical stage of disease, but little is known about changes in this antiviral activity over time in individual HIV-infected patients or SIV-infected macaques. We assessed changes in the soluble factor-mediated noncytolytic antiviral activity of CD8+ cells over time in eight cynomolgus macaques infected with SIVmac251 to determine the pathophysiological role of this activity. CD8+ cell-associated antiviral activity increased rapidly in the first week after viral inoculation and remained detectable during the early phase of infection. The net increase in antiviral activity of CD8+ cells was correlated with plasma viral load throughout the 15 months of follow-up. CD8+ cells gradually lost their antiviral activity over time and acquired virus replication-enhancing capacity. Levels of antiviral activity correlated with CD4+ T-cell counts after viral set point. Concentrations of beta-chemokines and interleukin-16 in CD8+ cell supernatants were not correlated with this antiviral activity, and alpha-defensins were not detected. The soluble factor-mediated antiviral activity of CD8+ cells was neither cytolytic nor restricted to major histocompatibility complex. This longitudinal study strongly suggests that the increase in noncytolytic antiviral activity from baseline and the maintenance of this increase over time in cynomolgus macaques depend on both viral replication and CD4+ T cells.

  10. Changes in Soluble Factor-Mediated CD8+ Cell-Derived Antiviral Activity in Cynomolgus Macaques Infected with Simian Immunodeficiency Virus SIVmac251: Relationship to Biological Markers of Progression†

    Science.gov (United States)

    Dioszeghy, Vincent; Benlhassan-Chahour, Kadija; Delache, Benoit; Dereuddre-Bosquet, Nathalie; Aubenque, Celine; Gras, Gabriel; Le Grand, Roger; Vaslin, Bruno

    2006-01-01

    Cross-sectional studies have shown that the capacity of CD8+ cells from human immunodeficiency virus (HIV)-infected patients and simian immunodeficiency virus (SIV) SIVmac-infected macaques to suppress the replication of human and simian immunodeficiency viruses in vitro depends on the clinical stage of disease, but little is known about changes in this antiviral activity over time in individual HIV-infected patients or SIV-infected macaques. We assessed changes in the soluble factor-mediated noncytolytic antiviral activity of CD8+ cells over time in eight cynomolgus macaques infected with SIVmac251 to determine the pathophysiological role of this activity. CD8+ cell-associated antiviral activity increased rapidly in the first week after viral inoculation and remained detectable during the early phase of infection. The net increase in antiviral activity of CD8+ cells was correlated with plasma viral load throughout the 15 months of follow-up. CD8+ cells gradually lost their antiviral activity over time and acquired virus replication-enhancing capacity. Levels of antiviral activity correlated with CD4+ T-cell counts after viral set point. Concentrations of β-chemokines and interleukin-16 in CD8+ cell supernatants were not correlated with this antiviral activity, and α-defensins were not detected. The soluble factor-mediated antiviral activity of CD8+ cells was neither cytolytic nor restricted to major histocompatibility complex. This longitudinal study strongly suggests that the increase in noncytolytic antiviral activity from baseline and the maintenance of this increase over time in cynomolgus macaques depend on both viral replication and CD4+ T cells. PMID:16352548

  11. Sequential priming with simian immunodeficiency virus (SIV) DNA vaccines, with or without encoded cytokines, and a replicating adenovirus-SIV recombinant followed by protein boosting does not control a pathogenic SIVmac251 mucosal challenge.

    Science.gov (United States)

    Demberg, Thorsten; Boyer, Jean D; Malkevich, Nina; Patterson, L Jean; Venzon, David; Summers, Ebonita L; Kalisz, Irene; Kalyanaraman, V S; Lee, Eun Mi; Weiner, David B; Robert-Guroff, Marjorie

    2008-11-01

    Previously, combination DNA/nonreplicating adenovirus (Ad)- or poxvirus-vectored vaccines have strongly protected against SHIV(89.6P), DNAs expressing cytokines have modulated immunity elicited by DNA vaccines, and replication-competent Ad-recombinant priming and protein boosting has strongly protected against simian immunodeficiency virus (SIV) challenge. Here we evaluated a vaccine strategy composed of these promising components. Seven rhesus macaques per group were primed twice with multigenic SIV plasmid DNA with or without interleukin-12 (IL-12) DNA or IL-15 DNA. After a multigenic replicating Ad-SIV immunization, all groups received two booster immunizations with SIV gp140 and SIV Nef protein. Four control macaques received control DNA plasmids, empty Ad vector, and adjuvant. All vaccine components were immunogenic, but the cytokine DNAs had little effect. Macaques that received IL-15-DNA exhibited higher peak anti-Nef titers, a more rapid anti-Nef anamnestic response postchallenge, and expanded CD8(CM) T cells 2 weeks postchallenge compared to the DNA-only group. Other immune responses were indistinguishable between groups. Overall, no protection against intrarectal challenge with SIV(mac251) was observed, although immunized non-Mamu-A*01 macaques as a group exhibited a statistically significant 1-log decline in acute viremia compared to non-Mamu-A*01 controls. Possible factors contributing to the poor outcome include administration of cytokine DNAs to sites different from the Ad recombinants (intramuscular and intratracheal, respectively), too few DNA priming immunizations, a suboptimal DNA delivery method, failure to ensure delivery of SIV and cytokine plasmids to the same cell, and instability and short half-life of the IL-15 component. Future experiments should address these issues to determine if this combination approach is able to control a virulent SIV challenge.

  12. Serial Cervicovaginal exposures with Replication-deficient SIVsm induce higher Dendritic Cell (pDC) and CD4+ T-Cell Infiltrates not associated with prevention but a More Severe SIVmac251 Infection of Rhesus Macaques

    Science.gov (United States)

    ABDULHAQQ, Shaheed A.; MARTINEZ, Melween I.; KANG, Guobin; FOULKES, Andrea S.; RODRIGUEZ, Idia V.; NICHOLS, Stephanie M.; HUNTER, Meredith; SARIOL, Carlos A.; RUIZ, Lynnette A.; ROSS, Brian N.; YIN, Xiangfan; SPEICHER, David W.; HAASE, Ashley T.; MARX, Preston A.; LI, Qinsheng; KRAISELBURD, Edmundo N.; MONTANER, Luis J.

    2014-01-01

    Objective Intravaginal exposure to SIV acutely recruits IFN-α producing plasmacytoid dendritic cells (pDC) and CD4+ T-lymphocyte targets to the endocervix of nonhuman primates. We tested the impact of repeated cervicovaginal exposures to noninfectious, defective SIV particles over 72 hrs on a subsequent cervicovaginal challenge with replication-competent SIV. Methods 34 Female Indian Rhesus macaques were given a three-day, twice-daily vaginal exposures to either SIVsmB7, a replication-deficient derivative of SIVsmH3 produced by a CEMX174 cell clone (n=16), or to CEM supernatant controls (n=18). On the fourth day, animals were either euthanized to assess cervicovaginal immune cell infiltration or intravaginally challenged with SIVmac251. Challenged animals were tracked for plasma viral load and CD4 counts and euthanized at 42 days post infection. Results At the time of challenge, macaques exposed to SIVsmB7, had higher levels of cervical CD123 pDCs (p=0.032) and CD4+ T-Cells (p=0.036) than those exposed to CEM control. Vaginal tissues showed a significant increase in CD4+ T-Cell infiltrates (p=0.048), and a trend towards increased CD68+ cellular infiltrates. After challenge, 12 SIVsmB7-treated macaques showed 2.5-fold greater daily rate of CD4 decline (p=0.0408), and viral load rise (p=0.0036) as compared to 12 control animals. Conclusions Repeated non-productive exposure to viral particles within a short daily timeframe did not protect against infection in spite of pDC recruitment, resulting instead in an accelerated CD4+ T-Cell loss with an increased rate of viral replication PMID:24226059

  13. 16 CFR 251.1 - The guide.

    Science.gov (United States)

    2010-01-01

    ... period. Except in the case of introductory offers, if no substantial sales were made, in fact, at the... Other Merchandising Payments and Services.” In advertising the “Free” promotion, the supplier should...

  14. 24 CFR 207.251 - Definitions.

    Science.gov (United States)

    2010-04-01

    ... Housing Act, as amended. (c) The term mortgage means such a first lien upon real estate and other property as is commonly given to secure advances on, or the unpaid purchase price of, real estate under the laws of the State, district or territory in which the real estate is located, together with the credit...

  15. 24 CFR 92.251 - Property standards.

    Science.gov (United States)

    2010-04-01

    ... rehabilitation that ensure that HOME-assisted housing is decent, safe, and sanitary. In the absence of a local...) Notify the prospective purchaser of the work needed to cure the defects and the time by which defects...

  16. 36 CFR 251.58 - Cost recovery.

    Science.gov (United States)

    2010-07-01

    ... estimated processing costs; (B) A description of the method for periodic billing, payment, and auditing; (C... monitoring costs; (B) A description of the method for periodic billing, payment, and auditing of monitoring... permanent facilities and rehabilitation of the construction or reconstruction site. (3) Billing and payment...

  17. 37 CFR 251.31 - Financial interests.

    Science.gov (United States)

    2010-07-01

    ... such as health insurance or a pension so long as the benefit would not be affected by the outcome of... general partner, except that the personal financial holdings, including stock and bond investments, of...

  18. 30 CFR 251.1 - Definitions.

    Science.gov (United States)

    2010-07-01

    ... to the Act. Human environment means the physical, social, and economic components, conditions, and..., and health of those affected, directly or indirectly, by activities occurring on the OCS. Hydrocarbon..., States, or political subdivisions of States or anyone operating in a manner provided for by treaty or...

  19. 15 CFR 904.251 - Evidence.

    Science.gov (United States)

    2010-01-01

    ... taken to establish matters of aggravation or mitigation. (b) Objections and offers of proof. (1) A party...) Whenever evidence is excluded from the record, the party offering such evidence may make an offer of proof... the agency as an expert body. Where a decision or part thereof rests on official notice of a material...

  20. Publications | Page 251 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    IDRC works with developing-country researchers and institutions to build local capacity through funding, knowledge sharing, and training. Through books, articles, research publications, and studies, we aim to widen the impact of our investment and advance development research. We share the results of our funded ...

  1. 37 CFR 251.1 - Official addresses.

    Science.gov (United States)

    2010-07-01

    ... Express, United Parcel Service and similar corporate courier services), use the following address... through the U.S. Postal Service, use the following address: Copyright Arbitration Royalty Panel, P.O. Box 70977, Southwest Station, Washington, DC 20024-0977. (d) Federal Express, United Parcel Service and...

  2. Publications | Page 251 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    "We need [the EcoHealth] journal to help articulate what ecohealth is and to encourage the growth of the community," said Dr Bruce Wilcox, the publication's editor-in-chief. The journal introduces projects, institutions,... International Association for Ecology and Health—Cultivating Partnerships and Engaging Members.

  3. Publications | Page 251 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    PAHO's involvement was natural, as the organization “has worked with The National Institute... COPEHs Continue to Sow Partnership Seeds ... Simpler Rules of Origin (RoO) with product specific rules can act as a catalyst in trade even if tariff rates are not low. Sector specific restrictiveness across trade agreements are ...

  4. 21 CFR 25.1 - Purpose.

    Science.gov (United States)

    2010-04-01

    ... part implement section 102(2) of NEPA in a manner that is consistent with FDA's authority under the... Administration Manual, part 30: Environmental Protection” (45 FR 76519 to 76534, November 19, 1980). ...

  5. 7 CFR 251.5 - Eligibility determinations.

    Science.gov (United States)

    2010-01-01

    ... funds, must ensure that an organization applying for participation in the program meets the definition... accordance with paragraph (b) of this section. (2) Agencies providing prepared meals. Organizations providing prepared meals must demonstrate, to the satisfaction of the State agency, or eligible recipient agency to...

  6. 5 CFR 251.101 - Introduction.

    Science.gov (United States)

    2010-01-01

    ... Administrative Personnel OFFICE OF PERSONNEL MANAGEMENT CIVIL SERVICE REGULATIONS AGENCY RELATIONSHIPS WITH... to agency operations and personnel management. (c) The purposes of consultation and communication are... communication with organizations representing Federal employees and with other organizations under this part may...

  7. 251 - 258_Hajara_Mobile exhaust

    African Journals Online (AJOL)

    pc

    may exert control over their gas exchange rate varying stomata ... This relationship is inv meaning that as C02 increases, the numbe stomata decreases and vice versa. This oc because as C02 concentration in the air surroun the leaf .... Table 2: Mean stomata measurement on abaxial (lower) surface of plant leaves studied.

  8. 36 CFR 251.53 - Authorities.

    Science.gov (United States)

    2010-07-01

    ... prescribed by the Secretaries of the Interior, Agriculture, and War, December 28, 1906 (43 CFR part 3); (d... purposes, and (iii) education or public activities; and (2) for not over 5 acres for summer homes and...

  9. 47 CFR 80.251 - Scope.

    Science.gov (United States)

    2010-10-01

    ... automatic-alarm-signal keying devices, survival craft radio equipment, watch receivers, radar equipment and...-generator, rectifier, or other unit required to convert the ship primary power to the phase, frequency, or...

  10. 25 CFR 700.251 - Fees.

    Science.gov (United States)

    2010-04-01

    ... international organizations when to do so without charge is an appropriate courtesy, or when the recipient is... established business custom (e.g., furnishing personal reference data to prospective employers of former...

  11. 40 CFR 60.251 - Definitions.

    Science.gov (United States)

    2010-07-01

    ... (excluding underground mining operations) which prepares coal by one or more of the following processes... equipment means any machinery used to reduce the size of coal or to separate coal from refuse, and the equipment used to convey coal to or remove coal and refuse from the machinery. This includes, but is not...

  12. Angular distributions of protons scattered by 40Ar nuclei with excitation of the 2+(1.46 MeV) and 3-(3.68 MeV) collective levels for incident energies of 25.1, 32.5, and 40.7 MeV

    International Nuclear Information System (INIS)

    Okumusoglu, N. T.; Gorur, F. Korkmaz; Birchall, J.; Soukhovitskii, E. Sh.; Capote, R.; Quesada, J. M.; Chiba, S.

    2007-01-01

    Elastic and inelastic scattering of unpolarized and polarized protons by 40 Ar nuclei for incident energies between 20 and 50 MeV has been studied by reanalyzing experimental scattering spectra for the 2 + (1.46 MeV) and 3 - (3.68 MeV) levels in the angular range 30 degree sign -160 degree sign for incident protons of energies of 25.1, 32.5, and 40.7 MeV. An isospin dependent soft-rotator coupled-channels optical model with the potential containing a dispersive term with a nonlocal contribution is used to analyze the data

  13. H:\\PMKER 25(1)\\PDF 25(1)\\KOTAIX.xps

    African Journals Online (AJOL)

    AISA

    au Sud et au Centre-Ouest de la Côte d'Ivoire sur deux années afin, d'améliorer le developpement de la tomate. Mais de ... ABSTRACT. EFFECT OF LIQUID ORGANIC FERTILIZER «DRAGON 1» ON THE DEVELOPMENT OF TOMATO IN SOUTHERN AND CENTRAL - ...... (CSRS) pour le financement du Projet de thèse.

  14. H:\\PMKER 25(1)\\PDF 25(1)\\EMANFO.xps

    African Journals Online (AJOL)

    AISA

    on Potato Dextrose Agar (PDA) medium to identify potential microorganisms. This study has identified the presence of four genera of mold : Aspergillus, Alternaria, Penicillium and Fusarium. Some species of these genera are generally involved in animal fungal infections and fungal diseases in plants. Thus, the genera.

  15. H:\\PMKER 25(1)\\PDF 25(1)\\AKOUANGO.xps

    African Journals Online (AJOL)

    AISA

    touristique. Conscient de cet enjeu, nous avons mené au Centre de Recherche Mondika, pendant neuf mois, une étude portant sur le suivi écologique du groupe de Gorilles nommé ''Buka'' en cours d'habituation à la présence humaine en vue de connaître son rythme circadien (rythme biologique pendant une période.

  16. H:\\PMKER 25(1)\\PDF 25(1)\\ZOBI.xps

    African Journals Online (AJOL)

    AISA

    MODELLING THE DYNAMIC OF COMERCIAL TREES SPECIES STANDAFTER LIBERATION THINNING IN NATURAL RAINFORESTS. OF CÔTE D'IVOIRE. The silvicultural plots of Mopri and Irobo aim to ..... Growth and yield of a tropical rain forest in the Brazilian Amazon 13 years after logging. For. Ecol. Manage. 71 (3) :.

  17. H:\\PMKER 25(1)\\PDF 25(1)\\ONDO-OVONO.xps

    African Journals Online (AJOL)

    AISA

    rendement (nombre de panicules / m2, nombre de grains / panicule, poids de 1 000 grains, taux de stérilité) ont été évalués durant la phase ..... L'analyse des paramètres de rendement et de ses composantes montre que les six nouvelles aux facteurs climatiques et à la bonne activité biologique. Un tel développement des ...

  18. H:\\PMKER 25(1)\\PDF 25(1)\\AMOUKOU.xps

    African Journals Online (AJOL)

    AISA

    TENEUR EN HUILE ET ELEMENTS MINERAUX. La teneur en huile a été très variable pour une même accession selon la méthode d'extraction utilisée. Ainsi, le taux d'extraction a été plus élevé avec la méthode du solvant qu'avec la méthode manuelle. La teneur en huile des accessions de sésame a été importante. Elle a.

  19. H:\\PMKER 25(1)\\PDF 25(1)\\KIKOUN.xps

    African Journals Online (AJOL)

    AISA

    évolution de la richesse, de la pureté ..... Richesse au labo agro = 100 x Somme Tonnes ..... Sugar industry technologists ; NEW YORK, éd. S.I.T. 298 p. Hildebrand C., 2002. An independent assessment of the sugar industry. Report to the Hon Truss ...

  20. 76 FR 251 - Country of Origin Labeling of Packed Honey

    Science.gov (United States)

    2011-01-04

    ... Small Business Administration [13 CFR 121.201] defines small agricultural producers as those having... considered small businesses, while most importers would not. National Agricultural Statistics Service (NASS... sampler in the performance of his duties by intimidation, threat, assault, bribery, or any other means...

  1. 24 CFR 251.1 - Termination of program.

    Science.gov (United States)

    2010-04-01

    ... binding Conditional or Firm Commitment is proposed to be issued. This procedure applies to lenders with...: (1) Firm commitments for insurance of advances may be granted two 60-day extensions; (2) Conditional... considers a commitment to be legally binding if: (1) It conforms to the format prescribed in the appropriate...

  2. 29 CFR 1926.251 - Rigging equipment for material handling.

    Science.gov (United States)

    2010-07-01

    ... working loads and shall be proof-tested prior to use to 125 percent of their rated load. (5) Scope. This... their body diameter. (14) Safe operating temperatures. Fiber core wire rope slings of all grades shall... unless proof tested by the manufacturer or equivalent entity at twice their rated capacity prior to...

  3. 27 CFR 19.251 - Relief of surety from bond.

    Science.gov (United States)

    2010-04-01

    ... deposits wholly subsequent to the effective date of the new or superseding bond. Notwithstanding such relief, the surety shall remain liable for the tax on all distilled spirits or wines produced, or for... bond for all spirits or wines on hand or in transit to the bonded premises or bonded wine cellar, as...

  4. 8 CFR 251.1 - Arrival manifests and lists.

    Science.gov (United States)

    2010-01-01

    ... performed, the master or agent shall note which exception listed in section 258 of the Act permits the work.... (A) To invoke the exception for tankers, the master or agent shall note on the manifest that the.... (iv) If longshore work will be performed under the prevailing practice exception, the master or agent...

  5. Correction [Physics Today, v. 25(1) p. 53

    International Nuclear Information System (INIS)

    1972-01-01

    November 1971, page 37—The figure illustrating estimated radiation doses in Joseph Lieberman's article was credited to the Division of Criteria and Standards, Office of Radiation Programs of the Environmental Protection Agency. Lieberman tells us that the data presented there should be attributed to an interagency special‐studies group working with the Criteria and Standards division; the participating agencies were the Department of Defense, the Department of Health, Education and Welfare, the Atomic Energy Commission and the Environmental Protection Agency. Their final report is due to be issued in June.

  6. All projects related to | Page 251 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Topic: International cooperation, DEVELOPMENT AID, SOUTH SOUTH RELATIONS. Region: Far East Asia, Singapore, Central Asia, South Asia, Philippines. Total Funding: CA$ 87,800.00. Anchoring Singapore Philanthropy in Southeast Asia. Project. Philanthropy in Singapore has traditionally had a charitable and local ...

  7. Time Warp Operating System, Version 2.5.1

    Science.gov (United States)

    Bellenot, Steven F.; Gieselman, John S.; Hawley, Lawrence R.; Peterson, Judy; Presley, Matthew T.; Reiher, Peter L.; Springer, Paul L.; Tupman, John R.; Wedel, John J., Jr.; Wieland, Frederick P.; hide

    1993-01-01

    Time Warp Operating System, TWOS, is special purpose computer program designed to support parallel simulation of discrete events. Complete implementation of Time Warp software mechanism, which implements distributed protocol for virtual synchronization based on rollback of processes and annihilation of messages. Supports simulations and other computations in which both virtual time and dynamic load balancing used. Program utilizes underlying resources of operating system. Written in C programming language.

  8. AF-Geospace User’s Manual Version 2.5.1 and Version 2.51P

    Science.gov (United States)

    2012-08-01

    Graphical Option .................................................................................. 241 The USE TEXTURE Graphical Option...1980’s are identical to the fast CME proxies of the 1990’s. The concept of particle acceleration in the solar corona by fast CME’s is still...Other diagnostics of shock generation and propagation into the solar corona may be coronal mass ejection information and forecaster judgment. STOA

  9. Wang et al., Afr J Tradit Complement Altern Med. (2013) 10(2):251 ...

    African Journals Online (AJOL)

    AJTCAM

    vegetable and seeds are full of oil. It is also a traditional herb in China. Ingredients isolated from Perilla frutescens(L.) such as rosmarinic acid, caffeic acid and apigenin have been demonstrated to inhibit cell proliferation in various type of cancers. However, there are less reports about the effects of isoegomaketone(IK) on ...

  10. : tous les projets | Page 251 | CRDI - Centre de recherches pour le ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    La maladie de Chagas, une maladie grave à transmission vectorielle, impose une lourde charge de morbidité aux populations pauvres de l'Amérique latine et des Caraïbes (région ALC). Date de début : 31 mars 2011. End Date: 31 mars 2014. Sujet: TRYPANOSOMIASIS, ENVIRONMENTAL ENGINEERING, ...

  11. 30 CFR 251.6 - Obligations and rights under a permit or a Notice.

    Science.gov (United States)

    2010-07-01

    ...) Cause harm or damage to life (including fish and other aquatic life), property, or to the marine... leased); (4) Cause pollution; (5) Disturb archaeological resources; (6) Create hazardous or unsafe... environmental hazards which imminently threaten life and property; or (3) Adversely affect the environment...

  12. 37 CFR 251.46 - Conduct of hearings: Role of arbitrators.

    Science.gov (United States)

    2010-07-01

    ... shall have responsibility for: (1) Setting the order of presentation of evidence and appearance of... decorum of the parties and their counsel, and insuring that the proceedings are fair and impartial; and (5...

  13. Impact of pEGFP mediated ING4 gene on growth of glioma U251 ...

    African Journals Online (AJOL)

    Jane

    2011-06-22

    Jun 22, 2011 ... Chen B, Deng YF (2008) Advances in the anti-tumor effects of ING4. Chin. J. Mini. Invas Neurosurg. 13(3): 141-144. Garkavtsev I, Kozin SV, Chernova O, Xu L, Winkler F, Brown E, Barnett. GH, Jain RK (2004). The candidate tumour suppressor protein ING4 regulates brain tumour growth and angiogenesis.

  14. Rational design of cyclodextrin glycosyltransferase from Bacillus circulans strain 251 to increase alpha-cyclodextrin production

    NARCIS (Netherlands)

    Uitdehaag, JCM; Penninga, D; van Alebeek, GJWM; Smith, LM; Dijkstra, BW; Dijkhuizen, L

    2000-01-01

    Cyclodextrin glycosyltransferases (CGTase) (EC;2.4.1.19) are extracellular bacterial enzymes that generate cyclodextrins from starch. All known CGTases produce mixtures of alpha, beta, and gamma-cyclodextrins. A maltononaose inhibitor bound to the active site of the CGTase from Bacillus circulans

  15. 36 CFR 251.54 - Proposal and application requirements and procedures.

    Science.gov (United States)

    2010-07-01

    ... radioactive or other hazardous substances. (2) Results of initial screening. Any proposed use other than a... lands, the proponent is required to contact the Forest Service office(s) responsible for the management... with the State Office, Bureau of Land Management, pursuant to regulations at 43 CFR part 2882. (c...

  16. People and things. CERN Courier, Jan-Feb 1985, v. 25(1)

    International Nuclear Information System (INIS)

    Anon.

    1985-01-01

    The article reports on achievements of various people, staff changes and position opportunities within the CERN organization and contains news updates on upcoming or past events. The General Assembly of the International Union of Pure and Applied Physics (IUPAP) met in Trieste in October. At this meeting the People 's Republic of China became a full member of IUPAP. Last year, voting took place for the new Executive Committee of the Division of Particles and Fields of the American Physical Society. A NATO Advanced Study Institute 'New Vistas in Electro-Nuclear Physics' will be held in Banff, Alberta, Canada, from 22 August to 4 September. The 1985 International Symposium on Lepton and Photon Interactions at High Energies is being held in Kyoto from 19-24 August. A conference on Computing in High Energy Physics will be held at Amsterdam, the Netherlands University of Amsterdam and will be devoted mainly to three subjects: networking, embedded systems and vector and parallel processing. The 1985 CERN/Joint Institute for Nuclear Research (JINR, Dubna, USSR) School of Physics, the ninth in the series, will be held from 1-14 September at Urbino, Italy. The basic aim of these schools is to teach various aspects of high energy physics, especially theoretical, to young experimentalists drawn mainly from CERN and JINR Member States

  17. Dynamics of viral replication in blood and lymphoid tissues during SIVmac251 infection of macaques

    Directory of Open Access Journals (Sweden)

    Mannioui Abdelkrim

    2009-01-01

    Full Text Available Abstract Background Extensive studies of primary infection are crucial to our understanding of the course of HIV disease. In SIV-infected macaques, a model closely mimicking HIV pathogenesis, we used a combination of three markers -- viral RNA, 2LTR circles and viral DNA -- to evaluate viral replication and dissemination simultaneously in blood, secondary lymphoid tissues, and the gut during primary and chronic infections. Subsequent viral compartmentalization in the main target cells of the virus in peripheral blood during the chronic phase of infection was evaluated by cell sorting and viral quantification with the three markers studied. Results The evolutions of viral RNA, 2LTR circles and DNA levels were correlated in a given tissue during primary and early chronic infection. The decrease in plasma viral load principally reflects a large decrease in viral replication in gut-associated lymphoid tissue (GALT, with viral RNA and DNA levels remaining stable in the spleen and peripheral lymph nodes. Later, during chronic infection, a progressive depletion of central memory CD4+ T cells from the peripheral blood was observed, accompanied by high levels of viral replication in the cells of this subtype. The virus was also found to replicate at this point in the infection in naive CD4+ T cells. Viral RNA was frequently detected in monocytes, but no SIV replication appeared to occur in these cells, as no viral DNA or 2LTR circles were detected. Conclusion We demonstrated the persistence of viral replication and dissemination, mostly in secondary lymphoid tissues, during primary and early chronic infection. During chronic infection, the central memory CD4+ T cells were the major site of viral replication in peripheral blood, but viral replication also occurred in naive CD4+ T cells. The role of monocytes seemed to be limited to carrying the virus as a cargo because there was an observed lack of replication in these cells. These data may have important implications for the targeting of HIV treatment to these diverse compartments.

  18. 7 CFR 1710.251 - Construction work plans-distribution borrowers.

    Science.gov (United States)

    2010-01-01

    ... additional capacity for new consumers; (4) New substation facilities or additions to existing substations; (5) Transmission and substation facilities required to support the distribution system; (6) Distribution equipment...

  19. Decree no. 2004-251 from March 19, 2004 relative to public utility obligations in the gas sector; Decret no. 2004-251 du 19 mars 2004 relatif aux obligations de service public dans le secteur du gaz

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    2004-03-01

    This decree defines the public utility obligations that gas suppliers and gas facility operators (transportation and distribution networks, underground storage facilities, LNG facilities) have to fulfill in order to ensure without interruption the continuity of gas supplies to their clients. (J.S.)

  20. 46 CFR 251.1 - Applications for construction-differential subsidy under Title V, Merchant Marine Act, 1936, as...

    Science.gov (United States)

    2010-10-01

    .... However the Board will permit modifications such as changes to reefer cargo capacity, deep tankage, and... contract will be allowed only when the net effect of the change will with reasonable certainty (a) comply... deep tanks, etc. This upper limit shall be adjusted downward to take into account features including...

  1. The three transglycosylation reactions catalyzed by cyclodextrin glycosyltransferase from Bacillus circulans (strain 251) proceed via different kinetic mechanisms

    NARCIS (Netherlands)

    Veen, Bart A. van der; Alebeek, Gert-Jan W.M. van; Uitdehaag, Joost C.M.; Dijkstra, Bauke W.; Dijkhuizen, Lubbert

    Cyclodextrin glycosyltransferase (CGTase) catalyzes three transglycosylation reactions via a double displacement mechanism involving a covalent enzyme-intermediate complex (substituted-enzyme intermediate). Characterization of the three transglycosylation reactions, however, revealed that they

  2. Intake assessment of the food additives nitrite (E 249 and E 250) and nitrate (E 251 and E 252)

    NARCIS (Netherlands)

    Sprong RC; Niekerk EM; Beukers MH; VVH; V&Z

    2017-01-01

    Nitrate and nitrite are authorised as preservatives in certain food products, such as salami, ham (nitrite) and cheese (nitrate). They prevent food spoilage and protect the consumer against food-borne pathogens. Next to that, nitrate and nitrite play a role in food colour retention and contribute to

  3. The Streambank Erosion Control Evaluation and Demonstration Act of 1974, Section 32, Public Law 93-251. Main Report.

    Science.gov (United States)

    1981-12-01

    of long-term. comprehensive studies ins ols ing channel alignment, bank stabilization, or navigation channeli/ation. (U. S. ArmN Engineer Civil Works...Program of the Civil Works Investigation Study on Materials U.S. Army Engineer Waterways Experiment Station, Vicksburg, Mississippi Technical Report...Pearl River Basin Development District, Mississippi; (64) La Asociacion De Santa Rosa De Lima De Abiquiu. Inc., New Mexico; (65) Pittsylvania Soil and

  4. Decree no. 2004-251 from March 19, 2004 relative to public utility obligations in the gas sector

    International Nuclear Information System (INIS)

    2004-03-01

    This decree defines the public utility obligations that gas suppliers and gas facility operators (transportation and distribution networks, underground storage facilities, LNG facilities) have to fulfill in order to ensure without interruption the continuity of gas supplies to their clients. (J.S.)

  5. 36 CFR 251.15 - Conditions, rules and regulations to govern exercise of mineral rights reserved in conveyances to...

    Science.gov (United States)

    2010-07-01

    ... fide prospecting for, drilling, mining (including the milling or concentration of ores), and removal of... repair or replace any improvements damaged or destroyed by the mining operations and restore the land to... repair, replacement or restoration. (iv) Failure to comply with the terms and conditions of the aforesaid...

  6. 36 CFR 251.18 - Rights-of-way reserved by the grantor on lands conveyed to the United States.

    Science.gov (United States)

    2010-07-01

    ... reservation shall be paid for at rates to be prescribed by the Forest Officer in charge, which rates shall be the usual stumpage prices charged in the locality in sales of national forest timber of the same kind or species; for injury to timber, second growth, and reproduction, the amount of actual damage shall...

  7. The Streambank Erosion Control Evaluation and Demonstration Act of 1974, Section 32, Public Law 93-251. Appendix B. Hydraulic Research.

    Science.gov (United States)

    1981-12-01

    were anchored with cables at top of the bank. The approach channel and test section with gabions before flow are shown in Photo 3. The approach channel...different hard-point spacing and flow velocities can be evaluated from specific prototype demonstration sites (existing or future). Gabion protection... Gabion hard-point protection No. 2, before flow 4- -FfV 4J. &~ Photo 7. Gabion hard-point protection No. 2, after flow B-3-8 4 ............. Photo 8

  8. An Evaluation of the Training Provided in Correctional Institutions under the Manpower Development and Training Act, Section 251. Volume I: Perspectives on Offender Rehabilitation. Final Report.

    Science.gov (United States)

    Hudson, John B.

    This first volume of a three part study evaluating vocational training provided in correctional institutions, focuses on theoretical foundations and historical developments of offender vocational rehabilitation. The effect of factors such as the family, community environment, and employment status on criminal behavior and rehabilitation are…

  9. An Evaluation of the Training Provided in Correctional Institutions under the Manpower Development and Training Act, Section 251. Volume II: Profiles of Inmate Training Projects. Final Report.

    Science.gov (United States)

    McDonnell, John C.

    As the second volume in a three part study evaluating vocational training provided in occupational institutions, this document is concerned with the administrative and legislative development of vocational training in correctional institutions, and with the characteristics of the 25 projects covered by this study. The basic aspects considered for…

  10. Frequency of and risk factors for epistaxis associated with exercise-induced pulmonary hemorrhage in horses: 251,609 race starts (1992-1997).

    Science.gov (United States)

    Takahashi, T; Hiraga, A; Ohmura, H; Kai, M; Jones, J H

    2001-05-01

    To determine the frequency of epistaxis during or after racing among racehorses and identify factors associated with development of epistaxis. Retrospective study. 247,564 Thoroughbred and 4,045 Anglo-Arab race starts. Race start information (breed, age, sex, racing distance, and race type) was obtained for Thoroughbred and Anglo-Arab horses racing in Japan Racing Association-sanctioned races between 1992 and 1997. All horses that raced were examined by a veterinarian within 30 minutes of the conclusion of the race; any horse that had blood at the nostrils was examined with an endoscope. If blood was observed in the trachea, epistaxis related to exercise-induced pulmonary hemorrhage (EIPH) was diagnosed. Epistaxis related to EIPH was identified following 369 race starts (0.15%). Frequency of EIPH-related epistaxis was significantly associated with race type, age, distance, and sex. Epistaxis was more common following steeplechase races than following flat races, in older horses than in horses that were 2 years old, following races horses that had an episode of epistaxis, the recurrence rate was 4.64%. Results suggested that frequency of EIPH-related epistaxis in racehorses is associated with the horse's age and sex, the type of race, and the distance raced. The higher frequency in shorter races suggests that higher intensity exercise of shorter duration may increase the probability of EIPH.

  11. Análise do papel das ciclooxigenases 1 e 2 na migração da linhagem celular de glioma humano U251-MG.

    OpenAIRE

    Pollyana Bulgarelli Stevanatto

    2013-01-01

    O glioblastoma multiforme (GBM) é um dos gliomas mais comuns, classificado como um glioma de grau IV (Organização Mundial da Saúde - OMS) e notoriamente difícil de ser tratado. O tratamento recomendado consiste na ressecção cirúrgica seguida de radio e quimioterapia, e a sobrevida média dos pacientes é de apenas 12 meses após o diagnóstico. Portanto, novas terapias que focam a redução do volume do tumor e o aumento da morte das células tumorais são urgentemente necessárias. Estudos pré-clínic...

  12. The Streambank Erosion Control Evaluation and Demonstration Act of 1974, Section 32, Public Law 93-251. Appendix A. Literature Survey.

    Science.gov (United States)

    1981-12-01

    scour, or in some other way alter the velocity regimen of the stream. Rock-and-wire ma~tress. A flat or cylindrical wire cage filled with stones or other...Service, U. S. Department of Commerce, Springfield, Virginia). 8 COMPENDEX (Engineering Index, Inc., New York, New York). 10, 110 AGRICOLA (National

  13. http://periodicos.ufsc.br/index.php/gual/article/view/1983-4535.2012v5n2p251/22582

    Directory of Open Access Journals (Sweden)

    Alexandre Costa Quintana

    2012-08-01

    Full Text Available The process of virtual learning passes for the necessity of the existence of an evaluation process. Normally, this evaluation is integrated by a virtual part and another class attendance. The posting of the task becomes an important communication tool between students, teachers and tutors, as it enables the exchange of information between those involved, besides serving as a component of assessment and therefore reflecting the development of teaching-learning process.In this direction the objective of this work is in the distance to analyze the form of execution of the virtual tasks of the pupil of the course of graduation in Administration at distance. This work was elaborated, by means of a descriptive research, with analysis of content and a qualitative boarding. Concluding that the results of this study show that teachers, tutors and coordination of distance courses have attention on the needs of students in relation to time for implementation, appropriate date for posting and service to academics, that in understanding these will be key to the tasks are actually an important tool in the teaching-learning.

  14. The Streambank Erosion Control Evaluation and Demonstration Act of 1974, Section 32, Public Law 93-251. Appendix G. Demonstration Projects on Other Streams, Nationwide. Volume 2.

    Science.gov (United States)

    1981-12-01

    protracted storm period in which prior rainfall served to fill the stream channels and to soak the ground, thereby decreasing the absorptive capacity of...area remains in agricultural producation with wheat, corn, rice, walnuts and almonds bc.ng the predominant crops. * d. Hydrologic characteristics

  15. The Streambank Erosion Control Evaluation and Demonstration Act of 1974, Section 32, Public Law 93-251. Appendix G. Demonstration Projects on Other Streams, Nationwide. Volume 1.

    Science.gov (United States)

    1981-12-01

    into Yellowstone Lake. Below the lake, it plunges 422 feet in two G-49/50-7 spectacular waterfalls and enters the Grand Canyon of the Yellowstone. Leav...staked out. The head section of the tube was placed against the existing seawall and hopper connections were made. Water was pumped into the tube to

  16. II Simpósio Brasileiro de Comunicação Científica 10.5007/1518-2924.2008v13n26p251

    Directory of Open Access Journals (Sweden)

    Rosângela Schwarz Rodrigues

    2008-01-01

    Full Text Available O II Simpósio Brasileiro de Comunicação Científica foi realizado nos dias 5 e 6 de maio de 2008 no Auditório da Reitoria da UFSC, tendo como foco potencializar as discussões acadêmicas e teóricas em torno de ações e políticas relacionadas ao implemento da Comunicação Científica no país, em especial na modalidade eletrônica. O evento contou com a contribuição de pesquisadores interessados no tema, da Ciência da Informação e de outras área (programa no Anexo A. Na oportunidade, o evento proporcionou um fórum privilegiado para as discussões da própria instituição, além de ser o momento em que se realizou o lançamento do portal Periódicos UFSC, com a presença dos editores de várias revistas científicas da universidade.

  17. Common variation at 2p13.3, 3q29, 7p13 and 17q25.1 associated with susceptibility to pancreatic cancer

    Czech Academy of Sciences Publication Activity Database

    Childs, E.J.; Mocci, E.; Campa, D.; Bracci, P. M.; Gallinger, S.; Goggins, M.; Li, D.; Neale, R.E.; Olson, S. H.; Scelo, G.; Amundadottir, L. T.; Bamlet, W.R.; Bijlsma, M.F.; Blackford, A.; Borges, M.; Brennan, P.; Brenner, H.; Bueno-de-Mesquita, H. B.; Canzian, F.; Capurso, G.; Cavestro, G.M.; Chaffee, K.G.; Chanock, S. J.; Cleary, S.P.; Cotterchio, M.; Foretová, L.; Fuchs, Ch.; Funel, N.; Gazouli, M.; Hassan, M.; Herman, J.M.; Holcatová, I.; Holly, E. A.; Hoover, R.N.; Hung, R.J.; Janout, V.; Key, T.J.; Kupcinskas, J.; Kurtz, R. C.; Landi, S.; Lu, S.; Malecka-Panas, E.; Mambrini, A.; Mohelníková-Duchoňová, B.; Neoptolemos, J.P.; Oberg, A. L.; Orlow, I.; Pasquali, C.; Pezzilli, R.; Rizzato, C.; Saldia, A.; Scarpa, A.; Stolzenberg-Solomon, R. S.; Strobel, O.; Tavano, F.; Vashist, Y.K.; Vodička, Pavel; Wolpin, B. M.; Yu, H.; Petersen, G.; Risch, H. A.; Klein, A. P.

    2015-01-01

    Roč. 47, č. 8 (2015), s. 911-918 ISSN 1061-4036 R&D Projects: GA MZd NR9422; GA ČR GAP301/12/1734 Institutional support: RVO:68378041 Keywords : genome-wide association * genotype imputation * lung adenocarcinoma * cigarette- smoking * genetic-variation * alpha-gene * risk * loci * population * mutations Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 31.616, year: 2015

  18. SU-E-J-251: Incorporation of Pre-Therapy 18F-FDG Uptake with CT Texture Features in a Predictive Model for Radiation Pneumonitis Development

    Energy Technology Data Exchange (ETDEWEB)

    Anthony, G; Cunliffe, A; Armato, S; Al-Hallaq, H [The University of Chicago, Chicago, IL (United States); Castillo, R [Univ Texas Medical Branch of Galveston, Pearland, TX (United States); Pham, N [Baylor College of Medicine, Houston, TX (United States); Guerrero, T [Beaumont Health System, Royal Oak, MI (United States)

    2015-06-15

    Purpose: To determine whether the addition of standardized uptake value (SUV) statistical variables to CT lung texture features can improve a predictive model of radiation pneumonitis (RP) development in patients undergoing radiation therapy. Methods: Anonymized data from 96 esophageal cancer patients (18 RP-positive cases of Grade ≥ 2) were retrospectively collected including pre-therapy PET/CT scans, pre-/posttherapy diagnostic CT scans and RP status. Twenty texture features (firstorder, fractal, Laws’ filter and gray-level co-occurrence matrix) were calculated from diagnostic CT scans and compared in anatomically matched regions of the lung. The mean, maximum, standard deviation, and 50th–95th percentiles of the SUV values for all lung voxels in the corresponding PET scans were acquired. For each texture feature, a logistic regression-based classifier consisting of (1) the average change in that texture feature value between the pre- and post-therapy CT scans and (2) the pre-therapy SUV standard deviation (SUV{sub SD}) was created. The RP-classification performance of each logistic regression model was compared to the performance of its texture feature alone by computing areas under the receiver operating characteristic curves (AUCs). T-tests were performed to determine whether the mean AUC across texture features changed significantly when SUV{sub SD} was added to the classifier. Results: The AUC for single-texturefeature classifiers ranged from 0.58–0.81 in high-dose (≥ 30 Gy) regions of the lungs and from 0.53–0.71 in low-dose (< 10 Gy) regions. Adding SUVSD in a logistic regression model using a 50/50 data partition for training and testing significantly increased the mean AUC by 0.08, 0.06 and 0.04 in the low-, medium- and high-dose regions, respectively. Conclusion: Addition of SUVSD from a pre-therapy PET scan to a single CT-based texture feature improves RP-classification performance on average. These findings demonstrate the potential for more accurate prediction of RP using information from multiple imaging modalities. Supported, in part, by the National Institute of Biomedical Imaging and Bioengineering of the National Institutes of Health under grant number T32 EB002103; SGA receives royalties and licensing fees through the University of Chicago for computer-aided diagnosis technology. HA receives royalties through the University of Chicago for computer-aided diagnosis technology.

  19. 36 CFR 251.11 - Governing mining locations under the mining laws of the United States within that portion of the...

    Science.gov (United States)

    2010-07-01

    ... the Forest Supervisor. (c) All slash resulting from cutting or destruction of forest growth incident... conducted in accordance with the marking rules and timber sale practices applicable to the Black Hills..., such persons shall be paid for their services at the current rate of pay of fire fighters employed by...

  20. Chemistry of the heaviest elements--one atom at a time

    International Nuclear Information System (INIS)

    Hoffman, Darleane C.; Lee, Diana M.

    2000-01-01

    In keeping with the goal of the Viewpoint series of the Journal of Chemical Education, this article gives a 75-year perspective of the chemistry of the heaviest elements, including a 50-year retrospective view of past developments, a summary of current research achievements and applications, and some predictions about exciting, new developments that might be envisioned within the next 25 years. A historical perspective of the importance of chemical separations in the discoveries of the transuranium elements from neptunium (Z=93) through mendelevium (Z=101) is given. The development of techniques for studying the chemical properties of mendelevium and still heavier elements on the basis of measuring the radioactive decay of a single atom (''atom-at-a-time'' chemistry) and combining the results of many separate experiments is reviewed. The influence of relativistic effects (expected to increase as Z 2 ) on chemical properties is discussed. The results from recent atom-at-a-time studies of the chemistry of the heaviest elements through seaborgium (Z=106) are summarized and show that their properties cannot be readily predicted based on simple extrapolation from the properties of their lighter homologues in the periodic table. The prospects for extending chemical studies to still heavier elements than seaborgium are considered and appear promising

  1. The discovery of 260Md and the decay properties of 258Fm, 258m,gMd and 259Md

    International Nuclear Information System (INIS)

    Lougheed, R.W.; Hulet, E.K.; Dougan, R.J.; Wild, J.F.; Dupzyk, R.J.; Henderson, C.M.; Moody, K.J.; Hahn, R.L.; Suemmerer, K.; Bethune, G.

    1986-01-01

    We have discovered a new neutron-rich isotope, 260 Md, from 18 O and 22 Ne bombardments of 254 Es. We observed a spontaneous-fission (SF) activity with a half-life of 32 days in electromagnetically separated fractions with mass number 260 from these bombardments and we measured the mass and kinetic energy distributions of this SF activity. The mass distribution was symmetric with the principal energy peak at a total kinetic energy (TKE) of 234 MeV, similar to previous observations for heavy fermium isotopes. Surprisingly, we also observed a smaller symmetric component with a TKE of 195 MeV. We interpret these two peaks in the TKE distribution as arising from two types of fission in the same nucleus, or bimodal fission. The observed fission activity may be either from the SF decay of 260 Md or from 260 Fm which would arise from electron-capture (EC) decay of 260 Md. We have eliminated the possible β - decay of 260 Md by measuring β - -SF time correlations for the decay of 260 Md and we plan to determine whether 260 Md decays by EC by measuring time correlations between fermium X-rays and SF events. We also measured various properties of the heavy fermium and mendelevium isotopes and obtained 1. more accurate cross-sections for the neutron-rich mendelevium isotopes which we use to predict the production rates of yet undiscovered nuclides, 2. improved half-life measurements for 258m,g Md and 259 Md, 3. confirmation of the EC decay of 258m Md by measurement of the fermium X-rays preceding the SF decay of 258 Fm and 4. very substantially improved mass and TKE distributions for the SF decay of 258 Fm and 259 Md. (orig.)

  2. An Evaluation of the Training Provided in Correctional Institutions under the Manpower Development and Training Act, Section 251. Volume III: Impact of the Training Program on Trainees. Final Report.

    Science.gov (United States)

    McDonnell, John C.

    This third volume of a three part study evaluating vocational training provided in correctional institutions, focuses on the rehabilitation program's impact on offender post-release performance, evaluated in terms of recidivism and employment status. Data were obtained through post-release questionnaires distributed at selected intervals to…

  3. GIS AND REMOTE SENSING BASEDLAND USE LAND COVER DYNAMICS AT SEMIEN MOUNTAIS NATIONAL PARK Authors name: Gebreanenya Gebru Kidane, Email. gglove2000@gmail.com University of Gondar Phone.251 920 88 84 62

    Science.gov (United States)

    Kidane, G. G., III; Belay, Y. G.; Kassa, B. A.; Yimam, D. A.

    2015-12-01

    ABSTRACT The main purpose of this study is to quantify the magnitude and rate of change of major land use/land cover types, and to identify the major drivers of change in SMNP using GIS and remote sensing. To address the pre-stated objective three landsat images of the periods between 1985, 2000 and 2015 with the time series of 15 (fifteen) years for the conceqative of 30 years land use land cover dynamics were classified and analyzed using Erdas Emagine 9.2 and ArcGIS 10 environments. The results depicted that a remarkable expansion was observed in forest cover followed by farmland and settlements between 1985 and 2015 by about 16% (22 ha/y) and 14.7% (21 ha/y) although some portions of their original extent were converted into other LUC classes. Expansion of forest cover was dominantly attributed to conversions of exposed rocks (1334.97 ha) and shrubs (1255.23 ha). These possibly attributed to conversion of some portions of exposed rocks and shrubs which were unsustainably utilized into protected areas by area closure and transformation of shrubs into forest cover. Similarly, farmlands and settlement has been expanded mainly due to area gains from grassland (984.51 ha) and forest cover (1037.25 ha). These largely associated with encroachment of farmlands and settlements into grasslands and original natural forest cover as a result of population pressure. The results also indicated that the reduction of areas under grassland, exposed volcanic rocks and shrubs by about 2.35% (5 ha/y), 18% (32 ha/y) and 11% (14 ha/y) evident because the added areas from other LUC classes could not compensate the losses, respectively. The major drivers identified in study area were civil war between 1984 and 1991 resulted in the agricultural exploitation, deforestation and illegal wildlife hunting, population pressure due to influx of settlers for the last decade. Finally revitalizing the nationally park is not only the duty of the government but also all the concerned individuals specially the communities around the park and different stock holders at different levels should be work in integrative and in synergism manner. Key Words: Dynamics, Land use, GIS, Remo sensing Email address of the authors: * gglove2000@gmail.com.

  4. Perturbations de l'homéostasie lymphocytaire T chez le macaque rhésus chinois en phase aiguë d'infection par le SIVmac251

    OpenAIRE

    Ponte, Rosalie

    2014-01-01

    As a model to study type 1 human immunodeficiency virus (HIV-1) pathogenesis, rhesus macaques infected with the simian immunodeficiency virus (SIV) are under extensive investigation. Two subspecies of rhesus macaques have been defined, based on a different geographic origin. Indian rhesus macaques exhibit a rapid disease progression and acute infection is characterized by a massive CD4 T-cell loss in the intestinal mucosa. This was associated to the translocation of bacterial products through...

  5. SU-F-T-251: The Quality Assurance for the Heavy Patient Load Department in the Developing Country: The Primary Experience of An Entire Workflow QA Process Management in Radiotherapy

    International Nuclear Information System (INIS)

    Xie, J; Wang, J; Peng, J; Chen, J; Hu, W

    2016-01-01

    Purpose: To implement an entire workflow quality assurance (QA) process in the radiotherapy department and to reduce the error rates of radiotherapy based on the entire workflow management in the developing country. Methods: The entire workflow QA process management starts from patient registration to the end of last treatment including all steps through the entire radiotherapy process. Error rate of chartcheck is used to evaluate the the entire workflow QA process. Two to three qualified senior medical physicists checked the documents before the first treatment fraction of every patient. Random check of the treatment history during treatment was also performed. A total of around 6000 patients treatment data before and after implementing the entire workflow QA process were compared from May, 2014 to December, 2015. Results: A systemic checklist was established. It mainly includes patient’s registration, treatment plan QA, information exporting to OIS(Oncology Information System), documents of treatment QAand QA of the treatment history. The error rate derived from the chart check decreases from 1.7% to 0.9% after our the entire workflow QA process. All checked errors before the first treatment fraction were corrected as soon as oncologist re-confirmed them and reinforce staff training was accordingly followed to prevent those errors. Conclusion: The entire workflow QA process improved the safety, quality of radiotherapy in our department and we consider that our QA experience can be applicable for the heavily-loaded radiotherapy departments in developing country.

  6. SU-F-T-251: The Quality Assurance for the Heavy Patient Load Department in the Developing Country: The Primary Experience of An Entire Workflow QA Process Management in Radiotherapy

    Energy Technology Data Exchange (ETDEWEB)

    Xie, J; Wang, J; Peng, J; Chen, J; Hu, W [Fudan University Shanghai Cancer Center, Shanghai, Shanghai (China)

    2016-06-15

    Purpose: To implement an entire workflow quality assurance (QA) process in the radiotherapy department and to reduce the error rates of radiotherapy based on the entire workflow management in the developing country. Methods: The entire workflow QA process management starts from patient registration to the end of last treatment including all steps through the entire radiotherapy process. Error rate of chartcheck is used to evaluate the the entire workflow QA process. Two to three qualified senior medical physicists checked the documents before the first treatment fraction of every patient. Random check of the treatment history during treatment was also performed. A total of around 6000 patients treatment data before and after implementing the entire workflow QA process were compared from May, 2014 to December, 2015. Results: A systemic checklist was established. It mainly includes patient’s registration, treatment plan QA, information exporting to OIS(Oncology Information System), documents of treatment QAand QA of the treatment history. The error rate derived from the chart check decreases from 1.7% to 0.9% after our the entire workflow QA process. All checked errors before the first treatment fraction were corrected as soon as oncologist re-confirmed them and reinforce staff training was accordingly followed to prevent those errors. Conclusion: The entire workflow QA process improved the safety, quality of radiotherapy in our department and we consider that our QA experience can be applicable for the heavily-loaded radiotherapy departments in developing country.

  7. REFLEXÕES SOBRE A ESTRATÉGIA DO OCEANO AZUL: UMA COMPARAÇÃO COM AS ESTRATÉGIAS DE ANSOFF, PORTER E HAX & WILDE DOI:10.7444/fsrj.v2i2.51

    OpenAIRE

    Jussani, Ailton Conde; Krakauer, Patricia Viveiros de Castro; Polo, Edison Fernandes

    2010-01-01

    Within the context of the globalized environment, competitiveness has become a critical issue for business. The use of research to inform strategic decisions is thus important for firms on the path to competitiveness, regardless of their market of operation. This paper provides an overview of four strategies—Kim and Mauborgne’s Blue Ocean Strategy, Ansoff’s Matrix, Porter’s Generic Strategies, and Hax and Wilde’s Delta model—in order to find the similarities and approximations among them. App...

  8. Substituição do milho por farelo de trigo ou farelo de glúten de milho na ração de bovinos de corte em terminação - DOI: 10.4025/actascianimsci.v29i1.251 Substitution of corn grain by wheat middlings or corn gluten feed in the finishing bulls diet - DOI: 10.4025/actascianimsci.v29i1.251

    Directory of Open Access Journals (Sweden)

    Térssio Roger Ramalho

    2007-11-01

    Full Text Available O objetivo do trabalho foi avaliar a substituição do milho moído fino (MM por farelo de trigo (FT ou farelo de glúten de milho (FGM na ração de 36 bovinos não castrados, em terminação (14 meses; peso inicial de 382 kg durante 87 dias. A ração continha 24% de silagem de capim e 76% de concentrado, constituído por polpa cítrica, farelo de soja, uréia, minerais, bicarbonato de sódio e monensina sódica, além de uma das fontes energéticas testadas. A substituição de MM por FT aumentou a ingestão de FDN (pThe objective of this work was to evaluate the substitution of finely ground (GC corn by wheat middlings (WM or dried corn gluten feed (CGF in finishing feedlot diets. Thirty-six yearling bulls (382 kg average initial live weight; 14 months old were fed during 87 days. The diets contained 24% grass silage and 76% concentrate, formulated with dried citrus pulp, soybean meal, urea, mineral-vitamin mix, sodium bicarbonate, sodium monensin, and one of the energy sources tested. The substitution of wheat middlings for corn increased NDF intake (p<0.05. However, no effect was observed on other measured parameters. Substitution of corn gluten feed for ground corn reduced dry matter intake (p<0.05 and average daily gain (p<0.10, increased NDF intake (p<0.05, but had no effect on feed efficiency. These diets showed no differences in the observed values of net energy of maintenance or gain. The ratio observed/expected net energy for the diet differs from the other treatments. For this type of diet, GC may be completely replaced by WM or CGF with no depression on feed efficiency or on diet net energy. NRC (2001 underestimates TDN values and net energy estimates for WM and CGF.

  9. ORF Alignment: EHA1 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available LLKDPRIDVNVKN 65 ... Query: 251 LLKAGAEVDATTKNGSTAMHYAMYMERTDLISILLENNASMEIKNEKGETPLSIVSKSKN 310 ... LLK...AGAEVDATTKNGSTAMHYAMYMERTDLISILLENNASMEIKNEKGETPLSIVSKSKN Sbjct: 126 LLKAGAEVDATTKNGSTAMHYAMYMERTDLISILLENNASMEIKNEKGETPLSIVSKSKN 185

  10. 77 FR 40848 - Certain Frozen Warmwater Shrimp From India: Final Results of Antidumping Duty Administrative...

    Science.gov (United States)

    2012-07-11

    .... Ltd 2.51 MSC Marine Exporters 2.51 MSRDR Exports 2.51 MTR Foods 2.51 N.C. John & Sons (P) Ltd 2.51... shrimp product is also coated with a wet viscous layer containing egg and/or milk, and par-fried. The...) Penver Products (P) Ltd. (10) Sharat Industries Ltd. (11) Uniroyal Marine Exports Ltd. As we stated in...

  11. Gclust Server: 31795 [Gclust Server

    Lifescience Database Archive (English)

    Full Text Available 31795 HSA_113416774 Cluster Sequences Related Sequences(36) 251 XP_001129900.1 PRED...ated sequences Related Sequences(36) Sequence length 251 Representative annotation XP_00112990

  12. ORF Alignment: NT_033778 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available VSVDQTPVNAAGYLKELTHLTTLNVSHTLIWNWEIVASIAQQLPSLTNLNLS 60 ... Query: 251 LAEVDRTKIFKQLHELDLHRTNIMDFDQVTKLGNLTTLRLLNIMENGIE...EIKLPDCDSQE 310 ... LAEVDRTKIFKQLHELDLHRTNIMDFDQVTKLGNLTTLRLLNIMENGIEEIKLPDCDSQE Sbjct: 121 ...LAEVDRTKIFKQLHELDLHRTNIMDFDQVTKLGNLTTLRLLNIMENGIEEIKLPDCDSQE 180 ... Query: 371 HLKS

  13. ORF Alignment: NT_033778 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available VSVDQTPVNAAGYLKELTHLTTLNVSHTLIWNWEIVASIAQQLPSLTNLNLS 60 ... Query: 251 LAEVDRTKIFKQLHELDLHRTNIMDFDQVTKLGNLTTLRLLNIMENGIE...EIKLPDCDSQE 310 ... LAEVDRTKIFKQLHELDLHRTNIMDFDQVTKLGNLTTLRLLNIMENGIEEIKLPDCDSQE Sbjct: 121 ...LAEVDRTKIFKQLHELDLHRTNIMDFDQVTKLGNLTTLRLLNIMENGIEEIKLPDCDSQE 180 ... Query: 352 HLKS

  14. 77 FR 13275 - Certain Frozen Warmwater Shrimp From India: Preliminary Results of Antidumping Duty...

    Science.gov (United States)

    2012-03-06

    ... Fisheries Pvt. Ltd 2.51 MSC Marine Exporters 2.51 MSRDR Exports 2.51 MTR Foods 2.51 N.C. John & Sons (P) Ltd... also coated with a wet viscous layer containing egg and/or milk, and par-fried. The products covered by...) Penver Products (P) Ltd. Since the implementation of the 1997 regulations, our practice concerning no...

  15. Dicty_cDB: Contig-U08029-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 81 |pid:none) Tanichthys albonubes beta-actin mR... 251 6e-65 ( P45886 ) RecName: Full=Actin-3, muscle-speci...fic; &L12255_1(L122... 251 6e-65 EU128482_1( EU128482 |pid:none) Tanichthys albonubes beta-actin ge... 251 6

  16. Physical trajectory profile data from glider unit_251 deployed by Oregon Health & Science University; Center for Coastal Margin Observation & Prediction in the Coastal Waters of Washington/Oregon from 2013-07-18 to 2013-08-06 (NCEI Accession 0145922)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Slocum glider dataset gathered as part of the CMOP observatory SATURN, funded by NOAA and NSF. Glider operations have historically been seasonal (April-September),...

  17. Physical trajectory profile data from glider unit_251 deployed by Oregon Health & Science University; Center for Coastal Margin Observation & Prediction in the Coastal Waters of Washington/Oregon from 2012-07-25 to 2012-08-22 (NCEI Accession 0145920)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Slocum glider dataset gathered as part of the CMOP observatory SATURN, funded by NOAA and NSF. Glider operations have historically been seasonal (April-September),...

  18. Physical trajectory profile data from glider unit_251 deployed by Oregon Health & Science University; Center for Coastal Margin Observation & Prediction in the Coastal Waters of Washington/Oregon from 2013-05-08 to 2013-05-31 (NCEI Accession 0145921)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Slocum glider dataset gathered as part of the CMOP observatory SATURN, funded by NOAA and NSF. Glider operations have historically been seasonal (April-September),...

  19. Nr 251 - Report on the behalf of the Commission of finances, general economy and budget control on the finance bill project for 2013. Appendix Nr 13: ecology, sustainable development and planning, risk prevention, management and steering of policies of ecology, energy, sustainable development and sea

    International Nuclear Information System (INIS)

    Eckert, Christian; Mariton, Herve

    2012-01-01

    After having indicated some key figures (public finances and budgets awarded to different involved institutions and agencies), this report comments and discusses the various challenges and financial aspects regarding risk prevention: evolution of endowments in 2013, action in the field of prevention of technological risks and pollutions, issue of nuclear safety after the Fukushima accident (actions undertaken by the ASN, IRSN and ANDRA), assessment of the implementation of the PPRN (plan of prevention of natural risks) and management of flood risks, management of the after-mine period. The second part discusses the management and steering of policies of ecology, energy, sustainable development and sea in a context of decreased endowments

  20. The Launch of a Joint Library/Writing Centre Online Course on Academic Integrity. A Review of: Greer, K., Swanberg, S., Hristova, M., Switzer, A. T., Daniel, D., & Perdue, S. W. (2012. Beyond the web tutorial: Development and implementation of an online, self-directed academic integrity course at Oakland University. The Journal of Academic Librarianship, 38(5, 251-258.

    Directory of Open Access Journals (Sweden)

    Cari Merkley

    2013-06-01

    Full Text Available Objective – To outline the collaborative development of an online course addressing academic integrity by a university’s library system and writing centre.Design – Case study.Setting – A public research university in the Midwestern United States.Subjects – 1650 students who completed the online module.Methods – Oakland University (OU Libraries and the Writing Centre began to collaborate on the development of a new online course on academic integrity in 2011. It was felt that an existing online library tutorial on plagiarism no longer met the needs of students and faculty. The development of the course was informed by the Association of College and Research Libraries’ Information Literacy Competency Standards for Higher Education (2000 as well as a research study investigating students’ use of sources in their scholarly writing across several institutions. Moodle, the institution’s learning management system (LMS, was used to develop the learning object.Main Results – OU Libraries and the Writing Centre launched the six-part online course entitled “Using and Citing Sources” in January 2012. They developed modules around learning outcomes in five broad categories: defining academic integrity and plagiarism; the use of sources in academic writing; paraphrasing; quoting; and citation. The final module provided students with an opportunity to practise lessons learned in the first five modules. The use of the LMS to design and host the course limited the tutorial to registered students, but provided developers with access to additional course functionality without labour-intensive coding. It also allowed Writing Centre staff to access students’ performance data on the modules prior to their appointments. Improvements over the previous online tutorial included expanded content on academic ethics and referencing, more active learning elements, video content, and the opportunity for students to choose discipline-specific examples. In the first four months of its availability, 1650 students completed the course, with 3330 attempts overall.Conclusion – The diverse perspectives and expertise that individuals from OU Libraries and the Writing Center brought to their collaboration greatly informed the development of the course. The time and effort saved by using the university’s existing LMS to develop interactive content and the focus on providing students with opportunities for active learning within the course contributed to the project’s success.

  1. Mutational analysis of amino acid residues involved in catalytic activity of a family 18 chitinase from tulip bulbs.

    Science.gov (United States)

    Suzukawa, Keisuke; Yamagami, Takeshi; Ohnuma, Takayuki; Hirakawa, Hideki; Kuhara, Satoru; Aso, Yoichi; Ishiguro, Masatsune

    2003-02-01

    We expressed chitinase-1 (TBC-1) from tulip bulbs (Tulipa bakeri) in E. coli cells and used site-directed mutagenesis to identify amino acid residues essential for catalytic activity. Mutations at Glu-125 and Trp-251 completely abolished enzyme activity, and activity decreased with mutations at Asp-123 and Trp-172 when glycolchitin was the substrate. Activity changed with the mutations of Trp-251 to one of several amino acids with side-chains of little hydrophobicity, suggesting that hydrophobic interaction of Trp-251 is important for the activity. Molecular dynamics (MD) simulation analysis with hevamine as the model compound showed that the distance between Asp-123 and Glu-125 was extended by mutation of Trp-251. Kinetic studies of Trp-251-mutated chitinases confirmed these various phenomena. The results suggested that Glu-125 and Trp-251 are essential for enzyme activity and that Trp-251 had a direct role in ligand binding.

  2. Application of alpha spectrometry to the discovery of new elements by heavy-ion-beam bombardment

    International Nuclear Information System (INIS)

    Nitschke, J.M.

    1983-05-01

    Starting with polonium in 1898, α-spectrometry has played a decisive role in the discovery of new, heavy elements. For even-even nuclei, α-spectra have proved simple to interpret and exhibit systematic trends that allow extrapolation to unknown isotopes. The early discovery of the natural α-decay series led to the very powerful method of genetically linking the decay of new elements to the well-established α-emission of daughter and granddaughter nuclei. This technique has been used for all recent discoveries of new elements including Z = 109. Up to mendelevium (Z = 101), thin samples suitable for α-spectrometry were prepared by chemical methods. With the advent of heavy-ion accelerators new sample preparation methods emerged. These were based on the large momentum transfer associated with heavy-ion reactions, which produced energetic target recoils that, when ejected from the target, could be thermalized in He gas. Subsequent electrical deposition or a He-jet technique yielded samples that were not only thin enough for α-spectroscopy, but also for α- and #betta#-recoil experiments. Many variations of these methods have been developed and are discussed. For the synthesis of element 106 an aerosol-based recoil transport technique was devised. In the most recent experiments, α-spectrometry has been coupled with the magnetic analysis of the recoils. The time from production to analysis of an isotope has thereby been reduced to 10 - 6 s; while it was 10 - 1 to 10 0 s for He-jets and 10 1 to 10 3 s for rapid chemical separations. Experiments are now in progress to synthesize super heavy elements (SHE) and to analyze them with these latest techniques. Again, α-spectrometry will play a major role since the expected signature for the decay of a SHE is a sequence of α-decays followed by spontaneous fission

  3. Gene : CBRC-MDOM-02-0490 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available 35195 /gi=3928780 /ug=Mdm.251 /len=1699 0.001 30% MHVKHLRHTYMIYVHANTCTHIPLYTLAYIIHTYTYIHICPSIHPSIHPSTHPHIHTSTHLHIHPSIHPLIHSSTH...PHIYTSTHLSIHPSTHPPIHPSIHPSIHPSIHPSIHLPIHTSTYPHIHPSTHPSIHTSIHPSIHTSTHPSIHLPIHTSTYPHIHPSTHPSIHTSIHPSIHTSTH...PSIHLPIHTSTYPHIHPSTHPSIHTSTHPSIHTSTHPSIHLPIHTSTYPHIHPSTHPSIHTSTHPSIHTSTH...PSIHPSIHPSIHPSIHPSTLPHIYLSTHPSTHPSIHPHIHSSIHPHIHTSTQPASQPATHTYIHPSIDPHIHPTIHPHIHPSTHPFIHPSIDPHIHPTIHPHIHPSTHPSIHPSIDPLIHPSTHPHIHPSTHTCTWNGGRSTC ...

  4. ORF Alignment: NC_005027 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available ASIAQTAVVDPRAQIGEGVQIGHFCVIGPNVKLGDRTRVGDHVTLDGVTSIGCDNQIFPH 60 ... Query: 123 DCNIGSRIVLANNCMIGGHAHIADDVTIAGGA...GVHQFVSIGTLSFVGAMTRILQDVPPFV 182 ... DCNIGSRIVLANNCMIGGHAHIADDVTIAGGAGVHQF...VSIGTLSFVGAMTRILQDVPPFV Sbjct: 121 DCNIGSRIVLANNCMIGGHAHIADDVTIAGGAGVHQFVSIGTLSFVGAMTRILQDVPPFV 180 ... Query: 243 LRHLFDCLDNS 253 ... LRHLFDCLDNS Sbjct: 241 LRHLFDCLDNS 251

  5. ORF Alignment: NC_004567 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available QKGGVGKTTTSINLGASLVELGQKVLLIDTDAQGNATSGLGVQKSTIEREIYDV 60 ... Query: 124 XXCPPSLGLLTINAFTACDSILIPVQSEYYALEGLSQL...LNTIKLVQKHFNKQLRIEGVLL 183 ... CPPSLGLLTINAFTACDSILIPVQSEYYALEGLSQLLNTIK...LVQKHFNKQLRIEGVLL Sbjct: 121 IDCPPSLGLLTINAFTACDSILIPVQSEYYALEGLSQLLNTIKLVQKHFNKQLRIEGVLL 180 ... Query: 244 ALAKEVLA 251 ... ALAKEVLA Sbjct: 241 ALAKEVLA 248

  6. ORF Alignment: NC_006138 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available protein ... S1 [Desulfotalea psychrophila LSv54] ... Length = 145 ... Query: 192 EGQTVEGVITSIRDFGAFVDIGAIDGLIPISEIGWSRVERV...EEYFAVGQKVQAVVKSIDW 251 ... EGQTVEGVITSIRDFGAFVDIGAIDGLIPISEIGWSRVERVE...EYFAVGQKVQAVVKSIDW Sbjct: 1 ... EGQTVEGVITSIRDFGAFVDIGAIDGLIPISEIGWSRVERVEEYFAVGQKVQAVVKS

  7. Make or Buy: A Systematic Approach to Department of Defense Sourcing Decisions

    Science.gov (United States)

    2013-07-30

    Material & Supply General 3151 Audiovisual Equipment 31.0 Equipment Material & Supply General 3152 Photographic Equipment 31.0 Equipment...Cost Element 251H Translation and Interpreting Services. 25.1 Advisory and Assistance Services Overhead Headquarters Management 252Q Safety and...Equipment Overhead Information Technology 252G Audiovisual Production and Services. 25.2 Other Services Overhead Information Technology 252H

  8. 76 FR 42560 - Approval and Promulgation of Air Quality Implementation Plans; Vermont; Reasonably Available...

    Science.gov (United States)

    2011-07-19

    ... (3) of regulation 5-251, Control of Nitrogen Oxides Emissions: RACT for large stationary sources, is... Plants,'' revised regulation 5-251(3) ``Control of Nitrogen Oxides Emissions: RACT for large stationary... oxide (NO X ) emissions sources and on all sources covered by a Control Techniques Guideline (CTG). A...

  9. 75 FR 52033 - Rigging Equipment for Material Handling; Extension of the Office of Management and Budget's (OMB...

    Science.gov (United States)

    2010-08-24

    ...] Rigging Equipment for Material Handling; Extension of the Office of Management and Budget's (OMB) Approval...), and (iii) and (f)(2) of the Standard on Rigging Equipment for Material Handling (29 CFR 1926.251... contained in the Standard on Rigging Equipment for Material Handling (29 CFR 1926.251). The Agency is...

  10. 78 FR 70326 - Rigging Equipment for Material Handling; Extension of the Office of Management and Budget's (OMB...

    Science.gov (United States)

    2013-11-25

    ...] Rigging Equipment for Material Handling; Extension of the Office of Management and Budget's (OMB) Approval... on Rigging Equipment for Material Handling (29 CFR 1926.251). These paragraphs require affixing... the Standard on Rigging Equipment for Material Handling (29 CFR 1926.251). The Agency is requesting an...

  11. Dynamics of the proteome in human and farm animal milk

    NARCIS (Netherlands)

    Zhang, L.

    2015-01-01

    25.1pt;">Abstract

    25.1pt;">The milk proteome changes due to many factors, such as lactation, individual, health status, processing, and species differences. The objective of the work described in this thesis was to increase our

  12. Dynamics of the proteome in human and farm animal milk

    NARCIS (Netherlands)

    Zhang, L.

    2015-01-01

    25.1pt;">Abstract

    25.1pt;">The milk proteome changes due to many factors, such as lactation, individual, health status, processing, and species differences. The objective of the work described in this thesis was to increase our

  13. Ethiopian Journal of Business and Economics (The): Journal ...

    African Journals Online (AJOL)

    Publisher. Publisher contact person: Fenta Mandefro (PhD), Dean, College of Business and Economics. Email: fenfet@gmail.com. Phone Mobile: +251 911 180 903,. Office: 251 111 224 590. Mailing address: P.O. Box 5563. College of Business and Economics. Addis Ababa. Ethiopia. College of Business and Economics, ...

  14. Les discours de la bourse et de la finance [Reseña

    OpenAIRE

    Olmo Cazevieille, Françoise Therese

    2014-01-01

    Reseña del libro "Les discours de la bourse et de la finance" de Laurent Gautier (ed). Olmo Cazevieille, FT. (2014). Les discours de la bourse et de la finance [Reseña]. Ibérica. (28):251-253. http://hdl.handle.net/10251/62367 Senia 251 253 28

  15. 76 FR 41075 - Copyright Arbitration Royalty Panel Rules and Procedures

    Science.gov (United States)

    2011-07-13

    ... LIBRARY OF CONGRESS Copyright Office 37 CFR Part 251 [Docket No. 2011-5] Copyright Arbitration... Part 251 Copyright Arbitration Royalty Panel Rules of Procedure. In 2004, Congress replaced the Copyright Arbitration Royalty Panels with three Copyright Royalty Judges who operate under separate...

  16. Lucifensins, the Insect Defensins of Biomedical Importance: The Story behind Maggot Therapy

    Czech Academy of Sciences Publication Activity Database

    Čeřovský, Václav; Bém, R.

    2014-01-01

    Roč. 7, č. 3 (2014), s. 251-264 ISSN 1424-8247 R&D Projects: GA ČR GA203/08/0536 Institutional support: RVO:61388963 Keywords : antimicrobial peptide * insect defensin * lucifensin * maggot therapy * Lucilia sericata * Lucilia cuprina * peptide isolation * peptide identification Subject RIV: CC - Organic Chemistry http://www.mdpi.com/1424-8247/7/3/251

  17. City and suburban competition

    Czech Academy of Sciences Publication Activity Database

    Austin, D. Andrew

    -, č. 251 (2005), s. 1-38 ISSN 1211-3298 Institutional research plan: CEZ:AV0Z70850503 Keywords : government competition * duopoly * local public finance Subject RIV: AH - Economics http://www.cerge-ei.cz/pdf/wp/Wp251.pdf

  18. Processes determining seasonality and interannual variability of settling particle fluxes to the deep Arabian Sea

    Digital Repository Service at National Institute of Oceanography (India)

    Haake, B.; Rixen, T.; Reemtsma, T.; Ramaswamy, V.; Ittekkot, V.

    stream_size 20 stream_content_type text/plain stream_name Particle_Flux_Ocean_Chapter_14_1996_251.pdf.txt stream_source_info Particle_Flux_Ocean_Chapter_14_1996_251.pdf.txt Content-Encoding ISO-8859-1 Content-Type text...

  19. Musik som analogi og metafor

    DEFF Research Database (Denmark)

    Bonde, Lars Ole

    2014-01-01

    Indeholder underkapitlerne: 2.5.1 Musik som analogi 2.5.2 Musik som metafor 2.5.3 Musikkens psykologiske funktioner - en taxonomi og metaforisk lytning til fire baroksatser......Indeholder underkapitlerne: 2.5.1 Musik som analogi 2.5.2 Musik som metafor 2.5.3 Musikkens psykologiske funktioner - en taxonomi og metaforisk lytning til fire baroksatser...

  20. Review: Derek Hook, A Critical Psychology of the Postcolonial: The Mind of Apartheid (2012 Buchbesprechung: Derek Hook, A Critical Psychology of the Postcolonial: The Mind of Apartheid (2012

    Directory of Open Access Journals (Sweden)

    Danielle Faye Tran

    2013-01-01

    Full Text Available Review of the monograph:Derek Hook, A Critical Psychology of the Postcolonial: The Mind of Apartheid, London: Routledge, 2012, ISBN 978-0-415-58757-0, 251 pagesBesprechung der Monographie:Derek Hook, A Critical Psychology of the Postcolonial: The Mind of Apartheid, London: Routledge, 2012, ISBN 978-0-415-58757-0, 251 Seiten

  1. Intracellular cholesterol level regulates sensitivity of glioblastoma cells against temozolomide-induced cell death by modulation of caspase-8 activation via death receptor 5-accumulation and activation in the plasma membrane lipid raft.

    Science.gov (United States)

    Yamamoto, Yutaro; Tomiyama, Arata; Sasaki, Nobuyoshi; Yamaguchi, Hideki; Shirakihara, Takuya; Nakashima, Katsuhiko; Kumagai, Kosuke; Takeuchi, Satoru; Toyooka, Terushige; Otani, Naoki; Wada, Kojiro; Narita, Yoshitaka; Ichimura, Koichi; Sakai, Ryuichi; Namba, Hiroki; Mori, Kentaro

    2018-01-01

    Development of resistance against temozolomide (TMZ) in glioblastoma (GBM) after continuous treatment with TMZ is one of the critical problems in clinical GBM therapy. Intracellular cholesterol regulates cancer cell biology, but whether intracellular cholesterol is involved in TMZ resistance of GBM cells remains unclear. The involvement of intracellular cholesterol in acquired resistance against TMZ in GBM cells was investigated. Intracellular cholesterol levels were measured in human U251 MG cells with acquired TMZ resistance (U251-R cells) and TMZ-sensitive control U251 MG cells (U251-Con cells), and found that the intracellular cholesterol level was significantly lower in U251-R cells than in U251-Con cells. In addition, treatment by intracellular cholesterol remover, methyl-beta cyclodextrin (MβCD), or intracellular cholesterol inducer, soluble cholesterol (Chol), regulated TMZ-induced U251-Con cell death in line with changes in intracellular cholesterol level. Involvement of death receptor 5 (DR5), a death receptor localized in the plasma membrane, was evaluated. TMZ without or with MβCD and/or Chol caused accumulation of DR5 into the plasma membrane lipid raft and formed a complex with caspase-8, an extrinsic caspase cascade inducer, reflected in the induction of cell death. In addition, treatment with caspase-8 inhibitor or knockdown of DR5 dramatically suppressed U251-Con cell death induced by combination treatment with TMZ, MβCD, and Chol. Combined treatment of Chol with TMZ reversed the TMZ resistance of U251-R cells and another GBM cell model with acquired TMZ resistance, whereas clinical antihypercholesterolemia agents at physiological concentrations suppressed TMZ-induced cell death of U251-Con cells. These findings suggest that intracellular cholesterol level affects TMZ treatment of GBM mediated via a DR5-caspase-8 mechanism. Copyright © 2017 Elsevier Inc. All rights reserved.

  2. Evidence for an enantioselective pumiliotoxin 7-hydroxylase in dendrobatid poison frogs of the genus Dendrobates.

    Science.gov (United States)

    Daly, John W; Garraffo, H Martin; Spande, Thomas F; Clark, Valerie C; Ma, Jingyuan; Ziffer, Herman; Cover, John F

    2003-09-16

    Dendrobatid poison frogs readily accumulate alkaloids from diet into skin, where such compounds serve as a chemical defense against predators. Arthropods seem to be the source of decahydroquinolines (DHQs), several izidines, coccinellines, spiropyrrolizidines, pumiliotoxins (PTXs), and allopumiliotoxins (aPTXs). A DHQ iso-223F, and PTX (+)-251D were fed to poison frogs of the dendrobatid genera Dendrobates, Epipedobates, and Phyllobates. The two alkaloids were accumulated in skin unchanged except for the three species of Dendrobates, where approximately 80% of accumulated PTX (+)-251D was stereoselectively hydroxylated to aPTX (+)-267A. The unnatural enantiomer PTX (-)-251D was accumulated efficiently when fed to Dendrobates auratus, but was not hydroxylated. The enantiomers of PTX 251D and their desmethyl analogs were synthesized from N-Boc-protected (-)- and (+)-proline methyl esters. Both PTX (+)-251D and aPTX (+)-267A proved to be potent convulsants in mice, with (+)-267A being approximately 5-fold more toxic than (+)-251D. Both alkaloids were hyperalgesic at the site of injection. The unnatural PTX (-)-251D caused no overt effect in mice. Thus, the evolutionary development of a pumiliotoxin 7-hydroxylase would have provided frogs of the genus Dendrobates with a means of enhancing the antipredator potency of ingested PTXs.

  3. Život i djelo Dmitrija Ivanoviča Mendeljejeva - povodom 100. obljetnice smrti

    Directory of Open Access Journals (Sweden)

    Vaščić, V.

    2007-04-01

    Full Text Available The life and activities of D. I. Mendeleyev are presented primarily in view of his role in the progress of chemistry. Born in Tobolsk in 1834 to a numerous and poor family, burdened by the family's bad luck and his ill health, he graduated natural sciences in 1855 at St. Petersburg and was awarded a gold medal for exceptional success. In 1855/56 he was teacher at a secondary school in Odessa. He obtained his MSc degree in 1856 in St. Petersburg where he was appointed lecturer in 1857. He was guest scientist 1859-1861 at the University in Heidelberg where he investigated the behavior of gases under various pressures and temperatures and discovered the criticaltemperature of liquefaction. He achieved his PhD degree in 1865 in St. Petersburg with a thesis on ethanol/water mixtures. Therein he had proven the existence of alcohol hydrates. His work later enabled the elaboration of modern conceptions on solvate formation in solutions. In 1865 he was elected professor at the University in St. Petersburg where he worked until 1890 when he was forced to retire. Preparing his textbook "Fundamentals of Chemistry" in 1869, he discovered that properties of chemical elements depend periodically on atomic weights. This enabled the elaboration of a periodic system as the base for classification in chemistry, as well as for further research and development of chemical science and technology. The international scientific community accepted Mendeleyev's system with distrust and it was generally acknowledged not before three "prophecies" of Mendeleyev were realized by the discovery of gallium (1875, scandium (1879 and germanium (1886. Later, in verification of his predictions, other elements - including transuranics - were discovered. Hence, in honor of the creator of the periodic system, the element of atomic number 101 was named mendelevium (1955. Mendeleyev was reactivated in 1892 as director of the Central Bureau for Measures and Weights where he worked until

  4. Microbial ecology of Campylobacter jejuni in a United Kingdom chicken supply chain: intermittent common source, vertical transmission, and amplification by flock propagation.

    OpenAIRE

    Pearson, A D; Greenwood, M H; Feltham, R K; Healing, T D; Donaldson, J; Jones, D M; Colwell, R R

    1996-01-01

    A study of Campylobacter jejuni on a broiler chicken farm between 1989 and 1994 gave an estimated isolation rate of 27% (3,304 of 12,233) from a 0.9% sample of 1.44 million broiler chickens from six to eight sheds over 32 consecutive rearing flocks comprising 251 broiler shed flocks. During the study, C. jejuni was found in 35.5% of the 251 shed flocks but only 9.2% (23 of 251) had Campylobacter isolates in successive flocks, with 9 of those 23 sheds having the same serotype between consecuti...

  5. Metallacarborane chemistry of the hypho-[6,7-C2B6H13](-)1-anion: the formation of uniquely structured metallacarboranes [5-Cp*-arachno-5,4,6-RhC2B6H12] and [2,5-Cp-2(*)-10-Me-nido-2,5,1-Rh2CB6H9] (Cp-* = eta(5)-C5Me5-): complete rhodium analogues of arachno-4,6-C2B7H13 and nido-1-CB8H12

    Czech Academy of Sciences Publication Activity Database

    Londesborough, Michael Geoffrey Stephen; Janoušek, Zbyněk; Štíbr, Bohumil; Císařová, I.

    2004-01-01

    Roč. 689, č. 16 (2004), s. 2702-2706 ISSN 0022-328X R&D Projects: GA MŠk LN00A028 Institutional research plan: CEZ:AV0Z4032918 Keywords : boranes * metallacarboranes * rhodium complex Subject RIV: CA - Inorganic Chemistry Impact factor: 1.905, year: 2004

  6. Chromatin modification of Notch targets in olfactory receptor neuron diversification

    Czech Academy of Sciences Publication Activity Database

    Endo, K.; Karim, M. R.; Taniguchi, H.; Krejčí, Alena; Kinameri, E.; Siebert, M.; Ito, K.; Bray, S. J.; Moore, A. W.

    2012-01-01

    Roč. 15, č. 2 (2012), s. 224-233 ISSN 1097-6256 Institutional research plan: CEZ:AV0Z50070508 Keywords : neuron diversification Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 15.251, year: 2012

  7. Wide Output Range Power Processing Unit for Electric Propulsion, Phase II

    Data.gov (United States)

    National Aeronautics and Space Administration — A power supply concept capable of operation over 25:1 and 64:1 impedance ranges at full power has been successfully demonstrated in our Phase I effort at...

  8. Německý Mácha, Óda na radost a krize evropské vize

    Czech Academy of Sciences Publication Activity Database

    Pokorný, Martin Z.

    2013-01-01

    Roč. 31, 97-98 (2013), s. 244-251 ISSN 0862-7045 Institutional support: RVO:67985955 Keywords : K. H. Mácha * F. Schiller * A. Mozart * Enlightenment * romanticism Subject RIV: AA - Philosophy ; Religion

  9. ORF Alignment: NC_005027 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available HCIAGD Sbjct: 1 ... DPQDSVTIVTGASSGIGFELTRMLVDQGAHVVAVARRRERLTELANSTSRPERVHCIAGD 60 ... Query: 130 RDALPRLRSVSQNGGRPVICNIG...SVLGHRAVPDKSEYCASKFALHGWNDSLRAELVGDGI 189 ... RDALPRLRSVSQNGGRPVICNIGSVLGHRAVPDKSEYCASKFALHG...WNDSLRAELVGDGI Sbjct: 121 RDALPRLRSVSQNGGRPVICNIGSVLGHRAVPDKSEYCASKFALHGWNDSLRAELVGDGI 180 ... Query: 250 AL 251 ... AL Sbjct: 241 AL 242

  10. Differentiating pidgin from early interlanguage — a comparison of ...

    African Journals Online (AJOL)

    Fanakalo) and interlanguage varieties of Xhosa and Zulu. ... However, for more complex tense patterns, similar simplificatory strategies occur in pidgin and L2. Southern African Linguistics and Applied Language Studies 2007, 25(1): 75–89 ...

  11. Population dynamics of annuals in perennial grassland controlled by ants and environmental stochasticity

    Czech Academy of Sciences Publication Activity Database

    Dostál, Petr

    2007-01-01

    Roč. 18, - (2007), s. 91-102 ISSN 1100-9233 Institutional research plan: CEZ:AV0Z60050516 Keywords : Lasius flavus * disturbance * megamatrix Subject RIV: EF - Botanics Impact factor: 2.251, year: 2007

  12. Testing of models of stomatal ozone fluxes with field measurements in a mixed Mediterranean forest

    Czech Academy of Sciences Publication Activity Database

    Fares, S.; Matteucci, G.; Mugnozza, S.; Morani, A.; Calfapietra, Carlo; Salvatori, E.; Fusaro, L.; Manes, F.; Loreto, F.

    2013-01-01

    Roč. 67, MAR (2013), s. 242-251 ISSN 1352-2310 Institutional support: RVO:67179843 Keywords : Ozone fluxes * Stomatal conductance models * GPP * Mediterranean forest Subject RIV: EH - Ecology, Behaviour Impact factor: 3.062, year: 2013

  13. Intrinsic defects, nonstoichiometry and aliovalent doping of A.sup.2+./sup. B.sup.4+./sup.O.sub.3./sub. perovskite scintillators

    Czech Academy of Sciences Publication Activity Database

    Casillas-Trujillo, L.; Andersson, D.A.; Dorado, B.; Nikl, Martin; Sickafus, K.E.; McClellan, K.J.; Stanek, C.R.

    2014-01-01

    Roč. 251, č. 11 (2014), s. 2279-2286 ISSN 0370-1972 Institutional support: RVO:68378271 Keywords : atomistic simulation * defects * nonstoichiometry * perovskites * scintillators Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 1.489, year: 2014

  14. Magnetické pole Země a jeho možný vliv na živé organizmy

    Czech Academy of Sciences Publication Activity Database

    Střeštík, Jaroslav

    2004-01-01

    Roč. 54, č. 4 (2004), s. 249-251 ISSN 0009-0700 Institutional research plan: CEZ:AV0Z3012916 Keywords : geomagnetic activity * geomagnetic storms * human beings Subject RIV: DE - Earth Magnetism, Geodesy, Geography

  15. Cytochemical and ultrastructural aspects of aquatic carnivorous plant turions

    Czech Academy of Sciences Publication Activity Database

    Plachno, B.J.; Adamec, Lubomír; Kozieradzka-Kiszkurno, M.; Świątek, P.; Kamińska, I.

    2014-01-01

    Roč. 251, č. 6 (2014), s. 1449-1454 ISSN 0033-183X Institutional support: RVO:67985939 Keywords : aquatic carnivorous plants * winter buds * storage functions Subject RIV: EF - Botanics Impact factor: 2.651, year: 2014

  16. African Zoology - Vol 11, No 2 (1976)

    African Journals Online (AJOL)

    Patterns in the Distribution of Southern African Terrestrial Tortoises (Cryptodira: Testudinidae) · EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT · DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. John Comrie Greig, Peter D. Burdett, 251-273 ...

  17. Éva Katalin Vámos (1950-2015)

    Czech Academy of Sciences Publication Activity Database

    Štrbáňová, Soňa

    2015-01-01

    Roč. 22, č. 2 (2015), s. 251-253 ISSN 1230-1159 Institutional support: RVO:68378114 Keywords : history of science and technology * hungarian history of science and technology * women in science Subject RIV: AB - History

  18. Cosmological Parameter Constraints from the Dark Energy Survey Supernova Program Three Year Spectroscopic Sample.

    Science.gov (United States)

    Brout, Dillon

    2018-01-01

    We present cosmological parameter constraints from 251 spectroscopically confirmed Type Ia Supernovae (0.02 Supernova Program (DESSN). The photometric calibration, scene modeling photometric pipeline, additional low-z supernovae samples (zcosmological results and systematics analysis are discussed.

  19. Artificial intelligence, quantum mechanics, neuroscience, and the philosophy of mind

    OpenAIRE

    Mainzer, Klaus

    1998-01-01

    Artificial intelligence, quantum mechanics, neuroscience, and the philosophy of mind. - In: Philosophy and the many faces of science / ed. by Dionysios Anapolitanos ... - Lanham u.a. : Rowman & Littlefield, 1998. - S. 235-251. - (CPS Publications in the philosophy of science)

  20. Maheshwari, Prof. Satish Chandra

    Indian Academy of Sciences (India)

    Delhi), FNA, FNASc. Date of birth: 4 October 1933. Specialization: Physiology & Biochemistry of Plant Growth & Development and Plant Molecular Biology Address: 251/56, Prathap Enclave, Haldighati Road, Jaipur 302 033, Rajasthan Contact ...

  1. Hypocrisy or maturity? Culture and context differentiation

    Czech Academy of Sciences Publication Activity Database

    Matsumoto, D.; Yoo, S.H.; Fontaine, J.; Anguas-Wong, A.M.; Arriola, M.; Ataca, B.; Bond, M.H.; Boratav, H.B.; Breugelmans, S.M.; Cabecinhas, R.; Chae, J.; Chin, W.H.; Comunian, A.L.; DeGere, D.N.; Djunaidi, A.; Fok, H.K.; Friedlmeier, W.; Ghosh, A.; Glamcevski, M.; Granskaya, J.V.; Groenvynck, H.; Harb, C.; Haron, F.; Joshi, R.; Kakai, H.; Kashima, E.; Khan, W.; Kurman, J.; Kwantes, C.T.; Mahmud, S.H.; Mandaric, M.; Nizharadze, G.; Odusanya, J.O.T.; Ostrosky-Solis, F.; Palaniappan, A.K.; Papastylianou, D.; Poláčková Šolcová, Iva; Safdar, S.; Setiono, K.; Shigemasu, E.; Singelis, T.M.; Spiess, E.; Sterkowicz, S.; Sunar, D.; Szarota, P.; Vishnivetz, B.; Vohra, N.; Ward, C.; Wong, S.; Wu, R.; Zebian, S.; Zengeya, A.

    2009-01-01

    Roč. 23, č. 3 (2009), s. 251-264 ISSN 0890-2070 Institutional research plan: CEZ:AV0Z70250504 Keywords : personality -traits * individualism * consistency Subject RIV: AN - Psychology Impact factor: 2.597, year: 2009

  2. Varadhan, Prof. Srinivasa S R

    Indian Academy of Sciences (India)

    Varadhan, Prof. Srinivasa S R . Date of birth: 2 January 1940. Address: Department of Mathematics, Courant Institute, New York University, 251, Mercer Street, New York, NY 10012, U.S.A.. Contact: Office: (+1-212) 982 9883

  3. Změny Římského statutu Mezinárodního trestního soudu

    Czech Academy of Sciences Publication Activity Database

    Šturma, Pavel

    2010-01-01

    Roč. 9, č. 8 (2010), s. 245-251 ISSN 1213-5313 Institutional research plan: CEZ:AV0Z70680506 Keywords : public international law * International Criminal Court * crime of agression Subject RIV: AG - Legal Sciences

  4. ORF Alignment: NC_004431 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available db|1JCL|B Chain ... B, Observation Of Covalent Intermediates In An Enzyme ... Mechanism At Atom...es In An Enzyme ... Mechanism At Atomic Resolution ... Length = 251 ... Query: 9 ... MTDLKASSLRALKX

  5. ORF Alignment: NC_000913 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available db|1JCL|B Chain ... B, Observation Of Covalent Intermediates In An Enzyme ... Mechanism At Atom...es In An Enzyme ... Mechanism At Atomic Resolution ... Length = 251 ... Query: 1 ... MTDLKASSLRALKX

  6. Particle–particle collisions in the Lagrangian modelling of saltating grains By ROBERT J. BIALIK, Journal of Hydraulic Research, Vol. 49, No. 1 (2011), pp. 23–31

    Czech Academy of Sciences Publication Activity Database

    Lukerchenko, Nikolay

    2012-01-01

    Roč. 50, č. 2 (2012), s. 251-252 ISSN 0022-1686 Institutional research plan: CEZ:AV0Z20600510 Keywords : saltation * spherical particle * particle-particle collision * numerical model Subject RIV: BK - Fluid Dynamics

  7. 76 FR 76411 - Ocean Transportation Intermediary License; Applicants

    Science.gov (United States)

    2011-12-07

    ..., Application Type: New NVO License. Classic Car Transport, LLC dba Classic Car Export (OFF), 1920 W. 143rd...), 17890 Castleton, 251, City of Industry, CA 91748, Officers: Catherine Tsai, President/Treasurer...

  8. 40 CFR 52.2386 - Original identification of plan section.

    Science.gov (United States)

    2010-07-01

    ... section 5-101, “Definitions,” subsection 5-251(2), “Reasonably available control technology for large... Recovery Controls at Gasoline Dispensing Facilities,” effective in the State of Vermont on November 13...

  9. African Journal of Biotechnology - Vol 15, No 8 (2016)

    African Journals Online (AJOL)

    Codon usage bias analysis for the coding sequences of Camellia sinensis and Brassica campestris · EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT · DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. Prosenjit Paul, Supriyo Chakraborty, 236-251 ...

  10. Thermal Manifestations and Nanoindentation of Bone Cements for Orthopaedic Surgery

    Czech Academy of Sciences Publication Activity Database

    Hloch, Sergej; Monka, P.; Hvizdoš, P.; Jakubéczyová, D.; Kozak, D.; Čolič, K.; Kloc, J.; Magurová, D.

    2013-01-01

    Roč. 17, č. 1 (2013), s. 251-258 ISSN 0354-9836 Institutional support: RVO:68145535 Keywords : bone cement * exothermic behaviour * nanoindentation * porosity * osteonecrosis Subject RIV: FJ - Surgery incl. Transplants Impact factor: 0.962, year: 2013

  11. Ethiopian Journal of Environmental Studies and Management: Contact

    African Journals Online (AJOL)

    Principal Contact. O.A. Ajala Dr Department of Geography and Environmenta Department of Geography and Environmental Studies Bahir Dar University Bahir Phone: +251-911572166. Email: ejesmbd@yahoo.com ...

  12. (TCF7L2) variations associated with earlier age-onset of type 2 ...

    Indian Academy of Sciences (India)

    onset of type 2 diabetes in Thai patients. Watip Tangjittipokin, Nalinee Chongjarean, Nattachet Plengvidhya, Mayuree Homsanit and Pa-Thai Yenchitsomanus. J. Genet. 91, 251–255. Table 1. Details of primers and PCR reaction condition. SNP.

  13. Animal Production Research Advances - Vol 5, No 4 (2009)

    African Journals Online (AJOL)

    Carcass Characteristics and Economics of Broiler Chickens Fed Different Levels of Grasshopper Meal in Place of Fish Meal · EMAIL FULL TEXT EMAIL FULL TEXT DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. MA Muftau, BR Olorede, 248-251 ...

  14. 273-IJBCS-Article-M Gbeassor

    African Journals Online (AJOL)

    Dr Gatsing

    . Gadano A, Gurni A, Carballo M. 2006. Argentine folk medicine; genotoxic effects of Chenopodiaceae family. J. Ethnopharmacol., 103: 246-251. Gisby J, Bryant J. 2002. Efficacy of a new cream formulation of mupirocin: comparison with oral ...

  15. Pholiota highlandensis var. citrinosquamulosa (Fungi, Agaricales) is conspecific with Pholiota gallica

    Czech Academy of Sciences Publication Activity Database

    Holec, J.; Kolařík, Miroslav; Borgarino, D.; Bidaud, A.; Moreau, P.A.

    2016-01-01

    Roč. 103, 1-2 (2016), s. 251-263 ISSN 0029-5035 Institutional support: RVO:61388971 Keywords : Basidiomycota * Strophariaceae * phylogeny Subject RIV: EE - Microbiology, Virology Impact factor: 0.941, year: 2016

  16. Is It a Cosmetic, a Drug, or Both? (or Is It Soap?)

    Science.gov (United States)

    ... Simplified Chinese: PDF 251KB Traditional Chinese, PDF: 260KB Korean, PDF: 217KB Whether a product is a cosmetic ... does the law define a cosmetic? The Federal Food, Drug, and Cosmetic Act (FD&C Act) defines ...

  17. Sex differences in cardiovascular function

    Czech Academy of Sciences Publication Activity Database

    Kolář, František; Ošťádal, Bohuslav

    2013-01-01

    Roč. 207, č. 4 (2013), s. 584-587 ISSN 1748-1708 Institutional support: RVO:67985823 Keywords : heart * vascular * risk factors * sex Subject RIV: FA - Cardiovascular Diseases incl. Cardiotharic Surgery Impact factor: 4.251, year: 2013

  18. The Chlamydomonas genome reveals the evolution of key animal and plant functions

    Czech Academy of Sciences Publication Activity Database

    Merchant, S.S.; Prochnik, S. E.; Bišová, Kateřina

    2007-01-01

    Roč. 318, - (2007), s. 245-251 ISSN 0036-8075 Institutional research plan: CEZ:AV0Z50200510 Keywords : chlamydomonas reinhardtii * alga * eukaryotic cell Subject RIV: EE - Microbiology, Virology Impact factor: 26.372, year: 2007

  19. 75 FR 12715 - Notice of Intent To Request Public Comments

    Science.gov (United States)

    2010-03-17

    ... under the Fur Products Labeling Act 2011 303 Rules and Regulations under the Textile Fiber Products... Allowances and Other Merchandising Payments and Services 2012 251 Guide Concerning Use of the Word ``Free...

  20. 10 CFR 110.23 - General license for the export of byproduct material.

    Science.gov (United States)

    2010-01-01

    ...) Actinium-225 and -227, americium-241 and -242m, californium-248, -249, -250, -251, -252, -253, and -254, curium-240, -241, -242, -243, -244, -245, -246 and -247, einsteinium-252, -253, -254 and -255, fermium...

  1. Effects of Aedes aegypti salivary components on dendritic cell and lymphocyte biology

    Czech Academy of Sciences Publication Activity Database

    Bizzarro, B.; Barros, M.S.; Maciel, C.; Gueroni, D.I.; Lino, C.N.; Campopiano, J.; Kotsyfakis, Michalis; Amarante-Mendes, G.P.; Calvo, E.; Capurro, M.L.; Sa-Nunes, A.

    2013-01-01

    Roč. 6, NOV 2013 (2013), s. 329 ISSN 1756-3305 Institutional support: RVO:60077344 Keywords : dendritic cells * T-cells * Aedes aegypti * saliva * apoptosis Subject RIV: EC - Immunology Impact factor: 3.251, year: 2013

  2. Jak se laser uplatnil v holografii?

    Czech Academy of Sciences Publication Activity Database

    Miler, Miroslav

    2010-01-01

    Roč. 60, 4-5 (2010), s. 251-256 ISSN 0009-0700 Institutional research plan: CEZ:AV0Z20670512 Keywords : holography * lasers * coherence Subject RIV: JA - Electronics ; Optoelectronics, Electrical Engineering

  3. 76 FR 62694 - Appeal of Decisions Relating to Occupancy or Use of National Forest System Lands and Resources

    Science.gov (United States)

    2011-10-11

    ... Forest Service 36 CFR Parts 212, 214, 215, 218, 222, 228, 241, 251, 254, and 292 RIN 0596--AB45 Appeal of.... 214.10 Dismissal of an appeal. Sec. 251.93 Resolution of issues..... Sec. 214.15 Resolution of issues... noncompliance pursuant to 36 CFR part 228, subpart A or D, or part 292, subpart D, F, or G; (2) Approval or...

  4. Defending the absurd: the iconoclast's guide to section 47(1) of the ...

    African Journals Online (AJOL)

    This contribution was intended as a defence of section 25(1) of the Supreme Court Act 59 of 1959. However, the Supreme Court Act was repealed in August 2013 and replaced by the Superior Courts Act 10 of 2013, and in the process section 25(1) of the former gave way to section 47(1) of the latter. Both sections concern ...

  5. Book Review: Training the Party: Party Adaptation and Elite Training in Reform-era China

    DEFF Research Database (Denmark)

    Brødsgaard, Kjeld Erik

    2016-01-01

    Review of: Training the Party: Party Adaptation and Elite Training in Reform-era China. Charlotte P. Lee . Cambridge: Cambridge University Press, 2015. xii + 251 pp. $99.99. ISBN 978-1-107-09063-7......Review of: Training the Party: Party Adaptation and Elite Training in Reform-era China. Charlotte P. Lee . Cambridge: Cambridge University Press, 2015. xii + 251 pp. $99.99. ISBN 978-1-107-09063-7...

  6. The effect of transport density and gender on stress indicators and carcass and meat quality in pigs

    Energy Technology Data Exchange (ETDEWEB)

    Pereira, T.L.; Corassa, A.; Komiyama, C. M.; Araújo, C.V.; Kataoka, A.

    2015-07-01

    A total of 168 finishing pigs were used to investigate the effects of gender (barrows and gilts) and transport densities for slaughter (236, 251, and 275 kg/m²) on stress indicators and carcass and pork quality. The animals transported at 251 kg/m² (T251) presented cortisol values below those at 236 kg/m2 (T236), but no different from those at 275 kg/m2 (T275). The lactate dehydrogenase (LDH) values in pigs transported at T236 were the lowest. The blood components did not differ between T236 and T275. The pH values at 45 min (pH45) and at 24 h (pH24) postmortem were higher for pigs subjected to T236. However, the pH45 was higher at T251 than at T275, but pH24 was lower at T251 than at T275. The lightness values in the muscles of the pigs transported at T236 and T251 were higher than those at T275. Lower drip loss values were observed in the muscle of animals at T251. Carcasses of pigs at T236 contained more 1–5 cm lesions while those at T275 contained more 5–10 cmlesions in sections of loin. No significant effects of gender were found on the stress indicators, blood components, pH45, pH24, color, drip loss or carcass lesions in general. These results indicate that the pre-slaughter transport of pigs at densities of 251 kg/m² generates less physiological damage and smaller losses on carcass and pork quality irrespective of gender. (Author)

  7. Graphene nanoribbons as a drug delivery agent for lucanthone mediated therapy of glioblastoma multiforme.

    Science.gov (United States)

    Chowdhury, Sayan Mullick; Surhland, Cassandra; Sanchez, Zina; Chaudhary, Pankaj; Suresh Kumar, M A; Lee, Stephen; Peña, Louis A; Waring, Michael; Sitharaman, Balaji; Naidu, Mamta

    2015-01-01

    We report use of PEG-DSPE coated oxidized graphene nanoribbons (O-GNR-PEG-DSPE) as agent for delivery of anti-tumor drug Lucanthone (Luc) into Glioblastoma Multiformae (GBM) cells targeting base excision repair enzyme APE-1 (Apurinic endonuclease-1). Lucanthone, an endonuclease inhibitor of APE-1, was loaded onto O-GNR-PEG-DSPEs using a simple non-covalent method. We found its uptake by GBM cell line U251 exceeding 67% and 60% in APE-1-overexpressing U251, post 24h. However, their uptake was ~38% and 29% by MCF-7 and rat glial progenitor cells (CG-4), respectively. TEM analysis of U251 showed large aggregates of O-GNR-PEG-DSPE in vesicles. Luc-O-GNR-PEG-DSPE was significantly toxic to U251 but showed little/no toxicity when exposed to MCF-7/CG-4 cells. This differential uptake effect can be exploited to use O-GNR-PEG-DSPEs as a vehicle for Luc delivery to GBM, while reducing nonspecific cytotoxicity to the surrounding healthy tissue. Cell death in U251 was necrotic, probably due to oxidative degradation of APE-1. Copyright © 2015 Elsevier Inc. All rights reserved.

  8. Conditioned Media from Human Adipose Tissue-Derived Mesenchymal Stem Cells and Umbilical Cord-Derived Mesenchymal Stem Cells Efficiently Induced the Apoptosis and Differentiation in Human Glioma Cell Lines In Vitro

    Directory of Open Access Journals (Sweden)

    Chao Yang

    2014-01-01

    Full Text Available Human mesenchymal stem cells (MSCs have an intrinsic property for homing towards tumor sites and can be used as tumor-tropic vectors for tumor therapy. But very limited studies investigated the antitumor properties of MSCs themselves. In this study we investigated the antiglioma properties of two easily accessible MSCs, namely, human adipose tissue-derived mesenchymal stem cells (ASCs and umbilical cord-derived mesenchymal stem cells (UC-MSCs. We found (1 MSC conditioned media can significantly inhibit the growth of human U251 glioma cell line; (2 MSC conditioned media can significantly induce apoptosis in human U251 cell line; (3 real-time PCR experiments showed significant upregulation of apoptotic genes of both caspase-3 and caspase-9 and significant downregulation of antiapoptotic genes such as survivin and XIAP after MSC conditioned media induction in U 251 cells; (4 furthermore, MSCs conditioned media culture induced rapid and complete differentiation in U251 cells. These results indicate MSCs can efficiently induce both apoptosis and differentiation in U251 human glioma cell line. Whereas UC-MSCs are more efficient for apoptosis induction than ASCs, their capability of differentiation induction is not distinguishable from each other. Our findings suggest MSCs themselves have favorable antitumor characteristics and should be further explored in future glioma therapy.

  9. Chryseobacterium chengduensis sp. nov. isolated from the air of captive giant panda enclosures in Chengdu, China.

    Science.gov (United States)

    Wen, Cai-Fang; Xi, Li-Xin; Zhao, Shan; Hao, Zhong-Xiang; Luo, Lu; Liao, Hong; Chen, Zhen-Rong; She, Rong; Han, Guo-Quan; Cao, San-Jie; Wu, Rui; Yan, Qi-Gui; Hou, Rong

    2016-08-01

    A Gram-negative, aerobic, non-motile, rod-shaped bacterial strain, designated 25-1(T), was isolated from the air inside giant panda enclosures at the Chengdu Research Base of Giant Panda Breeding, China. Strain 25-1(T) grew optimally at pH 7.0-8.0, at 28-30 °C and in the presence of NaCl concentrations from 0.0% to 0.5 %. 16S rRNA gene sequence analysis indicated that strain 25-1(T) belongs to the genus Chryseobacterium within the family Flavobacteriaceae and is related most closely to C. carnis G81(T) (96.4% similarity), C. lathyri RBA2-6(T) (95.8% similarity), and C. zeae JM1085(T) (95.8% similarity). Its genomic DNA G+C molar composition was 36.2%. The major cellular fatty acids were iso-C15:0 (44.0%), iso-C17:0 3OH (19.8%) and C16:1 ω7c/16:1 ω6c (12.7%). The only isoprenoid quinone was menaquinone 6 (MK-6). The major polar lipids were phosphatidylethanolamine, two unidentified amino lipids and two unidentified lipids. The DNA-DNA relatedness between strain 25-1(T) and C. lathyri RBA2-6(T) was 38%. Phenotypic, genotypic, and phylogenetic characteristics indicated that strain 25-1(T) is a novel member of the genus Chryseobacterium, for which the name C. chengduensis sp. nov. is proposed. The type strain is 25-1(T) (CCTCC AB2015133(T)=DSM 100396(T)).

  10. Participation of endocannabinoids in rapid suppression of stress responses by glucocorticoids in neonates.

    Science.gov (United States)

    Buwembo, A; Long, H; Walker, C-D

    2013-09-26

    In adult rodents, endocannabinoids (eCBs) regulate fast glucocorticoid (GC) feedback in the hypothalamus-pituitary adrenal (HPA) axis, acting as retrograde messengers that bind to cannabinoid receptors (CB1R) and inhibit glutamate release from presynaptic CRH neurons in the paraventricular nucleus of the hypothalamus (PVN). During the first two weeks of life, rat pups exhibit significant CRH and ACTH responses to stress although the adrenal GC output remains reduced. At the same time, pups also display increased sensitivity to GC feedback, but it is unclear whether eCBs play a role in mediating fast GC feedback in neonatal life. In our studies, we examined the role of eCBs in the rapid suppression of anoxia-induced ACTH release and determined whether eCB action could be modulated by the levels of circulating GCs present at the time of stress. PND8 pups were subjected to 3-min anoxia with AM251, a CB1R blocker, injected 30 min prior to stress onset. The effects of either metyrapone (MET) (a steroidogenic 11 beta-hydroxylase blocker) or methylprednisolone (PRED) (a synthetic GC) pretreatment on AM251 effect and the stress response were evaluated. Treatment with AM251 before stress onset tended to increase overall ACTH and CORT secretion, and also delayed the return to baseline ACTH. The AM251 effect on ACTH in PND8 pups was lost in MET-treated pups, who exhibited high basal and stimulated ACTH release and no CORT response to stress. Methylprednisolone suppressed ACTH stress responses although AM251 still delayed restoration of ACTH levels to the baseline. This suggests that the eCB effect on ACTH secretion in neonates is most evident when there is a dynamic fluctuation of corticosterone levels. Interestingly, AM251 increased basal and stimulated corticosterone secretion in all treatments including MET, suggestive of a direct action of CB1R blockade on adrenal steroidogenesis. Copyright © 2012 IBRO. Published by Elsevier Ltd. All rights reserved.

  11. Atomistic determinants of co-enzyme Q reduction at the Qi-site of the cytochrome bc1 complex

    DEFF Research Database (Denmark)

    Postila, Pekka A.; Kaszuba, Karol; Kuleta, Patryk

    2016-01-01

    has been studied vigorously. Here, this vast amount of data is reassessed after probing the substrate reduction steps at the Q i-site of the cyt bc 1 complex of Rhodobacter capsulatus using atomistic molecular dynamics simulations. The simulations suggest that the Lys251 side chain could rotate...... into the Q i-site to facilitate binding of half-protonated semiquinone-a reaction intermediate that is potentially formed during substrate reduction. At this bent pose, the Lys251 forms a salt bridge with the Asp252, thus making direct proton transfer possible. In the neutral state, the lysine side chain...

  12. Anti-α-galactosidase A antibody response to agalsidase beta treatment

    DEFF Research Database (Denmark)

    Wilcox, William R; Linthorst, Gabor E; Germain, Dominique P

    2012-01-01

    Agalsidase beta, a form of recombinant human α-galactosidase A (αGAL), is approved for use as enzyme replacement therapy (ERT) for Fabry disease. An immunogenic response against a therapeutic protein could potentially impact its efficacy or safety. The development of anti-αGAL IgG antibodies...... was evaluated in 571 men and 251 women from the Fabry Registry who were treated with agalsidase beta. Most men developed antibodies (416 of 571, 73%), whereas most women did not (31 of 251, 12%). Women were also significantly more likely to tolerize than men; whereas 18 of 31 women tolerized (58%, 95%CI: 52...

  13. Propiedades Psicométricas del Exercise Addiction Inventory (EAI) en una Muestra de Estudiantes Brasileños Universitarios

    OpenAIRE

    Sicilia, Álvaro; Departamento de Educación, Facultad de Ciencias de la Educación, Universidad de Almería, España; Bracht, Valter; Laboratorio de Estudos em Educação Física (LESEF), Centro de Educação Física e Desportos, Universidade Federal do Espirito Santo, Vitoria, ES, Brasil; Penha, Vinicius; Laboratorio de Estudos em Educação Física (LESEF), Centro de Educação Física e Desportos, Universidade Federal do Espirito Santo, Vitoria, ES, Brasil; Almeida, Ueberson Ribero; Laboratorio de Estudos em Educação Física (LESEF), Centro de Educação Física e Desportos, Universidade Federal do Espirito Santo, Vitoria, ES, Brasil; Ferriz, Roberto; Departamento de Educación, Facultad de Ciencias de la Educación, Universidad de Almería, España; Alcaraz-Ibáñez, Manuel; Departamento de Educación, Facultad de Ciencias de la Educación, Universidad de Almería, España

    2017-01-01

    El objetivo de este estudio fue validar el Inventario de Adicción al Ejercicio (EAI) en el contexto brasileño. Participaron en el estudio 251 estudiantes universitarios (hombres= 132, mujeres= 119, Medad = 22.34, DT = 4.65). Los resultados mostraron un adecuado ajuste del modelo a los datos: χ2 (9, N = 251) = 17.45, p = .04; χ2/gl = 1.94; CFI = .96; IFI = .96; RMSEA = .061 (IC 90% = .01, .10); SRMR = .041. La estructura factorial se mostró invariante respecto al género. Se obtuvieron adecuad...

  14. Polymorphism of inflammatory genes and arsenic methylation capacity are associated with urothelial carcinoma

    Energy Technology Data Exchange (ETDEWEB)

    Wu, Chia-Chang [School of Public Health, College of Public Health and Nutrition, Taipei Medical University, Taipei, Taiwan (China); Department of Urology, Taipei Medical University—Shuang Ho Hospital, Taipei, Taiwan (China); Huang, Yung-Kai [School of Oral Hygiene, College of Oral Medicine, Taipei Medical University, Taipei, Taiwan (China); Chung, Chi-Jung [Department of Health Risk Management, College of Public Health, China Medical University and Hospital, Taichung, Taiwan (China); Department of Medical Research, China Medical University Hospital, Taichung, Taiwan (China); Huang, Chao-Yuan; Pu, Yeong-Shiau [Department of Urology, National Taiwan University Hospital, College of Medicine National Taiwan University, Taipei, Taiwan (China); Shiue, Horng-Sheng [Department of Chinese Medicine, Chang Gung Memorial Hospital, Taipei, Taiwan (China); Lai, Li-An [School of Public Health, College of Public Health and Nutrition, Taipei Medical University, Taipei, Taiwan (China); Lin, Ying-Chin [Department of Family Medicine, Shung Ho Hospital, Taipei Medical University, Taipei, Taiwan (China); Department of Health Examination, Wan Fang Hospital, Taipei Medical University, Taipei, Taiwan (China); Su, Chien-Tien [Department of Family Medicine, Taipei Medical University Hospital, Taipei, Taiwan (China); Hsueh, Yu-Mei, E-mail: ymhsueh@tmu.edu.tw [School of Public Health, College of Public Health and Nutrition, Taipei Medical University, Taipei, Taiwan (China); Department of Public Health, School of Medicine, College of Medicine, Taipei Medical University, Taipei, Taiwan (China)

    2013-10-01

    Chronic exposure to arsenic can generate reactive oxidative species, which can induce certain proinflammatory cytokines such as tumor necrosis factor-alpha (TNF-α), interleukin-6 (IL-6) and interleukin-8 (IL-8). TNF-α, IL-6 and IL-8 have been shown to be involved in the development and progression of various cancers, including bladder cancer. This study aimed to investigate the joint effect of the polymorphism of TNF-α − 308 G/A, IL-6 − 174 G/C, IL-8 − 251 T/A and urinary arsenic profiles on urothelial carcinoma (UC) risk. This study evaluated 300 pathologically-confirmed cases of UC and 594 cancer-free controls. Urinary arsenic species were detected using high-performance liquid chromatography-linked hydride generator and atomic absorption spectrometry. The polymorphism of TNF-α − 308 G/A, IL-6 − 174 G/C and IL-8 − 251 T/A was determined using polymerase chain reaction-restriction fragment length polymorphism. The joint effects on UC risk were estimated by odds ratios and 95% confidence intervals using unconditional logistic regression. We found that the TNF-α − 308 A/A and IL-8 − 251 T/T polymorphisms were significantly associated with UC. Moreover, significant dose–response joint effect of TNF-α − 308 A/A or IL-8 − 251 T/T genotypes and arsenic methylation indices were seen to affect UC risk. The present results also showed a significant increase in UC risk in subjects with the IL-8 − 251 T/T genotype for each SD increase in urinary total arsenic and MMA%. In contrast, a significant decrease in UC risk was found in subjects who carried the IL-8 − 251 T/T genotype for each SD increase in DMA%. - Highlights: • Joint effect of the TNF-α -308 A/A genotype and urinary total arsenic affected UC. • Joint effect of the IL-8 -251 T/T genotype and urinary total arsenic affected UC. • Urinary total arsenic level, TNF-α -308 A/A and IL-8 -251 T/T genotype affected UC.

  15. Molecular evidence for polyphyletic origin of the primary symbionts of sucking lice (Phthiraptera, Anoplura)

    Czech Academy of Sciences Publication Activity Database

    Hypša, Václav; Křížek, J.

    2007-01-01

    Roč. 54, č. 2 (2007), s. 242-251 ISSN 0095-3628 Grant - others:GA ČR(CZ) GA206/04/0520 Institutional research plan: CEZ:AV0Z60220518 Keywords : Anoplura * endosymbionts * coevolution * molecular phylogeny Subject RIV: EE - Microbiology, Virology Impact factor: 2.558, year: 2007

  16. Journal of Astrophysics and Astronomy | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    2016-01-27

    Jan 27, 2016 ... Moscow Engineering Physics Institute, Kashirskoe Shosse 31, 115409 Moscow, Russia. Astronomical Institute, Czech Academy of Sciences, Fricova 298, 251 65 Ondrejov, Czech Republic. INAF/Observatorio Astronomico di Palermo and University of Palermo, Palazzo dei Normanni, I-90134 Palermo, Italy.

  17. Rising trend and indications of caesarean section at the university of ...

    African Journals Online (AJOL)

    2009-10-05

    5.1%). .... 5. 176. 14.8. Total. 1192. 100. Booking status. Booked. 941. 78.9. Unbooked. 251. 21.1. Total. 1192. 100. Type of C/S. Emergency. 947. 79.4. Elective. 245. 20.6 .... Those who cannot afford have to resort to other.

  18. Download this PDF file

    African Journals Online (AJOL)

    IV fluids 16 6.4. Others” 13 5.2. Total 251 100. Others**: antihelimenths, CVS drugs and Bronchodilators. Crystalline penicillin, gentamicine and ampicilline were the most commonly used antibiotics. Fursemide VitaminA were frequently used diuretics and vitamins respectively (Table 4). #TTN= Crystalline peniciſm * Percent.

  19. A retrospective analysis of acute organophosphorus poisoning ...

    African Journals Online (AJOL)

    A retrospective analysis of acute organophosphorus poisoning cases admitted to the tertiary care teaching hospital in South India. ... Young adult males were more commonly involved than females (M:F 2.5:1). The mean age of the patients was 28 years (range 2-72 years, SD ± 14.3 years). Mean time to receive treatment ...

  20. On the excited state wave functions of Dirac fermions in the random ...

    Indian Academy of Sciences (India)

    [22] G W Semenoff, Phys. Rev. Lett. 53, 2449 (1984). [23] K S Novoselov et al, Nature (London) 438, 197 (2005). [24] M P A Fisher and E Fradkin, Nucl. Phys. B251, 457 (1985). [25] A A Nersesyan, A M Tsvelik and F Wegner, Nucl. Phys. B438, 561 (1995). [26] D V Khveshchenko, A G Yashenkin and I V Gornyi, Phys. Rev.

  1. Browse Title Index

    African Journals Online (AJOL)

    Items 251 - 300 of 399 ... Issue, Title. Vol 11, No 2 (2012), Pattern of diabetic retinopathy in Kano, Nigeria, Abstract PDF. A Lawan, TB Mohammed. Vol 6, No 4 (2007), Pattern of Eclampsia in a Tertiary Health Facility Situated in a Semi-Rural Town in Northern Nigeria, Abstract PDF. J Tukur, BA Umar, A Rabi'u. Vol 7, No 3 (2008) ...

  2. Browse Author Index

    African Journals Online (AJOL)

    Items 251 - 300 of 1046 ... Ekore, Rabi Ilemona · Ekundayo, OO · Ekundayo, OS · Elegbeleye, AO · Elegbeleye, Ayotunde Oluwadamilola · Emmanuel, CO · Engelbrecht, Natasjha · Eni-Olorunda, T · Ephraim-Oluwanuga, Sola · Epie, C · Erhabor, SI · Eromonsele, O Andrew · Esere, M.O · Esmeranda, Manful · Ettang, Dorcas

  3. Browse Title Index

    African Journals Online (AJOL)

    Items 251 - 300 of 350 ... Vol 2, No 1 (2006), Preference for goat meat and milk products consumption in Bauchi state, Nigeria, Abstract. D Zahraddeen, ISR ... Vol 2, No 3 (2006), Prevalence of gastrointestinal helminthes in dromedary camels (Camelus dromedarius) slaughtered at Kano, Nigeria, Abstract. DJU Kalla, AM ...

  4. 14 CFR Special Federal Aviation... - Mitsubishi MU-2B Series Special Training, Experience, and Operating Requirements

    Science.gov (United States)

    2010-01-01

    ... applicable) a. TPE331-10-511M b. TPE331-5/6-252/251M c. TPE331-1-151M G. Engine Malfunctions and Failures 1... into Terrain Awareness B. CRM/SPRM 1. Crew Resource Management 2. Single Pilot Resource Management C... Procedures. (3) * Normal Takeoff (X-Wind) (Two Engine). (4) * Takeoff Engine Failure. (5) Rejected Takeoff...

  5. P A Aswatha Narayana

    Indian Academy of Sciences (India)

    P A Aswatha Narayana. Articles written in Sadhana. Volume 26 Issue 3 June 2001 pp 251-283. Finite element simulation of internal flows with heat transfer using a velocity correction approach · B S Varaprasad Patnaik Y T K Gowda M S Ravisankar P A Aswatha Narayana K N Seetharamu · More Details Abstract Fulltext ...

  6. Browse Title Index

    African Journals Online (AJOL)

    Items 251 - 257 of 257 ... Vol 26, No 1 (2016), Visibility of University of Zululand and Moi University Researchers in Web of Science and Scopus from 2003 to 2013, Abstract. Dennis N. Ocholla, Janneke Mostert, Daniel C. Rotich. Vol 12, No 2 (2002), Website Design on Some Aspects of a Peoples Culture: The Binis of Edo State ...

  7. Preparation of Mn-Zn ferrite nanoparticles and their silica-coated clusters: magnetic properties and transverse relaxivity

    Czech Academy of Sciences Publication Activity Database

    Kaman, Ondřej; Kuličková, Jarmila; Herynek, Vít; Koktan, Jakub; Maryško, Miroslav; Dědourková, T.; Knížek, Karel; Jirák, Zdeněk

    2017-01-01

    Roč. 427, Apr (2017), s. 251-257 ISSN 0304-8853 Institutional support: RVO:68378271 ; RVO:68378041 Keywords : magnetic nanoparticles * Mn-Zn ferrite * hydrothermal synthesis * magnetic resonance imaging * transverse relaxivity Subject RIV: BM - Solid Matter Physics ; Magnetism OBOR OECD: Condensed matter physics (including formerly solid state physics, supercond.) Impact factor: 2.630, year: 2016

  8. Browse Title Index

    African Journals Online (AJOL)

    Items 251 - 300 of 333 ... M O Ironkwe, F O Ajayi. Vol 15, No 1 (2016), Profitability of groundnut-based .... Grace C. Onuoha. Vol 5, No 2 (2006), Studies on the relationship between organic matter and exchangeable aluminium in representative soils of Cross River state, Abstract. EE Attoe, AU Akpan-Idiok, LE Isong. Vol 9, No 1 ...

  9. Photo-bleaching of polymer discoloration caused by quinone methides

    Czech Academy of Sciences Publication Activity Database

    Pospíšil, Jan; Nešpůrek, Stanislav; Zweifel, H.; Kuthan, J.

    2002-01-01

    Roč. 78, č. 2 (2002), s. 251-255 ISSN 0141-3910 R&D Projects: GA AV ČR IAA1050901 Institutional research plan: CEZ:AV0Z4050913 Keywords : quinone methide * photo-bleaching * polymer discoloration Subject RIV: CD - Macromolecular Chemistry Impact factor: 1.145, year: 2002

  10. Preparation and characterization of ZnS nanoparticles deposited on montmorillonite

    Czech Academy of Sciences Publication Activity Database

    Kozák, O.; Praus, P.; Kočí, K.; Klementová, Mariana

    2010-01-01

    Roč. 352, č. 2 (2010), s. 244-251 ISSN 0021-9797 Institutional research plan: CEZ:AV0Z40320502 Keywords : ZnS nanoparticles * montmorillonite * photoluminescence * photocatalysis * carbon dioxide Subject RIV: CA - Inorganic Chemistry Impact factor: 3.068, year: 2010

  11. All projects related to | Page 183 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Topic: SURVEYS, STATISTICAL ANALYSIS, POLICY MAKING, LOW INCOME GROUPS, SOCIAL PROBLEMS, TAXATION, HEALTH POLICY, DISEASES, MARKETING. Region: Argentina, Bolivia, Chile, Peru, United States. Program: Food, Environment, and Health. Total Funding: CA$ 251,500.00. The Impact of Price, Tax, ...

  12. Reverse altitudinal cline in cold hardiness among Erebia butterflies

    Czech Academy of Sciences Publication Activity Database

    Vrba, Pavel; Konvička, Martin; Nedvěd, Oldřich

    2012-01-01

    Roč. 33, č. 4 (2012), s. 251-258 ISSN 0143-2044 Grant - others:GA ČR(CZ) GAP505/10/1630; University of South Bohemia(CZ) 144/2010/100 Institutional support: RVO:60077344 Keywords : Alpine habitats * butterfly ecology * climate change Subject RIV: EH - Ecology, Behaviour Impact factor: 0.837, year: 2012

  13. Opuštěné vojenské prostory jako významná refugia motýlí fauny

    Czech Academy of Sciences Publication Activity Database

    Vrba, Pavel; Čížek, Oldřich; Marhoul, P.; Zámečník, J.; Beneš, Jiří; Konvička, Martin

    2012-01-01

    Roč. 2012, č. 5 (2012), s. 251-254 ISSN 0044-4812 R&D Projects: GA ČR GAP505/10/2167 Grant - others:Ministerstvo životního prostředí(CZ) VaV/SP/2d3/153/08 Institutional support: RVO:60077344 Keywords : butterfly fauna

  14. Determination of lycopene in food by on-line SFE-LC eliminating its degradation during the analytical procedure

    Czech Academy of Sciences Publication Activity Database

    Pól, Jaroslav; Hyötyläinen, T.; Ranta-Aho, O.; Riekkola, M. L.

    2005-01-01

    Roč. 99, S (2005), s251 ISSN 0009-2770. [Meeting on Chemistry and Life /3./. 20.09.2005-22.09.2005, Brno] R&D Projects: GA AV ČR KJB4031405 Keywords : liquid chromatography * supercritical fluid extraction * antioxidant Subject RIV: CB - Analytical Chemistry, Separation

  15. Browse Title Index

    African Journals Online (AJOL)

    Items 251 - 300 of 781 ... Vol 24, No 1 (1997), Effects of replacing maize with graded levels of mango-seed kernel meal on the performance characteristics of broiler chicks and chickens, Abstract. GF Faniyi. Vol 43, No 1 (2016), Effects of sex and frequency of litter change on growth prformance, haematology and carcass yield ...

  16. Browse Title Index

    African Journals Online (AJOL)

    Items 251 - 300 of 1255 ... Issue, Title. Vol 10, No 1 (2004), CAREER MOTIVATION AND SPECIALTY CHOICE OF VETERINARY MEDICAL STUDENTS AT USMANU DANFODIYO UNIVERSITY, SOKOTO, NIGERIA, Abstract. DBU Edemeka, OP Ajagbonna. Vol 11, No 1 (2005), Cataractogenic Potential Of Cyanide-Induced ...

  17. Browse Title Index

    African Journals Online (AJOL)

    Items 251 - 286 of 286 ... Vol 2, No 2 (2008), The effect of soaking and roasting on the proximate and functional properties of asparagus bean (Vigna sesquipedalis), Abstract. JN Nwosu, EN Nwajei, VO Ogbonna. Vol 5, No 2 (2011), The effects of feeding maize cob meal diets on the hematology of grower pigs, Abstract.

  18. 76 FR 10213 - Special Conditions: Embraer Model EMB-135BJ (Legacy 650) Airplanes, Limit Engine Torque Loads for...

    Science.gov (United States)

    2011-02-24

    ..., including Amendments 25-1 through 25-124, for components, areas, appliances, and systems affected by the... that the frequency of occurrence of the most severe sudden-engine-stoppage events is rare. Relative to... intended in Sec. 25.361(b), a more comprehensive criteria is needed for the new generation of high-bypass...

  19. Production of Polyclonal Antibodies to the Recombinant Potato virus M (PVM) Non-structural Triple Gene Block Protein 1 and Coat Protein

    Czech Academy of Sciences Publication Activity Database

    Čeřovská, Noemi; Moravec, Tomáš; Plchová, Helena; Hoffmeisterová, Hana; Dědič, P.

    2012-01-01

    Roč. 160, č. 5 (2012), s. 251-254 ISSN 0931-1785 R&D Projects: GA MŠk 1M06030 Institutional research plan: CEZ:AV0Z50380511 Keywords : Potato virus M * recombinant protein * coat protein Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 1.000, year: 2012

  20. 76 FR 25704 - Announcement of Funding Awards for the Emergency Capital Repair Grant Program; Fiscal Year 2010

    Science.gov (United States)

    2011-05-05

    .......... PA 12 251,953 Replace windows, emergency call system, elevators and roof. Culpepper Garden I Culpepper Garden I, Inc. Arlington VA 204 447,071 Replace the convertor system tees and piping. DePaul House... could not be absorbed within the project's operating budget and other project resources. A total of $4...

  1. Inadequate humidification of respiratory gases during mechanical ventilation of the newborn.

    Science.gov (United States)

    Tarnow-Mordi, W O; Sutton, P; Wilkinson, A R

    1986-01-01

    Proximal airway humidity was measured during mechanical ventilation in 14 infants using an electronic hygrometer. Values below recommended minimum humidity of adult inspired gas were recorded on 251 of 396 occasions. Inadequate humidification, largely due to inadequate proximal airway temperature, is commoner than recognised in infants receiving mechanical ventilation. PMID:3740912

  2. Browse Title Index

    African Journals Online (AJOL)

    Items 251 - 300 of 446 ... African Journal for the Psychological Study of Social Issues. ... John Oselenbalu Ekore, Henriet Omonike Aiyedun. Vol 5, No 2 (2000), Person-environment fit as a predictor of job satisfaction and stability at work of secondary school teachers, Abstract. SO Salami. Vol 10 (2007), Physical and sexual ...

  3. Optically transparent diamond-PDMS microfluidic system for electronic monitoring of cells

    Czech Academy of Sciences Publication Activity Database

    Babchenko, Oleg; Kromka, Alexander; Conde, J.P.; Chu, V.; Schmiedinger, T.; Rezek, Bohuslav

    2014-01-01

    Roč. 251, č. 12 (2014), s. 2593-2598 ISSN 0370-1972 R&D Projects: GA ČR GAP108/12/0996 Institutional support: RVO:68378271 Keywords : cells culturing * diamond sensor * electrical characterization * microfluidic system * optical monitoring * surface conductivity Subject RIV: BO - Biophysics Impact factor: 1.489, year: 2014

  4. Murray Pittock, ed., The Edinburgh Companion to Scottish Romanticism.

    Directory of Open Access Journals (Sweden)

    Manfred Malzahn

    2013-10-01

    Full Text Available Murray Pittock, ed., The Edinburgh Companion to Scottish Romanticism. Edinburgh: Edinburgh University Press, 2011. Pp. 251. ISBN 978-0-7486-3845-1 (hardback. £ 65.00. ISBN 978-0-7486-3846-8 (paperback. £ 21.99.

  5. ARBITRATION PROCEEDINGS: LAW SOCIETY OF THE ...

    African Journals Online (AJOL)

    10332324

    administrator to exercise discretion to give a person whose rights are materially and adversely affected by administrative action an opportunity to obtain legal representation both in serious and in complex cases, Rule 25(1)(c) does not, as does section 3(3)(a) of PAJA, confer the discretion on the commissioner in a CCMA.

  6. Browse Title Index

    African Journals Online (AJOL)

    Items 251 - 300 of 879 ... Vol 24, No 2 (2010), (Em)bodying affirmative action within a sociality of meaning making, Abstract. A Badroodien. Vol 24, No 2 (2010) ... G v W. Brand. Vol 24, No 3 (2010), Enhancing capacity for social justice work within the academy: Building critical consciousness, Abstract. S Ratković, S Tilley, ...

  7. Sadhana | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    Keyhole depth instability in case of CW CO2 laser beam welding of mild steel · N Kumar S Dash A K ... April 2011 pp 251-265. Melt pool vorticity in deep penetration laser material welding ... April 2013 pp 235-246. Study of dimensionless quantities to analyse front and rear wall of keyhole formed during laser beam welding.

  8. Browse Title Index

    African Journals Online (AJOL)

    Items 251 - 300 of 831 ... Vol 14, No 2 (2005), Fibroadenoma cowxisting with infiltrating ductal carcinoma a case report, Abstract. M Gogo-Abite, D Seleye-Fubara, RS Jamabo. Vol 14, No 4 (2005), Five-year experience with depot medroxy progesterone acetate injectable contraception, Abstract. FO Ezugwu, SE Anya. Vol 17 ...

  9. SPECTRUM OF CARDIOVASCULAR DISORDERS IN A NATIONAL ...

    African Journals Online (AJOL)

    hi-tech

    2000-12-12

    Dec 12, 2000 ... Strang J.I.G. Echoes from the Third World - two dimensional echocardiography in a developing country. S. Afr. Med. J. 1990; 77:85-91. 22. Markowitz M. Observations on the epidemiology and preventability of rheumatic fever in developing countries. Clin. Ther. 1981; 4:240-251. 23. Anabwani G.M., Book W ...

  10. the bacteriological safety and antimicrobial

    African Journals Online (AJOL)

    GB

    2013-03-01

    Mar 1, 2013 ... serotypes Typhimurium, Enteritidis and. Infantis from human infections, food stuffs and farm animals in Italy. Epidemiol Infec,. 2004; 132: 245-251. 34. Centinkaya F, Cibik G, Soyuteniz E, Ozkin C,. Kayali R, Levent B. Shigella and Salmonella contamination in various foodstuffs in Turkey. Food Control, 2008 ...

  11. Browse Title Index

    African Journals Online (AJOL)

    Items 251 - 300 of 2005 ... Issue, Title. Vol 92, No 4 (2015), Blood Pressure and Obesity Index Assessment in a Typical Urban Slum in Enugu, Nigeria, Abstract. GI Ahaneku, CU Osuji, OC Oguejiofor, BC Anisiuba, VO Ikeh, JE Ahaneku. Vol 80, No 10 (2003):, Blood pressure control in a population where antihypertensives are ...

  12. Identification of tuberculosis bacteria based on shape and color

    Czech Academy of Sciences Publication Activity Database

    Forero, M. G.; Šroubek, Filip; Cristóbal, G.

    2004-01-01

    Roč. 10, č. 4 (2004), s. 251-262 ISSN 1077-2014 R&D Projects: GA ČR GA102/04/0155 Institutional research plan: CEZ:AV0Z1075907 Keywords : tuberculosis * fluorescence microscopy * clustering Subject RIV: BD - Theory of Information Impact factor: 0.455, year: 2004

  13. Bulletin of Materials Science | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    Home; Journals; Bulletin of Materials Science. Chandrabhas Narayana. Articles written in Bulletin of Materials Science. Volume 33 Issue 3 June 2010 pp 251-255 Polymers. Effect of substrate roughness on growth of diamond by hot filament CVD · Awadesh K Mallik S R Binu L N Satapathy Chandrabhas Narayana Md Motin ...

  14. Thermally stimulated discharge conductivity in polymer composite ...

    Indian Academy of Sciences (India)

    Unknown

    Klason Carl and Kubat Josef 1975 J. Appl. Polym. Sci. 19 831. Ramadin Y, Ahmed M, Jawad S A and Zihlif A 1993 J. Polym. Mater. 10 251. Sangawar V S 1996 D.C. electrical conductivity study of poly- styrene and polymethyl methacrylate iodine doped thermo- electrets, Ph.D. Thesis, Amravati University, Amravati.

  15. Stimulation of prolactin receptor induces STAT-5 phosphorylation and cellular invasion in glioblastoma multiforme.

    Science.gov (United States)

    Alkharusi, Amira; Yu, Shengze; Landázuri, Natalia; Zadjali, Fahad; Davodi, Belghis; Nyström, Thomas; Gräslund, Torbjörn; Rahbar, Afsar; Norstedt, Gunnar

    2016-11-29

    Glioblastoma multiforme (GBM) is the most common and aggressive primary brain tumor in humans and is characterized with poor outcome. In this study, we investigated components of prolactin (Prl) system in cell models of GBM and in histological tissue sections obtained from GBM patients. Expression of Prolactin receptor (PrlR) was detected at high levels in U251-MG, at low levels in U87-MG and barely detectable in U373 cell lines and in 66% of brain tumor tissues from 32 GBM patients by immunohistochemical technique. In addition, stimulation of U251-MG and U87-MG cells but not U373 with Prl resulted in increased STAT5 phosphorylation and only in U251-MG cells with increased cellular invasion. Furthermore, STAT5 phosphorylation and cellular invasion induced in Prl stimulated cells were significantly reduced by using a Prl receptor antagonist that consists of Prl with four amino acid replacements. We conclude that Prl receptor is expressed at different levels in the majority of GBM tumors and that blocking of PrlR in U251-MG cells significantly reduce cellular invasion.

  16. Bevacizumab targeting diffuse intrinsic pontine glioma : Results of 89Zr-bevacizumab PET imaging in brain tumor models

    NARCIS (Netherlands)

    Jansen, Marc H A; Lagerweij, Tonny; Sewing, A. Charlotte P; Vugts, Danielle J.; Van Vuurden, Dannis G.; Molthoff, Carla F M; Caretti, Viola; Veringa, Susanna J E; Petersen, Naomi; Carcaboso, Angel M.; Noske, David P.; Vandertop, W. Peter; Wesseling, Pieter; Van Dongen, Guus A M S; Kaspers, Gertjan J L; Hulleman, Esther

    2016-01-01

    The role of the VEGF inhibitor bevacizumab in the treatment of diffuse intrinsic pontine glioma (DIPG) is unclear. We aim to study the biodistribution and uptake of zirconium-89 (89Zr)-labeled bevacizumab in DIPG mouse models. Human E98-FM, U251-FM glioma cells, and HSJD-DIPG-007-FLUC primary DIPG

  17. 33 CFR 127.003 - Incorporation by reference.

    Science.gov (United States)

    2010-07-01

    ... NFPA 70, National Electrical Code, 1993 127.107; 127.201; 127.1107 NFPA 251, Fire Tests of Building..., (CG-543), 2100 2nd St., SW., Stop 7581, Washington, DC 20593-7581, and at the National Archives and...-6030, or go to: http://www.archives.gov/federal_register/code_of_federal_regulations/ibr_locations.html...

  18. Screening for Chinese Children with Dyslexia in Hong Kong: The Use of the Teachers' Behaviour Checklist

    Science.gov (United States)

    Chan, David W.; Ho, Connie Suk-Han; Tsang, Suk-Man; Lee, Suk-Han; Chung, Kevin K. H.

    2004-01-01

    Primary school teachers rated the frequency of occurrence of 65 reading-related behavioural characteristics in a sample of 251 Grade 1 to Grade 6 Chinese school children in Hong Kong. These behavioural characteristics were in the areas of general performance, reading, dictation, writing, mathematics, language, memory, concentration, sequential…

  19. Comparison of 6q25 breast cancer hits from Asian and European genome wide association studies in the Breast Cancer Association consortium (BCAC)

    NARCIS (Netherlands)

    R. Hein (Rebecca); M. Maranian (Melanie); J.L. Hopper (John); M.K. Kapuscinski (Miroslaw); M.C. Southey (Melissa); D.J. Park (Daniel); M.K. Schmidt (Marjanka); A. Broeks (Annegien); F.B.L. Hogervorst (Frans); H.B. Bueno-de-Mesquit (Bas); K.R. Muir (Kenneth); A. Lophatananon (Artitaya); S. Rattanamongkongul (Suthee); P. Puttawibul (Puttisak); P.A. Fasching (Peter); A. Hein (Alexander); A.B. Ekici (Arif); M.W. Beckmann (Matthias); O. Fletcher (Olivia); N. Johnson (Nichola); I. dos Santos Silva (Isabel); J. Peto (Julian); E.J. Sawyer (Elinor); I.P. Tomlinson (Ian); M. Kerin (Michael); N. Miller (Nicola); F. Marmee (Frederick); A. Schneeweiss (Andreas); C. Sohn (Christof); B. Burwinkel (Barbara); P. Guénel (Pascal); E. Cordina-Duverger (Emilie); F. Menegaux (Florence); T. Truong (Thérèse); S.E. Bojesen (Stig); B.G. Nordestgaard (Børge); H. Flyger (Henrik); R.L. Milne (Roger); J.I.A. Perez (Jose Ignacio Arias); M.P. Zamora (Pilar); J. Benítez (Javier); H. Anton-Culver (Hoda); A. Ziogas (Argyrios); L. Bernstein (Leslie); C.A. Clarke (Christina); H. Brenner (Hermann); H. Müller (Heike); V. Arndt (Volker); C. Stegmaier (Christa); N. Rahman (Nazneen); S. Seal (Sheila); C. Turnbull (Clare); A. Renwick (Anthony); A. Meindl (Alfons); S. Schott (Sarah); C.R. Bartram (Claus); R.K. Schmutzler (Rita); H. Brauch (Hiltrud); U. Hamann (Ute); Y-D. Ko (Yon-Dschun); S. Wang-Gohrke (Shan); T. Dörk (Thilo); P. Schürmann (Peter); J.H. Karstens (Johann); P. Hillemanns (Peter); H. Nevanlinna (Heli); T. Heikinen (Tuomas); K. Aittomäki (Kristiina); C. Blomqvist (Carl); N.V. Bogdanova (Natalia); I.V. Zalutsky (Iosif); N.N. Antonenkova (Natalia); M. Bermisheva (Marina); D. Prokovieva (Darya); A. Farahtdinova (Albina); E.K. Khusnutdinova (Elza); A. Lindblom (Annika); S. Margolin (Sara); A. Mannermaa (Arto); V. Kataja (Vesa); V-M. Kosma (Veli-Matti); J. Hartikainen (Jaana); X. Chen (Xiaoqing); J. Beesley (Jonathan); D. Lambrechts (Diether); H. Zhao (Hui); P. Neven (Patrick); H. Wildiers (Hans); S. Nickels (Stefan); D. Flesch-Janys (Dieter); P. Radice (Paolo); P. Peterlongo (Paolo); S. Manoukian (Siranoush); M. Barile (Monica); F.J. Couch (Fergus); J.E. Olson (Janet); X. Wang (Xianshu); Z. Fredericksen (Zachary); G.G. Giles (Graham); L. Baglietto (Laura); C.A. McLean (Catriona Ann); G. Severi (Gianluca); K. Offit (Kenneth); M. Robson (Mark); M.M. Gaudet (Mia); J. Vijai (Joseph); G.G. Alnæs (Grethe); V. Kristensen (Vessela); A.L. Børresen-Dale (Anne Lise); E.M. John (Esther); A. Miron (Alexander); R. Winqvist (Robert); K. Pykäs (Katri); A. Jukkola-Vuorinen (Arja); M. Grip (Mervi); I.L. Andrulis (Irene); J.A. Knight (Julia); G. Glendon (Gord); A.M. Mulligan (Anna Marie); J.D. Figueroa (Jonine); M. García-Closas (Montserrat); J. Lissowska (Jolanta); M.E. Sherman (Mark); M.J. Hooning (Maartje); J.W.M. Martens (John); C.M. Seynaeve (Caroline); J.M. Collée (Margriet); P. Hall (Per); K. Humpreys (Keith); K. Czene (Kamila); J. Liu (Jianjun); A. Cox (Angela); I.W. Brock (Ian); S.S. Cross (Simon); M.W.R. Reed (Malcolm); S. Ahmed (Shahana); M. Ghoussaini (Maya); P.D.P. Pharoah (Paul); D. Kang (Daehee); K-Y. Yoo (Keun-Young); D-Y. Noh (Dong-Young); A. Jakubowska (Anna); K. Jaworska (Katarzyna); K. Durda (Katarzyna); E. Złowocka (Elzbieta); S. Sangrajrang (Suleeporn); V. Gaborieau (Valerie); P. Brennan (Paul); J.D. McKay (James); C-Y. Shen (Chen-Yang); J-C. Yu (Jyh-Cherng); H.-M. Hsu (Huan-Ming); M.-F. Hou (Ming-Feng); N. Orr (Nick); M. Schoemaker (Minouk); A. Ashworth (Alan); A.J. Swerdlow (Anthony ); A. Trentham-Dietz (Amy); P. Newcomb (Polly); L. Titus (Linda); K.M. Egan (Kathleen); G. Chenevix-Trench (Georgia); A.C. Antoniou (Antonis); M.K. Humphreys (Manjeet); J. Morrison (Jonathan); J. Chang-Claude (Jenny); D.F. Easton (Douglas); A.M. Dunning (Alison)

    2012-01-01

    textabstractThe 6q25.1 locus was first identified via a genome-wide association study (GWAS) in Chinese women and marked by single nucleotide polymorphism (SNP) rs2046210, approximately 180 Kb upstream of ESR1. There have been conflicting reports about the association of this locus with breast

  20. Browse Title Index

    African Journals Online (AJOL)

    Items 251 - 300 of 444 ... K Opoku-Ameyaw, FK Oppong, K Ofori-Frimpong, FM Amoah, K Osei-Bonsu. Vol 39, No 1 (2006), Irradiation of ready meals for microbiological safety and shelf-life extension. 1. Microbiological quality of waakye and other ready-to-eat meals, Abstract. J Nketsia-Tabiri, A Adu-Gyamfi, A Owusu-Biney.

  1. Browse Title Index

    African Journals Online (AJOL)

    Items 251 - 300 of 406 ... Vol 54, No 1 (2016), Positron emission tomography/computed tomography scanning for the diagnosis of occult sepsis in the critically injured, Abstract PDF. D Muckart, T Hardcastle, F Peer. Vol 51, No 2 (2013), Posterolateral diaphragmatic hernia with small-bowel incarceration in an adult, Abstract ...

  2. Demolition work

    CERN Multimedia

    2004-01-01

    Because of demolition work inside Bldg. 251, two containers will be placed on the route Démocrite. For security reasons, the part of this road in front of barrack 553 will be closed to circulation from 5 to 12 November. Thank you, in advance for your understanding. PH-SMI

  3. Effect of nifedipine, imipramine and sertraline on the antidepressant ...

    African Journals Online (AJOL)

    DR ORIAFOH

    2012-06-28

    Jun 28, 2012 ... Ann. Nuclear Med. 11(3): 213-218. Kozisek ME, Middlemas D, Bylund DB (2008). The differential regulation of BDNF and TrkB levels in juvenile rats after four days of escitalopram and desipramine treatment. Neuropharmacol. 54(2):. 251-257. Kreydiyyeh SI (2000). Cyclic AMP and furosemide stimulate the ...

  4. Survey of mastitis in dairy herds in the Ethiopian Central Highlands ...

    African Journals Online (AJOL)

    Subclinical mastitis had highest relative occurrence (88.1%). Prevalence of quarter SCM was over 40% in Urban (n=5402) and Peri-urban. Dairy (n=2454), and 25.1 % in Dairy Herds Intra-urban of the Secondary Towns. (n=2334) and the same increased with the herd size. On cow basis, prevalence of SCM was 18.7 % and ...

  5. Study of Microflares through SOXS Mission Rajmal Jain , Vishal ...

    Indian Academy of Sciences (India)

    Patel, Falgun and Jain, Noopur 2005, SOXS/PRL Technical document, “Software Development for data Processing and Analysis of Data from Solar X-ray Spectrometer (SOXS) Mission. Onboard GSAT-2 Spacecraft”. Shimuzu, T. 1995, Publ. Astron. Soc. Japan, 47, 251. Sylwester, J., Farnik, F., Likin, O., Kordylewski, Z., ...

  6. Household market participation and stunting in preschool children in ...

    African Journals Online (AJOL)

    Background: Stunting among Malawian preschool children continues to be a concern. Method: A cross-sectional survey of 251 semi-urban households, who participated in a community-supported preschool programme, was conducted. Results: Of the 433 participating two- to five-year-old children, 34.4% had stunting.

  7. Sr-sulphate and associated minerals found from kyanite-bearing eclogite in the Moldanubian Zone of the Bohemian Massif, Czech Republic

    Czech Academy of Sciences Publication Activity Database

    Nakamura, D.; Kobayshi, T.; Shimobayashi, N.; Svojtka, Martin; Hirajima, T.

    2010-01-01

    Roč. 105, č. 5 (2010), s. 251-261 ISSN 1345-6296 Grant - others:Kyoto University(JP) 14400313 Institutional research plan: CEZ:AV0Z30130516 Keywords : celestine * Sr * eclogite * sulphide * Bohemian Massif Subject RIV: DB - Geology ; Mineralogy Impact factor: 0.677, year: 2010

  8. Browse Title Index

    African Journals Online (AJOL)

    Items 251 - 298 of 298 ... AB Mustapha, W Dangaladima. Vol 18, No 1 (2010), The Effects of Iron Filling On Some Mechanical and Physical Properties of a Sawdust Particleboard, Abstract PDF. PAP Mamza, A Aliu, RA Muhammad. Vol 16, No 2 (2008), The Swelling Behaviour of Polystyrene (PS)/ Polyvinylacetate (Pvac) Blends ...

  9. Search Results | Page 26 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Results 251 - 260 of 280 ... Understanding Obstacles to Peace in the Great Lakes Region : Actors, Interests and Strategies. Africa's Great Lakes region is home to violent and prolonged conflicts that cause a lot of suffering and block socioeconomic progress. Several initiatives are underway to bring peace to the region. Project ...

  10. Search Results | Page 26 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Results 251 - 260 of 8491 ... This project aims to use nanomaterials (a nanometer is one billionth of a meter) to provide new, inexpensive techniques to purify water that also address the increasingly important issue of antimicrobial resistance. Project. -. Building parliamentary research capacity: The case of Shan state's ...

  11. Browse Title Index

    African Journals Online (AJOL)

    Items 251 - 300 of 559 ... Vol 3, No 1 (2004), HIV/AIDS, poverty and risky sexual behaviour in South Africa, Abstract ... Vol 1, No 1 (2002), HIV/AIDS: South African women at risk, Abstract ... Vol 8, No 4 (2009), Home-based care for people living with AIDS in Zimbabwe: voluntary caregivers' motivations and concerns, Abstract.

  12. Should one be a left or a right Sellarsian? (And is there really such a choice?)

    Czech Academy of Sciences Publication Activity Database

    Peregrin, Jaroslav

    2016-01-01

    Roč. 47, č. 2 (2016), s. 251-263 ISSN 0026-1068 R&D Projects: GA ČR GA13-20785S Institutional support: RVO:67985955 Keywords : Sellars * normativity * ontology * translation * first-person perspective Subject RIV: AA - Philosophy ; Religion

  13. Growth of adlayers studied by fluorination of isotopically engineered graphene

    Czech Academy of Sciences Publication Activity Database

    Ek Weis, Johan; da Costa, Sara; Frank, Otakar; Kalbáč, Martin

    2014-01-01

    Roč. 251, č. 12 (2014), s. 2505-2508 ISSN 0370-1972 R&D Projects: GA MŠk LH13022 Institutional support: RVO:61388955 Keywords : chemical vapor deposition * graphene * isotope labeling Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 1.489, year: 2014

  14. Browse Title Index

    African Journals Online (AJOL)

    Items 251 - 300 of 1250 ... RS Kumar, K Moorthy, R Vinodhini, T Punitha. Vol 12, No 2 (2015), Antimicrobial potential of alkaloids and flavonoids extracted from Tamarix aphylla leaves against common human pathogenic bacteria, Abstract PDF. M Adnan, A Tariq, R Bibi, NM AbdElsalam, H Rehman, W Murad, S Ahmad, M Israr, ...

  15. Some Connections between Increasing Religiousness and Academic Accomplishment in a College Population.

    Science.gov (United States)

    Zern, David S.

    1989-01-01

    Asked 251 college students to describe their own degree of religiousness and that of the home atmosphere in which they grew up. When measures of students' total religiousness, their belief in God, and their ritual observance were related separately to their cumulative grade point averages, no relationship was found for either present or past…

  16. Browse Title Index

    African Journals Online (AJOL)

    Items 101 - 150 of 251 ... Vol 3, No 3 (2001), Hepatic status and lipid petroxidation in rats fed Bambara groundnut (Voanzela subterranea) and pigeon pea (Cajanus cajan) ... Vol 9, No 2 (2007), Influence of total cholesterol/high density lipoprotein cholesterol ratio in the pathogenesis of ischaemic heart disease in Enugu, ...

  17. Two-year oscillation cycle in abundance of soybean aphid in Indiana

    Czech Academy of Sciences Publication Activity Database

    Rhainds, M.; Yoo, H. J. S.; Kindlmann, Pavel; Voegtlin, D.; Castillo, D.; Rutledge, C.; Sadof, C.; Yaninek, S.; O'Neil, R. J.

    2010-01-01

    Roč. 12, č. 3 (2010), s. 251-257 ISSN 1461-9555 Institutional research plan: CEZ:AV0Z60870520 Keywords : Aphididae * Aphis glycines * autumn migration * Hemiptera * heteroecy * Rhamnus * seesaw effect * soybean aphid Subject RIV: EH - Ecology, Behaviour Impact factor: 1.484, year: 2010

  18. Sexual function of pregnant women in the third trimester

    African Journals Online (AJOL)

    Nülüfer Erbil

    2017-04-07

    35th and 36th and higher gestational weeks of preg- nancy were as follows: sexual desire scores, 2.50, 2.77 and 2.40; sexual arousal scores, 2.26, 2.72 and. 1.69; lubrication scores, 2.61, 3.42 and 1.97; orgasm scores, 2.51, ...

  19. Browse Title Index

    African Journals Online (AJOL)

    Items 251 - 292 of 292 ... Vol 6, No 2 (2009), Traditional healers as caregivers to HIV/AIDS clients and other terminally challenged persons in Kanye community home-based care programme (CHBC), Botswana, Abstract PDF. SM Kang'ethe. Vol 9, No 3 (2012), Transgender in Africa: Invisible, inaccessible, or ignored?

  20. Browse Title Index

    African Journals Online (AJOL)

    Items 251 - 300 of 1463 ... Vol 12, No 2 (2012), Challenges in diagnosis and management of Cryptococcal immune reconstitution inflammatory syndrome (IRIS) in resource limited ... Vol 16, No 1 (2016), Characteristics and management of Enterobacteriaceae harboring IMP-4 or IMP-8 carbapenemase in a tertiary hospital ...

  1. Mechanisms of pH change in wood ant (.i.Formica polyctena./i.) nests

    Czech Academy of Sciences Publication Activity Database

    Jílková, Veronika; Šebek, O.; Frouz, J.

    2012-01-01

    Roč. 55, č. 5 (2012), s. 247-251 ISSN 0031-4056 Institutional research plan: CEZ:AV0Z60660521 Keywords : basic cations * glucose * honeydew Subject RIV: EH - Ecology, Behaviour Impact factor: 1.690, year: 2012

  2. Diurnal and seasonal fluctuations in wood ant (.i.Formica polyctena./i.) nest temperature in two geographically distant populations along a south-north gradient

    Czech Academy of Sciences Publication Activity Database

    Frouz, Jan; Finer, L.

    2007-01-01

    Roč. 54, - (2007), s. 251-259 ISSN 0020-1812 Grant - others:Academy of Finland(FI) 200870 Institutional research plan: CEZ:AV0Z60660521 Source of funding: V - iné verejné zdroje Keywords : ant nests * thermoregulation * Formica rufa group Subject RIV: EH - Ecology, Behaviour Impact factor: 1.391, year: 2007

  3. Browse Title Index

    African Journals Online (AJOL)

    Items 251 - 300 of 519 ... W Tamire, F Enqueselassie. Vol 25, No 3 (2011), Knowledge, attitude and practice towards strabismus in Cheha District, Central Ethiopia, Abstract PDF. K Geta, A Bejiga. Vol 16, No 2 (2002), Knowledge, Attitudes and Practices involved in Harmful Health Behavior in Dembia District, northwest Ethiopia ...

  4. Taverniera abyssynica final report for P.JU

    African Journals Online (AJOL)

    User

    Serazetdinova G. Hensel D. Becker H. and Lorz H. (2006). Genetic transformation of barley (Hordeum vulgare L.) via of androgenetic pollen cultures with. Agrobacterium tumefaciens. Plant Biotech. J. 4: 251-. 261. Manickam VS. Mathavan ER. and. Antonysamy R. (2000). Regeneration of Indian Ginseng plantlets from stem.

  5. MM Arimi, B.Sc., Institute of Primate Research, PO. Box 24481, Karen

    African Journals Online (AJOL)

    MAB to SIV Mac 251 gag +/—. — Negative. 1' Weak positive. ++ Strong positive. BERV Polyclonal antibody against crude baboon endogenous retrovirus antigen. Monoclonal antibody against human. MHC class I determinants. PBS Phosphate buffered saline. W6/32 showed a mutation in the ERV-3 env gene in about.

  6. Adult Recognition of School Bullying Situations.

    Science.gov (United States)

    Hazler, Richard J.; Miller, Dina L.; Carney, JoLynn V.; Green, Suzy

    2001-01-01

    Teachers and counselors (n=251) rated the severity of 21 bullying scenarios. Physical threat or abuse was rated more serious than verbal or social/emotional abuse. Physical conflicts were rated as bullying even when they did not fit the definition. Repeated abuse and an unfair match between participants were related to effectiveness of evaluators'…

  7. ' and learners\\' HIV status with a view to wellness promotion

    African Journals Online (AJOL)

    Educator perception of educators\\' and learners\\' HIV status with a view to wellness promotion. LC Theron. Abstract. No Abstract Available South African Journal of Education Vol.25(1) 2005: 56-60. Full Text: EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT · DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT ...

  8. Browse Title Index

    African Journals Online (AJOL)

    Items 251 - 278 of 278 ... Vol 45, No 1 (2011), Towards informed decision making: the importance of baseline academic literacy assessment in promoting responsible university access and support, Abstract ... Vol 48, No 2 (2014), Writing as construct in the Grade 12 Home Language curriculum and examination, Abstract.

  9. Aging driver and pedestrian safety : parking lot hazards study.

    Science.gov (United States)

    2012-06-20

    In 2009, Florida reported the highest rate of : pedestrian fatalities in the nation. At 2.51 : deaths per 100,000 residents, Floridas rate was : nearly twice the national average. These deaths : occurred in all age groups, but compared to : other ...

  10. Aging driver and pedestrian safety : parking lot hazards study [summary].

    Science.gov (United States)

    2012-01-01

    In 2009, Florida reported the highest rate of pedestrian fatalities in the nation. At 2.51 deaths per 100,000 residents, Floridas rate was nearly twice the national average. These deaths occurred in all age groups, but compared to other age groups...

  11. Browse Title Index

    African Journals Online (AJOL)

    Items 251 - 300 of 777 ... Vol 39, No 8 (2016), Global cycle properties in graphs with large minimum clustering coefficient, Abstract. Adam Borchert, Skylar Nicol, Ortrud R. Oellermann. Vol 40, No 6 (2017), Global optimization of cyclic Kannan nonexpansive mappings in nonreflexive Banach spaces, Abstract. M Gabeleh, O.O. ...

  12. Browse Title Index

    African Journals Online (AJOL)

    Items 251 - 300 of 900 ... Vol 10, No 10 (2010), Effect of lactoperoxidase-thiocyanate-hydrogen peroxide system and storage temperature on keeping quality of raw camel milk, Abstract PDF. P.M.N Kamau, P.O Lamuka, J Wangoh. Vol 2, No 2 (2002), EFFECT OF MALTING ON PROTEIN DIGESTIBILITY OF SOME SORGHUM ...

  13. Browse Title Index

    African Journals Online (AJOL)

    Items 251 - 300 of 649 ... Vol 12, No 1 (2002), Hypotensive Activity of Residue From “Gebto Arekei”, Locally Distilled Medicinal Spirit From a Brew Containing Lupinus Albus Seeds in Normotensive Guinea pigs, Abstract PDF. Cherinet Ambaye, Tefaye Tolessa, Abebe Abera, Hassen Taha Sherief, Dawit Abebe, Kelbessa Urga.

  14. Browse Title Index

    African Journals Online (AJOL)

    Items 251 - 289 of 289 ... Vol 3, No 1 (2003), The impact of capture and trade in African grey parrot populations (Psittacus erithacus) in Lobeke National Park, south east Cameroon, Details PDF. A Ngenyi, Z Nzooh, L Usongo. Vol 4, No 2 (2004), The impact of the urban environment on plantain and banana production in Akwa ...

  15. Combustion synthesis and preliminary luminescence studies of ...

    Indian Academy of Sciences (India)

    The polycrystalline sample of LiBaPO4 : Tb3+ (LBPT) was successfully synthesized by solution combustion synthesis and studied for its luminescence characteristics. The thermoluminescence (TL) glow curve of LBPT material consists of two peaks at 204.54 and 251.21°C. The optimum concentration was 0.005 mol to ...

  16. Investigating University Students' Preferences to Science Communication Skills: A Case of Prospective Science Teacher in Indonesia

    Science.gov (United States)

    Suprapto, Nadi; Ku, Chih-Hsiung

    2016-01-01

    The purpose of this study was to investigate Indonesian university students' preferences to science communication skills. Data collected from 251 students who were majoring in science education program. The Learning Preferences to Science Communication (LPSC) questionnaire was developed with Indonesian language and validated through an exploratory…

  17. Browse Author Index

    African Journals Online (AJOL)

    Items 251 - 300 of 1337 ... Bibi, Nousheen · Bidmeshkipour, A · Boehles, H · Bolz, H · Bouayed, Nouha Abdemoula · Brousseau, T · Brown, Nick · Buchan, Rachel · Burlaka, IS ... Choudhry, AR · Chouery, Eliane · Chowdri, Nissar A. Christobher, S. Christopoulos, G · Cook, Stuart A. Corbani, Sandra · Costa, Cláudia Amorim ...

  18. Browse Title Index

    African Journals Online (AJOL)

    Items 251 - 300 of 644 ... Vol 26, No 4 (2014), Falls and other geriatric syndromes in Blantyre, Malawi: A community survey of older adults, Abstract PDF ... Vol 29, No 3 (2017), Fulbright project focuses on rehabilitation technician education and physiotherapy practice at the Kachere Rehabilitation Centre in Malawi, Abstract ...

  19. Journal of Genetics | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    Home; Journals; Journal of Genetics. CHRISSA G TSIARA. Articles written in Journal of Genetics. Volume 97 Issue 1 March 2018 pp 235-251 RESEARCH ARTICLE. Interleukin gene polymorphisms and susceptibility to HIV-1 infection: a meta-analysis · CHRISSA G TSIARA GEORGIOS K. NIKOLOPOULOS NIKI L. DIMOU ...

  20. 75 FR 47808 - Verde Hydro, LLC; Notice of Preliminary Permit Application Accepted for Filing and Soliciting...

    Science.gov (United States)

    2010-08-09

    ... From the Federal Register Online via the Government Publishing Office DEPARTMENT OF ENERGY Federal Energy Regulatory Commission Verde Hydro, LLC; Notice of Preliminary Permit Application Accepted for... with an 823-ft length at crest and hydraulic head of 251-ft; (2) two existing 72-inch diameter steel...

  1. NMR study on polymer-solvent interactions during temperature-induced phase separation in aqueous polymer solutions

    Czech Academy of Sciences Publication Activity Database

    Spěváček, Jiří; Hanyková, L.

    2007-01-01

    Roč. 251, č. 1 (2007), s. 72-80 ISSN 1022-1360. [International Conference on Polymer-Solvent Complexes and Intercalates /6./. Manchester, 29.08.2006-01.09.2006] Institutional research plan: CEZ:AV0Z40500505 Keywords : hydration * NMR * phase separation Subject RIV: CD - Macromolecular Chemistry Impact factor: 0.913, year: 2005

  2. Browse Title Index

    African Journals Online (AJOL)

    Items 251 - 300 of 436 ... Issue, Title. Vol 3, No 1 (2014), Motor Park Discourse in South-Western Nigeria: Relations among Discourse, Group Ideology and Social Identity, Abstract PDF. TA Amao. Vol 2, No 3 (2013), Multinational Oil Companies and Corporate Social Responsibilities: The Host Communities Experience ...

  3. Search Results | Page 26 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Results 251 - 260 of 8491 ... Women supporting women: Networked civic engagement to foster effective women's leadership for inclusive policymaking. “Women supporting Women” is an applied ... Transitions in Sub-Saharan Africa. What limits women's ability to become financially self-sufficient from an early age in Africa?

  4. Search Results | Page 26 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Results 251 - 260 of 8492 ... Women supporting women: Networked civic engagement to foster effective women's leadership for inclusive policymaking. “Women supporting Women” is an applied ... Transitions in Sub-Saharan Africa. What limits women's ability to become financially self-sufficient from an early age in Africa?

  5. Guides to . . . Histories of . . . Who Delineates the Field? On Reading ...

    African Journals Online (AJOL)

    The question in the title above is prompted by my being invited to review the recently published 251-page Columbia Guide to South African Literature in English since 1945 (2010), by Gareth Cornwell, Dirk Klopper and Craig MacKenzie. It is a guide that follows closely on another guide, the A–Z of. African Writers: A Guide to ...

  6. Effects of melatonin on ischemia and reperfusion injury of the rat heart

    Czech Academy of Sciences Publication Activity Database

    Szárszoi, Ondrej; Asemu, Girma; Vaněček, Jiří; Ošťádal, Bohuslav; Kolář, František

    2001-01-01

    Roč. 15, č. 3 (2001), s. 251-257 ISSN 0920-3206 R&D Projects: GA ČR GA306/98/0470; GA MŠk LN00A069 Institutional research plan: CEZ:AV0Z5011922 Keywords : melatonin * heart * ischemia Subject RIV: ED - Physiology Impact factor: 1.009, year: 2001

  7. Nigerian Journal of Physics - Vol 18, No 2 (2006)

    African Journals Online (AJOL)

    Bouguer correction density determination from fractal analysis using data from part of the Nigerian Basement Complex · EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. K M Lawal, C Z Akaolisa, 251-254. http://dx.doi.org/10.4314/njphy.v18i2.38111 ...

  8. Browse Title Index

    African Journals Online (AJOL)

    Items 251 - 300 of 745 ... Vol 8, No 4 (1998), Effects of Melatonin and photoperiodic factors on the ovarious structue of Sprague-Dawley rats, Abstract ... Effects of subcutaneous administration of monosodium L-glutamate on ovulation and oestrus cycle in adult female cycling rats and of rats treated during pregnancy, Details.

  9. Predicting Intrinsic Motivation

    Science.gov (United States)

    Martens, Rob; Kirschner, Paul A.

    2004-01-01

    Intrinsic motivation can be predicted from participants' perceptions of the social environment and the task environment (Ryan & Deci, 2000)in terms of control, relatedness and competence. To determine the degree of independence of these factors 251 students in higher vocational education (physiotherapy and hotel management) indicated the…

  10. Repeatless and Repeat-Based Centromeres in Potato: Implications for Centromere Evolution[C][W

    Czech Academy of Sciences Publication Activity Database

    Gong, Z.; Wu, Y.; Koblížková, Andrea; Torres, G.A.; Wang, K.; Iovene, M.; Neumann, Pavel; Zhang, W.; Novák, Petr; Buell, C.R.; Macas, Jiří; Jiang, J.

    2012-01-01

    Roč. 24, č. 9 (2012), s. 3559-3574 ISSN 1040-4651 R&D Projects: GA MŠk(CZ) LH11058 Institutional research plan: CEZ:AV0Z50510513 Institutional support: RVO:60077344 Keywords : repetitive sequences * plant satellite repeats * Arabidopsis thaliana * rice centromere * wild potatoes Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 9.251, year: 2012

  11. 78 FR 28244 - Agency Information Collection Activities; Proposed Collection; Comment Request

    Science.gov (United States)

    2013-05-14

    ... communications. 5. The number of annual respondents: 251. 6. The number of hours needed annually to complete the... affected licensees and applicants. Submit, by July 15, 2013, comments that address the following questions... information technology? The public may examine and have copied for a fee publicly available documents...

  12. Photorelaxation of imidazole and adenine via electron-driven proton transfer along H2O wires

    Czech Academy of Sciences Publication Activity Database

    Szabla, Rafal; Gora, R.W.; Janicki, M.; Šponer, Jiří

    2016-01-01

    Roč. 195, č. 2016 (2016), s. 237-251 E-ISSN 1364-5498 R&D Projects: GA ČR(CZ) GA14-12010S Institutional support: RVO:68081707 Keywords : excited-state deactivation * induced charge-transfer Subject RIV: BO - Biophysics

  13. Alien plant invasions in European woodlands

    NARCIS (Netherlands)

    Wagner, Viktoria; Chytrý, Milan; Jiménez-Alfaro, Borja; Pergl, Jan; Hennekens, Stephan; Biurrun, Idoia; Knollová, Ilona; Berg, Christian; Vassilev, Kiril; Rodwell, John S.; Škvorc, Željko; Jandt, Ute; Ewald, Jörg; Jansen, Florian; Tsiripidis, Ioannis; Botta-Dukát, Zoltán; Casella, Laura; Attorre, Fabio; Rašomavičius, Valerijus; Ćušterevska, Renata; Schaminée, Joop H.J.; Brunet, Jörg; Lenoir, Jonathan; Svenning, Jens Christian; Kącki, Zygmunt; Petrášová-Šibíková, Mária; Šilc, Urban; García-Mijangos, Itziar; Campos, Juan Antonio; Fernández-González, Federico; Wohlgemuth, Thomas; Onyshchenko, Viktor; Pyšek, Petr

    2017-01-01

    Aim: Woodlands make up a third of European territory and carry out important ecosystem functions, yet a comprehensive overview of their invasion by alien plants has never been undertaken across this continent. Location: Europe. Methods: We extracted data from 251,740 vegetation plots stored in the

  14. Information Technology: Opportunities for Improving Acquisitions and Operations

    Science.gov (United States)

    2017-04-01

    acquisitions using agile development processes.26 One participant noted that, in her experience, the government may not explore all procurement...United States Government Accountability Office Highlights of GAO-17-251SP, a GAO forum April 2017 INFORMATION TECHNOLOGY Opportunities... government leadership. They identified key actions related to the following topics: strengthening the Federal Information Technology Acquisition Reform Act

  15. Browse Title Index

    African Journals Online (AJOL)

    Items 251 - 290 of 290 ... Vol 25, No 2 (2013), The legend of plantar neuropraxia in long-distance athletes, Abstract PDF. DS Kellogg, J Joslin. Vol 24, No 1 (2012), The limits to exercise performance and the future of fatigue research, Abstract PDF. FE Marino, M Gard, EJ Drinkwater. Vol 28, No 1 (2016), The medial tibial stress ...

  16. Search Results | Page 26 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Results 251 - 260 of 1128 ... Managing Agricultural Biodiversity for Nutrition, Health, Livelihoods and Sustainable Production Systems (Sub-Saharan Africa) ... Africa food systems appears to be getting worse as evidenced by the increase in micronutrient deficiencies, chronic diseases and low resistance to infectious diseases.

  17. Browse Title Index

    African Journals Online (AJOL)

    Items 251 - 270 of 270 ... Vol 11, No 1 (2012), Using an ecosystem model to evaluate fisheries management options to mitigate climate change impacts in western Indian Ocean coral reefs, Abstract PDF. Carlos Ruiz Sebastián, Tim R. McClanahan. Vol 4, No 2 (2005), Using Otolity Weight to Estimate Total Mortality of Blackspot ...

  18. An Investigation into Communication Climate and Staff Efficiency in ...

    African Journals Online (AJOL)

    Nekky Umera

    Using the stratified random sampling technique, 1500 workers were drawn from public and private tertiary institutions i.e .... climate and efficiency of private and public tertiary institutions staff. 5. There is no significant difference .... Vol. 8. No2. Pp. 251-263. Ijaduola, K.O. (2007a). An evaluation of public relations awareness of.

  19. A new species of the Camponotus aureopilus VIEHMEYER, 1914 species-group (Hymenoptera: Formicidae) from Papua New Guinea

    Czech Academy of Sciences Publication Activity Database

    Shattuck, S.; Janda, Milan

    2009-01-01

    Roč. 12, - (2009), s. 251-253 ISSN 1994-4136 R&D Projects: GA MŠk LC06073; GA AV ČR KJB612230701 Grant - others:U.S. National Science Foundation(US) DEB-02-11591 Institutional research plan: CEZ:AV0Z50070508 Keywords : taxonomic description * Hymenoptera * Formicidae Subject RIV: EG - Zoology

  20. Waterborne Commerce of the United States, Calendar Year 1980. Part 1. Waterways and Harbors, Atlantic Coast.

    Science.gov (United States)

    1982-09-01

    Canada, the esport statistics reflect fully compiled data for shipments named $1,000 and over combined with estimated data for shipments valted $251-$999...Rivers, Federal and Private Canals, Connecting Channels, and Intracoastal Waterways The terms "imports." " esports ." "coastwise receipts," "coastwise

  1. Browse Title Index

    African Journals Online (AJOL)

    Items 51 - 100 of 251 ... Vol 13, No 1 (2011), Effects of Hibiscus Sabdariffa on the Heamostatic and heamatological Profiles of Albino rats, Abstract. FN Oguwike, BN Esimai, EN ... Vol 6, No 3 (2004), Effects of maternal malaria and anaemia acquired during pregnancy on neonatal birth weight, Abstract. CJ Uneke, AS Sagay, ...

  2. marginal notes à propos magris' danubio and morselli's contro ...

    African Journals Online (AJOL)

    User

    replaced by the quasi-religious fervour of Deutschland über alles, sung on the same melody as the old Imperial anthem, composed by “Papa” Haydn, the archetype of serene composure and classical purity (Magris: 251-252), the composer par excellence of playful inventiveness and elegant surfaces. Once the centre of the ...

  3. Gender factor as a correlate of students\\' performance on creativity ...

    African Journals Online (AJOL)

    Gender factor as a correlate of students\\' performance on creativity and intellegence tests in Oyo State secondary schools. J O Oyundoyin, R A Olatoye. Abstract. No Abstract. African Journal for the psychological studies of social issues Vol. 10 (1&2) 2007: pp. 251-262. Full Text: EMAIL FULL TEXT EMAIL FULL TEXT

  4. Standing Stock, Agar Yield and Properties of Gracilaria salicornia ...

    African Journals Online (AJOL)

    The highest mean biomass and cover values were obtained during the SE monsoon. Agar yield varied from 13.7 to 30.2 % (dry weight) and was highest during the dry NE monsoon period. Alkali treatment generally reduced agar yield by 25–56 %. Gel strength of the agar gels ranged between 118 and 251 g/cm2 and was ...

  5. Browse Title Index

    African Journals Online (AJOL)

    Items 251 - 300 of 823 ... Vol 17, No 3 (2012), First Experience with OSCE as an Exit Clinical Examination for General Surgery Residency Program at the Addis Ababa University, School of Medicine, Abstract PDF. A Bekele, S Shiferaw, B Kotisso. Vol 20, No 3 (2015), Five year review of the pattern and outcome of managment ...

  6. 75 FR 71455 - Agency Information Collection Activities; Submission for OMB Review; Comment Request; Rigging...

    Science.gov (United States)

    2010-11-23

    ... for OMB Review; Comment Request; Rigging Equipment for Material Handling ACTION: Notice. SUMMARY: The... collection of information provisions of the rigging equipment for material handling standard specify affixing.... Title of Collection: Rigging Equipment for Material Handling (29 CFR 1926.251). OMB Control Number: 1218...

  7. HNC and HCN in an extended negative glow discharge: Implication to the branching ratio of the dissociative recombination of HCNH+

    Czech Academy of Sciences Publication Activity Database

    Amano, T.; Zelinger, Zdeněk; Hirao, T.; Takano, J.; Toyoda, R.

    2008-01-01

    Roč. 251, 1-2 (2008), s. 252-255 ISSN 0022-2852 Institutional research plan: CEZ:AV0Z40400503 Keywords : submillimeter-wave * molecular ions * dissociative recombination Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 1.636, year: 2008

  8. Browse Title Index

    African Journals Online (AJOL)

    Items 251 - 300 of 522 ... Vol 18, No 2 (2012), Intrathecal fentanyl with 0.5% bupivacaine heavy in chronic opium abusers, Abstract PDF. S Gupta, K Dev, S Katyal, S Kathuria. Vol 20, No 5 (2014), Intubation of a neonate with glossopalatine ankylosis using a paraglossal approach and a laryngoscope with a straight blade ...

  9. Browse Title Index

    African Journals Online (AJOL)

    Items 251 - 300 of 372 ... Homemade heroin substitute causing hallucinations, Abstract PDF. TI Lemon. Vol 16, No 6 (2013), Screening a heterogeneous elderly South African population for cognitive impairment: the utility and performance of the Mini-Mental State Examination, Six Item Screener, Subjective Memory Rating ...

  10. Survival of enteric bacteria in source-separated human urine used ...

    African Journals Online (AJOL)

    MAKAYA

    Urine in Pumpkin (Cucurbita maxima) Cultivation. Agric. Food Sci. 18:57-68. Pronk W, Koné D (2010). Options for urine treatment in developing countries. Desalination 251:360-368. Schönning C, Leeming R, Stenström TA (2002). Faecal contamination of source-separated human urine based on the content of faecal sterols ...

  11. Measurement of the running of the QED coupling in small-angle Bhabha scattering at LEP

    Czech Academy of Sciences Publication Activity Database

    Abbiendi, G.; Ainsley, C.; Akesson, P.F.; Alexander, G.; Anagnostou, G.; Taševský, Marek

    2006-01-01

    Roč. 45, - (2006), s. 1-21 ISSN 1434-6044 Institutional research plan: CEZ:AV0Z10100502 Keywords : OPAL * Bhabha scattering * alpha(t) Subject RIV: BF - Elementary Particles and High Energy Physics Impact factor: 3.251, year: 2006

  12. Closo-dodecaborate (2-) anion as a potential prosthetic group for attachment of astatine to proteins. Aspects of the labelling chemistry with Chloramine-T

    Czech Academy of Sciences Publication Activity Database

    Orlova, A.; Lebeda, Ondřej; Tolmachev, V.; Sjoberg, S.; Carsllon, J.; Lundqvist, H.

    2000-01-01

    Roč. 43, č. 43 (2000), s. 251-260 ISSN 0362-4803 Institutional research plan: CEZ:AV0Z1048901 Keywords : closo-dodecaborate (2-) anion * AT-211 * astatination Subject RIV: CH - Nuclear ; Quantum Chemistry Impact factor: 0.756, year: 2000

  13. Management and use of dairy cattle feed resources on smallholder certified organic pineapple farms in Central Uganda

    DEFF Research Database (Denmark)

    Kiggundu, Muhammad; Kabi, Fred; Vaarst, Mette

    2014-01-01

    as major dairy cattle feed resources while only 19% reported using elephant grass. Banana peels (25.1%) and sweet potato vines (24.7%) were the most important crop residues fed to cattle. Farmers reported high cost of concentrates and scarcity of feeds as their biggest challenges in dairy cattle production...

  14. Influence of rice sample preparation and milling procedures on milling quality appraisals

    Science.gov (United States)

    The objective of this research was to investigate the effect of sample preparation and milling procedure on milling quality appraisals of rough rice. Samples of freshly harvested medium-grain rice (M202) with different initial moisture contents (MCs) ranging from 20.2% to 25.1% (w.b.) were used for...

  15. 77 FR 52072 - Sunshine Act Meeting

    Science.gov (United States)

    2012-08-28

    ...: Commissioners' Conference Room, 11555 Rockville Pike, Rockville, Maryland. STATUS: Public and Closed. Week of...) (Contact: Richard Correia, 301-251-7430). This meeting will be webcast live at the Web address--www.nrc.gov. Friday, September 14, 2012 11:00 a.m. Discussion of Management and Personnel Issues (Closed--Ex. 2 and 6...

  16. 78 FR 23960 - Sunshine Act Meetings

    Science.gov (United States)

    2013-04-23

    ...' Conference Room, 11555 Rockville Pike, Rockville, Maryland. STATUS: Public and Closed. Week of April 22, 2013... Meeting) (Contact: Brett Rini, 301-251-7615). This meeting will be webcast live at the Web address--www.nrc.gov. 2:30 p.m. Discussion of Management and Personnel Issues (Closed--Ex. 2 and 6). Tuesday April...

  17. 78 FR 21171 - Sunshine Act Meetings

    Science.gov (United States)

    2013-04-09

    ...: Commissioners' Conference Room, 11555 Rockville Pike, Rockville, Maryland. STATUS: Public and Closed. Week of... Meeting) (Contact: Brett Rini, 301-251-7615) This meeting will be webcast live at the Web address--www.nrc.gov. 2:30 p.m. Discussion of Management and Personnel Issues (Closed-- Ex. 2 and 6) Tuesday, April 23...

  18. 78 FR 18376 - Sunshine Act Meetings

    Science.gov (United States)

    2013-03-26

    ...: Commissioners' Conference Room, 11555 Rockville Pike, Rockville, Maryland. STATUS: Public and Closed. Week of...-0223). This meeting will be webcast live at the Web address--www.nrc.gov. Week of April 8, 2013...) (Contact: Brett Rini, 301-251-7615). This meeting will be webcast live at the Web address--www.nrc.gov. 2...

  19. Search Results | Page 26 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Results 251 - 260 of 1804 ... Open Crowd-Sourced Online Digital Review of Asia Pacific. An evaluation of the IDRC-supported serial, Digital Review of Asia Pacific (DirAP), revealed that the Review faced many challenges as a print publication.

  20. Myogenic nature of insect heartbeat and intestinal peristalsis, revealed by neuromuscular paralysis caused by the sting of a braconid wasp

    Czech Academy of Sciences Publication Activity Database

    Sláma, Karel; Lukáš, J.

    2011-01-01

    Roč. 57, č. 2 (2011), s. 251-259 ISSN 0022-1910 Grant - others:MZe ČR(CZ) 002 700 604 Institutional research plan: CEZ:AV0Z50070508 Keywords : autonomic heartbeat * myogenic heartbeat * anterograde heartbeat Subject RIV: ED - Physiology Impact factor: 2.236, year: 2011

  1. Browse Title Index

    African Journals Online (AJOL)

    Items 251 - 300 of 462 ... OSM Ali, MTM Mansour, HT El-Bassyouni, SMA El-Maksoud, RR El-Awady. Vol 13, No 3 (2012), Hepatoadrenal ... in a cohort of Egyptian families, Abstract PDF. AM Kamel, MF Mira, GI Mossallam, GTA Ebid, ER Radwan, NH Aly Eldin, M Mamdouh, M Amin, N Badawy, H Bazaraa, A Ibrahim, N Salah.

  2. Inter-state coupling and definitions of bright and dark states

    Czech Academy of Sciences Publication Activity Database

    Menšík, Miroslav; Nešpůrek, Stanislav

    2007-01-01

    Roč. 124, č. 2 (2007), s. 245-251 ISSN 0022-2313 R&D Projects: GA AV ČR IAA4050406 Institutional research plan: CEZ:AV0Z40500505 Keywords : electron–vibrational interaction * bright and dark states * energy transfer Subject RIV: CD - Macromolecular Chemistry Impact factor: 1.611, year: 2007

  3. 432-IJBCS-Article - Dr S O Oke - Final version

    African Journals Online (AJOL)

    User

    a new environment deliberately or otherwise can have many unanticipated ecological effects (Howard and ... activities such as road construction colonised by Tithonia diversifolia on seedling emergence in the study sites. ..... low land of Papua New Guinea. Journal of Tropical Ecology, 16: 243-251. Hutchinson J, Dalziel JM.

  4. Browse Title Index

    African Journals Online (AJOL)

    Items 251 - 270 of 270 ... Vol 9, No 1 (2012), Topical Delivery of Miconazole-Loaded Microemulsion: Formulation Design and Evaluation, Abstract. KC Ofokansi, FC Kenechukwu, L Charles, AA Attama. Vol 9, No 3 (2012), Total Phenol amd Flavonoid contents of Crude Extract and Fractions of Picralima Nitida root bark TH. and ...

  5. Effect of abandonment and plant classification on carbohydrate reserves of meadow plants

    Czech Academy of Sciences Publication Activity Database

    Janeček, Štěpán; Lanta, Vojtěch; Klimešová, Jitka; Doležal, Jiří

    2010-01-01

    Roč. 13, č. 2 (2010), s. 243-251 ISSN 1435-8603 R&D Projects: GA ČR GA526/09/0963; GA ČR(CZ) GA526/06/0723 Institutional research plan: CEZ:AV0Z60050516 Keywords : carbohydrates * meadow * abandonment Subject RIV: EF - Botanics Impact factor: 2.409, year: 2010

  6. Functional screening of abundant bacteria from acidic forest soil indicates the metabolic potential of Acidobacteria subdivision 1 for polysaccharide decomposition

    Czech Academy of Sciences Publication Activity Database

    Lladó, Salvador; Žifčáková, Lucia; Větrovský, Tomáš; Eichlerová, Ivana; Baldrian, Petr

    2016-01-01

    Roč. 52, č. 2 (2016), s. 251-260 ISSN 0178-2762 R&D Projects: GA ČR(CZ) GP14-09040P EU Projects: European Commission(CZ) FP7ITN no.289949 Institutional support: RVO:61388971 Keywords : Coniferous forest * Bacterial ecology * Acidobacteria Subject RIV: EE - Microbiology, Virology Impact factor: 3.683, year: 2016

  7. Browse Title Index

    African Journals Online (AJOL)

    Items 251 - 300 of 763 ... Vol 10, No 3 (2016), Effect of biochar on soil properties and lead (Pb) availability in a military camp in South West Ethiopia, Abstract PDF. Bayu Dume, Tadesse Mosissa, Amsalu Nebiyu. Vol 5, No 8 (2011), Effect of biotic and abiotic factors on composition and foraging intensity of subterranean termites ...

  8. Evaluation of point mutations in dystrophin gene in Iranian ...

    Indian Academy of Sciences (India)

    1Faculty of Sciences, Department of Biology, University of Guilan, Rasht 4199613776, Iran. 2Department of Medical Genetics, Faculty of Medical Sciences, Tarbiat Modares University, Tehran 14115-111, Iran. 3Tehran Medical Genetics Laboratory, No. 251, Taleghani Street, Tehran 1598618133, Iran. 4Department of ...

  9. Search Results | Page 26 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Results 251 - 260 of 8491 ... This project aims to use nanomaterials (a nanometer is one billionth of a meter) to provide new, inexpensive techniques to purify water that also address ... This project seeks to examine the links between women's economic empowerment, women's paid work, and their unpaid care responsibilities.

  10. African Zoology - Vol 24, No 4 (1989)

    African Journals Online (AJOL)

    Fine structure of endogenous stages of Eimeria turcicus developing in gall bladder epithelium of the gecko Hemidactylus turcicus · EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT · DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. I Paperna, J.H. Landsberg, 251-259 ...

  11. Search for dark matter produced in association with a hadronically decaying vector boson in pp collisions at √s = 13 TeV with the ATLAS detector

    Czech Academy of Sciences Publication Activity Database

    Aaboud, M.; Aad, G.; Abbott, B.; Chudoba, Jiří; Havránek, Miroslav; Hejbal, Jiří; Jakoubek, Tomáš; Kepka, Oldřich; Kupčo, Alexander; Kůs, Vlastimil; Lokajíček, Miloš; Lysák, Roman; Marčišovský, Michal; Mikeštíková, Marcela; Němeček, Stanislav; Penc, Ondřej; Šícho, Petr; Staroba, Pavel; Svatoš, Michal; Taševský, Marek; Vrba, Václav

    2016-01-01

    Roč. 763, Dec (2016), 251-268 ISSN 0370-2693 Institutional support: RVO:68378271 Keywords : ATLAS * effective field theory * transverse momentum * missing-energy * CERN LHC Coll Subject RIV: BF - Elementary Particles and High Energy Physics Impact factor: 4.807, year: 2016

  12. Research Article Special Issue

    African Journals Online (AJOL)

    pc

    2017-11-24

    Nov 24, 2017 ... [4] Idrus, S.S., Ismail, H., and Palaniandy, S., 2011. Study of the effect of different shapes of ultrafine silica as fillers in natural rubber compounds. Polym Test 30, 251-259. [5] Rattanasom, N., Prasertsri, S., and Ruangritnumchai, T., 2009. Comparison of the mechanical properties at similar hardness level of ...

  13. Area Handbook Series: Jordan: A Country Study

    Science.gov (United States)

    1989-12-01

    Jordan reported its first three cases of acquired immunodeficiency syndrome (AIDS) to the WHO in 1987. The most frequently cited causes of morbidity in...Ministry of Occupied Territories), Baha ’ religion, xxvi, 114 49-50, 188 Bahrain, 215 Bush, George, xxix balance of payments, xxviii, 127, 131,251 Byzantine

  14. African Crop Science Journal - Vol 20, No 4 (2012)

    African Journals Online (AJOL)

    Impact of some climatic and phenological parameters on the callogenesis and somatic embrogenesis variations in coco · EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT · DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. AE Issali, A Traoré, N Diarrassouba, J Andi Kohi Ngoran, A Sangaré, 251-260 ...

  15. Browse Title Index

    African Journals Online (AJOL)

    Items 251 - 300 of 400 ... Vol 5, No 3 (2011), Preoperative fasting in paediatric patients: An audit of two tertiary hospitals in Nigeria, Abstract. S Fyneface-Ogan ... Vol 3, No 2 (2009), Prevalence of alcohol-linked problems among Nigerian students in Minsk, Belarus and their academic performance, Abstract. MO Welcome, YE ...

  16. Download this PDF file

    African Journals Online (AJOL)

    User

    Serazetdinova G. Hensel D. Becker H. and Lorz H. (2006). Genetic transformation of barley (Hordeum vulgare L.) via of androgenetic pollen cultures with. Agrobacterium tumefaciens. Plant Biotech. J. 4: 251-. 261. Manickam VS. Mathavan ER. and. Antonysamy R. (2000). Regeneration of Indian Ginseng plantlets from stem.

  17. Publications | Page 26 | IDRC - International Development Research ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Results 251 - 260 of 6381 ... Migrants in and from cities in Southern Africa play a critical role in the informal economy, yet the importance of that role is often underestimated and even invisible to researchers and policy-makers. ... Thiamin-fortified fish sauce is an efficacious means of improving dietary thiamin intake and.

  18. owusu dabo

    African Journals Online (AJOL)

    dmosman.admin

    cultural beliefs. In 2007, the Central Region located along coastal Ghana recorded a prevalence of 25.1 cases per 100,000 individuals. A death rate of. 10.1% was recorded in ... We took a random sample of patients in a cross sectional study design that ...... tients in Sarawak, Malaysia: a cross-sectional study. Rural Remote ...

  19. Numerical solution of modified fokker-planck equation with poissonian input

    Czech Academy of Sciences Publication Activity Database

    Náprstek, Jiří; Král, Radomil

    2010-01-01

    Roč. 17, 3/4 (2010), s. 251-268 ISSN 1802-1484 R&D Projects: GA AV ČR(CZ) IAA200710805; GA ČR(CZ) GA103/09/0094 Institutional research plan: CEZ:AV0Z20710524 Keywords : Fokker-Planck equation * poisson ian exciation * numerical solution * transition effects Subject RIV: JN - Civil Engineering

  20. Time-dependent mechanical characteristics measured through the use of a microindentation technique

    Czech Academy of Sciences Publication Activity Database

    Minster, Jiří; Bláhová, O.; Lukeš, J.; Němeček, J.

    2010-01-01

    Roč. 14, č. 3 (2010), s. 243-251 ISSN 1385-2000 R&D Projects: GA AV ČR(CZ) IAA200710801 Institutional research plan: CEZ:AV0Z20710524 Keywords : materials testing * microindentation * viscoelastic compliance * relaxation modulus Subject RIV: JI - Composite Materials Impact factor: 0.955, year: 2010

  1. Browse Title Index

    African Journals Online (AJOL)

    Items 251 - 300 of 458 ... Vol 28, No 3 (2007), Molecular, Serological And Microbiological Profiling Evidence Of The Formit Transmission Of Escherichia Coli O157: Nm To A 1-Year Old Nigerian Child, Abstract PDF. I I Luga. Vol 23, No 2 (2002), Morphological analysis of mouse testes following gestational and lactational ...

  2. Screening a cDNA library for protein-protein interactions directly in planta

    Czech Academy of Sciences Publication Activity Database

    Lee, L.-Y.; Wu, F.-H.; Hsu, Ch.-T.; Shen, S.-Ch.; Yeh, H.-Y.; Liao, D.-Ch.; Fang, M.-J.; Liu, N.-T.; Yen, Y.-Ch.; Dokládal, Ladislav; Sýkorová, Eva; Gelvin, S.B.; Lin, Ch.-S.

    2012-01-01

    Roč. 24, č. 5 (2012), s. 1746-1759 ISSN 1040-4651 R&D Projects: GA AV ČR(CZ) IAA500040801 Institutional research plan: CEZ:AV0Z50040702 Keywords : bimolecular fluorescence complementation * telomerase-binding-protein * transformation Subject RIV: BO - Biophysics Impact factor: 9.251, year: 2012

  3. Browse Title Index

    African Journals Online (AJOL)

    Items 201 - 250 of 251 ... Vol 7, No 2 (2005), Study on colorectal cancer in the University of Nigeria Teaching Hospital, Enugu risk factors and evaluation of screening .... Vol 2, No 2 (2000), Thiocyanate concentrations in serum and tissues of guinea pigs fed cassava based diets containing graded levels of protein, Abstract.

  4. Browse Title Index

    African Journals Online (AJOL)

    Items 251 - 300 of 769 ... Vol 20, No 1 (2012), Gambling behaviour of university students in south-western Nigeria, Abstract. EO Oyebisi, KA Alao, BI Popoola. Vol 7, No 1 (1999), Gender Differential in the Effect of Two Group Counselling Approaches on Attitude toward Science: Implications for Manpower Development, Details.

  5. Browse Title Index

    African Journals Online (AJOL)

    Items 251 - 300 of 479 ... Nigerian Food Journal. ... 1 (2016), Impact of varying thickness in the size of meat cuts on volatile compounds and sensory attributes of Tsire, a Nigerian grilled stick meat product, Abstract ... Vol 26, No 1 (2008), Mathematical Modeling of some Functional Properties of Mucuna cochinchinensis, Abstract.

  6. Browse Title Index

    African Journals Online (AJOL)

    Items 251 - 300 of 775 ... Vol 8, No 1 (2015), Effect of imazapyr treated maize on Striga infestation and time of intercropping cowpea in Samaru, Nigeria, Abstract PDF ... Vol 3, No 1 (2010), Effect of water harvesting methods, nitrogen and phosphorus fertilizer on leaf length of different date palm (phoenix d-) varieties, Abstract ...

  7. Browse Title Index

    African Journals Online (AJOL)

    Items 251 - 300 of 412 ... Vol 28, No 2 (2009), Progressive Politics: Liberalism, Humanism, and Feminism in Nussbaum's Capabilities Approach, Abstract. R Terlazzo. Vol 29, No 4 (2010), Prospects for Reconciling Sellars' World Images, Abstract. J Collier. Vol 30, No 2 (2011), Qualified-agent virtue ethics, Abstract. L van Zyl.

  8. 41 CFR 101-25.104 - Acquisition of office furniture and office machines.

    Science.gov (United States)

    2010-07-01

    ... furniture and office machines. 101-25.104 Section 101-25.104 Public Contracts and Property Management... PROCUREMENT 25-GENERAL 25.1-General Policies § 101-25.104 Acquisition of office furniture and office machines... machines. The acquisition of new items shall be limited to those requirements which are considered...

  9. Effect of Preferential Solvation of Polymer Chains on Vapor-Pressure Osmometry Results. Computer Simulation Study.

    Czech Academy of Sciences Publication Activity Database

    Svoboda, Martin; Lísal, Martin; Limpouchová, Z.; Procházka, Karel

    2018-01-01

    Roč. 23, č. 3 (2018), s. 244-251 ISSN 1023-666X R&D Projects: GA ČR GA15-19542S Institutional support: RVO:67985858 Keywords : vapor-pressure osmometry * simulation * solvatation Subject RIV: CF - Physical ; Theoretical Chemistry OBOR OECD: Physical chemistry

  10. Journal of Genetics | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    Home; Journals; Journal of Genetics. STEFANOS BONOVAS. Articles written in Journal of Genetics. Volume 97 Issue 1 March 2018 pp 235-251 RESEARCH ARTICLE. Interleukin gene polymorphisms and susceptibility to HIV-1 infection: a meta-analysis · CHRISSA G TSIARA GEORGIOS K. NIKOLOPOULOS NIKI L. DIMOU ...

  11. Teaching Computer Ergonomic Techniques: Practices and Perceptions of Secondary and Postsecondary Business Educators.

    Science.gov (United States)

    Alexander, Melody W.; Arp, Larry W.

    1997-01-01

    A survey of 260 secondary and 251 postsecondary business educators found the former more likely to think computer ergonomic techniques should taught in elementary school and to address the hazards of improper use. Both groups stated that over half of students they observe do not use good techniques and agreed that students need continual…

  12. Mediators of the Association of Major Depressive Syndrome and Anxiety Syndrome with Postpartum Smoking Relapse

    Science.gov (United States)

    Correa-Fernandez, Virmarie; Ji, Lingyun; Castro, Yessenia; Heppner, Whitney L.; Vidrine, Jennifer Irvin; Costello, Tracy J.; Mullen, Patricia Dolan; Cofta-Woerpel, Ludmila; Velasquez, Mary M.; Greisinger, Anthony; Cinciripini, Paul M.; Wetter, David W.

    2012-01-01

    Objective: Based on conceptual models of addiction and affect regulation, this study examined the mechanisms linking current major depressive syndrome (MDS) and anxiety syndrome (AS) to postpartum smoking relapse. Method: Data were collected in a randomized clinical trial from 251 women who quit smoking during pregnancy. Simple and multiple…

  13. The Relationship between Perceived Parenting Style and Hope in College Students.

    Science.gov (United States)

    Edwards, Lisa M.; Price, Gary E.

    The purpose of this study was to investigate the relationship between levels of hope and perceived parental authority style in college students (N=251). It was expected that there would be a positive relationship between authoritative parenting and students' levels of hope. It was also expected that there would be a negative relationship between…

  14. 41 CFR 101-25.103-1 - General.

    Science.gov (United States)

    2010-07-01

    ... System FEDERAL PROPERTY MANAGEMENT REGULATIONS SUPPLY AND PROCUREMENT 25-GENERAL 25.1-General Policies... accounting controls. [48 FR 48232, Oct. 18, 1983] ... 41 Public Contracts and Property Management 2 2010-07-01 2010-07-01 true General. 101-25.103-1...

  15. les tumeurs benignes de la parotide benign parotid tumors

    African Journals Online (AJOL)

    Materials and Methods: We report a retrospective study of 48 cases of benign parotid tumors, collected over a period of 7 years. (2004-2010). ... superficial lobe tumor, a total parotidectomy was performed in 5 patients, an exofacialparotidectomy in 35 patients and a single tumor ..... Cancer Radiother 2005;9:251-60.

  16. 76 FR 56407 - Notice of Availability of a Draft Supplemental Environmental Impact Statement/Supplemental...

    Science.gov (United States)

    2011-09-13

    ... to various Federal, state, and local agencies, as well as other interested individuals and... King St., Honolulu, HI 96813. 6. Kaneohe Public Library, 45-829 Kamehameha Highway, Kaneohe, HI 96744. 7. Hilo Public Library, 300 Waianuenue Ave., Hilo, HI 96720. 8. Wailuku Public Library, 251 High St...

  17. Hospital

    African Journals Online (AJOL)

    Burkitt's lymphoma of the head and neck region in a Nigerian tertiary. Hospital ... Some complications of treatment were noted. Discussion: ..... Cancer. Biother Radiopharm 1999 14: 251-62 (Medline). Reece DE. Evidence based management of Hodgkin's disease. The role of autologous stem cell transplantation. Cancer ...

  18. C677T gene polymorphism and risk of ischemic stroke in North Ind

    African Journals Online (AJOL)

    Amit Kumar

    2016-03-07

    Mar 7, 2016 ... Multivariate logistic regression analysis showed an independent association between ..... the effects of potential confounding in multivariable logistic regression analysis. [OR 2.51; 95% CI 1.30–4.85; p = 0.006]. A significant association was observed ... shown that a single base pair replacement of Cytosine.

  19. Journal of Biosciences | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    Volume 32 Issue 2 March 2007 pp 251-260 Articles. Antisense expression of a gene encoding a calcium-binding protein in transgenic tobacco leads to altered morphology and enhanced chlorophyll ... 2014 pp 931-944 Reviews. Antifreeze proteins enable plants to survive in freezing conditions · Ravi Gupta Renu Deswal.

  20. Multistudy fine mapping of chromosome 2q identifies XRCC5 as a chronic obstructive pulmonary disease susceptibility gene

    DEFF Research Database (Denmark)

    Hersh, Craig P; Pillai, Sreekumar G; Zhu, Guohua

    2010-01-01

    XRCC5, was replicated in the Boston Early-Onset COPD Study, with a combined P = 2.51 x 10(-5) across the four studies, which remains significant when adjusted for multiple testing (P = 0.02). Genotype imputation confirmed the association with SNPs in XRCC5. CONCLUSIONS: By combining data from COPD...

  1. Browse Title Index

    African Journals Online (AJOL)

    Items 251 - 300 of 705 ... ... Dictionary Visions, Research and Practice. Selected Papers from the 12th International Symposium on Lexicography, Copenhagen 2004, Abstract PDF. M Smit. Vol 11 (2001), Herbert Wiegand with a "Metalexicographical Panga" in the Jungle: An Unlocking of "Wörterbuchforschung", Abstract PDF.

  2. Challenges of Recognition of the Psychiatric Aspects of Intimate ...

    African Journals Online (AJOL)

    hanumantp

    . Achor JU, Ibekwe PC1 .... Barriers to Recognition and Treatment of. Psychiatric Aspects of Partner Violence. A number of ..... Ann Intern Med 1978;88:251-8. 50. Angel R, Thoits P. The impact of culture on the cognitive structure of illness.

  3. Dicty_cDB: Contig-U04801-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available an troglodytes chromosome 19 clone CH251-496F20,... 42 6.9 2 ( EY504188 ) CBBP7356.fwd CBBP Hirudo medicin...alis hermaphrodit... 36 7.5 2 ( EY504187 ) CBBP7356.rev CBBP Hirudo medicinalis her

  4. 78 FR 79567 - National School Lunch Program and School Breakfast Program: Nutrition Standards for All Foods...

    Science.gov (United States)

    2013-12-31

    ... first FEDERAL REGISTER issue of each week. Federal Register / Vol. 78, No. 251 / Tuesday, December 31... Program: Nutrition Standards for All Foods Sold in Schools as Required by the Healthy, Hunger-Free Kids... All Foods Sold in Schools as required by the Healthy, Hunger-Free Kids Act of 2010 was published on...

  5. Browse Title Index

    African Journals Online (AJOL)

    Items 251 - 300 of 437 ... Vol 18, No 1 (2013), Perceptions of health promoters about health promotion programmes for families with adolescents orphaned as a result of AIDS in the rural Hammanskraal region in South Africa, Abstract PDF ... Vol 10, No 2 (2005), Perceptions of rural teenagers on teenage pregnancy, Abstract.

  6. Gene expression profiling and qRT-PCR expression of RRP1B ...

    Indian Academy of Sciences (India)

    84. 0.203. 04612. Antigen processing and presentation. 2. 52. 0.251. Biological processes downregulated in Down's syndrome. 04514. Cell adhesion molecules (CAMs). 6. 82. 0.0102. 05330. Allograft rejection. 3. 24. 0.0164. 05320. Autoimmune thyroid disease. 3. 26. 0.0204. 04080. Neuroactive ligand–receptor interaction.

  7. 47 CFR 51.715 - Interim transport and termination pricing.

    Science.gov (United States)

    2010-10-01

    ....715 Section 51.715 Telecommunication FEDERAL COMMUNICATIONS COMMISSION (CONTINUED) COMMON CARRIER... arrangement, pending resolution of negotiation or arbitration regarding transport and termination rates and approval of such rates by a state commission under sections 251 and 252 of the Act. (1) This requirement...

  8. Browse Title Index

    African Journals Online (AJOL)

    Items 251 - 300 of 319 ... Vol 13, No 2 (2013), Quality and value chain analyses of Ethiopian coffee, Abstract PDF. B Beshah, D Kitaw, ... Vol 6, No 2 (2006), Rural households perception of the impact of crude iol exploration in Ogba/Egbema/Ndoni Local Government area of Rivers State, Nigeria, Abstract PDF. CG Okoli.

  9. 48 CFR 2813.7002 - Procedure.

    Science.gov (United States)

    2010-10-01

    ... be domestic source end products, except as provided in FAR subpart 25.1. (b) Use of the certified... by the appropriate administrative office and forwarded to the Finance Office for payment within 5... forwarding the invoice to Finance, the administrative office shall place the following statement on the...

  10. Lay Theories of Suicide: An Examination of Culturally Relevant Suicide Beliefs and Attributions among African Americans and European Americans

    Science.gov (United States)

    Walker, Rheeda L.; Lester, David; Joe, Sean

    2006-01-01

    The purpose of this study was to examine African Americans' lay beliefs and attributions toward suicide. The Attitudes Toward Suicide Scale, Life Ownership Orientation Questionnaire, Stigma Questionnaire, and Suicide Ideation Questionnaire were administered to 251 undergraduate college students. Beliefs about stigma associated with suicide were…

  11. Browse Title Index

    African Journals Online (AJOL)

    Items 251 - 300 of 475 ... Vol 3, No 1 (2008), Lansoprazole as part of triple therapy in eradication of H. pylori in Sudanese patients with gastro-duodenal inflammation, Abstract. AA Wadi, SS Fedail. Vol 7, No 3 (2012), Laparoscopy for the management of impalpable testis, Abstract. B El-Nabulsi, S Karadsheh, M Dajja, W Mofleh, ...

  12. Kolísání a tendence v režimu odtoků povodí českého Labe

    Czech Academy of Sciences Publication Activity Database

    Buchtele, Josef; Buchtelová, Marie; Fořtová, Magda

    2008-01-01

    Roč. 58, č. 7 (2008), s. 251-255 ISSN 1211-0760 Grant - others:EU(CZ) NeWater No. 511179 Institutional research plan: CEZ:AV0Z20600510 Keywords : runoff changes * natural affection * antropogenic changes * identification of changes Subject RIV: BK - Fluid Dynamics

  13. 19 CFR 10.221 - Applicability.

    Science.gov (United States)

    2010-04-01

    ... Partnership Act Textile and Apparel Articles Under the United States-Caribbean Basin Trade Partnership Act § 10.221 Applicability. Title II of Public Law 106-200 (114 Stat. 251), entitled the United States-Caribbean Basin Trade Partnership Act (CBTPA), amended section 213(b) of the Caribbean Basin Economic...

  14. 19 CFR 10.231 - Applicability.

    Science.gov (United States)

    2010-04-01

    ... Partnership Act Non-Textile Articles Under the United States-Caribbean Basin Trade Partnership Act § 10.231 Applicability. Title II of Public Law 106-200 (114 Stat. 251), entitled the United States-Caribbean Basin Trade Partnership Act (CBTPA), amended section 213(b) of the Caribbean Basin Economic Recovery Act (the CBERA, 19 U...

  15. Browse Title Index

    African Journals Online (AJOL)

    Items 251 - 300 of 319 ... Vol 14, No 1 (2007), Review of public health implications of cell phone radiation and other sources of non-ionizing radiation and ionizing radiation, Abstract. AA Mustapha, AO Owoyemi. Vol 16, No 1 (2009), Rheumatic valvular heart disease as seen at echocardiography in Ilorin, Nigeria, Abstract.

  16. Extent of Intramolecular pi Stacks in Aqueous Solution in Mixed-Ligand Copper(II) Complexes Formed by Heteroaromatic Amines and 1-[2-(Phosphonomethoxy)ethyl]cytosine (PMEC), a Relative of Antivirally Active Acyclic Nucleotide Analogues (Part 72)

    Czech Academy of Sciences Publication Activity Database

    Blindauer, C. A.; Sigel, A.; Operschall, B. P.; Holý, Antonín; Sigel, H.

    2013-01-01

    Roč. 639, 8-9 (2013), s. 1661-1673 ISSN 0044-2313 Institutional support: RVO:61388963 Keywords : nucleotide analogues * antivirals * complex stabilities * isomers * equilibria * mixed ligand complexes Subject RIV: CC - Organic Chemistry Impact factor: 1.251, year: 2013

  17. Browse Title Index

    African Journals Online (AJOL)

    Items 251 - 300 of 1025 ... Vol 17, No 1 (2003), Speciation of cadmium mixed ligand complexes in salt water lakes, Abstract PDF. John L. Kituyi, Henry M. Thairu, Justin Irina, Knut H. Schroder. Vol 24, No 3 (2010), Spectral characterizations and antibacterial effect of 2-(5-R-1H-benzimidazol-2-YL)-4-methyl/bromo-phenols and ...

  18. Malaria Epidemics in Dembia, Northwest Ethiopia 1952 – 1953

    African Journals Online (AJOL)

    unhcc

    1Department of History, Bahir Dar University, Email: fantahun@gmail.com, Phone: +251-911759867. Original article ... Objective: The main objective of this study is to investigate the history of the 1952/53 malaria epidemic in. Dembia and the scale of its devastation. ... In sub-Saharan Africa, malaria still claims 1-2 million ...

  19. Browse Title Index

    African Journals Online (AJOL)

    Items 251 - 300 of 670 ... Vol 6, No 1 (2009), HEALTH / GENDER STUDIES: HIV/AIDS and Health Inequalities in Sub-Saharan Africa: Trends and Dimensions, Abstract. EE Obioha. Vol 1 (2004), Heroes in African folktale: agents of contemporary corruption, Abstract. Patric Ebewo. Vol 13, No 2 (2016), Historical allusions as ...

  20. Considerations about the light reflectance digital imaging colorimetry under linear approach

    Czech Academy of Sciences Publication Activity Database

    Pospíšil, Jaroslav; Hrdý, J.; Hrdý, jr., J.

    2006-01-01

    Roč. 51, č. 9 (2006), s. 247-251 ISSN 0447-6441 Institutional research plan: CEZ:AV0Z10100522 Keywords : light reflectance digital imaging colorimetry * digital color camera * tristimulus color coordinates * camera digital output color data Subject RIV: BH - Optics, Masers, Lasers

  1. Browse Title Index

    African Journals Online (AJOL)

    Items 251 - 300 of 488 ... Vol 8, No 2 (2011), Littre hernia in childhood: A case report with a brief review of the literature, Abstract. A Pampal, ED Aksakal. Vol 11, No 2 (2014), Longterm outcome of Macroplatique injection for treatment of vesicoureteral reflux in children, Abstract. EA Mohamed, FH Shehata, EA Abdelbaset, MA ...

  2. Fauna and associations of aphid parasitoids in an up-dated farmland area (Czech Republic)

    Czech Academy of Sciences Publication Activity Database

    Starý, Petr; Havelka, Jan

    2008-01-01

    Roč. 61, č. 2 (2008), s. 251-276 ISSN 1721-8861 R&D Projects: GA AV ČR IAA600960705 Institutional research plan: CEZ:AV0Z50070508 Keywords : aphids * Hymenoptera * Braconidae Subject RIV: EH - Ecology, Behaviour Impact factor: 0.153, year: 2008

  3. Ruthenium-modified MCM-41 mesoporous molecular sieve and Y zeolite catalysts for selective hydrogenation of cinnamaldehyde

    Czech Academy of Sciences Publication Activity Database

    Hájek, J.; Kumar, N.; Mäki-Arvela, P.; Salmi, T.; Murzin, D. Z.; Paseka, Ivo; Heikkilä, T.; Laine, E.; Laukkanen, P.; Väyrynen, J.

    2003-01-01

    Roč. 251, č. 2 (2003), s. 385-396 ISSN 0926-860X R&D Projects: GA ČR GA104/03/0409 Institutional research plan: CEZ:AV0Z4032918 Keywords : mesoporous molecular sieve * zeolites * ruthenium Subject RIV: CA - Inorganic Chemistry Impact factor: 2.825, year: 2003

  4. Compensatory growth of Euphorbia peplus regenerating from a bud bank

    Czech Academy of Sciences Publication Activity Database

    Latzel, Vít; Malíková, Lenka; Klimešová, Jitka

    2011-01-01

    Roč. 89, č. 5 (2011), 313-321 ISSN 1916-2790 R&D Projects: GA ČR GD206/08/H044; GA ČR GPP505/10/P173 Institutional research plan: CEZ:AV0Z60050516 Keywords : hypocotyl * disturbance * invasive species Subject RIV: EF - Botanics Impact factor: 1.251, year: 2011

  5. Molecular Mechanism of Dioxin Action: Molecular Cloning of the Ah Receptor Using a DNA Recognition Site Probe

    Science.gov (United States)

    1992-01-13

    DNA with high affinity (Whitlock and Galeazzi , 1984; Henry et al., 1989; Denison and Yao, 1991). Biochemical and genetic studies (Denison et al., 1988a...Pharmacol. Toxicol. 30: 251-277. Whitlock, J. P., Jr. (1987) Pharmacol. Rev. 39: 147-161. Whitlock, J. P., Jr. and Galeazzi , D. R. (1984) J. Biol

  6. Search Results | Page 26 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    2017-09-14

    Results 251 - 260 of 8491 ... Four key findings to promote good health and well-being for all. IDRC supported five regional consultations to explore the role of think tanks and academic institutions in the SDG implementation and monitoring. Published date. September 14, 2017. Research in Action. Gender ...

  7. The Influence of Self-Compassion on Academic Procrastination and Dysfunctional Attitudes

    Science.gov (United States)

    Iskender, Murat

    2011-01-01

    In the present study, aims were (1) to determine gender differences in self-compassion, academic procrastination, and dysfunctional attitudes and (2) to examine the relationships between self-compassion, academic procrastination, and dysfunctional attitudes. Participants were 251 university students who completed a questionnaire package that…

  8. Development and Evaluation of Floating Microspheres of Curcumin

    African Journals Online (AJOL)

    The shape and surface morphology of the microspheres were characterised by optical and scanning electron microscopy. Result: The floating microspheres showed particle size, buoyancy, drug entrapment efficiency and yield in the ranges of 251 - 387 µm, 74.6 - 90.6 %, and 72.6 - 83.5 %, and 45.5 - 82.0 %, respectively.

  9. Secondary Structures Associated With Alkaline Transition of Horse ...

    African Journals Online (AJOL)

    acer

    Wasagu et al.; Secondary Structures Associated With Alkaline Transition of Horse Heart Ferricytochrome C: An FTIR Study. 251 above mentioned enhancement techniques. In contrast with single band observed in the primary spectrum, second derivative in the amide I region (1700 and 1600 cm-1), was characterized by ...

  10. Ischaemic heart disease in Aminu Kano Teaching Hospital, Kano ...

    African Journals Online (AJOL)

    Ischaemic heart disease in Aminu Kano Teaching Hospital, Kano, Nigeria: a 5 year review. ... Forty six patients were diagnosed to have IHD giving it a prevalence of 0.9% of medical conditions and 3.4% of all cardiovascular cases. There were 33 males and 13 females (M: F = 2.5:1). Twenty two patients (47.8%) had ...

  11. Genetic Polymorphisms in SOD (rs2070424, rs7880) and CAT (rs7943316, rs1001179) Enzymes Are Associated with Increased Body Fat Percentage and Visceral Fat in an Obese Population from Central Mexico.

    Science.gov (United States)

    Hernández-Guerrero, César; Hernández-Chávez, Paulina; Romo-Palafox, Inés; Blanco-Melo, Grecia; Parra-Carriedo, Alicia; Pérez-Lizaur, Ana

    2016-07-01

    Oxidative disturbance is an important factor involved in the etiology of comorbidities associated with obesity. Genetic polymorphisms such as SOD1 -251A>G, SOD2 47 C>T, CAT -21A>T and CAT -262 C>T have been described to alter the activity of antioxidant enzymes. The aim of the present work was to analyze the association of the mentioned SNPs with obesity and their relationship with anthropometric and clinical variables in this group. The study included 416 Mexican women (208 normal weight, NW and 208 subjects with obesity, OB). Dietary intake, anthropometric, biochemical and clinical features were evaluated and then analyzed in function of the genotypes. The mutated carriers (GA+GG) of SOD -251 were significantly higher in the OB group (0.24) compared to the NW group (0.08). The other SNPs showed no differences compared with control group. When comparing carrier mutated subjects with obesity vs. wild-type obese participants with the SNPs SOD1 -251, SOD2 47 and CAT -262, the carriers showed a significantly (p G is associated with obesity independent of the presence of diabetes or dyslipidemia. Mutated obese carries of SOD1 -251, SOD2 47 and CAT -262 are associated with a higher distribution of fat in comparison with obese wild-type carriers. Copyright © 2016 IMSS. Published by Elsevier Inc. All rights reserved.

  12. Biotechnology Process Engineering Center at MIT Home

    Science.gov (United States)

    ... &6; &1; - &8; &22; Q )&25;&1;f &6; &2; - &8; &1; &22; )&16;&2;fi &6; - &8; &22; )&31;&1;c &6; - &8; &22; )&21;&2;e" ... &6; &1; - &8; &22; Q )'&1;s &6; &2; - &8; &1; &22; )&20;&2;Wi &6; - &8; &22; )>&1;t &6; &1; - &8; &22; Q ...

  13. 78 FR 79690 - California Independent System Operator Corporation; Notice of Filing

    Science.gov (United States)

    2013-12-31

    ... electronically should submit an original and 5copies of the protest or intervention to the Federal Energy... [Federal Register Volume 78, Number 251 (Tuesday, December 31, 2013)] [Notices] [Pages 79690-79691] [FR Doc No: 2013-31254] DEPARTMENT OF ENERGY Federal Energy Regulatory Commission [Docket No. EL05-146...

  14. Browse Title Index

    African Journals Online (AJOL)

    Items 251 - 300 of 1305 ... Vol 11, No 2 (2007), Concentrations of Polychlorinated Biphenyls (PCBs), Polychlorinated Dibenzo-pdioxins and Furans (PCDD/Fs), and Polybrominated Diphenyl Ethers (PBDEs) as Functions of Sample Depth in Killer Whale (Orcinus orca) Blubber, Abstract PDF. MG Ikonomou, S Rayne, NF Crewe.

  15. Nanocrystalline Ni-Zn ferrites prepared by sol-gel method

    Czech Academy of Sciences Publication Activity Database

    Popovici, M.; Savii, C.; Nižňanský, Daniel; Šubrt, Jan; Boháček, Jaroslav; Becherescu, D.; Caizer, C.; Enache, C.; Ionescu, C.

    2003-01-01

    Roč. 5, č. 1 (2003), s. 251-256 ISSN 1454-4164 R&D Projects: GA MŠk LN00A028 Institutional research plan: CEZ:AV0Z4032918 Keywords : nanostructures * sol-gel processing * XRD Subject RIV: CA - Inorganic Chemistry Impact factor: 0.996, year: 2003

  16. Silver salt of 4,6-diazido-N-nitro-1,3,5-triazine-2-amine - characterization of this primary explosive

    Czech Academy of Sciences Publication Activity Database

    Musil, T.; Matyáš, R.; Vala, R.; Růžička, A.; Vlček, Milan

    2014-01-01

    Roč. 39, č. 2 (2014), s. 251-259 ISSN 0721-3115 Institutional support: RVO:61389013 Keywords : primary explosive * AgDANT * silver salt of 4,6-diazido-N-nitro-1,3,5-triazine-2-amine Subject RIV: CC - Organic Chemistry Impact factor: 1.604, year: 2014

  17. Trans-ancestry genome-wide association study identifies 12 genetic loci influencing blood pressure and implicates a role for DNA methylation

    DEFF Research Database (Denmark)

    Kato, Norihiro; Loh, Marie; Takeuchi, Fumihiko

    2015-01-01

    We carried out a trans-ancestry genome-wide association and replication study of blood pressure phenotypes among up to 320,251 individuals of East Asian, European and South Asian ancestry. We find genetic variants at 12 new loci to be associated with blood pressure (P = 3.9 × 10(-11) to 5.0 × 10...

  18. Factors predicting optic nerve axonal degeneration after methanol-induced acute optic neuropathy: a 2-year prospective study in 54 patients

    Czech Academy of Sciences Publication Activity Database

    Zakharov, S.; Nurieva, O.; Kotíková, K.; Urban, P.; Navrátil, Tomáš; Pelclová, D.

    2016-01-01

    Roč. 147, č. 1 (2016), s. 251-261 ISSN 0026-9247 Institutional support: RVO:61388955 Keywords : methanol optic neuropathy * visual evoked potentials * axonal degeneration Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 1.282, year: 2016

  19. Child Welfare Involvement among Children in Homeless Families

    Science.gov (United States)

    Park, Jung Min; Metraux, Stephen; Brodbar, Gabriel; Culhane, Dennis P.

    2004-01-01

    An analysis of 8,251 homeless children in New York City found that 18% of them received child welfare services over the five-year period following their first shelter admission, and an additional 6% had a history of having received such services before their first shelter admission. Recurrent use of public shelters, exposure to domestic violence,…

  20. Dieting, Dietary Restraint, and Binge Eating Disorder among Overweight Adolescents in Turkey

    Science.gov (United States)

    Bas, Murat; Bozan, Nuray; Cigerim, Nevin

    2008-01-01

    The purpose of this study was to determine the relationship among dieting, dietary restraint, disinhibition, hunger, and binge eating among overweight adolescent girls. Participants were 743 overweight adolescent girls between 16 and 19 years of age. The mean BMI was 24.9 [+ or -] 0.8 kg/[m[superscript 2] in the low-restraint group and 25.1 [+ or…