WorldWideScience

Sample records for mendelevium 248

  1. Symposium commemorating the 25th anniversary of the discovery of mendelevium

    Energy Technology Data Exchange (ETDEWEB)

    Seaborg, G.T. (ed.)

    1980-01-01

    The Symposium honoring the 25th Anniversary of the discovery of mendelevium was held at the Lawrence Berkeley Laboratory on March 28, 1980. The following three papers were presented: Chemical Properties of Mendelevium; Nuclear Properties of Mendelevium; and Radioactive Decay of Md Isotopes. Besides these papers there were introductory remarks, reminiscences, and concluding remarks.

  2. Studies on some physico-chemical properties of the monovalent mendelevium

    International Nuclear Information System (INIS)

    Kamenskaya, A.N.; Mikheev, N.B.; Novichenko, V.L.

    1979-01-01

    It was established that Md 3+ reduced by Yb 2+ or Eu 2+ co-crystallizes with NaCl in water-ethanol solutions. The co-crystallization coefficient is independent of the relative quantities of the solid and liquid phase, of the concentration of the reducing agent in the concentration range from 1 to 8 mg/ml, and of the concentration of the chloride ion in the solution. Basing on the knowledge of anomalous mixed crystals and on the thermodynamical analysis of the formation of truly isomorphical solid solutions and anomalous mixed crystals, it was shown that mendelevium co-crystallizing with NaCl is in its monovalent state. Besides, it was concluded that up to 1.5 M chloride concentration the monovalent mendelevium does not form stable chloride complexes in water-ethanol solutions. (author)

  3. 17 CFR 248.103-248.119 - [Reserved

    Science.gov (United States)

    2010-04-01

    ... 17 Commodity and Securities Exchanges 3 2010-04-01 2010-04-01 false [Reserved] 248.103-248.119 Section 248.103-248.119 Commodity and Securities Exchanges SECURITIES AND EXCHANGE COMMISSION (CONTINUED) REGULATIONS S-P AND S-AM Regulation S-AM: Limitations on Affiliate Marketing §§ 248.103-248.119 [Reserved] ...

  4. Chemical properties of mendelevium

    Energy Technology Data Exchange (ETDEWEB)

    Hulet, E.K.

    1980-11-01

    Even with the most intense ion beams and the largest available quantities of target isotope, about 10/sup 6/ atoms at a time is all the Md that can be produced for chemical studies. This lack of sufficient sample size coupled with the very short lifetimes of the few atoms produced has severely restricted the gathering and the broadness of our knowledge concerning the properties of Md and the heavier elements. To illustrate, the literature contains a mere eleven references to the chemical studies of Md, and none of these deal with bulk properties associated with the element bound in solid phases. Some of these findings are: Md was found to be more volatile than other actinide metals which lead to the belief that it is divalent in the metallic state; separation of Md from the other actinides can be accomplished either by reduction of Md/sup 3 +/ to the divalent state or by chromatographic separations with Md remaining in the tripositive state; extraction of Md/sup 2 +/ with bis(2-ethylhexyl)phosphoric acid is much poorer than the extraction of the neighboring tripositive actinides; attempts to oxidize Md/sup 3 +/ with sodium bismuthate failed to show any evidence for Md/sup 4 +/; reduction potential of Md/sup 3 +/ was found to be close to -0.1 volt; Md/sup 3 +/ can be reduced to Md(Hg) by sodium amalgams and by electrolysis; the electrochemical behavior of Md is very similar to that of Fm and can be summarized in the equation, Md/sup 2 +/ + 2e/sup -/ = Md(Hg) and E/sup 0/ = -1.50 V.; and Md cannot be reduced to a monovalent ion with Sm/sup 2 +/.

  5. Chemical properties of mendelevium

    International Nuclear Information System (INIS)

    Hulet, E.K.

    1980-01-01

    The isotope 256 Md is nearly always employed for chemical studies of this element. This nuclide can be made by bombardment of fractions of a microgram of 254 Es with intense alpha-particle beams which will produce about 10 6 atoms of 256 Md with a half-life of 77 minutes. Even with the most intense ion beams and the largest available quantities of target isotope, about 10 6 atoms at a time is all the Md that can be produced for chemical studies. This lack of sufficient sample size coupled with the very short lifetimes of the few atoms produced has severly restricted the gathering and broadening of our knowledge concerning the properties of Md and the heavier elements. To illustrate, the literature contains a mere eleven references to the chemical studies of Md, and none of these deal with bulk properties associated with element found in solid phases. Some of these findings are: Md was found to be more volatile than other actinide metals which lead to the belief that it is divalent in the metallic state; separation of Md from the other actinides can be accomplished either by reduction of Md to the divalent state or by chromatographic separations with Md remaining in the tripositive state; extraction of Md with bis(2-ethylhexyl)phosphoric acid is much poorer than the extraction of the neighboring tripositive actinides; attempts to oxidize Md wih sodium bismuthate failed to show any evidence of Md 4+ ; standard reduction potential of Md 3+ was found to be close to -0.1 volt; Md 3+ can be reduced to Md(Hg) by sodium amalgams and by electrolysis; the electrochemical behavior of Md is very similar to that of Fm and can be summarized in the equation, Md 2+ + 2e - = Md(Hg), and E 0 = 1.5 V

  6. Chemical properties of mendelevium

    International Nuclear Information System (INIS)

    Hulet, E.K.

    1980-11-01

    Even with the most intense ion beams and the largest available quantities of target isotope, about 10 6 atoms at a time is all the Md that can be produced for chemical studies. This lack of sufficient sample size coupled with the very short lifetimes of the few atoms produced has severely restricted the gathering and the broadness of our knowledge concerning the properties of Md and the heavier elements. To illustrate, the literature contains a mere eleven references to the chemical studies of Md, and none of these deal with bulk properties associated with the element bound in solid phases. Some of these findings are: Md was found to be more volatile than other actinide metals which lead to the belief that it is divalent in the metallic state; separation of Md from the other actinides can be accomplished either by reduction of Md 3+ to the divalent state or by chromatographic separations with Md remaining in the tripositive state; extraction of Md 2+ with bis(2-ethylhexyl)phosphoric acid is much poorer than the extraction of the neighboring tripositive actinides; attempts to oxidize Md 3+ with sodium bismuthate failed to show any evidence for Md 4+ ; reduction potential of Md 3+ was found to be close to -0.1 volt; Md 3+ can be reduced to Md(Hg) by sodium amalgams and by electrolysis; the electrochemical behavior of Md is very similar to that of Fm and can be summarized in the equation, Md 2+ + 2e - = Md(Hg) and E 0 = -1.50 V.; and Md cannot be reduced to a monovalent ion with Sm 2+

  7. 17 CFR 248.102 - Examples.

    Science.gov (United States)

    2010-04-01

    ... 17 Commodity and Securities Exchanges 3 2010-04-01 2010-04-01 false Examples. 248.102 Section 248... AND S-AM Regulation S-AM: Limitations on Affiliate Marketing § 248.102 Examples. The examples in this subpart are not exclusive. The examples in this subpart provide guidance concerning the rules' application...

  8. 7 CFR 248.3 - Administration.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 4 2010-01-01 2010-01-01 false Administration. 248.3 Section 248.3 Agriculture... CHILD NUTRITION PROGRAMS WIC FARMERS' MARKET NUTRITION PROGRAM (FMNP) General § 248.3 Administration. (a) Delegation to FNS. Within the Department, FNS shall act on behalf of the Department in the administration of...

  9. 7 CFR 248.9 - Nutrition education.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 4 2010-01-01 2010-01-01 false Nutrition education. 248.9 Section 248.9 Agriculture... Nutrition education. (a) Goals. Nutrition education shall emphasize the relationship of proper nutrition to.... (b) Requirement. The State agency shall integrate nutrition education into FMNP operations and may...

  10. 7 CFR 248.24 - Other provisions.

    Science.gov (United States)

    2010-01-01

    ... CHILD NUTRITION PROGRAMS WIC FARMERS' MARKET NUTRITION PROGRAM (FMNP) Miscellaneous Provisions § 248.24... information. FNS reserves the right to use information obtained under the FMNP in a summary, statistical or...

  11. 7 CFR 248.7 - Nondiscrimination.

    Science.gov (United States)

    2010-01-01

    ... CHILD NUTRITION PROGRAMS WIC FARMERS' MARKET NUTRITION PROGRAM (FMNP) Recipient Eligibility § 248.7 Nondiscrimination. (a) Civil rights requirements. The State agency shall comply with the requirements of title VI of the Civil Rights Act of 1964, title IX of the Education Amendments of 1972, section 504 of the...

  12. 17 CFR 248.120 - Definitions.

    Science.gov (United States)

    2010-04-01

    ... S-P AND S-AM Regulation S-AM: Limitations on Affiliate Marketing § 248.120 Definitions. As used in this subpart, unless the context requires otherwise: (a) Affiliate of a broker, dealer, or investment... is related by common ownership or common control with the broker, dealer, or investment company, or...

  13. 7 CFR 248.13 - FMNP income.

    Science.gov (United States)

    2010-01-01

    ... CHILD NUTRITION PROGRAMS WIC FARMERS' MARKET NUTRITION PROGRAM (FMNP) State Agency Provisions § 248.13 FMNP income. Program income means gross income the State agency earns from grant supported activities... property. The State agency shall retain Program income earned during the agreement period and use it for...

  14. 7 CFR 248.15 - Closeout procedures.

    Science.gov (United States)

    2010-01-01

    ... CHILD NUTRITION PROGRAMS WIC FARMERS' MARKET NUTRITION PROGRAM (FMNP) State Agency Provisions § 248.15 Closeout procedures. (a) General. State agencies shall submit to FNS a final closeout report for the fiscal... the State agency shall do the same for farmers/farmers' markets. (4) A grant closeout shall not affect...

  15. 7 CFR 248.11 - Financial management system.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 4 2010-01-01 2010-01-01 false Financial management system. 248.11 Section 248.11... § 248.11 Financial management system. (a) Disclosure of expenditures. The State agency shall maintain a financial management system which provides accurate, current and complete disclosure of the financial status...

  16. 7 CFR 58.248 - Nonfat dry milk.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 3 2010-01-01 2010-01-01 false Nonfat dry milk. 58.248 Section 58.248 Agriculture... Products Bearing Usda Official Identification § 58.248 Nonfat dry milk. (a) Nonfat dry milk in commercial....S. Standard Grade. (b) Regular nonfat dry milk in consumer size packages which bears an official...

  17. 7 CFR 248.1 - General purpose and scope.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 4 2010-01-01 2010-01-01 false General purpose and scope. 248.1 Section 248.1... AGRICULTURE CHILD NUTRITION PROGRAMS WIC FARMERS' MARKET NUTRITION PROGRAM (FMNP) General § 248.1 General purpose and scope. This part announces regulations under which the Secretary of Agriculture shall carry...

  18. 25 CFR 248.4 - Applicability of laws and regulations.

    Science.gov (United States)

    2010-04-01

    ... 25 Indians 1 2010-04-01 2010-04-01 false Applicability of laws and regulations. 248.4 Section 248... RIVER INDIAN IN-LIEU FISHING SITES § 248.4 Applicability of laws and regulations. No Indian shall use... regulation of his tribe or contrary to any applicable State or Federal law or regulation. The Area Director...

  19. CD248 facilitates tumor growth via its cytoplasmic domain

    Directory of Open Access Journals (Sweden)

    Janssens Tom

    2011-05-01

    Full Text Available Abstract Background Stromal fibroblasts participate in the development of a permissive environment for tumor growth, yet molecular pathways to therapeutically target fibroblasts are poorly defined. CD248, also known as endosialin or tumor endothelial marker 1 (TEM1, is a transmembrane glycoprotein expressed on activated fibroblasts. We recently showed that the cytoplasmic domain of CD248 is important in facilitating an inflammatory response in a mouse model of arthritis. Others have reported that CD248 gene inactivation in mice results in dampened tumor growth. We hypothesized that the conserved cytoplasmic domain of CD248 is important in regulating tumor growth. Methods Mice lacking the cytoplasmic domain of CD248 (CD248CyD/CyD were generated and evaluated in tumor models, comparing the findings with wild-type mice (CD248WT/WT. Results As compared to the response in CD248WT/WT mice, growth of T241 fibrosarcomas and Lewis lung carcinomas was significantly reduced in CD248CyD/CyD mice. Tumor size was similar to that seen with CD248-deficient mice. Conditioned media from CD248CyD/CyD fibroblasts were less effective at supporting T241 fibrosarcoma cell survival. In addition to our previous observation of reduced release of activated matrix metalloproteinase (MMP-9, CD248CyD/CyD fibroblasts also had impaired PDGF-BB-induced migration and expressed higher transcripts of tumor suppressor factors, transgelin (SM22α, Hes and Hey1. Conclusions The multiple pathways regulated by the cytoplasmic domain of CD248 highlight its potential as a therapeutic target to treat cancer.

  20. R248Q mutation--Beyond p53-DNA binding.

    Science.gov (United States)

    Ng, Jeremy W K; Lama, Dilraj; Lukman, Suryani; Lane, David P; Verma, Chandra S; Sim, Adelene Y L

    2015-12-01

    R248 in the DNA binding domain (DBD) of p53 interacts directly with the minor groove of DNA. Earlier nuclear magnetic resonance (NMR) studies indicated that the R248Q mutation resulted in conformation changes in parts of DBD far from the mutation site. However, how information propagates from the mutation site to the rest of the DBD is still not well understood. We performed a series of all-atom molecular dynamics (MD) simulations to dissect sterics and charge effects of R248 on p53-DBD conformation: (i) wild-type p53 DBD; (ii) p53 DBD with an electrically neutral arginine side-chain; (iii) p53 DBD with R248A; (iv) p53 DBD with R248W; and (v) p53 DBD with R248Q. Our results agree well with experimental observations of global conformational changes induced by the R248Q mutation. Our simulations suggest that both charge- and sterics are important in the dynamics of the loop (L3) where the mutation resides. We show that helix 2 (H2) dynamics is altered as a result of a change in the hydrogen bonding partner of D281. In turn, neighboring L1 dynamics is altered: in mutants, L1 predominantly adopts the recessed conformation and is unable to interact with the major groove of DNA. We focused our attention the R248Q mutant that is commonly found in a wide range of cancer and observed changes at the zinc-binding pocket that might account for the dominant negative effects of R248Q. Furthermore, in our simulations, the S6/S7 turn was more frequently solvent exposed in R248Q, suggesting that there is a greater tendency of R248Q to partially unfold and possibly lead to an increased aggregation propensity. Finally, based on the observations made in our simulations, we propose strategies for the rescue of R248Q mutants. © 2015 Wiley Periodicals, Inc.

  1. 17 CFR 248.18 - Effective date; transition rule.

    Science.gov (United States)

    2010-04-01

    ... Safeguarding Personal Information Relation to Other Laws; Effective Date § 248.18 Effective date; transition... customers on the compliance date. By July 1, 2001, you must have provided an initial notice, as required by § 248.4, to consumers who are your customers on July 1, 2001. (2) Example. You provide an initial notice...

  2. 24 CFR 248.223 - Alternative State strategy.

    Science.gov (United States)

    2010-04-01

    ... 24 Housing and Urban Development 2 2010-04-01 2010-04-01 false Alternative State strategy. 248.223... Preservation Act of 1987 § 248.223 Alternative State strategy. (a) The Commissioner may approve a State strategy providing for State approval of plans of action that involve termination of low income...

  3. 17 CFR 248.124 - Reasonable opportunity to opt out.

    Science.gov (United States)

    2010-04-01

    ... (CONTINUED) REGULATIONS S-P AND S-AM Regulation S-AM: Limitations on Affiliate Marketing § 248.124 Reasonable... affiliate to make marketing solicitations to a consumer about your products or services unless the consumer...

  4. 7 CFR 248.23 - Records and reports.

    Science.gov (United States)

    2010-01-01

    ... CHILD NUTRITION PROGRAMS WIC FARMERS' MARKET NUTRITION PROGRAM (FMNP) Miscellaneous Provisions § 248.23... rights procedures. (2) All records shall be retained for a minimum of 3 years following the date of...

  5. 49 CFR 195.248 - Cover over buried pipeline.

    Science.gov (United States)

    2010-10-01

    ... HAZARDOUS LIQUIDS BY PIPELINE Construction § 195.248 Cover over buried pipeline. (a) Unless specifically... millimeters) from high water mark to high water mark 48 (1219) 18 (457) Drainage ditches at public roads and...

  6. 17 CFR 248.126 - Delivery of opt out notices.

    Science.gov (United States)

    2010-04-01

    ... (CONTINUED) REGULATIONS S-P AND S-AM Regulation S-AM: Limitations on Affiliate Marketing § 248.126 Delivery... expected to receive actual notice if the affiliate providing the notice: (1) Hand-delivers a printed copy... electronic disclosures by e-mail from the affiliate providing the notice; or (4) Posts the notice on the...

  7. 17 CFR 248.127 - Renewal of opt out elections.

    Science.gov (United States)

    2010-04-01

    ... (CONTINUED) REGULATIONS S-P AND S-AM Regulation S-AM: Limitations on Affiliate Marketing § 248.127 Renewal of... expires, you may not make marketing solicitations to a consumer who previously opted out, unless: (i) The....122(b). (3) Affiliates who may provide the notice. The notice required by this paragraph must be...

  8. 47 CFR 90.248 - Wildlife and ocean buoy tracking.

    Science.gov (United States)

    2010-10-01

    ... 47 Telecommunication 5 2010-10-01 2010-10-01 false Wildlife and ocean buoy tracking. 90.248... and ocean buoy tracking. (a) The frequency bands 40.66-40.70 MHz and 216-220 MHz may be used for the tracking of, and the telemetry of scientific data from, ocean buoys and animal wildlife. (b) Transmitters...

  9. 7 CFR 248.5 - Selection of new State agencies.

    Science.gov (United States)

    2010-01-01

    ... objective criteria to rank and approve State plans submitted in accordance with § 248.4. In making this ranking, the Department will consider the amount of funds necessary to successfully operate the FMNP in.... Approval of a State Plan does not equate to an obligation on the part of the Department to fund the FMNP...

  10. 25 CFR 248.9 - Camping and use restrictions.

    Science.gov (United States)

    2010-04-01

    ...-LIEU FISHING SITES § 248.9 Camping and use restrictions. All camping, picnicking, use of alcoholic... commercial purchase of fish) shall be subject to such prohibitions, restrictions, or other regulations as the... applicable; provided that no fee may be charged to any Indian or member of his family for any such use. ...

  11. 17 CFR 248.101 - Purpose and scope.

    Science.gov (United States)

    2010-04-01

    ...) REGULATIONS S-P AND S-AM Regulation S-AM: Limitations on Affiliate Marketing § 248.101 Purpose and scope. (a...”), regulates the use of consumer information received from an affiliate to make marketing solicitations. (b) Scope. This subpart applies to any broker or dealer other than a notice-registered broker or dealer, to...

  12. 48 CFR 52.248-2 - Value Engineering-Architect-Engineer.

    Science.gov (United States)

    2010-10-01

    ...-Architect-Engineer. 52.248-2 Section 52.248-2 Federal Acquisition Regulations System FEDERAL ACQUISITION... Clauses 52.248-2 Value Engineering—Architect-Engineer. As prescribed in 48.201(f), insert the following clause: Value Engineering—Architect-Engineer (MAR 1990) (a) General. The Contractor shall (1) perform...

  13. 17 CFR 248.16 - Protection of Fair Credit Reporting Act.

    Science.gov (United States)

    2010-04-01

    ... Reporting Act. 248.16 Section 248.16 Commodity and Securities Exchanges SECURITIES AND EXCHANGE COMMISSION (CONTINUED) REGULATIONS S-P AND S-AM Regulation S-P: Privacy of Consumer Financial Information and Safeguarding Personal Information Relation to Other Laws; Effective Date § 248.16 Protection of Fair Credit...

  14. 17 CFR 248.13 - Exception to opt out requirements for service providers and joint marketing.

    Science.gov (United States)

    2010-04-01

    ... requirements for service providers and joint marketing. 248.13 Section 248.13 Commodity and Securities... Consumer Financial Information and Safeguarding Personal Information Exceptions § 248.13 Exception to opt out requirements for service providers and joint marketing. (a) General rule. (1) The opt out...

  15. 17 CFR 248.5 - Annual privacy notice to customers required.

    Science.gov (United States)

    2010-04-01

    ... Safeguarding Personal Information Privacy and Opt Out Notices § 248.5 Annual privacy notice to customers required. (a)(1) General rule. You must provide a clear and conspicuous notice to customers that accurately... customers required. 248.5 Section 248.5 Commodity and Securities Exchanges SECURITIES AND EXCHANGE...

  16. 24 CFR 248.157 - Voluntary sale of housing not in excess of Federal cost limit.

    Science.gov (United States)

    2010-04-01

    ... § 248.157 Voluntary sale of housing not in excess of Federal cost limit. (a) Offer to sell. Where an... 24 Housing and Urban Development 2 2010-04-01 2010-04-01 false Voluntary sale of housing not in excess of Federal cost limit. 248.157 Section 248.157 Housing and Urban Development Regulations Relating...

  17. 24 CFR 248.161 - Mandatory sale of housing in excess of the Federal cost limit.

    Science.gov (United States)

    2010-04-01

    ... § 248.161 Mandatory sale of housing in excess of the Federal cost limit. (a) In general. With respect to... 24 Housing and Urban Development 2 2010-04-01 2010-04-01 false Mandatory sale of housing in excess of the Federal cost limit. 248.161 Section 248.161 Housing and Urban Development Regulations Relating...

  18. Actinide production from xenon bombardments of curium-248

    International Nuclear Information System (INIS)

    Welch, R.B.

    1985-01-01

    Production cross sections for many actinide nuclides formed in the reaction of 129 Xe and 132 Xe with 248 Cm at bombarding energies slightly above the coulomb barrier were determined using radiochemical techniques to isolate these products. These results are compared with cross sections from a 136 Xe + 248 Cm reaction at a similar energy. When compared to the reaction with 136 Xe, the maxima in the production cross section distributions from the more neutron deficient projectiles are shifted to smaller mass numbers, and the total cross section increases for the production of elements with atomic numbers greater than that of the target, and decreases for lighter elements. These results can be explained by use of a potential energy surface (PES) which illustrates the effect of the available energy on the transfer of nucleons and describes the evolution of the di-nuclear complex, an essential feature of deep-inelastic reactions (DIR), during the interaction. The other principal reaction mechanism is the quasi-elastic transfer (QE). Analysis of data from a similar set of reactions, 129 Xe, 132 Xe, and 136 Xe with 197 Au, aids in explaining the features of the Xe + Cm product distributions, which are additionally affected by the depletion of actinide product yields due to deexcitation by fission. The PES is shown to be a useful tool to predict the general features of product distributions from heavy ion reactions

  19. 7 CFR 248.22 - Nonprocurement debarment/suspension, drug-free workplace, and lobbying restrictions.

    Science.gov (United States)

    2010-01-01

    ... workplace, and lobbying restrictions. 248.22 Section 248.22 Agriculture Regulations of the Department of.../suspension, drug-free workplace, and lobbying restrictions. The State agency shall ensure compliance with the... lobbying (7 CFR part 3018), where applicable. ...

  20. Evaluation of neutron cross sections for 244Cm, 246Cm, and 248Cm

    International Nuclear Information System (INIS)

    Benjamin, R.W.; McCrosson, F.J.; Gettys, W.E.

    1977-01-01

    An evaluation of neutron cross sections for 244 246 248 Cm using the ENDF/B format is presented. Primary data input included differential measurements, integral measurements, nuclear model calculations, and reactor production experience

  1. Photolysis of butenedial at 193, 248, 280, 308, 351, 400, and 450 nm

    Science.gov (United States)

    Tang, Yongxin; Zhu, Lei

    2005-06-01

    We have studied the photolysis of butenedial at 193, 248, 280, 308, 351, 400, and 450 nm by using laser photolysis combined with cavity ring-down spectroscopy. The HCO radical is a photodissociation product at 193 and 248 nm. The corresponding HCO quantum yields are 0.55 ± 0.07 and 0.12 ± 0.01, independent of butenedial pressure and nitrogen buffer gas pressure. Absorption cross-sections of butenedial are (6.88 ± 0.39) × 10 -18 and (3.62 ± 0.69) × 10 -19 cm 2 at 193 and 248 nm. The end-products from the photolysis of butenedial at 193, 248, 308, and 351 nm were measured by FTIR. Acrolein and 3H-furan-2-one were observed and their yields have been estimated.

  2. Evaluation of neutron cross sections for /sup 244/Cm, /sup 246/Cm, and /sup 248/Cm

    Energy Technology Data Exchange (ETDEWEB)

    Benjamin, R.W.; McCrosson, F.J.; Gettys, W.E.

    1977-01-01

    An evaluation of neutron cross sections for /sup 244/ /sup 246/ /sup 248/Cm using the ENDF/B format is presented. Primary data input included differential measurements, integral measurements, nuclear model calculations, and reactor production experience. (SDF)

  3. Single-mode 37-core fiber with a cladding diameter of 248 μm

    DEFF Research Database (Denmark)

    Sasaki, Y.; Takenaga, K.; Aikawa, K.

    2017-01-01

    A heterogeneous single-mode 37-core fiber with a cladding diameter of 248 μm is designed and fabricated. The fiber provides the highest core count and low total-crosstalk less than −20 dB/1000 km in C+L band.......A heterogeneous single-mode 37-core fiber with a cladding diameter of 248 μm is designed and fabricated. The fiber provides the highest core count and low total-crosstalk less than −20 dB/1000 km in C+L band....

  4. 7 CFR 248.8 - Level of benefits and eligible foods.

    Science.gov (United States)

    2010-01-01

    ... State Plan the fresh, nutritious, unprepared, locally grown fruits, vegetables and herbs which are... 248.8 Agriculture Regulations of the Department of Agriculture (Continued) FOOD AND NUTRITION SERVICE, DEPARTMENT OF AGRICULTURE CHILD NUTRITION PROGRAMS WIC FARMERS' MARKET NUTRITION PROGRAM (FMNP) Recipient...

  5. 17 CFR 248.125 - Reasonable and simple methods of opting out.

    Science.gov (United States)

    2010-04-01

    ... COMMISSION (CONTINUED) REGULATIONS S-P AND S-AM Regulation S-AM: Limitations on Affiliate Marketing § 248.125... consumer that you receive from an affiliate to make a marketing solicitation to the consumer about your... the GLBA privacy, FCRA affiliate sharing, and FCRA affiliate marketing opt outs, by a single method...

  6. 17 CFR 248.128 - Effective date, compliance date, and prospective application.

    Science.gov (United States)

    2010-04-01

    ... Affiliate Marketing § 248.128 Effective date, compliance date, and prospective application. (a) Effective... subpart do not prohibit you from using eligibility information that you receive from an affiliate to make a marketing solicitation to a consumer if you receive such information prior to January 1, 2010. For...

  7. 17 CFR 248.123 - Contents of opt out notice; consolidated and equivalent notices.

    Science.gov (United States)

    2010-04-01

    ... EXCHANGE COMMISSION (CONTINUED) REGULATIONS S-P AND S-AM Regulation S-AM: Limitations on Affiliate Marketing § 248.123 Contents of opt out notice; consolidated and equivalent notices. (a) Contents of opt out...) The name of the affiliate(s) providing the notice. If the notice is provided jointly by multiple...

  8. 43 CFR 2.48 - Standards for maintenance of records subject to the Act.

    Science.gov (United States)

    2010-10-01

    ... information from the individual is unreasonable when compared with the cost of collecting it from a third... whether disclosure of such information is mandatory or voluntary; (ii) The principal purpose or purposes... RECORDS AND TESTIMONY; FREEDOM OF INFORMATION ACT Privacy Act § 2.48 Standards for maintenance of records...

  9. Cold valleys in the radioactive decay of 248−254Cf isotopes

    Indian Academy of Sciences (India)

    Abstract. Based on the concept of cold valley in cold fission and fusion, we have in- vestigated the cluster decay process in 248−254Cf isotopes. In addition to alpha particle minima, other deep minima occur for S, Ar and Ca clusters. It is found that inclusion of proximity potential does not change the position of minima but ...

  10. 17 CFR 248.12 - Limits on sharing account number information for marketing purposes.

    Science.gov (United States)

    2010-04-01

    ... Financial Information and Safeguarding Personal Information Limits on Disclosures § 248.12 Limits on sharing... affinity or similar program where the participants in the program are identified to the customer when the customer enters into the program. (c) Example—Account number. An account number, or similar form of access...

  11. 17 CFR 248.6 - Information to be included in privacy notices.

    Science.gov (United States)

    2010-04-01

    ... Safeguarding Personal Information Privacy and Opt Out Notices § 248.6 Information to be included in privacy...; (4) The categories of nonpublic personal information about your former customers that you disclose... personal information about your former customers, other than those parties to whom you disclose information...

  12. 17 CFR 248.9 - Delivering privacy and opt out notices.

    Science.gov (United States)

    2010-04-01

    ... Safeguarding Personal Information Privacy and Opt Out Notices § 248.9 Delivering privacy and opt out notices... reasonably expect that a customer will receive actual notice of your annual privacy notice if: (i) The customer uses your web site to access financial products and services electronically and agrees to receive...

  13. 17 CFR 248.7 - Form of opt out notice to consumers; opt out methods.

    Science.gov (United States)

    2010-04-01

    ... Safeguarding Personal Information Privacy and Opt Out Notices § 248.7 Form of opt out notice to consumers; opt... the consumer revokes it in writing or, if the consumer agrees, electronically. (2) When a customer relationship terminates, the customer's opt out direction continues to apply to the nonpublic personal...

  14. 17 CFR 248.122 - Scope and duration of opt out.

    Science.gov (United States)

    2010-04-01

    ... (CONTINUED) REGULATIONS S-P AND S-AM Regulation S-AM: Limitations on Affiliate Marketing § 248.122 Scope and... information received from another affiliate as described in the notice to make marketing solicitations to the consumer. (2) Continuing relationship—(i) In general. If the consumer establishes a continuing relationship...

  15. 17 CFR 248.121 - Affiliate marketing opt out and exceptions.

    Science.gov (United States)

    2010-04-01

    ... business relationship with the consumer. (b) Making marketing solicitations—(1) In general. For purposes of... 17 Commodity and Securities Exchanges 3 2010-04-01 2010-04-01 false Affiliate marketing opt out... COMMISSION (CONTINUED) REGULATIONS S-P AND S-AM Regulation S-AM: Limitations on Affiliate Marketing § 248.121...

  16. 31 CFR 248.5 - Exception to requirement of undertaking of indemnity Form 2244.

    Science.gov (United States)

    2010-07-01

    ... 31 Money and Finance: Treasury 2 2010-07-01 2010-07-01 false Exception to requirement of... POSSESSIONS Action to Be Taken by Claimants § 248.5 Exception to requirement of undertaking of indemnity Form... and agents, of and from any and all liability, loss, expense, claim, and demand whatsoever, arising in...

  17. Cold valleys in the radioactive decay of 248-254 Cf isotopes

    Indian Academy of Sciences (India)

    Based on the concept of cold valley in cold fission and fusion, we have investigated the cluster decay process in 248-254Cf isotopes. In addition to alpha particle minima, other deep minima occur for S, Ar and Ca clusters. It is found that inclusion of proximity potential does not change the position of minima but minima ...

  18. 49 CFR 24.8 - Compliance with other laws and regulations.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 1 2010-10-01 2010-10-01 false Compliance with other laws and regulations. 24.8... other laws and regulations. The implementation of this part must be in compliance with other applicable Federal laws and implementing regulations, including, but not limited to, the following: (a) Section I of...

  19. Organic nanostructures on silicon, created with semitransparent polystyrene spheres and 248 nm laser pulses

    International Nuclear Information System (INIS)

    Rothe, Erhard W; Manke, Charles W; Piparia, Reema; Baird, Ronald J

    2008-01-01

    Arrays of nanostructures are made starting with a template of close-packed, polystyrene spheres on a silicon surface. The spheres are either 1.091 or 2.99 μm in diameter (d) and are of polystyrene (PS). They are irradiated with a pulse of either 308 or 248 nm light to which they are transparent and semitransparent, respectively. A transparent sphere with d = 1.091 μm diameter concentrates incident light onto a small substrate area. As has been previously reported, that creates silicon nanobumps that rise from circular craters. At 248 nm and d = 2.99 μm, the light energy is mainly absorbed, destroys the sphere, and leaves a shrunken mass (typically about 500 nm wide and 100 nm high) of organic material that is probably polystyrene and its thermal degradation products. At 248 nm and d = 1.091 μm, the residual organic structures are on the order of 300 nm wide and 100 nm high. A distinctive feature is that these organic structures are connected by filaments that are on the order of 50 nm wide and 10 nm high. Filaments form because the close-packed PS spheres expand into each other during the early part of the laser pulse, and then, as the main structures shrink, their viscoelasticity leads to threads between them. Our results with 248 nm and d = 1.091 μm differ from those described by Huang et al with 248 nm and d = 1.0 μm. Future studies might include the further effect of wavelength and fluence upon the process as well the use of other materials and the replacement of nanospheres by other focusing shapes, such as ellipsoids or rods

  20. 17 CFR 248.30 - Procedures to safeguard customer records and information; disposal of consumer report information.

    Science.gov (United States)

    2010-04-01

    ... customer records and information; disposal of consumer report information. 248.30 Section 248.30 Commodity... any customer. (b) Disposal of consumer report information and records—(1) Definitions (i) Consumer... Regulation S-P: Privacy of Consumer Financial Information and Safeguarding Personal Information Relation to...

  1. PCR-RFLP to Detect Codon 248 Mutation in Exon 7 of "p53" Tumor Suppressor Gene

    Science.gov (United States)

    Ouyang, Liming; Ge, Chongtao; Wu, Haizhen; Li, Suxia; Zhang, Huizhan

    2009-01-01

    Individual genome DNA was extracted fast from oral swab and followed up with PCR specific for codon 248 of "p53" tumor suppressor gene. "Msp"I restriction mapping showed the G-C mutation in codon 248, which closely relates to cancer susceptibility. Students learn the concepts, detection techniques, and research significance of point mutations or…

  2. Study on damage of K9 glass under 248nm ultraviolet pulsed laser irradiation

    Science.gov (United States)

    Wang, Xi; Fang, Xiaodong

    2015-04-01

    The damage of K9 glass under 248nm ultraviolet pulsed laser irradiation was studied. The laser pulse energy was kept within the range of 60mJ to 160mJ, and the repetition rate was adjusted within the range of 1Hz to 40Hz. The damage morphologies of single-pulse and multi-pulse laser irradiation were characterized by optical microscope, and the damage mechanism was discussed. The experimental results indicated that the damage of K9 glass irradiated by 248nm ultraviolet laser mainly followed the thermal-mechanical coupling mechanism and the damage threshold of K9 glass was 2.8J/cm2. The intensity of damage area increased gradually with the increase of the laser pulse number. It was shown that accumulation effect of laser induced damage to K9 glass was obvious.

  3. 29 CFR 779.248 - Purchase or receive “goods for resale.”

    Science.gov (United States)

    2010-07-01

    ... section 3(s)(1) of the prior Act if they are purchased or received with the intention of being resold... purchased or received by the enterprise with the intention of reselling them in the same form or after... 29 Labor 3 2010-07-01 2010-07-01 false Purchase or receive âgoods for resale.â 779.248 Section 779...

  4. Phase-shifted Bragg grating inscription in PMMA microstructured POF using 248 nm UV radiation

    OpenAIRE

    Pereira, L.; Pospori, A.; Antunes, Paulo; Domingues, Maria Fatima; Marques, S.; Bang, Ole; Webb, David J.; Marques, Carlos A.F.

    2017-01-01

    In this work we experimentally validate and characterize the first phase-shifted polymer optical fiber Bragg gratings (PS-POFBGs) produced using a single pulse from a 248 nm krypton fluoride laser. A single-mode poly (methyl methacrylate) optical fiber with a core doped with benzyl dimethyl ketal for photosensitivity improvement was used. A uniform phase mask customized for 850 nm grating inscription was used to inscribe these Bragg structures. The phase shift defect was created directly duri...

  5. Spatial structure of oligopeptide PAP(248-261), the N-terminal fragment of the HIV enhancer prostatic acid phosphatase peptide PAP(248-286), in aqueous and SDS micelle solutions

    Science.gov (United States)

    Blokhin, Dmitriy S.; Filippov, Andrei V.; Antzutkin, Oleg N.; Karataeva, Farida Kh.; Klochkov, Vladimir V.

    2014-07-01

    Prostatic acid phosphatase (PAP) is an enzyme that facilitates infection of cells by HIV. Its peptide fragment PAP(248-286) forms amyloid fibrils known as SEVI, which enhance attachment of the virus by viral adhesion to the host cell prior to receptor-specific binding via reducing the electrostatic repulsion between the membranes of the virus and the target cell. The secondary structure of PAP(248-286) in aqueous and SDS solutions can be divided into an N-terminal disordered region, an α-helical central part and an α/310-helical C-terminal region (Nanga et al., 2009). In this work, we used NMR spectroscopy to study the spatial structure of the isolated N-terminal fragment of PAP(248-286), PAP(248-261) (GIHKQKEKSRLQGG), in aqueous and SDS micelle solutions. Formation of a PAP(248-261)-SDS complex was confirmed by chemical shift alterations in the 1H NMR spectra of the peptide, as well as by the signs and values of Nuclear Overhauser Effect (NOE). In addition, the PAP(248-261) peptide does not form any specified secondary structure in either aqueous or SDS solutions.

  6. Damage thresholds of thin film materials and high reflectors at 248 nm

    Energy Technology Data Exchange (ETDEWEB)

    Rainer, F.; Lowdermilk, W.H.; Milam, D.; Carniglia, C.K.; Hart, T.T.; Lichtenstein, T.L.

    1982-01-01

    Twenty-ns, 248-nm KrF laser pulses were used to measure laser damage thresholds for halfwave-thick layers of 15 oxide and fluoride coating materials, and for high reflectance coatings made with 13 combinations of these materials. The damage thresholds of the reflectors and single-layer films were compared to measurements of several properties of the halfwave-thick films to determine whether measurements of these properties of single-layer films to determine whether measurements of these properties of single-layer films were useful for identifying materials for fabrication of damage resistant coatings.

  7. Confirmed results of the 248Cm(48Ca,4n)292116 experiment

    International Nuclear Information System (INIS)

    Patin, J B; Moody, K J; Stoyer, M A; Wild, J F; Shaughnessy, D A; Stoyer, N J

    2003-01-01

    The results of a detailed analysis performed on the data obtained in the 248 Cm( 48 Ca,4n) 292 116 reaction is presented. This analysis is independent of the original data analysis performed in Dubna in which three separate decay chains were found. Each decay chain began with an evaporation residue followed by three α decays and ended in a spontaneous fission event, all correlated in time and position. The analysis presented confirms that the three events are present in the data. A summary of the three events will be given as well as a description of the analysis performed

  8. Search for superheavy elements in the bombardment of 248Cm with 48Ca

    International Nuclear Information System (INIS)

    Hulet, E.K.; Lougheed, R.W.; Wild, J.F.; Landrum, J.H.; Stevenson, P.C.; Ghiorso, A.; Nitschke, J.M.; Otto, R.J.; Morrissey, D.J.; Baisden, P.A.; Gavin, B.F.; Lee, D.; Silva, R.J.; Fowler, M.M.; Seaborg, G.T.

    1977-01-01

    We have searched for superheavy elements 110 to 116 with half-lives between 10 4 and 10 8 s in fractions chemically separated after each of a series of bombardments of 248 Cm made with 267-MeV 48 Ca ions. After 6 months of α and spontaneous-fission counting, our results provide no persuasive evidence for the presence of super-heavy elements. The most plausible explanation for not finding the superheavy elements is that they have either short half-lives or very small formation cross sections

  9. Development of damage-resistant sputtered-oxide optical coatings for use at 248 NM

    International Nuclear Information System (INIS)

    Pawlewicz, W.T.; Martin, P.M.; Hays, D.D.; Mann, I.B.

    1981-10-01

    This report summarizes the results of a six-month effort to develop damage-resistant Kr*F laser mirrors by using and refining reactive sputter deposition techniques for the fabricaton of multilayer oxide optical coatings. Mirror performance goals included a reflectivity of 99% at 248 nm and a laser damage threshold of 5 J/cm 2 for 20 ns pulses. Oxide multilayer coating combinations selected for development were SiO 2 /Al 2 O 3 , SiO 2 /HfO 2 and SiO 2 /Y 2 O 3 . Selection was based on review and compilation of the optical properties of oxide materials reported in the recent literature. Twenty-eight coatings of selected designs were fabricated on LLNL substrates for laser damage testing by LLNL. Forty other coatings were fabricated on PNL substrates for optical, microstructural and topographical characterization by PNL aimed at optimization of their performance. Specimens for damage testing consisted of single layers of Al 2 O 3 , HfO 2 and Y 2 O 3 in thicknesses of lambda/2, 3lambda/2 and 2lambda at 248 nm plus high reflectors of the design LL (HL)/sup m/ HLL

  10. Development of damage resistant sputtered oxide optical coatings for use at 248 NM

    Energy Technology Data Exchange (ETDEWEB)

    Pawlewicz, W.T.; Martin, P.M.; Hays, D.D.; Mann, I.B.

    1981-10-01

    This report summarizes the results of a six-month effort to develop damage-resistant Kr*F laser mirrors by using and refining reactive sputter deposition techniques for the fabricaton of multilayer oxide optical coatings. Mirror performance goals included a reflectivity of 99% at 248 nm and a laser damage threshold of 5 J/cm/sup 2/ for 20 ns pulses. Oxide multilayer coating combinations selected for development were SiO/sub 2//Al/sub 2/O/sub 3/, SiO/sub 2//HfO/sub 2/ and SiO/sub 2//Y/sub 2/O/sub 3/. Selection was based on review and compilation of the optical properties of oxide materials reported in the recent literature. Twenty-eight coatings of selected designs were fabricated on LLNL substrates for laser damage testing by LLNL. Forty other coatings were fabricated on PNL substrates for optical, microstructural and topographical characterization by PNL aimed at optimization of their performance. Specimens for damage testing consisted of single layers of Al/sub 2/O/sub 3/, HfO/sub 2/ and Y/sub 2/O/sub 3/ in thicknesses of lambda/2, 3lambda/2 and 2lambda at 248 nm plus high reflectors of the design LL (HL)/sup m/ HLL.

  11. [Dental implant restoration in 248 patients with periodontal disease and type 2 diabetes].

    Science.gov (United States)

    Wu, Da-yi; Li, Gang; Zhang, Qing; Teng, Li-zhao; Lu, Huan-you

    2011-11-01

    To discuss the risk and strategy of dental implantation in patients with periodontal disease and type 2 diabetes. Retrospective analysis was performed of dental implantation results in 248 patients with periodontal disease and type 2 diabetes from 2000 to 2008. The survival rate was evaluated and the data statistically analyzed. The Nobel implant system and CDIC implant system were used. The operation applied flapless and bone expanding techniques. A total of 1190 implants were inserted (333 Nobel Replace implants and 857 CDIC implants). 0.5% (6 implants) lost during the first 6 months healing stage. The 1-year, 5-year and 8-year survival rate were 98.4% (1165/1184), 95.3% (487/511) and 89.2% (91/102) respectively. The patients with periodontal disease and type 2 diabetes are suitable for implant treatment with satisfactory results under the conditions that the indication and risk factors are evaluated and controlled strictly.

  12. Phase-shifted Bragg grating inscription in PMMA microstructured POF using 248 nm UV radiation

    DEFF Research Database (Denmark)

    Pereira, L.; Pospori, A.; Antunes, Paulo

    2017-01-01

    In this work we experimentally validate and characterize the first phase-shifted polymer optical fiber Bragg gratings (PS-POFBGs) produced using a single pulse from a 248 nm krypton fluoride laser. A single-mode poly (methyl methacrylate) optical fiber with a core doped with benzyl dimethyl ketal...... for photosensitivity improvement was used. A uniform phase mask customized for 850 nm grating inscription was used to inscribe these Bragg structures. The phase shift defect was created directly during the grating inscription process by placing a narrow blocking aperture in the center of the UV beam. The produced high......-quality Bragg grating structures, presenting a double dips, reject 16.3 dB (97.6% reflectivity) and 13.2 dB (95.2% reflectivity) of the transmitted power, being therefore appropriate for sensing or other photonic applications. Its transmission spectrum possesses two sharp transmission notches, allowing...

  13. A systematic study of actinide production from the interactions of heavy ions with sup 248 Cm

    Energy Technology Data Exchange (ETDEWEB)

    Leyba, J.D.

    1990-09-07

    Production cross sections for heavy actinides produced from the interactions of {sup 12}C, {sup 31}P, {sup 40}Ar, and {sup 44}Ca ions with {sup 248}Cm were measured at energies ranging from 0.98 to 1.35 X Coulomb barrier. The recoiling reaction products were collected in copper or gold catcher foils located near the {sup 248}Cm target. Separate fractions of Bk, Cf, Es, Fm, and Md were obtained from a radiochemical separation procedure. For the {sup 12}C system, a He/KCl jet was used to transport the recoiling No activities of interest to a rotating wheel system. The isotopic distributions of the actinide products were found to be essentially symmetric about the maximum with full-widths-at-half-maximum of approximately 2.5 mass units. Isotopic distributions of the {sup 12}C, {sup 31}P, {sup 40}Ar, and {sup 44}Ca systems were found to be very similar to the {sup 40,48}Ca systems studied previously. The maxima of the isotopic distributions generally occurred for those reaction channels which involved the exchange of the fewest number of nucleons between the target and projectile for which the calculated excitation energy was a positive quantity. Additionally, the maxima of the excitation functions occurred at those projectile energies which were consistent with the calculated reaction barriers based upon a binary reaction mechanism. The experimental data from the four systems investigated were compared to several models of heavy ion interactions including a damped reaction mechanism, compound nucleus formation and subsequent particle evaporation, and classical partial wave calculations for binary systems.

  14. Fast and stable gratings inscription in POFs made of different materials with pulsed 248 nm KrF laser

    DEFF Research Database (Denmark)

    Marques, C. A.F.; Min, R.; Leal, A.

    2018-01-01

    This paper presents fiber Bragg grating (FBG) inscription with a pulsed 248 nm UV KrF laser in polymer optical fibers (POFs) made of different polymers, namely polymethyl methacrylate (PMMA), cyclic-olefin polymer and co-polymer, and Polycarbonate. The inscribed gratings and the corresponding...

  15. Evidence for a novel O-linked sialylated trisaccharide on Ser-248 of human plasminogen 2.

    Science.gov (United States)

    Pirie-Shepherd, S R; Stevens, R D; Andon, N L; Enghild, J J; Pizzo, S V

    1997-03-14

    Human plasminogen, the inactive precursor of plasmin, exists in two major glycoforms. Plasminogen 1 contains an N-linked oligosaccharide at Asn-289 and an O-linked oligosaccharide at Thr-345. Plasminogen 2 is known to contain only an O-linked oligosaccharide at Thr-345. However, plasminogen 2 displays a further well documented microheterogeneity dependent on the N-acetylneuraminic acid content, which has functional consequences with regard to activation of plasminogen. The proposed structure and number of known oligosaccharide linkages in plasminogen 2 is insufficient to account for this microheterogeneity. In the present study, a combination of trypsin digestion, lectin affinity chromatography, Edman degradation amino acid sequence analysis, carbohydrate composition analysis, and mass spectrometry revealed the existence of a novel site for O-linked glycosylation on plasminogen 2 at Ser-248. Direct evidence for the structure of the carbohydrate was obtained from a combination of lectin affinity chromatography, desialylation experiments, and mass spectrometry analysis. These findings provide a structural basis for some of the observed microheterogeneity, and have implications with regard to the known functional consequences of the extent of sialylation of plasminogen.

  16. Laser-damage thresholds of thin-film optical coatings at 248 nm

    Energy Technology Data Exchange (ETDEWEB)

    Milam, D.; Rainer, F.; Lowdermilk, W.H.

    1981-12-11

    We have measured the laser-induced damage thresholds for 248 nm wavelength light of over 100 optical coatings from commercial vendors and research institutions. All samples were irradiated once per damage site with temporally multi-lobed, 20-ns pulses generated by a KrF laser. The survey included high, partial, and dichroic reflectors, anti-reflective coatings, and single layer films. The samples were supplied by ten vendors. The majority of samples tested were high reflectors and antireflective coatings. The highest damage thresholds were 8.5 to 9.4 J/cm/sup 2/, respectively. Although these represent extremes of what has been tested so far, several vendors have produced coatings of both types with thresholds which consistently exceed 6 J/cm/sup 2/. Repeated irradiations of some sites were made on a few samples. These yielded no degradation in threshold, but in fact some improvement in damage resistance. These same samples also exhibited no change in threshold after being retested seven months later.

  17. Photodissociation of dibromoethanes at 248 nm: An ignored channel of Br2 elimination

    Science.gov (United States)

    Lee, Hsin-Lung; Lee, Ping-Chen; Tsai, Po-Yu; Lin, King-Chuen; Kuo, H. H.; Chen, P. H.; Chang, A. H. H.

    2009-05-01

    Br2 molecular elimination is probed in the photodissociation of 1,1- and 1,2-C2H4Br2 isomeric forms at 248 nm by using cavity ring-down absorption spectroscopy. Their photodissociation processes differ markedly from each other. The quantum yield of the Br2 fragment in 1,2-dibromoethane is 0.36±0.18, in contrast to a value of 0.05±0.03 in 1,1-dibromoethane. The vibrational population ratios of Br2(v=1)/Br2(v =0) are 0.8±0.1 and 0.5±0.2 for 1,2- and 1,1-dibromoethanes, respectively. The Br2 yield densities are found to increase by a factor of 35% and 190% for 1,2- and 1,1-dibromoethanes within the same temperature increment. In the ab initio potential energy calculations, the transition state (TS) along the adiabatic ground state surface may correlate to the Br2 products. The TS energy for 1,2-dibromoethane is well below the excitation energy at 483 kJ/mol, whereas that for 1,1-dibromoethane is slightly above. Such a small TS energy barrier impedes the photodissociation of the ground state 1,1-dibromoethane such that the production yield of Br2 may become relatively low, but rise rapidly with the temperature. The TS structure shows a larger bond distance of Br-Br in 1,2-dibromoethane than that in 1,1-dibromoethane. That explains why the former isomer may result in hotter vibrational population of the Br2 fragments.

  18. Photodissociation of dibromoethanes at 248 nm: An ignored channel of Br2 elimination

    International Nuclear Information System (INIS)

    Lee, Hsin-Lung; Lee, Ping-Chen; Tsai, Po-Yu; Lin, King-Chuen; Kuo, H. H.; Chen, P. H.; Chang, A. H. H.

    2009-01-01

    Br 2 molecular elimination is probed in the photodissociation of 1,1- and 1,2-C 2 H 4 Br 2 isomeric forms at 248 nm by using cavity ring-down absorption spectroscopy. Their photodissociation processes differ markedly from each other. The quantum yield of the Br 2 fragment in 1,2-dibromoethane is 0.36±0.18, in contrast to a value of 0.05±0.03 in 1,1-dibromoethane. The vibrational population ratios of Br 2 (v=1)/Br 2 (v=0) are 0.8±0.1 and 0.5±0.2 for 1,2- and 1,1-dibromoethanes, respectively. The Br 2 yield densities are found to increase by a factor of 35% and 190% for 1,2- and 1,1-dibromoethanes within the same temperature increment. In the ab initio potential energy calculations, the transition state (TS) along the adiabatic ground state surface may correlate to the Br 2 products. The TS energy for 1,2-dibromoethane is well below the excitation energy at 483 kJ/mol, whereas that for 1,1-dibromoethane is slightly above. Such a small TS energy barrier impedes the photodissociation of the ground state 1,1-dibromoethane such that the production yield of Br 2 may become relatively low, but rise rapidly with the temperature. The TS structure shows a larger bond distance of Br-Br in 1,2-dibromoethane than that in 1,1-dibromoethane. That explains why the former isomer may result in hotter vibrational population of the Br 2 fragments.

  19. Photodissociation of dibromoethanes at 248 nm: an ignored channel of Br2 elimination.

    Science.gov (United States)

    Lee, Hsin-Lung; Lee, Ping-Chen; Tsai, Po-Yu; Lin, King-Chuen; Kuo, H H; Chen, P H; Chang, A H H

    2009-05-14

    Br(2) molecular elimination is probed in the photodissociation of 1,1- and 1,2-C(2)H(4)Br(2) isomeric forms at 248 nm by using cavity ring-down absorption spectroscopy. Their photodissociation processes differ markedly from each other. The quantum yield of the Br(2) fragment in 1,2-dibromoethane is 0.36+/-0.18, in contrast to a value of 0.05+/-0.03 in 1,1-dibromoethane. The vibrational population ratios of Br(2)(v=1)/Br(2)(v=0) are 0.8+/-0.1 and 0.5+/-0.2 for 1,2- and 1,1-dibromoethanes, respectively. The Br(2) yield densities are found to increase by a factor of 35% and 190% for 1,2- and 1,1-dibromoethanes within the same temperature increment. In the ab initio potential energy calculations, the transition state (TS) along the adiabatic ground state surface may correlate to the Br(2) products. The TS energy for 1,2-dibromoethane is well below the excitation energy at 483 kJ/mol, whereas that for 1,1-dibromoethane is slightly above. Such a small TS energy barrier impedes the photodissociation of the ground state 1,1-dibromoethane such that the production yield of Br(2) may become relatively low, but rise rapidly with the temperature. The TS structure shows a larger bond distance of Br-Br in 1,2-dibromoethane than that in 1,1-dibromoethane. That explains why the former isomer may result in hotter vibrational population of the Br(2) fragments.

  20. Predictors of survival in posterior cricoid squamous cell carcinoma: A study of 248 cases.

    Science.gov (United States)

    Din, Hassieb A; Zhan, Kevin Y; Boling, Caitlin; Nguyen, Shaun; Lentsch, Eric J

    2017-05-01

    We aimed to describe the presentation, treatment patterns, and survival characteristics of posterior cricoid squamous cell carcinoma (SCC) with the National Cancer Database (NCDB). Retrospective database review. We reviewed the NCDB from 2004 to 2013. Primary, previously untreated cases of posterior cricoid SCC were studied. Cox regression analysis was performed to look for prognostic factors. Out of 14,416 hypopharyngeal malignancies, 269 (1.8%) posterior cricoid tumors were identified, of which 248 (92.2%) were SCC. Mean age at diagnosis was 65 years (range 20-90+). Most patients were Caucasian (74.7%) and male (77.1%). By presentation, 58% were classified as clinical stage tumor (cT) 3 or cT4 to cT4 disease and 57.4% were clinical node (cN) +. Radiation (RT) alone was the most common form of treatment (32.1%), followed by chemoradiation (CRT) (31.7%) and surgery plus RT (7.4%). Overall 5- and 10-year survival was 25% and 19%, respectively. Significant prognostic factors include overall clinical stage III to IV (hazard ratio [HR] 1.8 [95% confidence interval (CI) 1.15-2.82], P = 0.011), clinical nodal disease (HR 1.54 [95% CI 1.10-2.15], P = 0.012), and Charlson/Deyo comorbidity score > 1 (HR 1.94 [95% CI 1.14-3.29], P = 0.014) on univariate analysis. Posterior cricoid SCCs are rare hypopharyngeal malignancies with a poor prognosis. They typically present at late stage with nodal metastasis and are most commonly treated nonsurgically with primary RT or CRT. Increasing clinical stage, comorbidity, and nodal disease are associated with worse survival. 4. Laryngoscope, 127:1093-1096, 2017. © 2016 The American Laryngological, Rhinological and Otological Society, Inc.

  1. Spectroscopy of neutron-rich nuclei populated in the spontaneous fission of 252Cf and 248Cm

    International Nuclear Information System (INIS)

    Smith, A. G.; Simpson, G. S.; Billowes, J.; Durell, J. L.; Phillips, W. R.; Dagnall, P. J.; Freeman, S. J.; Leddy, M.; Roach, A. A.; Smith, J. F.

    1999-01-01

    In this paper we present research that has been carried out using the Euroball and Eurogam arrays to detect γ rays emitted from spontaneously fissioning 248 Cm and 252 Cf. The paper focuses on three sub-areas of current activity, namely, the measurement of yields of secondary fragment pairs, the measurement of state lifetimes at around spin 10, and recent measurements of g-factors of excited states in fission fragments. (c) 1999 American Institute of Physics

  2. Photosensitivity of the Er/Yb-Codoped Schott IOG1 Phosphate Glass Using 248 nm, Femtosecond, and Picosecond Laser Radiation

    International Nuclear Information System (INIS)

    Pissadakis, S.; Michelakaki, I.

    2009-01-01

    The effect of 248 nm laser radiation, with pulse duration of 5 picoseconds, 500 femtosecond, and 120 femtosecond, on the optical properties and the Knoop hardness of a commercial Er/Yb-codoped phosphate glass is presented here. Refractive index changes of the order of few parts of 10-4 are correlated with optical absorption centers induced in the glass volume, using Kramers-Kroning relationship. Accordingly, substantially lower refractive index changes are measured in volume Bragg gratings inscribed in the glass, indicating that, in addition to the optical density changes, volume dilation changes of negative sign may also be associated with the 248 nm ultrafast irradiation. The Knoop hardness experimental results reveal that the glass matrix undergoes an observable initial hardening and then a reversing softening and volume dilation process for modest accumulated energy doses, where the Knoop hardness follows a nonmonotonic trend. Comparative results on the Knoop hardness trend are also presented for the case of 193 nm excimer laser radiation. The above findings denote that the positive or negative evolution of refractive index changes induced by the 248 0nm ultrafast radiation in the glass is dominated by the counteraction of the color center formation and the volume modification effects.

  3. A Compact Group of Galaxies at z = 2.48 Hosting an AGN-driven Outflow

    Science.gov (United States)

    Shih, Hsin-Yi; Stockton, Alan

    2015-12-01

    We present observations of a remarkable compact group of galaxies at z = 2.48. Four galaxies, all within 40 kpc of each other, surround a powerful high-redshift radio source. This group comprises two compact red passive galaxies and a pair of merging galaxies. One of the red galaxies, with an apparent stellar mass of 3.6 × 1011M⊙ and an effective radius of 470 pc, is one of the most extreme examples of a massive quiescent compact galaxy found so far. One of the pair of merging galaxies hosts the active galactic nucleus (AGN) producing the large powerful radio structure. The merger is massive and enriched, consistent with the mass-metallicity relation expected at this redshift. Close to the merging nuclei, the emission lines exhibit broad and asymmetric profiles that suggest outflows powered either by a very young expanding radio jet or by AGN radiation. At ≳50 kpc from the system, we found a fainter extended-emission region that may be a part of a radio-jet-driven outflow. Some of the data presented herein were obtained at the W. M. Keck Observatory, which is operated as a scientific partnership among the California Institute of Technology, the University of California, and the National Aeronautics and Space Administration. The Observatory was made possible by the generous financial support of the W. M. Keck Foundation. The work is also based, in part, on data collected at the Subaru Telescope, which is operated by the National Astronomical Observatory of Japan, and on observations obtained at the Gemini Observatory, which is operated by the Association of Universities for Research in Astronomy, Inc., under a cooperative agreement with the NSF on behalf of the Gemini partnership: the National Science Foundation (United States), the National Research Council (Canada), CONICYT (Chile), the Australian Research Council (Australia), Ministério da Ciência, Tecnologia e Inovação (Brazil), and Ministerio de Ciencia, Tecnología e Innovación Productiva (Argentina).

  4. Search for surviving actinides and superheavy nuclei in damped collisions of 238U with 238U and 248Cm

    International Nuclear Information System (INIS)

    Kratz, J.V.

    1980-03-01

    In the present talk aspects of the reaction mechanism related to the survival probability of the heaviest fragments in 238 U + 238 U collisions are discussed first. This is followed by a description of the experiments that have been performed to search for surviving superheavy fragments in the 238 U + 238 U reaction and by a presentation of the results obtained so far. In a third section our recent first attempts with the 238 U + 248 Cm reaction are described and preliminary results are discussed. (orig.)

  5. A Peptide Derived from the HIV-1 gp120 Coreceptor-Binding Region Promotes Formation of PAP248-286 Amyloid Fibrils to Enhance HIV-1 Infection.

    Directory of Open Access Journals (Sweden)

    Jinquan Chen

    Full Text Available Semen is a major vehicle for HIV transmission. Prostatic acid phosphatase (PAP fragments, such as PAP248-286, in human semen can form amyloid fibrils to enhance HIV infection. Other endogenous or exogenous factors present during sexual intercourse have also been reported to promote the formation of seminal amyloid fibrils.Here, we demonstrated that a synthetic 15-residue peptide derived from the HIV-1 gp120 coreceptor-binding region, designated enhancing peptide 2 (EP2, can rapidly self-assemble into nanofibers. These EP2-derivated nanofibers promptly accelerated the formation of semen amyloid fibrils by PAP248-286, as shown by Thioflavin T (ThT and Congo red assays. The amyloid fibrils presented similar morphology, assessed via transmission electron microscopy (TEM, in the presence or absence of EP2. Circular dichroism (CD spectroscopy revealed that EP2 accelerates PAP248-286 amyloid fibril formation by promoting the structural transition of PAP248-286 from a random coil into a cross-β-sheet. Newly formed semen amyloid fibrils effectively enhanced HIV-1 infection in TZM-bl cells and U87 cells by promoting the binding of HIV-1 virions to target cells.Nanofibers composed of EP2 promote the formation of PAP248-286 amyloid fibrils and enhance HIV-1 infection.

  6. Operational tests of the BNL 24.8 kW, 3.80K helium refrigerator

    International Nuclear Information System (INIS)

    Brown, D.P.; Farah, Y.; Gibbs, R.J.; Schlafke, A.P.; Sondericker, J.H.

    1986-01-01

    The BNL 24.8 kW refrigeration system is completely installed and major portions of the acceptance tests have been completed. So far, the equipment tested has performed at or above design levels. The room temperature helium compressor station has been completely tested and accepted. The two-stage oil injected screw compressor system exhibited an isothermal efficiency of 57% while delivering a helium flow in excess of 4400 g/s. Data on the performance of the make-up gas cryogenic purifier is also given. The refrigerator turbomachinery, 13 expanders and three cold compressors, has been tested at room temperature for mechanical integrity and control stability. The first cooldown to operating temperature will be attempted in late August, 1985

  7. Operational tests of the BNL 24.8 kW, 3.8 K helium refrigerator

    International Nuclear Information System (INIS)

    Brown, D.P.; Farah, Y.; Gibbs, R.J.

    1985-01-01

    The BNL 24.8 kW refrigeration system is completely installed and major portions of the acceptance tests have been completed. So far, the equipment tested has performed at or above design levels. The room temperature helium compressor station has been completely tested and accepted. The two-stage oil injected screw compressor system exhibited an isothermal efficiency of 57% while delivering a helium flow in excess of 4400 g/s. Data on the performance of the make-up gas cryogenic purifier is given. The refrigerator turbomachinery, 13 expanders and three cold compressors, has been tested at room temperature for mechanical integrity and control stability. The first cooldown to operating temperature will be attempted in late August, 1985. 2 refs., 5 figs

  8. Photodissociation dynamics of the simplest alkyl peroxy radicals, CH3OO and C2H5OO, at 248 nm

    Science.gov (United States)

    Sullivan, Erin N.; Nichols, Bethan; Neumark, Daniel M.

    2018-01-01

    The photodissociation dynamics of the simplest alkyl peroxy radicals, methyl peroxy (CH3OO) and ethyl peroxy (C2H5OO), are investigated using fast beam photofragment translational spectroscopy. A fast beam of CH3OO- or C2H5OO- anions is photodetached to generate neutral radicals that are subsequently dissociated using 248 nm photons. The coincident detection of the photofragment positions and arrival times allows for the determination of mass, translational energy, and angular distributions for both two-body and three-body dissociation events. CH3OO exhibits repulsive O loss resulting in the formation of O(1D) + CH3O with high translational energy release. Minor two-body channels leading to OH + CH2O and CH3O + O(3P) formation are also detected. In addition, small amounts of H + O(3P) + CH2O are observed and attributed to O loss followed by CH3O dissociation. C2H5OO exhibits more complex dissociation dynamics, in which O loss and OH loss occur in roughly equivalent amounts with O(1D) formed as the dominant O atom electronic state via dissociation on a repulsive surface. Minor two-body channels leading to the formation of O2 + C2H5 and HO2 + C2H4 are also observed and attributed to a ground state dissociation pathway following internal conversion. Additionally, C2H5OO dissociation yields a three-body product channel, CH3 + O(3P) + CH2O, for which the proposed mechanism is repulsive O loss followed by the dissociation of C2H5O over a barrier. These results are compared to a recent study of tert-butyl peroxy (t-BuOO) in which 248 nm excitation results in three-body dissociation and ground state two-body dissociation but no O(1D) production.

  9. Laser induced transient absorptions of the excited triplet state of 9,10-anthraquinone-2-sulfonate. A further study by 248 nm laser photolysis

    International Nuclear Information System (INIS)

    Ma Jianhua; Lin Weizheng; Wang Wenfen; Yao Side; Lin Nianyun

    1999-01-01

    Transient absorption spectrum of triplet state of 9,10-anthraquinone-2-sulfonate (AQS) in aqueous solution has been investigated using 248 nm (KrF) laser photolysis. A whole transient absorption spectrum with absorption maxim at 380 nm and 580 nm has been assigned to triple AQS from detailed kinetic analysis of decay of 380 nm and 580 nm signals, which is the neat characteristic absorption of triplet AQS reported for the first time. In addition, the difference in feature of the spectrum of triplet AQS in H 2 O and that in CH 3 CN was eliminated by further study using 248 nm laser pulses

  10. L-shell emission from high-Z solid targets by intense (10{sup 19}W/cm{sup 2}) irradiation with a 248nm laser

    Energy Technology Data Exchange (ETDEWEB)

    Nelson, T. R.; Borisov, A. B.; Boyer, K.; Schroeder, W. A.; Santoro, J.; Van Tassle, A. J.; Rhodes, C. K.; Luk, T. S.; Cameron, S.; Longworth, J. W.; McPherson, A.

    1999-11-22

    Efficient (1.2% yield) multikilovolt x-ray emission from Ba(L) (2.4--2.8{angstrom}) and Gd(L) (1.7--2.1{angstrom}) is produced by ultraviolet (248nm) laser-excited BaF{sub 2} and Gd solids. The high efficiency is attributed to an inner shell-selective collisional electron ejection.

  11. Analysis of damage threshold of K9 glass irradiated by 248-nm KrF excimer laser

    Science.gov (United States)

    Wang, Xi; Shao, Jingzhen; Li, Hua; Nie, Jinsong; Fang, Xiaodong

    2016-02-01

    The theoretical model of K9 glass irradiated by a 248-nm KrF excimer laser was established, and a numerical simulation was performed to calculate temperature and thermal stress fields in the K9 glass sample using the finite element method. The laser-induced damage thresholds were defined and calculated, and the effect of repetition frequency and the number of pulses on the damage threshold were also studied. Furthermore, the experiment research was carried out to confirm the numerical simulation. The damage threshold and damage morphology were analyzed by means of a metallurgical microscope and scanning electron microscopy. The simulation and experimental results indicated that the damage mechanism of K9 glass irradiated by a KrF excimer laser was melting damage and stress damage, and the stress damage first appeared inside the K9 glass sample. The tensile stress damage threshold, the compressive stress damage threshold, and the melting damage threshold were 0.64, 0.76, and 1.05 J/cm2, respectively. The damage threshold decreased with increasing repetition frequency and number of laser pulses. The experimental results indicated that the damage threshold of K9 glass was 2.8 J/cm2.

  12. Cervical foraminal steroid injections under CT guidance: retrospective study of in situ contrast aspects in a serial of 248 cases

    Energy Technology Data Exchange (ETDEWEB)

    Pottecher, Pierre; Krause, Denis; Di Marco, Lucy; Loffroy, Romaric; Estivalet, Louis [CHU Dijon Bocage Central, Departement de Radiologie et Imagerie Diagnostique et Interventionnelle, Dijon (France); Duhal, Romain; Demondion, Xavier [CHRU de Lille, Service de Radiologie Musculosquelettique, CCIAL, Laboratoire d' Anatomie, Faculte de Medecine de Lille, Hopital Roger Salengro, Lille (France)

    2015-01-15

    To describe all the CT findings after in situ contrast injection just before steroid injection and to recognize the abnormal aspects associated with intravascular contamination. We retrospectively evaluated 248 cervical transforaminal steroid injections done at the university hospital in Dijon, France, in 2008-2012, to treat cervicobrachial neuralgia inadequately improved by optimal medical treatment for at least 3 weeks. Features describing the opacification patterns were recorded. Five main nonvascular opacification patterns were identified: clumps of contrast agent outside the foramen (16 %), a crab claw pattern surrounding the ganglion (13 %), a ''French'' circumflex accent pattern (15 %), reflux along the needle (7 %), and facet joint capsule opacification (22 %). Concerning the situations requiring a change in needle position, intravenous injection occurred in 26 % of the patients, with a crab claw pattern in half the cases and a clump pattern in half the cases. Intraarteriolar injection was noted in two patients. CT after in situ contrast injection ensures proper needle positioning outside the blood vessels before steroid injection. Penetration of the needle tip into a vein is very common, whereas arteriolar puncture is extremely rare. (orig.)

  13. Cl2O photochemistry: ultraviolet/vis absorption spectrum temperature dependence and O(3P) quantum yield at 193 and 248 nm.

    Science.gov (United States)

    Papanastasiou, Dimitrios K; Feierabend, Karl J; Burkholder, James B

    2011-05-28

    The photochemistry of Cl(2)O (dichlorine monoxide) was studied using measurements of its UV/vis absorption spectrum temperature dependence and the O((3)P) atom quantum yield, Φ(Cl(2)O)(O)(λ), in its photolysis at 193 and 248 nm. The Cl(2)O UV/vis absorption spectrum was measured over the temperature range 201-296 K between 200 and 500 nm using diode array spectroscopy. Cl(2)O absorption cross sections, σ(Cl(2)O)(λ,T), at temperatures <296 K were determined relative to its well established room temperature values. A wavelength and temperature dependent parameterization of the Cl(2)O spectrum using the sum of six Gaussian functions, which empirically represent transitions from the ground (1)A(1) electronic state to excited states, is presented. The Gaussian functions are found to correlate well with published theoretically calculated vertical excitation energies. O((3)P) quantum yields in the photolysis of Cl(2)O at 193 and 248 nm were measured using pulsed laser photolysis combined with atomic resonance fluorescence detection of O((3)P) atoms. O((3)P) quantum yields were measured to be 0.85 ± 0.15 for 193 nm photolysis at 296 K and 0.20 ± 0.03 at 248 nm, which was also found to be independent of temperature (220-352 K) and pressure (17 and 28 Torr, N(2)). The quoted uncertainties are at the 2σ (95% confidence) level and include estimated systematic errors. ClO radical temporal profiles obtained following the photolysis of Cl(2)O at 248 nm, as reported previously in Feierabend et al. [J. Phys. Chem. A 114, 12052, (2010)], were interpreted to establish a <5% upper-limit for the O + Cl(2) photodissociation channel, which indicates that O((3)P) is primarily formed in the three-body, O + 2Cl, photodissociation channel at 248 nm. The analysis also indirectly provided a Cl atom quantum yield of 1.2 ± 0.1 at 248 nm. The results from this work are compared with previous studies where possible. © 2011 American Institute of Physics

  14. Pages 242 - 248.pmd

    African Journals Online (AJOL)

    Administrator

    A history of measles was negatively associated with being a case: 2/13 of cases and 11/19 of controls had .... be possible given the security situation and periodic aerial bombardments. Because ... Table 1: Relationship of Nodding syndrome and Onchocerca volvulus skin-snip results in 3 case- control studies. Study. Cases.

  15. Endoscopic Sleeve Gastroplasty for Obesity: a Multicenter Study of 248 Patients with 24 Months Follow-Up.

    Science.gov (United States)

    Lopez-Nava, Gontrand; Sharaiha, Reem Z; Vargas, Eric J; Bazerbachi, Fateh; Manoel, Galvao Neto; Bautista-Castaño, Inmaculada; Acosta, Andres; Topazian, Mark D; Mundi, Manpreet S; Kumta, Nikhil; Kahaleh, Michel; Herr, Andrea Marie; Shukla, Alpana; Aronne, Louis; Gostout, Christopher J; Abu Dayyeh, Barham K

    2017-10-01

    Endoscopic sleeve gastroplasty (ESG) is a technique for managing mild to moderately obese patients. We aimed to evaluate the long-term outcomes, reproducibility, and predictors of weight response in a large multicenter cohort. Patients who underwent ESG between January 2013 and December 2015 in three centers were retrospectively analyzed. All procedures were performed using the Apollo OverStitch device (Apollo Endosurgery, Austin, TX). We performed per protocol (PP) and intention-to-treat (ITT) analyses, where patients lost to follow-up were considered failures. Multivariable linear and logistic regression analyses were performed. We included 248 patients (mean age 44.5 ± 10 years, 73% female). Baseline BMI was 37.8 ± 5.6 kg/m 2 . At 6 and 24 months, 33 and 35 patients were lost to follow-up, respectively. At 6 and 24 months, %TBWL was 15.2 [95%CI 14.2-16.3] and 18.6 [15.7-21.5], respectively. Weight loss was similar between centers at both follow-up intervals. At 24 months, % of patients achieving ≥10% TBWL was 84.2 and 53% with PP and ITT analyses, respectively. On multivariable linear regression analysis, only %TBWL at 6 months strongly predicted %TBWL at 24 months (adjusted for age, gender, and baseline BMI, β = 1.21, p ESG effectively induces weight loss up to 24 months in moderately obese patients. Failure to achieve adequate weight loss can be predicted early, and patients should be offered adjunctive therapies to augment it.

  16. On the study of the electron kinetic processes in the breakdown of argon by 0.53 µm and 0.248 µm laser radiation

    Science.gov (United States)

    Gamal, Yosr E.; El-Nadi, L.; Omara, Magdi O.; Ghazoulin, B.; Sabour, Khaled A.

    1999-07-01

    Based on a previously developed electron cascade model, a study is performed to investigate the electron kinetics in the breakdown of argon under two sets of experimental conditions in which argon over a pressure range 10-3 × 103 Torr is irradiated with focused beams of laser radiation of wavelengths 0.53 µm and 0.248 µm and pulse duration 15 ns and 18 ns, respectively. The model takes into account all the possible electron, atom and photon interactions. The calculated breakdown threshold intensities are found to be in accordance with the measured ones over the whole pressure range for lambda = 0.248 µm. However, the agreement for lambda = 0.53 µm was poor below 200 Torr. Moreover, the study of the electron energy distribution function and its parameters revealed the competing role of multiphoton and cascade collisional ionization mechanisms against loss processes over the pressure range examined in this analysis.

  17. Measurement of intensity-dependent rates of above-threshold ionization (ATI) of atomic hydrogen at 248 nm

    Energy Technology Data Exchange (ETDEWEB)

    Nichols, T.D.

    1991-04-01

    Measured rates of multiphoton ionization (MPI) from the ground state of atomic hydrogen by a linearly polarized, subpicosecond KrF laser pulse at 248 nm wavelength are compared to predictions of lowest-order perturbation theory, Floquet theory, and Keldysh-Faisal-Reiss (KFR) theory with and without Coulomb correction for peak irradiance of 3 {times} 10{sup 12}W/cm{sup 2} to 2 {times} 10{sup 14}W/cm{sup 2}. The Coulomb-corrected Keldysh model falls closest to the measured rates, the others being much higher or much lower. At 5 {times} 10{sup 13}W/cm{sup 2}, the number of ATI electrons decreased by a factor of approximately 40 with each additional photon absorbed. ATI of the molecular hydrogen background and of atoms from photodissociation of the molecules were also observed. The experiment employed a crossed-beam technique at ultrahigh vacuum with an rf-discharge atomic hydrogen source and a magnetic-bottle type electron time-of-flight spectrometer to count the electrons in the different ATI channels separately. The apparatus was calibrated to allow comparison of absolute as well as relative ionization rates to the theoretical predictions. This calibration involved measuring the distribution of irradiance in a focal volume that moved randomly and changed its size from time to time. A data collection system under computer control divided the time-of-flight spectra into bins according to the energy of each laser pulse. This is the first measurement of absolute rates of ATI in atomic hydrogen, and the first measurement of absolute test of MPI in atomic hydrogen without a large factor to account for multiple modes in the laser field. As such, the results of this work are important to the development of ATI theories, which presently differ by orders of magnitude in their prediction of the ionization rates. They are also important to recent calculations of temperatures in laser-heated plasmas, many of which incorporate KFR theory.

  18. Hydrothermal synthesis, structure, Raman spectroscopy, and self-irradiation studies of 248Cm(IO3)3

    International Nuclear Information System (INIS)

    Sykora, Richard E.; Assefa, Zerihun; Haire, Richard G.; Albrecht-Schmitt, Thomas E.

    2004-01-01

    The study of curium iodate, Cm(IO 3 ) 3 , was undertaken as part of a systematic investigation of the 4f- and 5f-elements' iodates. The reaction of 248 CmCl 3 with aqueous H 5 IO 6 under mild hydrothermal conditions results in the reduction of IO 6 5- to IO 3 - anions, and the subsequent formation of Cm(IO 3 ) 3 single crystals. Crystallographic data are: (193K, MoKα, λ=0.71073A): monoclinic, space group P2 1 /c, a=7.2014(7)A, b=8.5062(9)A, c=13.4622(14)A, β=100.142(2) o , V=811.76(14), Z=4, R(F)=2.11%, Rw(Fo2)=4.43% for 119 parameters with 1917 reflections with I>2σ(I). The structure consists of Cm 3+ cations bound by iodate anions to form [Cm(IO 3 ) 8 ] units, where the local coordination environment around the curium centers can be described as a distorted dodecahedron. There are three crystallographically unique iodate anions within the structure; two iodates bridge between three Cm centers, and one iodate bridges between two Cm centers and has a terminal oxygen atom. The bridging of the curium centers by the iodate anions creates a three-dimensional structure. Three strong Raman bands with comparable intensities were observed at 846, 804, and 760cm -1 and correspond to the I-O symmetric stretching of the three crystallographically distinct iodate ions. The Raman profile suggests a lack of inter-ionic vibrational coupling of the I-O stretching, while intra-ionic coupling provides symmetric and asymmetric components that correspond to each iodate site. Repeated collection of X-ray diffraction data for a crystal of Cm(IO 3 ) 3 over a period of time revealed a gradual expansion of the unit cell from self-irradiation. After 71 days, the new parameters were: a=7.2132(7)A, b=8.5310(8)A, c=13.505(1)A, β=100.021(2) o , V=818.3(2)

  19. Why are high- Tc superconductors, HTSC, deposited by 248 nm lasers at 400 MW/cm 2?

    Science.gov (United States)

    Dreyfus, R. W.

    1995-02-01

    (undesirable) region of CuO decomposition. Furthermore, large I increases the pressure impulse on the target, which may be the critical quantity leading to particulate emission. One can now visualize the advantage of 248 nm versus longer wavelengths. At longer λ the inverse Bremsstrahlung heating of free electrons is elevated by a factor ⩾ λ 2, again unfortunately elevating Tplume. At shorter wavelength (193 nm), elevated photodissociation eliminates nearby all the initial CuO; i.e. an undersirable situation. In summary, one can now make quantitative statements which point to similar laser λ and I values as found empirically.

  20. Insolation data manual: long-term monthly averages of solar radiation, temperature, degree-days and global anti K/sub T/ for 248 national weather service stations

    Energy Technology Data Exchange (ETDEWEB)

    Knapp, C L; Stoffel, T L; Whitaker, S D

    1980-10-01

    Monthly averaged data is presented which describes the availability of solar radiation at 248 National Weather Service stations. Monthly and annual average daily insolation and temperature values have been computed from a base of 24 to 25 years of data. Average daily maximum, minimum, and monthly temperatures are provided for most locations in both Celsius and Fahrenheit. Heating and cooling degree-days were computed relative to a base of 18.3/sup 0/C (65/sup 0/F). For each station, global anti K/sub T/ (cloudiness index) were calculated on a monthly and annual basis. (MHR)

  1. Coinheritance of High Oxygen Affinity Hb Helsinki [HBB: c.248A>T; β82(EF6)Lys→Met] with Hb H Disease.

    Science.gov (United States)

    Lee, Shir-Ying; Goh, Jia-Hui; Tan, Karen M L; Liu, Te-Chih

    2017-05-01

    Hb Helsinki [HBB: c.248A>T; β82(EF6)Lys→Met] is a high oxygen affinity hemoglobin (Hb) causing polycythemia, whereas Hb H (β4) disease causes mild to severe chronic hemolytic anemia. The clinical characteristics, gel electrophoresis, capillary electrophoresis (CE) and molecular genotyping of a case of Hb Helsinki coinherited with Hb H disease in an ethnic Malay is described, illustrating the interaction between the β-globin variant and coinheritance of three α gene deletions. The proband was asymptomatic, exhibited microcytosis and a normal with Hb value.

  2. A STRONG EMISSION LINE NEAR 24.8 Angstrom-Sign IN THE X-RAY BINARY SYSTEM MAXI J0556-332: GRAVITATIONAL REDSHIFT OR UNUSUAL DONOR?

    Energy Technology Data Exchange (ETDEWEB)

    Maitra, Dipankar; Miller, Jon M.; Reynolds, Mark T. [Department of Astronomy, University of Michigan, Ann Arbor, MI 48109 (United States); Raymond, John C., E-mail: dmaitra@umich.edu [Harvard-Smithsonian Center for Astrophysics, 60 Garden Street, Cambridge, MA 02138 (United States)

    2011-12-10

    We report the discovery of a strong emission line near 24.8 Angstrom-Sign (0.5 keV) in the newly discovered X-ray binary system MAXI J0556-332 with the reflection grating spectrometer (RGS) on board the XMM-Newton observatory. The X-ray light curve morphology during these observations is complex and shows occasional dipping behavior. Here we present time- and rate-selected spectra from the RGS and show that this strong emission line is unambiguously present in all the XMM observations. The measured line center is consistent with the Ly{alpha} transition of N VII in the rest frame. While the spectra contain imprints of absorption lines and edges, there appear to be no other significantly prominent narrow line due to the source itself, thus making the identification of the 24.8 Angstrom-Sign line uncertain. We discuss possible physical scenarios, including a gravitationally redshifted O VIII Ly{alpha} line originating at the surface of a neutron star or an unusual donor with an extremely high N/O abundance (>57) relative to solar that may have produced this comparatively strong emission line.

  3. High silicon content silylating reagents for dry-developed positive-tone resists for extreme ultraviolet (13.5 nm) and deep ultraviolet (248 nm) microlithography

    Energy Technology Data Exchange (ETDEWEB)

    Wheeler, D.; Scharrer, E.; Kubiak, G. [and others

    1994-12-31

    Recent results in the use of disilanes as silylating reagents for near-surface imaging with deep-UV (248 nm) and EUV (13.5 nm) lithography are reported. A relatively thin imaging layer of a photo-cross-linking resist is spun over a thicker layer of hard-baked resist that functions as a planarizing layer and antireflective coating. Photoinduced acid generation and subsequent heating crosslinks and renders exposed areas impermeable to an aminodisilane that reacts with the unexposed regions. Subsequent silylation and reactive ion etching afford a positive-tone image. The use of disilanes introduces a higher concentration of silicon into the polymer than is possible with silicon reagents that incorporate only one silicon atom per reactive site. The higher silicon content in the silylated polymer increases etching selectivity between exposed and unexposed regions and thereby increases the contrast. Additional improvements that help to minimize flow during silylation are also discussed, including the addition of bifunctional disilanes. We have resolved high aspect ratio, very high quality 0.20 {mu}m line and space patterns at 248 nm with a stepper having a numerical aperture (NA)= 0.53, and have resolved {<=} 0.15 {mu}m line and spaces at 13.5 nm.

  4. (n,d) elastic differential cross section at 2.48 and 3.28 MeV and related phase shift analyses

    International Nuclear Information System (INIS)

    Chatelain, P.; Onel, Y.; Viennet, R.; Weber, J.

    1978-01-01

    In the case of (n,d) scattering, at energies of a few MeV, the elastic differential scattering cross sections are not well determined, especially beyond costhetasub(CM) = -0.8 and the number of data points is rather scarce. This lack of experimental data causes great difficulty to perform a phase shift analysis even in the simple case when partial waves up to lsub(max) = 2 are included as free parameters in the parametrization of the scattering amplitude. We have therefore, in the framework of our study of the (n,d) scattering, measured this cross section at 2.48 and 3.28 MeV with special emphasize on large scattering angles. (orig./WL) [de

  5. Effects of temperature on the p53-DNA binding interactions and their dynamical behavior: comparing the wild type to the R248Q mutant.

    Directory of Open Access Journals (Sweden)

    Khaled Barakat

    Full Text Available BACKGROUND: The protein p53 plays an active role in the regulation of cell cycle. In about half of human cancers, the protein is inactivated by mutations located primarily in its DNA-binding domain. Interestingly, a number of these mutations possess temperature-induced DNA-binding characteristics. A striking example is the mutation of Arg248 into glutamine or tryptophan. These mutants are defective for binding to DNA at 310 K although they have been shown to bind specifically to several p53 response elements at sub-physiological temperatures (298-306 K. METHODOLOGY/PRINCIPAL FINDINGS: This important experimental finding motivated us to examine the effects of temperature on the structure and configuration of R248Q mutant and compare it to the wild type protein. Our aim is to determine how and where structural changes of mutant variants take place due to temperature changes. To answer these questions, we compared the mutant to the wild-type proteins from two different aspects. First, we investigated the systems at the atomistic level through their DNA-binding affinity, hydrogen bond networks and spatial distribution of water molecules. Next, we assessed changes in their long-lived conformational motions at the coarse-grained level through the collective dynamics of their side-chain and backbone atoms separately. CONCLUSIONS: The experimentally observed effect of temperature on the DNA-binding properties of p53 is reproduced. Analysis of atomistic and coarse-grained data reveal that changes in binding are determined by a few key residues and provide a rationale for the mutant-loss of binding at physiological temperatures. The findings can potentially enable a rescue strategy for the mutant structure.

  6. Nitryl chloride (ClNO2): UV/vis absorption spectrum between 210 and 296 K and O(3P) quantum yield at 193 and 248 nm.

    Science.gov (United States)

    Ghosh, Buddhadeb; Papanastasiou, Dimitrios K; Talukdar, Ranajit K; Roberts, James M; Burkholder, James B

    2012-06-21

    Recent studies have shown that the UV/vis photolysis of nitryl chloride (ClNO2) can be a major source of reactive chlorine in the troposphere. The present work reports measurements of the ClNO2 absorption spectrum and its temperature dependence between 210 and 296 K over the wavelength range 200–475 nm using diode array spectroscopy. The room temperature spectrum obtained in this work was found to be in good agreement with the results from Ganske et al. (J. Geophys. Res. 1992, 97, 7651) over the wavelength range common to both studies (200–370 nm) but differs systematically from the currently recommended spectrum for use in atmospheric models. The present results lead to a decrease in the calculated atmospheric ClNO2 photolysis rate by 30%. Including the temperature dependence of the ClNO2 spectrum decreases the calculated atmospheric photolysis rate at lower temperatures (higher altitudes) even further. A parametrization of the wavelength and temperature dependence of the ClNO2 spectrum is presented. O(3P) quantum yields, Φ(ClNO2)(O), in the photolysis of ClNO2 at 193 and 248 nm were measured at 296 K using pulsed laser photolysis combined with atomic resonance fluorescence detection of O(3P) atoms. Φ(ClNO2)(O)(λ) was found to be 0.67 ± 0.12 and 0.15 ± 0.03 (2σ error limits, including estimated systematic errors) at 193 and 248 nm, respectively, indicating that multiple dissociation channels are active in the photolysis of ClNO2 at these wavelengths. The Φ(ClNO2)(O)(λ) values obtained in this work are discussed in light of previous ClNO2 photodissociation studies and the differences are discussed.

  7. Nonclinical phenotypic and genotypic analyses of a Phase 1 pediatric respiratory syncytial virus vaccine candidate MEDI-559 (rA2cp248/404/1030ΔSH) at permissive and non-permissive temperatures.

    Science.gov (United States)

    Schickli, Jeanne H; Kaur, Jasmine; Tang, Roderick S

    2012-10-01

    MEDI-559 is a recombinant live attenuated intranasal RSV vaccine candidate currently being evaluated in 5 to MEDI-559 and the previously tested rA2cp248/404/1030ΔSH both have 5 cold-passaged mutations, 3 temperature sensitive (ts) markers designated 248, 404, and 1030, and deletion of the SH gene that collectively contribute to their attenuation and temperature sensitive growth phenotypes. However, MEDI-559 differs from rA2cp248/404/1030ΔSH by 39 silent nucleotide substitutions. Nevertheless, these viruses have comparable in vitro and in vivo phenotypes. Temperature sensitivity is monitored by the efficiency of plaque formation at elevated temperatures. The efficiency of plaque formation of MEDI-559 is reduced by ≥ 100-fold at 35 ° C and by ≥ 1000 fold at 37 °C compared to 32 °C. Passaging of MEDI-559 at temperatures up to 37 °C resulted in generation of temperature sensitive intermediate (tsi) viruses. The most frequent change was a reversion to wildtype tyrosine at the 1030 ts site followed by a less frequently observed leucine to non-wildtype serine substitution at the 248 ts site. One tsi virus had changes at both the 248 and 1030 ts sites and another tsi virus that had maintained all of the 248, 404 and 1030 ts sites had two novel changes (Asp158Gly and Ser1313Cys) in the polymerase (L) gene. Asp158Gly and Ser1313Cys singly or in combination in the MEDI-559 genetic background were confirmed to result in a tsi growth phenotype. All the tsi viruses have small plaque phenotypes and are highly attenuated in the lungs of cotton rats. Copyright © 2012 Elsevier B.V. All rights reserved.

  8. [Review of:] Dirk Lewandowski, Web Information Retrieval: Technologien zur Informationssuche im Internet. Frankfurt am Main: DGI, 2005. 248 S. (DGI-Schrift; Informationswissenschaft 7), ISBN 3-925474-55-2

    OpenAIRE

    Oberhauser, Otto

    2005-01-01

    Book review of Dirk Lewandowski, Web Information Retrieval: Technologien zur Informationssuche im Internet. Frankfurt am Main: DGI, 2005. 248 p. (DGI-Schrift; Informationswissenschaft 7), ISBN 3-925474-55-2. A well-investigated and easy to read state-of-the-art report on web search engines.

  9. Br2 elimination in 248-nm photolysis of CF2Br2 probed by using cavity ring-down absorption spectroscopy.

    Science.gov (United States)

    Hsu, Ching-Yi; Huang, Hong-Yi; Lin, King-Chuen

    2005-10-01

    By using cavity ring-down absorption spectroscopy technique, we have observed the channel of Br2 molecular elimination following photodissociation of CF2Br2 at 248 nm. A tunable laser beam, which is crossed perpendicular to the photolyzing laser beam in a ring-down cell, is used to probe the Br2 fragment in the B 3Piou+-X1Sigmag+ transition. The vibrational population is obtained in a nascent state, despite ring-down time as long as 500-1000 ns. The population ratio of Br2(v=1)/Br2(v=0) is determined to be 0.4+/-0.2, slightly larger than the value of 0.22 evaluated by Boltzmann distribution at room temperature. The quantum yield of the Br2 elimination reaction is also measured to be 0.04+/-0.01. This work provides direct evidence to support molecular elimination occurring in the CF2Br2 photodissociation and proposes a plausible pathway with the aid of ab initio potential-energy calculations. CF2Br2 is excited probably to the 1B1 and 3B2 states at 248 nm. As the C-Br bond is elongated upon excitation, the coupling of the 1A'(1B1) state to the high vibrational levels of the ground state X 1A'(1A1) may be enhanced to facilitate the process of internal conversion. After transition, the highly vibrationally excited CF2Br2 feasibly surpasses a transition barrier prior to decomposition. According to the ab initio calculations, the transition state structure tends to correlate with the intermediate state CF2Br+Br(CF2Br...Br) and the products CF2+Br2. A sequential photodissociation pathway is thus favored. That is, a single C-Br bond breaks, and then the free-Br atom moves to form a Br-Br bond, followed by the Br2 elimination. The formed Br-Br bond distance in the transition state tends to approach equilibrium such that the Br2 fragment may be populated in cold vibrational distribution. Observation of a small vibrational population ratio of Br2(v=1)Br2(v=0) agrees with the proposed mechanism.

  10. PROBING THE MSP PRENATAL STAGE: THE OPTICAL IDENTIFICATION OF THE X-RAY BURSTER EXO 1745-248 IN TERZAN 5

    Energy Technology Data Exchange (ETDEWEB)

    Ferraro, F. R.; Pallanca, C.; Lanzoni, B.; Cadelano, M.; Dalessandro, E.; Mucciarelli, A. [Dipartimento di Fisica e Astronomia, Università degli Studi di Bologna, v.le Berti Pichat 6/2, I-40127 Bologna (Italy); Massari, D. [INAF-Osservatorio Astronomico di Bologna, via Ranzani 1, I-40127 Bologna (Italy)

    2015-07-01

    We report on the optical identification of the neutron star burster EXO 1745-248 in Terzan 5. The identification was performed by exploiting Hubble Space Telescope/Advanced Camera for Surveys images acquired in Director's Discretionary Time shortly after (approximately one month) the Swift detection of the X-ray burst. The comparison between these images and previous archival data revealed the presence of a star that is currently brightened by ∼3 mag, consistent with expectations during an X-ray outburst. The centroid of this object well agrees with the position, in the archival images, of a star located in the turn-off/sub-giant-branch region of Terzan 5. This supports the scenario that the companion should have recently filled its Roche Lobe. Such a system represents the prenatal stage of a millisecond pulsar, an evolutionary phase during which heavy mass accretion on the compact object occurs, thus producing X-ray outbursts and re-accelerating the neutron star.

  11. Risk Factors for Insulin Resistance, Metabolic Syndrome, and Diabetes in 248 HFE C282Y Homozygotes Identified by Population Screening in the HEIRS Study

    Science.gov (United States)

    Barton, J. Clayborn; Adams, Paul C.; Acton, Ronald T.

    2016-01-01

    Abstract Background: We sought to identify risk factors for insulin resistance, metabolic syndrome (MetS), and diabetes mellitus in 248 non-Hispanic white HFE C282Y homozygotes identified by population screening. Methods: We analyzed observations obtained prospectively in a postscreening examination: age; sex; body mass index (BMI); systolic/diastolic blood pressure; metacarpophalangeal (MP) joint hypertrophy; hepatomegaly; complete blood counts; alanine/aspartate aminotransferase levels; elevated C-reactive protein (>0.5 mg/dL); transferrin saturation; serum ferritin; homeostasis model assessment-insulin resistance (HOMA-IR); and MetS. Results: Twenty-six participants (10.5%) had diabetes diagnoses. A significant trend across HOMA-IR quartiles was observed only for blood neutrophils. Logistic regression on HOMA-IR fourth quartile revealed positive associations: age (P = 0.0002); male sex (P = 0.0022); and BMI (P HOMA-IR fourth quartile predicted MetS (P HOMA-IR fourth quartile, MetS, or diabetes. Conclusions: In screening C282Y homozygotes, age, male sex, and BMI predicted HOMA-IR fourth quartile. HOMA-IR fourth quartile alone predicted MetS. Diabetes was associated with greater age, male sex, MP joint hypertrophy, greater blood neutrophil counts, and MetS. PMID:26771691

  12. Photodissociation of gaseous CH3COSH at 248 nm by time-resolved Fourier-transform infrared emission spectroscopy: Observation of three dissociation channels

    International Nuclear Information System (INIS)

    Hu, En-Lan; Tsai, Po-Yu; Fan, He; Lin, King-Chuen

    2013-01-01

    Upon one-photon excitation at 248 nm, gaseous CH 3 C(O)SH is dissociated following three pathways with the products of (1) OCS + CH 4 , (2) CH 3 SH + CO, and (3) CH 2 CO + H 2 S that are detected using time-resolved Fourier-transform infrared emission spectroscopy. The excited state 1 (n O , π * CO ) has a radiative lifetime of 249 ± 11 ns long enough to allow for Ar collisions that induce internal conversion and enhance the fragment yields. The rate constant of collision-induced internal conversion is estimated to be 1.1 × 10 −10 cm 3 molecule −1 s −1 . Among the primary dissociation products, a fraction of the CH 2 CO moiety may undergo further decomposition to CH 2 + CO, of which CH 2 is confirmed by reaction with O 2 producing CO 2 , CO, OH, and H 2 CO. Such a secondary decomposition was not observed previously in the Ar matrix-isolated experiments. The high-resolution spectra of CO are analyzed to determine the ro-vibrational energy deposition of 8.7 ± 0.7 kcal/mol, while the remaining primary products with smaller rotational constants are recognized but cannot be spectrally resolved. The CO fragment detected is mainly ascribed to the primary production. A prior distribution method is applied to predict the vibrational distribution of CO that is consistent with the experimental findings.

  13. Br2 molecular elimination in photolysis of (COBr)2 at 248 nm by using cavity ring-down absorption spectroscopy: a photodissociation channel being ignored.

    Science.gov (United States)

    Wu, Chia-Ching; Lin, Hsiang-Chin; Chang, Yuan-Bin; Tsai, Po-Yu; Yeh, Yu-Ying; Fan, He; Lin, King-Chuen; Francisco, J S

    2011-12-21

    A primary dissociation channel of Br(2) elimination is detected following a single-photon absorption of (COBr)(2) at 248 nm by using cavity ring-down absorption spectroscopy. The technique contains two laser beams propagating in a perpendicular configuration. The tunable laser beam along the axis of the ring-down cell probes the Br(2) fragment in the B(3)Π(ou)(+)-X(1)Σ(g)(+) transition. The measurements of laser energy- and pressure-dependence and addition of a Br scavenger are further carried out to rule out the probability of Br(2) contribution from a secondary reaction. By means of spectral simulation, the ratio of nascent vibrational population for v = 0, 1, and 2 levels is evaluated to be 1:(0.65 ± 0.09):(0.34 ± 0.07), corresponding to a Boltzmann vibrational temperature of 893 ± 31 K. The quantum yield of the ground state Br(2) elimination reaction is determined to be 0.11 ± 0.06. With the aid of ab initio potential energy calculations, the pathway of molecular elimination is proposed on the energetic ground state (COBr)(2) via internal conversion. A four-center dissociation mechanism is followed synchronously or sequentially yielding three fragments of Br(2) + 2CO. The resulting Br(2) is anticipated to be vibrationally hot. The measurement of a positive temperature effect supports the proposed mechanism.

  14. 248 nm photolysis of CH2Br2 by using cavity ring-down absorption spectroscopy: Br2 molecular elimination at room temperature.

    Science.gov (United States)

    Wei, Pei-Ying; Chang, Yuan-Ping; Lee, Wei-Bin; Hu, Zhengfa; Huang, Hong-Yi; Lin, King-Chuen; Chen, K T; Chang, A H H

    2006-10-07

    Following photodissociation of CH2Br2 at 248 nm, Br2 molecular elimination is detected by using a tunable laser beam, as crossed perpendicular to the photolyzing laser beam in a ring-down cell, probing the Br2 fragment in the B 3Piou+ -X 1Sigmag+ transition. The nascent vibrational population is obtained, yielding a population ratio of Br2(v = 1)Br2(v = 0) to be 0.7 +/- 0.2. The quantum yield for the Br2 elimination reaction is determined to be 0.2 +/- 0.1. Nevertheless, when CH2Br2 is prepared in a supersonic molecular beam under cold temperature, photofragmentation gives no Br2 detectable in a time-of-flight mass spectrometer. With the aid of ab initio potential energy calculations, a plausible pathway is proposed. Upon excitation to the 1B1 or 3B1 state, C-Br bond elongation may change the molecular symmetry of Cs and enhance the resultant 1 1,3A'-X 1A' (or 1 1,3B1-X 1A1 as C2v is used) coupling to facilitate the process of internal conversion, followed by asynchronous concerted photodissociation. Temperature dependence measurements lend support to the proposed pathway.

  15. Probing the ignored elimination channel of Br2 in the 248 nm photodissociation of 1,1-dibromoethylene by cavity ring-down absorption spectroscopy.

    Science.gov (United States)

    Lee, Ping-Chen; Tsai, Po-Yu; Hsiao, Ming-Kai; Lin, King-Chuen; Huang, C H; Chang, A H H

    2009-03-09

    In the photodissociation of 1,1-C(2)H(2)Br(2) at 248 nm, the Br(2) elimination channel is probed by using cavity ring-down absorption spectroscopy (CRDS). In terms of spectral simulation, the vibrational population ratio of Br(2)(v = 1)/Br(2)(v = 0) is found to be 0.55+/-0.05, which indicates that the Br(2) fragment is vibrationally hot. The rotational population is thermally equilibrated with a Boltzmann temperature of 349+/-38 K. According to ab initio potential energy calculations, the obtained fragments are anticipated to result primarily from photodissociation of the ground electronic state that undergoes 1) H migration followed by three-center elimination, and 2) isomerization forming either trans- or cis-1,2-C(2)H(2)Br(2) from which Br(2) is eliminated. RRKM calculations predict that the Br(2) dissociation rates through the ground singlet state prevail over those through the triplet state. Measurements of temperature and Ar pressure dependence are examined to support the proposed pathway via internal conversion. The quantum yield for the Br(2) elimination reaction is determined to be 0.07+/-0.04. This result is smaller than that obtained in 1,2-C(2)H(2)Br(2), probably because the dissociation rates are slowed in the isomerization stage.

  16. Photodissociation of 1,2-dibromoethylene at 248 nm: Br2 molecular elimination probed by cavity ring-down absorption spectroscopy.

    Science.gov (United States)

    Chang, Yuan-Pin; Lee, Ping-Chen; Lin, King-Chuen; Huang, C H; Sun, B J; Chang, A H H

    2008-06-02

    The Br2 elimination channel is probed for 1,2-C2H2Br2 in the B(3)Pi(+)ou-X(1)Sigma(+)g transition upon irradiation at 248 nm by using cavity ring-down absorption spectroscopy (CRDS). The nascent vibrational population ratio of Br2(v=1)/Br2(v=0) is obtained to be 0.7+/-0.2, thus indicating that the Br2 fragment is produced in hot vibrational states. The obtained Br2 products are anticipated to result primarily from photodissociation of the ground-state cis isomer via four-center elimination or from cis/trans isomers via three-center elimination, each mechanism involving a transition state that has a Br-Br distance much larger than that of ground state Br2. According to ab initio potential energy calculations, the pathways that lead to Br2 elimination may proceed either through the electronic ground state by internal conversion or through the triplet state by intersystem crossing. Temperature-dependence measurements are examined, thereby supporting the pathway that involves internal conversion--which was excluded previously by using product translational spectroscopy (PTS). The quantum yield for the Br2 elimination reaction is determined to be 0.120.1, being substantially contributed by the ground-state Br2 product. The discrepancy of this value from that (of 0.2) obtained by PTS may rise from the lack of measurements in probing the triplet-state Br2 product.

  17. Molecular elimination of Br2 in photodissociation of CH2BrC(O)Br at 248 nm using cavity ring-down absorption spectroscopy.

    Science.gov (United States)

    Fan, He; Tsai, Po-Yu; Lin, King-Chuen; Lin, Cheng-Wei; Yan, Chi-Yu; Yang, Shu-Wei; Chang, A H H

    2012-12-07

    The primary elimination channel of bromine molecule in one-photon dissociation of CH(2)BrC(O)Br at 248 nm is investigated using cavity ring-down absorption spectroscopy. By means of spectral simulation, the ratio of nascent vibrational population in v = 0, 1, and 2 levels is evaluated to be 1:(0.5 ± 0.1):(0.2 ± 0.1), corresponding to a Boltzmann vibrational temperature of 581 ± 45 K. The quantum yield of the ground state Br(2) elimination reaction is determined to be 0.24 ± 0.08. With the aid of ab initio potential energy calculations, the obtained Br(2) fragments are anticipated to dissociate on the electronic ground state, yielding vibrationally hot Br(2) products. The temperature-dependence measurements support the proposed pathway via internal conversion. For comparison, the Br(2) yields are obtained analogously from CH(3)CHBrC(O)Br and (CH(3))(2)CBrC(O)Br to be 0.03 and 0.06, respectively. The trend of Br(2) yields among the three compounds is consistent with the branching ratio evaluation by Rice-Ramsperger-Kassel-Marcus method. However, the latter result for each molecule is smaller by an order of magnitude than the yield findings. A non-statistical pathway so-called roaming process might be an alternative to the Br(2) production, and its contribution might account for the underestimate of the branching ratio calculations.

  18. Characterization of the in vitro expressed autoimmune rippling muscle disease immunogenic domain of human titin encoded by TTN exons 248-249

    Energy Technology Data Exchange (ETDEWEB)

    Zelinka, L. [Biomedical Sciences Program, Kent State University, Kent, OH (United States); McCann, S.; Budde, J.; Sethi, S.; Guidos, M.; Giles, R. [Center for Applied Chemical Biology, Department of Biological Sciences, Youngstown State University, One University Plaza, Youngstown, OH 44555 (United States); Walker, G.R., E-mail: grwalker@ysu.edu [Center for Applied Chemical Biology, Department of Biological Sciences, Youngstown State University, One University Plaza, Youngstown, OH 44555 (United States); Biomedical Sciences Program, Kent State University, Kent, OH (United States)

    2011-08-05

    Highlights: {yields} Affinity purification of the autoimmune rippling muscle disease immunogenic domain of titin. {yields} Partial sequence analysis confirms that the peptides is in the I band region of titin. {yields} This region of the human titin shows high degree of homology to mouse titin N2-A. -- Abstract: Autoimmune rippling muscle disease (ARMD) is an autoimmune neuromuscular disease associated with myasthenia gravis (MG). Past studies in our laboratory recognized a very high molecular weight skeletal muscle protein antigen identified by ARMD patient antisera as the titin isoform. These past studies used antisera from ARMD and MG patients as probes to screen a human skeletal muscle cDNA library and several pBluescript clones revealed supporting expression of immunoreactive peptides. This study characterizes the products of subcloning the titin immunoreactive domain into pGEX-3X and the subsequent fusion protein. Sequence analysis of the fusion gene indicates the cloned titin domain (GenBank ID: (EU428784)) is in frame and is derived from a sequence of N2-A spanning the exons 248-250 an area that encodes the fibronectin III domain. PCR and EcoR1 restriction mapping studies have demonstrated that the inserted cDNA is of a size that is predicted by bioinformatics analysis of the subclone. Expression of the fusion protein result in the isolation of a polypeptide of 52 kDa consistent with the predicted inferred amino acid sequence. Immunoblot experiments of the fusion protein, using rippling muscle/myasthenia gravis antisera, demonstrate that only the titin domain is immunoreactive.

  19. Incidence and clinical characteristics of unexpected uterine sarcoma after hysterectomy and myomectomy for uterine fibroids: a retrospective study of 10,248 cases

    Directory of Open Access Journals (Sweden)

    Zhao WC

    2015-10-01

    Full Text Available Wan-Cheng Zhao,1 Fang-Fang Bi,1 Da Li,2 Qing Yang11Department of Obstetrics and Gynecology, 2Center of Reproductive Medicine, Shengjing Hospital of China Medical University, Shenyang, People’s Republic of ChinaBackground: Uterine fibroids often require a hysterectomy or myomectomy via laparotomy or laparoscopy. Morcellation is often necessary to perform a laparoscopic surgery. The objective of this study is to determine the incidence of unexpected uterine sarcomas (UUSs after hysterectomy and myomectomy for uterine fibroids and to reduce the occurrence and avoid the morcellation of UUSs by analyzing their characteristics.Methods: Women who had a hysterectomy or myomectomy for uterine fibroids in Shengjing Hospital of China Medical University between November 2008 and November 2014 were selected for the study, and their clinical characteristics were analyzed.Results: During the period, 48 UUSs were found in 10,248 cases, and the overall incidence was 0.47%. There was no statistical difference (P=0.449 regarding the incidence (0.50% vs 0.33% between 42 UUSs in 8,456 cases undergoing laparotomy and six UUSs in 1,792 cases undergoing laparoscopy. Most of the UUSs were stage I (89.58%, which occurred more commonly (56.25% in women aged 40–49. Abnormal uterine bleeding (39.58% was the main clinical manifestation. Rapidly growing pelvic masses (12.5%, rich blood flow signals (18.75%, and degeneration of uterine fibroids (18.75% prompted by ultrasonography may suggest the possibility of UUSs. The margins of most UUSs (93.75% were regular, which may cause UUSs to be misdiagnosed as uterine fibroids. Fifteen cases underwent magnetic resonance imaging examinations. Approximately 73.33% showed heterogeneous and hypointense signal intensity on T1-weighted images, and 80% showed intermediate-to-high signal intensity on T2-weighted images, with necrosis and hemorrhage in 40% of cases. After contrast administration, 80% presented early heterogeneous

  20. Comparación de variables físicas, culinarias y amilográficas del cultivar de arroz (Oryza sativa L. MD248 con dos cultivares comerciales de arroz en Venezuela

    Directory of Open Access Journals (Sweden)

    Manuel Ávila

    2014-12-01

    Full Text Available El objetivo del estudio fue evaluar las variables físicas culinarias y amilográficas del cultivar MD248 y su potencial como arroz de mesa en Venezuela. Para ello, MD248 se sembró bajo un diseño completamente aleatorizado, en Calabozo (Estado Guárico, Venezuela, junto con 2 cultivares empleados como testigos de buena (D-Sativa y baja (D-Primera calidad culinaria. De cada cultivar se cosecharon 2.500 g de arroz paddy y se procesaron hasta obtener una fracción de arroz entero pulido la cual fue evaluada para: largo, ancho, espesor, relación largo/ancho (L/A, peso de 100 granos, contenido de amilosa aparente, tiempo de cocción, relación de expansión volumétrica (REV, relación de absorción de agua (RAA, viscosidades pico, media, final, ‘breakdown’, ‘setback’, consistencia y temperatura de empaste del perfil amilográfico. Además, atributos sensoriales descriptivos (brillo, percepción visual de la adhesividad, adhesividad manual, adhesividad entre los granos y preferenciales (apariencia, adhesividad, calidad global del arroz cocido. Los resultados indicaron diferencias estadísticas altamente significativas (p ≤ 0,01 entre los cultivares para largo, relación L/A, peso de 100 granos, contenido de amilosa aparente, tiempo de cocción, REV, RAA y todas las variables amilográficas, excepto para viscosidad media y temperatura de empaste (p > 0,05. En los perfiles descriptivo y preferencial hubo diferencias altamente significativas (p ≤ 0,01 para todos los atributos evaluados. MD248 estuvo asociado con los mayores valores de largo de grano (7,07 mm, relación L/A (3,43, peso de 100 granos (2,20 g y amilosa aparente (19,14 %, y con los menores valores de tiempo de cocción (22,90 min, REV (3,07, RAA (1,55, viscosidad pico (159,61 RVU, media (130,10 RVU, p > 0,05 y ‘breakdown’ (29,51 RVU. MD248 presentó un perfil descriptivo comparable al cultivar de buena calidad culinaria y se diferenció ampliamente del cultivar de baja

  1. Estudo do comportamento do revestimento de pavimento utilizando mistura asfáltica morna com adição de borracha moída de pneu na SPA-248/055

    Directory of Open Access Journals (Sweden)

    Cecilia Fortes Merighi

    2017-12-01

    Full Text Available This paper presents a study of a warm asphalt mix using rubberized binder additive with surfactant. Tests were made to verify the mechanical behavior of the warm mixture and then compared to a reference rubberized hot mixture. The warm asphalt mix presented satisfactory results. Also, it was made an analysis of reducing pollutant emissions during the mix production. A test section was performed with the warm mixture, located in SPA-248/055, West Lane and compared to the hot mix reference section, located on the same highway. The results indicated that there is a reduction of pollutants such as total smoke, fumes soluble and volatile organic compounds (VOCs. Both the experimental and the reference section were evaluated during 4 years for pavement performance parameters. The results showed a positive behavior of warm asphalt mix compared to the reference pavement section.

  2. Photolysis of CH{sub 3}CHO at 248 nm: Evidence of triple fragmentation from primary quantum yield of CH{sub 3} and HCO radicals and H atoms

    Energy Technology Data Exchange (ETDEWEB)

    Morajkar, Pranay; Schoemaecker, Coralie; Fittschen, Christa, E-mail: christa.fittschen@univ-lille1.fr [Université Lille Nord de France, PhysicoChimie des Processus de Combustion et de l’Atmosphère – PC2A, UMR 8522, F-59650 Villeneuve d’Ascq (France); Bossolasco, Adriana [Université Lille Nord de France, PhysicoChimie des Processus de Combustion et de l’Atmosphère – PC2A, UMR 8522, F-59650 Villeneuve d’Ascq (France); INFIQC (CONICET), Departamento de Fisicoquímica, Facultad de Ciencias Químicas, Universidad Nacional de Córdoba, Córdoba (Argentina)

    2014-06-07

    Radical quantum yields have been measured following the 248 nm photolysis of acetaldehyde, CH{sub 3}CHO. HCO radical and H atom yields have been quantified by time resolved continuous wave Cavity Ring Down Spectroscopy in the near infrared following their conversion to HO{sub 2} radicals by reaction with O{sub 2}. The CH{sub 3} radical yield has been determined using the same technique following their conversion into CH{sub 3}O{sub 2}. Absolute yields have been deduced for HCO radicals and H atoms through fitting of time resolved HO{sub 2} profiles, obtained under various O{sub 2} concentrations, to a complex model, while the CH{sub 3} yield has been determined relative to the CH{sub 3} yield from 248 nm photolysis of CH{sub 3}I. Time resolved HO{sub 2} profiles under very low O{sub 2} concentrations suggest that another unknown HO{sub 2} forming reaction path exists in this reaction system besides the conversion of HCO radicals and H atoms by reaction with O{sub 2}. HO{sub 2} profiles can be well reproduced under a large range of experimental conditions with the following quantum yields: CH{sub 3}CHO + hν{sub 248nm} → CH{sub 3}CHO{sup *}, CH{sub 3}CHO{sup *} → CH{sub 3} + HCO ϕ{sub 1a} = 0.125 ± 0.03, CH{sub 3}CHO{sup *} → CH{sub 3} + H + CO ϕ{sub 1e} = 0.205 ± 0.04, CH{sub 3}CHO{sup *}→{sup o{sub 2}}CH{sub 3}CO + HO{sub 2} ϕ{sub 1f} = 0.07 ± 0.01. The CH{sub 3}O{sub 2} quantum yield has been determined in separate experiments as ϕ{sub CH{sub 3}} = 0.33 ± 0.03 and is in excellent agreement with the CH{sub 3} yields derived from the HO{sub 2} measurements considering that the triple fragmentation (R1e) is an important reaction path in the 248 nm photolysis of CH{sub 3}CHO. From arithmetic considerations taking into account the HO{sub 2} and CH{sub 3} measurements we deduce a remaining quantum yield for the molecular pathway: CH{sub 3}CHO{sup *} → CH{sub 4} + CO ϕ{sub 1b} = 0.6. All experiments can be

  3. Experimental Cross Sections for Reactions of Heavy Ions and 208Pb, 209Bi, 238U, and 248Cm Targets

    Energy Technology Data Exchange (ETDEWEB)

    Patin, Joshua Barnes [Univ. of California, Berkeley, CA (United States)

    2002-01-01

    The study of the reactions between heavy ions and 208Pb, 209Bi, 238U, and 248Cm Cm targets was performed to look at the differences between the cross sections of hot and cold fusion reactions. Experimental cross sections were compared with predictions from statistical computer codes to evaluate the effectiveness of the computer code in predicting production cross sections. Hot fusion reactions were studied with the MG system, catcher foil techniques and the Berkeley Gas-filled Separator (BGS). 3n- and 4n-exit channel production cross sections were obtained for the 238U(18O,xn)256-xFm, 238U(22Ne,xn)260-xNo, and 248Cm(15N,xn)263-xLr reactions and are similar to previous experimental results. The experimental cross sections were accurately modeled by the predictions of the HIVAP code using the Reisdorf and Schaedel parameters and are consistent with the existing systematics of 4n exit channel reaction products. Cold fusion reactions were examined using the BGS. The 48Pb(238Ca,xn)256-xNo, 208Pb(50Ti,xn)258-xRf, 208Pb(51V,xn)259-xDb, 50Bi(238Ti,xn)259-xDb, and 209Bi(51V,xn)260-xSg reactions were studied. The experimental production cross sections are in agreement with the results observed in previous experiments. It was necessary to slightly alter the Reisdorf and Schaedel parameters for use in the HIVAP code in order to more accurately model the experimental data. The cold fusion experimental results are in agreement with current 1n- and 2n-exit channel systematics.

  4. 7 CFR 248.4 - State Plan.

    Science.gov (United States)

    2010-01-01

    ... the FMNP coupon; (vi) Identification of the fresh, nutritious, unprepared fruits, vegetables, and...) If available, information on the change in consumption of fresh fruits and vegetables by recipients... Regulations of the Department of Agriculture (Continued) FOOD AND NUTRITION SERVICE, DEPARTMENT OF AGRICULTURE...

  5. 7 CFR 248.19 - Investigations.

    Science.gov (United States)

    2010-01-01

    ... CHILD NUTRITION PROGRAMS WIC FARMERS' MARKET NUTRITION PROGRAM (FMNP) Monitoring and Review of State..., coerce, or discriminate against any individual for the purpose of interfering with any right or privilege...

  6. 7 CFR 248.2 - Definitions.

    Science.gov (United States)

    2010-01-01

    ... the Hunger Prevention Act of 1988 (Pub. L. 100-435), enacted September 19, 1988. Public Law 102-314... means any nonprofit entity or local government agency which issues FMNP coupons, and provides nutrition...

  7. 7 CFR 248.12 - FMNP costs.

    Science.gov (United States)

    2010-01-01

    ... must obtain prior approval in accordance with 7 CFR 3016.22 before charging to the FMNP any capital... the FMNP. (10) The cost of preparing contracts for farmers/farmers' markets and local WIC providers...

  8. 24 CFR 248.101 - Definitions.

    Science.gov (United States)

    2010-04-01

    ... Internal Revenue Service under section 501(c) of the Internal Revenue Code of 1986; (5) Does not include a... regulations, constitute a basis for eviction. HOME Investment Trust Fund. A public fund established in the... of the total overall rental inventory in the area is not sufficient to allow for normal growth and...

  9. Publications | Page 248 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Bureaucratic resistance to regulatory reforms : the contrasting experiences in electricity and telecommunications in Brazil (restricted access). The process of regulatory diffusion has been extensively explored in developed countries, but much less so in developing countries. In an attempt to open the black box of the diffusion ...

  10. 7 CFR 248.18 - Audits.

    Science.gov (United States)

    2010-01-01

    ... of the Department of Agriculture (Continued) FOOD AND NUTRITION SERVICE, DEPARTMENT OF AGRICULTURE CHILD NUTRITION PROGRAMS WIC FARMERS' MARKET NUTRITION PROGRAM (FMNP) Monitoring and Review of State... the purpose of making surveys, audits, examinations, excerpts, and transcripts. (b) State agency...

  11. 17 CFR 248.3 - Definitions.

    Science.gov (United States)

    2010-04-01

    ... definite, concrete, everyday words and active voice whenever possible; (D) Avoid multiple negatives; (E... exercise a controlling influence over the management or policies of a company whether through ownership of...

  12. Publications | Page 248 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    IDRC works with developing-country researchers and institutions to build local capacity through funding, knowledge sharing, and training. Through books, articles, research publications, and studies, we aim to widen the impact of our investment and advance development research. We share the results of our funded ...

  13. ¿Serían la Guardia, Tutela y Curatela Bienes Jurídicos Penales? Un Análisis Crítico de los Arts. 248 y 249 del CP a la Luz de la Exclusiva Protección de Bienes Jurídicos

    Directory of Open Access Journals (Sweden)

    Gerson Faustino Rosa

    2015-12-01

    Full Text Available El presente trabajo tiene por objeto el análisis crítico y la explotación de un importante problema político-criminal de la actualidad: la criminalización de conductas que afrontan la guarda, la tutela y la curatela en el Código Penal, en sus artículos 248 y 249, lo que ya no tiene sentido ante la actual función del sistema penal, criticándose la actividad desenfrenada del Poder Legislativo, que produce ley espenales que no protegen bien jurídico alguno,oque salvaguardan bienes pasibles de protección por otras esferas del Derecho, valiéndose de la fuerza simbólico-comunicativa del Derecho Penal de forma desnecesaria, ampliando demasiadamente el alcance de la pena criminal, hasta el punto de vulgarizar todo el sistema jurídico penalenrazón de su uso indiscriminado. Paraello, enprimer plano,este estudio trata de la política criminal relativa a la libre planificación familiar, criticando la intervención estatal en cuestiones familiares, como ocurre en el Código Penal de 1940, destacando la necesidad de respetarse los principios de intervención mínima y de proporcionalidad antes de que el legislador se valga de la injerencia penal para la protección de cualquier bien jurídico. Más adelante, se presenta la importancia del bien jurídico-penal, con énfasis en la familia como bien jurídico categorial, especialmente la guardia, tutela y curatela, supuestamente lesionadas por los delitos de los artículos 248 y 249 del Código Penal. Así, se analizan brevemente los tipos penales citados, criticándose dicha criminalización, teniéndose en cuenta que tales tipos son subsidiarios, perfectamente prescindibles en el ordenamiento jurídico-penal y pasibles de salvaguardia por el Derecho Civil, que en la solución de los conflictos familiares se muestra mucho más eficaz que la intervención penal.

  14. All projects related to | Page 248 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Total Funding: CA$ 1,874,950.00. Enhancing Participation of Indigenous People to Address Discrimination and Promote Equity in Health Systems. Project. New research will help indigenous peoples in Latin America tackle the inequity, racial discrimination, and other barriers they face in accessing their right to health care.

  15. 24 CFR 248.173 - Resident homeownership program.

    Science.gov (United States)

    2010-04-01

    ... necessary to own and manage the project, where appropriate, and shall be approved by the Commissioner. (b... proposed management entity to manage the project, in compliance with paragraph (n) of this section; (xiv... abilities to manage eligible properties by having done so effectively and efficiently for a period of not...

  16. 7 CFR 248.14 - Distribution of funds.

    Science.gov (United States)

    2010-01-01

    ... grown fruits and vegetables. (i) Transfer of funds. A State agency may use not more than 5 percent of... Agriculture Regulations of the Department of Agriculture (Continued) FOOD AND NUTRITION SERVICE, DEPARTMENT OF AGRICULTURE CHILD NUTRITION PROGRAMS WIC FARMERS' MARKET NUTRITION PROGRAM (FMNP) State Agency Provisions...

  17. 48 CFR 52.248-1 - Value Engineering.

    Science.gov (United States)

    2010-10-01

    ... funding of subsequent year requirements on a multiyear contract. Collateral costs, as used in this clause, means agency cost of operation, maintenance, logistic support, or Government-furnished property. Collateral savings, as used in this clause, means those measurable net reductions resulting from a VECP in...

  18. 48 CFR 52.248-3 - Value Engineering-Construction.

    Science.gov (United States)

    2010-10-01

    .... Collateral costs, as used in this clause, means agency costs of operation, maintenance, logistic support, or Government-furnished property. Collateral savings, as used in this clause, means those measurable net reductions resulting from a VECP in the agency's overall projected collateral costs, exlcusive of acquisition...

  19. 7 CFR 248.17 - Management evaluations and reviews.

    Science.gov (United States)

    2010-01-01

    ..., DEPARTMENT OF AGRICULTURE CHILD NUTRITION PROGRAMS WIC FARMERS' MARKET NUTRITION PROGRAM (FMNP) Monitoring..., evaluation of management, accountability, certification, nutrition education, financial management systems...

  20. 7 CFR 248.10 - Coupon and market management.

    Science.gov (United States)

    2010-01-01

    ... AGRICULTURE CHILD NUTRITION PROGRAMS WIC FARMERS' MARKET NUTRITION PROGRAM (FMNP) State Agency Provisions... responsible for the fiscal management of, and accountability for, FMNP-related activities for farmers, farmers... FMNP requirements, including both overt and covert monitoring; (viii) Be accountable for actions of...

  1. 31 CFR 248.4 - Undertaking of indemnity.

    Science.gov (United States)

    2010-07-01

    ... in the circumstances set forth below, a corporate surety authorized by the Secretary of the Treasury... disbursing officer is satisfied as to the identity of the check presented and that any missing portions are...

  2. Firming up the Foundations: Reflections on Verifying the 248 ...

    African Journals Online (AJOL)

    In addition to this, the article looks at the necessarily systematic nature of quotation handling and the main types of considerations determining methodology (for example, lexicographic, bibliographic and typographic requirements). Keywords: Dictionary, South African English, Historical Principles, Verification, Quotation, ...

  3. 17 CFR 248.1 - Purpose and scope.

    Science.gov (United States)

    2010-04-01

    ...) REGULATIONS S-P AND S-AM Regulation S-P: Privacy of Consumer Financial Information and Safeguarding Personal... subpart: (1) Requires a financial institution to provide notice to customers about its privacy policies...

  4. 17 CFR 248.8 - Revised privacy notices.

    Science.gov (United States)

    2010-04-01

    ...) REGULATIONS S-P AND S-AM Regulation S-P: Privacy of Consumer Financial Information and Safeguarding Personal... customer to a nonaffiliated third party, if that former customer has not had the opportunity to exercise an...

  5. 24 CFR 248.103 - General prepayment limitation.

    Science.gov (United States)

    2010-04-01

    ...) Effect of unauthorized prepayment. A mortgagee's acceptance of a prepayment in violation of paragraph (a... acceptance of a prepayment in violation of paragraph (a) of this section, or attempt to obtain voluntary... administrative action under parts 24 and 25 of this title, in addition to any other remedies available by law...

  6. 28 CFR 2.48 - Revocation: Preliminary interview.

    Science.gov (United States)

    2010-07-01

    ... OF PRISONERS, YOUTH OFFENDERS, AND JUVENILE DELINQUENTS United States Code Prisoners and Parolees § 2... himself or others. (f) Conviction as probable cause. Conviction of a Federal, State, or local crime...

  7. 24 CFR 248.105 - Notice of intent.

    Science.gov (United States)

    2010-04-01

    ... the owner intends to extend the affordability restrictions on the project by retaining ownership of... shall be furnished by the Commissioner. Upon the request of any non-English speaking tenants residing in... OF LOW INCOME HOUSING MORTGAGES Prepayments and Plans of Action Under the Low Income Housing...

  8. Dicty_cDB: SFF248 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available PPDQQRLIFA G--- ---KRTPSPFSLKIKRXYANFC*tsxw*txplgsgr*l*h*kxqsqnpxqxrxsprsttf hfrw*tikkwpyxx*lqhpkxipxpfsxxikrwxanxcknlxw*xxpxgsxrf...xxx*kcq sqnsxqxrfsprstxixfxwxtikxwxdxxxlqxskgipxpfsxxxkrxxanxc*nxxr* nxpxgsrrx Transla...*fsl v--- ---KRTPSPFSLKIKRXYANFC*tsxw*txplgsgr*l*h*kxqsqnpxqxrxsprsttf hfrw*tikkwpyxx*lqhpkxipxpfsxxikrwxanxcknlxw*xxpxgsxrf...xxx*kcq sqnsxqxrfsprstxixfxwxtikxwxdxxxlqxskgipxpfsxxxkrxxanxc*nx

  9. 248 A CRITICAL REVIEW OF ALEXIS KAGAME'S FOUR ...

    African Journals Online (AJOL)

    Ike Odimegwu

    and existence of philosophy precipitated the drive and the move of .... to do this, Kagame used a category that is akin to the systems of .... intelligence[17]. The appreciation of these beings is in most cases abstract and can only be made necessary and made concrete as long as they as symbols and appear in practice of ...

  10. Dicty_cDB: VSJ248 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available vrdnanq*m*s*rsnprrlclwm*kkleclpsmfrsccqira*rksklfrsifrtcsmy **mcwtkiicsikvkymanm*kiviknsnikkkkkixwxkxxlxkx*k...kkfxgxxpfx*xfkkkxf*xffxxkk- -- ---dnanq*m*s*rsnprrlclwm*kkleclpsmfrsccqira*rksklfrsifrtcsmy **mcwtk Frame C:

  11. 1935 15' Quad #248 Aerial Photo Mosaic Index

    Data.gov (United States)

    Earth Data Analysis Center, University of New Mexico — Aerial Photo Reference Mosaics contain aerial photographs that are retrievable on a frame by frame basis. The inventory contains imagery from various sources that...

  12. Dicty_cDB: AFK248 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available qkkilkyldi*vsein*rktil*inskrshqkfivki hl*af*lkehvyygnqknvskylmnc*n*ilyqskkvislavekyh*d*CQLPEVCQHRY EDLYFSVKL...me C: fqnysiqhlnnmisy*iiqiyiiqkkilkyldi*vsein*rktil*inskrshqkfivki hl*af*lkehvyygnqknvskylmnc*n*ilyqskkvislave

  13. Dicty_cDB: SHG248 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available lyiggtrkgyqqcrvflwr*kai--- ---refkeyklksirctfksnrfpkfipti*fin*sreifriikxstkiif*lfkkxyct iiiketkkpfrrd*icfstr...l**sfitittf*ftfwyf*ynnnnnqyk**yk*yk***ys itfr*srfyfnhhhyynhykykyyskscittfititn*ke*fncfstkttttttry*ync ttth*s

  14. Dicty_cDB: CHO248 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available TTGTTGCAGTTAAAAAGCTCGTAGTTGAAGTTTAAGGTTXXXXXXXXXX sequence update 2002.10.25 Translated Amino Acid sequence *lvdpasshmlvskikpcms...qqpavipapiaytkvvavkklvvev*g--- Translated Amino Acid sequence (All Frames) Frame A: *lvdpasshmlvskikpcmskykf

  15. Machine Learning-Augmented Propensity Score-Adjusted Multilevel Mixed Effects Panel Analysis of Hands-On Cooking and Nutrition Education versus Traditional Curriculum for Medical Students as Preventive Cardiology: Multisite Cohort Study of 3,248 Trainees over 5 Years

    Directory of Open Access Journals (Sweden)

    Dominique J. Monlezun

    2018-01-01

    Full Text Available Background. Cardiovascular disease (CVD annually claims more lives and costs more dollars than any other disease globally amid widening health disparities, despite the known significant reductions in this burden by low cost dietary changes. The world’s first medical school-based teaching kitchen therefore launched CHOP-Medical Students as the largest known multisite cohort study of hands-on cooking and nutrition education versus traditional curriculum for medical students. Methods. This analysis provides a novel integration of artificial intelligence-based machine learning (ML with causal inference statistics. 43 ML automated algorithms were tested, with the top performer compared to triply robust propensity score-adjusted multilevel mixed effects regression panel analysis of longitudinal data. Inverse-variance weighted fixed effects meta-analysis pooled the individual estimates for competencies. Results. 3,248 unique medical trainees met study criteria from 20 medical schools nationally from August 1, 2012, to June 26, 2017, generating 4,026 completed validated surveys. ML analysis produced similar results to the causal inference statistics based on root mean squared error and accuracy. Hands-on cooking and nutrition education compared to traditional medical school curriculum significantly improved student competencies (OR 2.14, 95% CI 2.00–2.28, p<0.001 and MedDiet adherence (OR 1.40, 95% CI 1.07–1.84, p=0.015, while reducing trainees’ soft drink consumption (OR 0.56, 95% CI 0.37–0.85, p=0.007. Overall improved competencies were demonstrated from the initial study site through the scale-up of the intervention to 10 sites nationally (p<0.001. Discussion. This study provides the first machine learning-augmented causal inference analysis of a multisite cohort showing hands-on cooking and nutrition education for medical trainees improves their competencies counseling patients on nutrition, while improving students’ own diets. This

  16. Cold valleys in the radioactive decay of 248− 254Cf isotopes

    Indian Academy of Sciences (India)

    Computed half-lives for alpha decay agree with experimental values within two orders of magnitude. The most probable clusters from these parents are predicted to be 46Ar, 48,50Ca which indicate the role of doubly or near doubly magic clusters in cluster radioactivity. Odd A clusters are found to be favorable for emission ...

  17. 17 CFR 248.15 - Other exceptions to notice and opt out requirements.

    Science.gov (United States)

    2010-04-01

    ... consumer's application for a mortgage loan. (2) A consumer may revoke consent by subsequently exercising... COMMISSION (CONTINUED) REGULATIONS S-P AND S-AM Regulation S-P: Privacy of Consumer Financial Information and... consent or at the direction of the consumer, provided that the consumer has not revoked the consent or...

  18. 24 CFR 248.233 - Approval of a plan of action that includes incentives.

    Science.gov (United States)

    2010-04-01

    ... best use; (c) The incentives are the least costly alternative for the Federal government to achieve the... increase in rents for current tenants (except for increases made necessary by increased operating costs... operating costs. (e) In cases where the owner agrees to maintain only a portion of the project as low income...

  19. 24 CFR 248.145 - Criteria for approval of a plan of action involving incentives.

    Science.gov (United States)

    2010-04-01

    ... action is, for the Federal Government, the least costly alternative that is consistent with the full... necessary by increased operating costs) shall be phased in as follows: (i) If such increase is 30 percent or..., to the portion of rent attributable to operating expenses for the project, and, where the owner is a...

  20. Cold valleys in the radioactive decay of 248−254Cf isotopes

    Indian Academy of Sciences (India)

    C46, 1939 (1992). [31] M Balasubramaniam and R K Gupta, Phys. Rev. C60, 064316 (1999). [32] D N Basu, Phys. Rev. C66, 027601 (2002). [33] P Moller, J R Nix, W D Myers and W Swiatecki, At. Data Nucl. Data Tables 59, 185. (1995). [34] S Wang, D Snowden-Ifft, P B Price, K J Moody and E K Hulet, Phys Rev. C39, 1647.

  1. 24 CFR 248.127 - Limitations on action pursuant to Federal cost limit.

    Science.gov (United States)

    2010-04-01

    ... cost limit. (b) Transfer of the project. With respect to owners who seek to transfer the project— (1) If the transfer preservation rent does not exceed the Federal cost limit, or if the transfer preservation rent exceeds the Federal cost limit and the owner is willing to transfer the project at a price...

  2. 17 CFR 248.10 - Limits on disclosure of nonpublic personal information to nonaffiliated third parties.

    Science.gov (United States)

    2010-04-01

    ...: Privacy of Consumer Financial Information and Safeguarding Personal Information Limits on Disclosures... customer opens an on-line account with you and agrees to receive the notices required in paragraph (a)(1) of this section electronically, and you allow the customer to opt out by any reasonable means within...

  3. : tous les projets | Page 248 | CRDI - Centre de recherches pour le ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Ce projet est l'un des sept financés grâce à l'initiative Centres africains de recherche sur l'adaptation du CRDI. Date de début : 8 mars 2011. End Date: 8 juillet 2014. Sujet: RESEARCH CAPACITY, POLICY MAKING, Climate change, ADAPTATION TO CHANGE, DISASTER PREPAREDNESS, DISASTER MANAGEMENT, ...

  4. Income inequality and mortality: a multilevel prospective study of 521 248 individuals in 50 US states.

    Science.gov (United States)

    Backlund, Eric; Rowe, Geoff; Lynch, John; Wolfson, Michael C; Kaplan, George A; Sorlie, Paul D

    2007-06-01

    Some of the most consistent evidence in favour of an association between income inequality and health has been among US states. However, in multilevel studies of mortality, only two out of five studies have reported a positive relationship with income inequality after adjustment for the compositional characteristics of the state's inhabitants. In this study, we attempt to clarify these mixed results by analysing the relationship within age-sex groups and by applying a previously unused analytical method to a database that contains more deaths than any multilevel study to date. The US National Longitudinal Mortality Study (NLMS) was used to model the relationship between income inequality in US states and mortality using both a novel and previously used methodologies that fall into the general framework of multilevel regression. We adjust age-sex specific models for nine socioeconomic and demographic variables at the individual level and percentage black and region at the state level. The preponderance of evidence from this study suggests that 1990 state-level income inequality is associated with a 40% differential in state level mortality rates (95% CI = 26-56%) for men 25-64 years and a 14% (95% CI = 3-27%) differential for women 25-64 years after adjustment for compositional factors. No such relationship was found for men or women over 65. The relationship between income inequality and mortality is only robust to adjustment for compositional factors in men and women under 65. This explains why income inequality is not a major driver of mortality trends in the United States because most deaths occur at ages 65 and over. This analysis does suggest, however, the certain causes of death that occur primarily in the population under 65 may be associated with income inequality. Comparison of analytical techniques also suggests coefficients for income inequality in previous multilevel mortality studies may be biased, but further research is needed to provide a definitive answer.

  5. 19 CFR 10.248 - Additional requirements for preferential treatment of brassieres.

    Science.gov (United States)

    2010-04-01

    ..., packing, and other costs incurred in transporting the fabrics to the place of production if included in... follows: (A) In the case of fabric purchased by the producer or entity controlling production, the f.o.b... other costs incurred in transporting the fabric to the place of production if included in that price; (B...

  6. 17 CFR 248.11 - Limits on redisclosure and reuse of information.

    Science.gov (United States)

    2010-04-01

    ... COMMISSION (CONTINUED) REGULATIONS S-P AND S-AM Regulation S-P: Privacy of Consumer Financial Information and... and use of that information is limited as follows: (i) You may disclose the information to the affiliates of the financial institution from which you received the information; (ii) You may disclose the...

  7. Wavelength tuning of photonic crystal waveguides fabricated using 248-nm deep UV lithography

    DEFF Research Database (Denmark)

    Zhuang, Yanxin; Frandsen, Lars Hagedorn; Harpøth, Anders

    2004-01-01

    Wavelength tuning of characteristic features of straight photonic crystal waveguides has been obtained by varying the exposure dose in deep UV lithography. The experimental results agree very well with numerical simulations....

  8. 7 CFR 248.16 - Administrative appeal of State agency decisions.

    Science.gov (United States)

    2010-01-01

    .../farmers' markets adversely affected by certain actions of the State agency may appeal those actions. A... the State agency disqualifying it from participating in the FMNP. A farmer/farmers' market may appeal... agency or farmer/farmers' market, a postponement is appropriate where the State agency finds that...

  9. 7 CFR 2.48 - Administrator, Rural Business-Cooperative Service.

    Science.gov (United States)

    2010-01-01

    ...) of the Act (42 U.S.C. 9611(f)), with respect to the designation of officials who may obligate money... U.S.C. 9601 et seq.). (19) Administer in rural areas the process of designation, provision of... Federal agencies in encouraging the creation of local rural community development organizations. Within a...

  10. People and things. CERN Courier, Oct 1984, v. 24(8)

    International Nuclear Information System (INIS)

    Anon.

    1984-01-01

    The article reports on achievements of various people, staff changes and position opportunities within the CERN organization and contains news updates on upcoming or past events. The second Jerusalem Winter School of Theoretical Physics, sponsored by Israel's Ministry of Science and the Institute for Advanced Studies of the Hebrew University of Jerusalem will take place form 27 December 1984 to 4 January 1985, with the title 'Physics in Higher Dimensions '. Formed this year in the University of Tokyo is ICEPP - International Centre for Elementary Particle Physics - under Masatoshi Koshiba. With sports commentators exhausted after the long grind of the British football season, the 10th UK National Bubble Chamber Fivea-Side Soccer Tournament held in London earlier this year did not attract the media coverage it deserved

  11. 27 CFR 24.248 - Processes authorized for the treatment of wine, juice, and distilling material.

    Science.gov (United States)

    2010-04-01

    ... transmembrane pressures of 250 psi or less. Osmotic transport 1 For alcohol reduction (1) Use must not alter the... which are selective for molecules not greater than 500 molecular weight with transmembrane pressures of... water for use in wine production. Thin-film evaporation under reduced pressure 1 To separate wine into a...

  12. 17 CFR 248.4 - Initial privacy notice to consumers required.

    Science.gov (United States)

    2010-04-01

    ... relationship when the consumer: (i) Effects a securities transaction with you or opens a brokerage account with you under your procedures; (ii) Opens a brokerage account with an introducing broker or dealer that... an advisory contract with you (whether in writing or orally); or (iv) Purchases shares you have...

  13. SU-E-J-248: Contributions of Tumor and Stroma Phenotyping in Computer-Aided Diagnosis

    Energy Technology Data Exchange (ETDEWEB)

    Li, H; Lan, L; Sennett, C; Giger, M [Univ Chicago, Chicago, IL (United States)

    2015-06-15

    Purpose: To gain insight into the role of parenchyma stroma in the characterization of breast tumors by incorporating computerized mammographic parenchyma assessment into breast CADx in the task of distinguishing between malignant and benign lesions. Methods: This study was performed on 182 biopsy-proven breast mass lesions, including 76 benign and 106 malignant lesions. For each full-field digital mammogram (FFDM) case, our quantitative imaging analysis was performed on both the tumor and a region-of-interest (ROI) from the normal contralateral breast. The lesion characterization includes automatic lesion segmentation and feature extraction. Radiographic texture analysis (RTA) was applied on the normal ROIs to assess the mammographic parenchymal patterns of these contralateral normal breasts. Classification performance of both individual computer extracted features and the output from a Bayesian artificial neural network (BANN) were evaluated with a leave-one-lesion-out method using receiver operating characteristic (ROC) analysis with area under the curve (AUC) as the figure of merit. Results: Lesion characterization included computer-extracted phenotypes of spiculation, size, shape, and margin. For parenchymal pattern characterization, five texture features were selected, including power law beta, contrast, and edge gradient. Merging of these computer-selected features using BANN classifiers yielded AUC values of 0.79 (SE=0.03) and 0.67 (SE=0.04) in the task of distinguishing between malignant and benign lesions using only tumor phenotypes and texture features from the contralateral breasts, respectively. Incorporation of tumor phenotypes with parenchyma texture features into the BANN yielded improved classification performance with an AUC value of 0.83 (SE=0.03) in the task of differentiating malignant from benign lesions. Conclusion: Combining computerized tumor and parenchyma phenotyping was found to significantly improve breast cancer diagnostic accuracy highlighting the need to consider both tumor and stroma in decision making. Funding: University of Chicago Dean Bridge Fund, NCI U24-CA143848-05, P50-CA58223 Breast SPORE program, and Breast Cancer Research Foundation. COI: MLG is a stockholder in R2 technology/Hologic and receives royalties from Hologic, GE Medical Systems, MEDIAN Technologies, Riverain Medical, Mitsubishi, and Toshiba. MLG is a cofounder and stockholder in Quantitative Insights.

  14. 26 CFR 1.248-1 - Election to amortize organizational expenditures.

    Science.gov (United States)

    2010-04-01

    ... expenditures relate is for a fixed term of years; (ii) Expenditures connected with the transfer of assets to a... the like; necessary accounting services; expenses of temporary directors and of organizational...

  15. 30 CFR 250.248 - What solid and liquid wastes and discharges information and cooling water intake information must...

    Science.gov (United States)

    2010-07-01

    ... Mineral Resources MINERALS MANAGEMENT SERVICE, DEPARTMENT OF THE INTERIOR OFFSHORE OIL AND GAS AND SULPHUR OPERATIONS IN THE OUTER CONTINENTAL SHELF Plans and Information Contents of Development and Production Plans... quantity, and composition of solid and liquid wastes (such as spent drilling fluids, drill cuttings, trash...

  16. 17 CFR Appendix A to Subpart A of... - Appendix A to Subpart A of Part 248 Forms

    Science.gov (United States)

    2010-04-01

    ... affiliates, state, as applicable: “Our affiliates include companies with a [common corporate identity of... corporate logo on any page of the notice, so long as it does not interfere with the readability of the model... identity of affiliated institutions jointly providing the notice on the form wherever [name of financial...

  17. SU-E-T-248: Near Real-Time Analysis of Radiation Delivery and Imaging, Accuracy to Ensure Patient Safety

    Energy Technology Data Exchange (ETDEWEB)

    Wijesooriya, K; Seitter, K; Desai, V; Read, P; Larner, J [University of Virginia Health Systems, Charlottesville, VA (United States)

    2014-06-01

    Purpose: To develop and optimize an effective software method for comparing planned to delivered control point machine parameters for all VARIAN TrueBeam treatments so as to permit (1) assessment of a large patient pool throughout their treatment course to quantify treatment technique specific systematic and random uncertainty of observables, (2) quantify the site specific daily imaging shifts required for target alignment, and (3) define tolerance levels for mechanical parameters and imaging parameters based on statistical analysis data gathered, and the dosimetric impact of variations. Methods: Treatment and imaging log files were directly compared to plan parameters for Eclipse and Pinnacle planned treatments via 3D, IMRT, control point, RapidArc, and electrons. Each control point from all beams/arcs (7984) for all fractions (1940) of all patients treated over six months were analyzed. At each control point gantry angle, collimator angle, couch angle, jaw positions, MLC positions, MU were compared. Additionally per-treatment isocenter shifts were calculated. Results were analyzed as a whole in treatment type subsets: IMRT, 3D, RapidArc; and in treatment site subsets: brain, chest/mediastinum, esophagus, H and N, lung, pelvis, prostate. Results: Daily imaging isocenter shifts from initial external tattoo alignment were dependent on the treatment site with < 0.5 cm translational shifts for H and N, Brain, and lung SBRT, while pelvis, esophagus shifts were ∼1 cm. Mechanical delivery parameters were within tolerance levels for all sub-beams. The largest variations were for RapidArc plans: gantry angle 0.11±0.12,collimator angle 0.00±0.00, jaw positions 0.48±0.26, MLC leaf positions 0.66±0.08, MU 0.14±0.34. Conclusion: Per-control point validation reveals deviations between planned and delivered parameters. If used in a near real-time error checking system, patient safety can be improved by equipping the treatment delivery system with additional forcing functions which by-pass human error avenues.

  18. 77 FR 26824 - Agency Information Collection; Activity Under OMB Review; Submission of Audit Reports-Part 248

    Science.gov (United States)

    2012-05-07

    ...: BTS collects independent audited financial reports from U.S. certificated air carriers. Carriers not having an annual audit must file a statement that no such audit has been performed. In lieu of the audit... used by analyst in examining proposed mergers, acquisitions and consolidations, (4) a means whereby BTS...

  19. SU-E-J-248: Comparative Study of Two Image Registration for Image-Guided Radiation Therapy in Esophageal Cancer

    International Nuclear Information System (INIS)

    Shang, K; Wang, J; Liu, D; Li, R; Cao, Y; Chi, Z

    2014-01-01

    Purpose: Image-guided radiation therapy (IGRT) is one of the major treatment of esophageal cancer. Gray value registration and bone registration are two kinds of image registration, the purpose of this work is to compare which one is more suitable for esophageal cancer patients. Methods: Twenty three esophageal patients were treated by Elekta Synergy, CBCT images were acquired and automatically registered to planning kilovoltage CT scans according to gray value or bone registration. The setup errors were measured in the X, Y and Z axis, respectively. Two kinds of setup errors were analysed by matching T test statistical method. Results: Four hundred and five groups of CBCT images were available and the systematic and random setup errors (cm) in X, Y, Z directions were 0.35, 0.63, 0.29 and 0.31, 0.53, 0.21 with gray value registration, while 0.37, 0.64, 0.26 and 0.32, 0.55, 0.20 with bone registration, respectively. Compared with bone registration and gray value registration, the setup errors in X and Z axis have significant differences. In Y axis, both measurement comparison results of T value is 0.256 (P value > 0.05); In X axis, the T value is 5.287(P value < 0.05); In Z axis, the T value is −5.138 (P value < 0.05). Conclusion: Gray value registration is recommended in image-guided radiotherapy for esophageal cancer and the other thoracic tumors. Manual registration could be applied when it is necessary. Bone registration is more suitable for the head tumor and pelvic tumor department where composed of redundant interconnected and immobile bone tissue

  20. SU-E-T-248: Near Real-Time Analysis of Radiation Delivery and Imaging, Accuracy to Ensure Patient Safety

    International Nuclear Information System (INIS)

    Wijesooriya, K; Seitter, K; Desai, V; Read, P; Larner, J

    2014-01-01

    Purpose: To develop and optimize an effective software method for comparing planned to delivered control point machine parameters for all VARIAN TrueBeam treatments so as to permit (1) assessment of a large patient pool throughout their treatment course to quantify treatment technique specific systematic and random uncertainty of observables, (2) quantify the site specific daily imaging shifts required for target alignment, and (3) define tolerance levels for mechanical parameters and imaging parameters based on statistical analysis data gathered, and the dosimetric impact of variations. Methods: Treatment and imaging log files were directly compared to plan parameters for Eclipse and Pinnacle planned treatments via 3D, IMRT, control point, RapidArc, and electrons. Each control point from all beams/arcs (7984) for all fractions (1940) of all patients treated over six months were analyzed. At each control point gantry angle, collimator angle, couch angle, jaw positions, MLC positions, MU were compared. Additionally per-treatment isocenter shifts were calculated. Results were analyzed as a whole in treatment type subsets: IMRT, 3D, RapidArc; and in treatment site subsets: brain, chest/mediastinum, esophagus, H and N, lung, pelvis, prostate. Results: Daily imaging isocenter shifts from initial external tattoo alignment were dependent on the treatment site with < 0.5 cm translational shifts for H and N, Brain, and lung SBRT, while pelvis, esophagus shifts were ∼1 cm. Mechanical delivery parameters were within tolerance levels for all sub-beams. The largest variations were for RapidArc plans: gantry angle 0.11±0.12,collimator angle 0.00±0.00, jaw positions 0.48±0.26, MLC leaf positions 0.66±0.08, MU 0.14±0.34. Conclusion: Per-control point validation reveals deviations between planned and delivered parameters. If used in a near real-time error checking system, patient safety can be improved by equipping the treatment delivery system with additional forcing functions which by-pass human error avenues

  1. 24 CFR 248.141 - Criteria for approval of a plan of action involving prepayment and voluntary termination.

    Science.gov (United States)

    2010-04-01

    ... Consumer Price Index or 10 percent (whichever is lower); or (ii) Involuntarily displace current tenants... Age Discrimination Act of 1975 (42 U.S.C. 6101-6107); section 504 of the Rehabilitation Act of 1973...

  2. 24 CFR 248.221 - Approval of a plan of action that involves termination of low income affordability restrictions.

    Science.gov (United States)

    2010-04-01

    ... monthly rental payment in any year that exceeds the increase in the Consumer Price Index or 10 percent...); the Age Discrimination Act of 1975 (42 U.S.C. 6101-6107); section 504 of the Rehabilitation Act of...

  3. Investigation of the threshold intensity versus gas pressure in the breakdown of helium by 248 nm laser radiation

    Science.gov (United States)

    Gamal, Yosr E. E.-D.; Abdellatif, Galila

    2014-10-01

    An investigation of the unexpectedly strong dependence of the threshold intensity on the gas pressure in the experimental study on the breakdown of He by short laser wavelength (Turcu et al., in Opt Commun, 134:66-68, 1997) is presented. A modified electron cascade model is applied (Evans and Gamal, in J Phys D Appl Phys, 13:1447-1458, 1980). Computations revealed reasonable agreement between the calculated thresholds and the measured ones. Moreover, the calculated electron energy distribution function and its parameters proved that multiphoton ionization of ground and excited atoms is the main source for the seed electrons, which contributes to the breakdown of helium. The effect of diffusion losses over pressures <1,000 Torr elucidated the origin of the strong dependence of the threshold intensity on the gas pressure. Collisional ionization dominates only at high pressures. No evidence for recombination losses is observed for pressures up to 3,000 Torr.

  4. 77 FR 12365 - Agency Information Collection; Activity Under OMB Review: Submission of Audit Reports-Part 248

    Science.gov (United States)

    2012-02-29

    ... (BTS), DOT. ACTION: Notice. SUMMARY: In compliance with the Paperwork Reduction Act of 1995, Public Law... governmental parties to comment on the continuing need for and usefulness of BTS requiring U.S. large... needed by BTS and DOT; (2) BTS accurately estimated the reporting burden; (3) there are other ways to...

  5. Historic Archaeology of the Johnson (41DN248) and Jones (41DN250) Farmsteads in the Ray Roberts Lake Area: 1850-1950

    Science.gov (United States)

    1996-08-15

    were favorable (Hill 1887) . Present-day dominants, Texas stipa (Stipa leucotricha ) and silver bluestem (Andropogon saccharoides), may have been...Indian grass, switchgrass, sideoats grama, hairy grama (Bouteloua hirsuta), tall dropseed (Sporobolus asr) and Texas wintergrasf (.. leucotricha

  6. Conflitos Sociais na Europa: uma paz impossível? 10.5102/uri.v4i1.248

    Directory of Open Access Journals (Sweden)

    Leila Bijos

    2007-08-01

    Full Text Available Análise dos movimentos sociais na França e na América Latina, num contexto de ausência de programas políticos de inserção de imigrantes. Por meio da violência, os jovens manifestantes expressam seu inconformismo com o desemprego, o fracasso escolar e outros sintomas da discriminação de que se julgam vítimas, inclusive por parte da polícia. A passagem do estado de natureza até o estado social produz no homem uma mudança bem acentuada, substituindo, em sua conduta, o instinto pelo sentimento de justiça, e outorgando a suas ações relações morais que antes estavam ausentes. À medida que a repressão se intensifique, fica ainda mais difícil a percepção da realidade. A França, como sociedade pode converter-se em uma ameaça a si própria ao não combinar integração e diferenças socioeconômicas, superando a oposição entre um modelo republicano e um comunitarismo carregado de agressividade. A América Latina vivenciou uma longa era de repressão militar, de violência, oprimida por um Estado distante dos indivíduos; incapaz de suprí-los com políticas públicas e sociais. Na sociedade civil é onde surgem e se desenvolvem os conflitos econômicos, sociais, ideológicos, religiosos, que as instituições públicas têm o dever de equacionar.

  7. Excimer laser irradiation at 248 nm of wooden archaeological objects and polymeric consolidants used in conservation: a study of cone formation and optimum cleaning parameters

    Science.gov (United States)

    Belli, R.; Toniutti, L.; Miotello, A.; Mosaner, P.; Avi, D.

    2008-07-01

    Samples of a prehistoric consolidated vegetable basketry, coming from an important pile building in the North-East of Italy (Fiavé Carrera, Trento), had been irradiated with excimer laser pulses to remove the consolidant layer and restore the artifact. Some problems, related to the nature of the consolidant resin, were found in the preliminary laser cleaning process. The two main obstacles were related to the unknown composition of the polymeric resin and to the irregular surface morphology of the archaeological find. We observed that large numbers of laser pulses, for selected laser parameters, strongly modify the resin surface morphology with formation of a large number of cones. After cone formation, the surface was so irregular that it was almost impossible to complete the laser cleaning procedure. To find a solution to the problem, we here try to understand the mechanisms of cone formation in the present polymeric material. Scanning electron microscopy (SEM) and Fourier transformation infrared spectroscopy (FTIR) have been used to study surface morphology and chemical modification after selected irradiation processes. To understand the influence of laser irradiation on surface modifications and to establish a cleaning procedure for this specific application, investigations have been carried out separately on models of resin consolidants and wood (both dried and buried wood sample). The consolidants were commercial resins, typically used in archaeological conservation (Plexisol and Paraloid), deposited on a silicon substrate. Silicon was used because it is an appropriate substrate in FT-IR analysis. Finally, we chose wood because of its wide use in prehistoric artefact (Viburnum lantana).

  8. The Behaviour of the Military Battery Type BB248/U Used to Start the Engine of the A.P.C.

    Science.gov (United States)

    1979-12-01

    pour une durée de30 A 45 sin. Enfin , is viacositC de l’huile A moteur eat susceptible d’influenc,rl’aptitude au démarrage. C’est ainsi que deux ...comprises entre —18 et —26 C. La moteur , de type diesel, démarre ~ is t~~pérature minlmale de—20 C sans assistance d’accumulateurs auxilisir es d...ora que is temp ~ratureinitlaje des accumulateurs eat de —15 C. La courant de d~charge moyen , ischarge requise et is durêe de cette décharge sont de

  9. A pacemaker with P = 2.48 h modulated the generator of flares in the X-ray light curve of Sgr A* in the year 2012

    Science.gov (United States)

    Leibowitz, Elia

    2017-01-01

    In an intensive observational campaign in the nine month duration of Chandra X-ray Visionary Project that was conducted in the year 2012, 39 large X-ray flares of Sgr A* were recorded. An analysis of the times of the observed flares reveals that the 39 flares are separated in time by intervals that are grouped around integer numbers times 0.10333 days. This time interval is thus the period of a uniform grid of equally spaced points on the time axis. The grouping of the flares around tic marks of this grid is derived from the data with at least a 3.2 σ level of statistical significance. No signal of any period can be found among 22 flares recorded by Chandra in the years 2013-2014. If the 0.10333 day period is that of a nearly circular Keplerian orbit around the blackhole at the center of the Galaxy, its radius is at 7.6 Schwarzschild radii. Large flares were more likely to be triggered when the agent responsible for their outbursts was near the peri-center phase of its slightly eccentric orbit.

  10. Phosphorylation of Serine 248 of C/EBPa Is Dispensable for Myelopoiesis but Its Disruption Leads to a Low Penetrant Myeloid Disorder with Long Latency

    DEFF Research Database (Denmark)

    Hasemann, Marie S; Schuster, Mikkel B; Frank, Anne-Katrine

    2012-01-01

    Transcription factors play a key role in lineage commitment and differentiation of stem cells into distinct mature cells. In hematopoiesis, they regulate lineage-specific gene expression in a stage-specific manner through various physical and functional interactions with regulatory proteins that ...

  11. Influence of cold work in the elastic modulus of the Ti-16.2Hf-24.8Nb-1Zr alloy characterized by instrumented nanoindentation

    OpenAIRE

    González Colominas, Marta; Peña Andrés, Francisco Javier; Manero Planella, José María; Gil Mur, Francisco Javier

    2010-01-01

    Nowadays, β type Ti-based alloys have been developed for load transfer clinical applications due to their superelasticity, shape memory effect, low elastic modulus and high damping capacity [1]. These properties promote bone regeneration and make them promising candidates for being used in load transfer implantology. The objective of the present work is to achieve a material with shape memory properties and/or low elastic modulus. The influence of cold work on the thermoelastic...

  12. A Test of the Homogeneity Thesis of the Culture of Poverty Theory: Characteristics of Disadvantaged Farm Families. Tech. Bul. No. 248, December 1975.

    Science.gov (United States)

    White, Estelle E.; Clay, Rex J.

    Utilizing data derived from a stratified random sample of disadvantaged farm families (DFF) living in 3 northeastern North Carolina counties (N=42, 56, and 32 families from Bertie, Halifax, and Northampton respectively), study objectives were to test the homogeneity thesis of the culture of poverty theory via a comparison of a selected set of…

  13. Chemistry of the heaviest elements--one atom at a time

    International Nuclear Information System (INIS)

    Hoffman, Darleane C.; Lee, Diana M.

    2000-01-01

    In keeping with the goal of the Viewpoint series of the Journal of Chemical Education, this article gives a 75-year perspective of the chemistry of the heaviest elements, including a 50-year retrospective view of past developments, a summary of current research achievements and applications, and some predictions about exciting, new developments that might be envisioned within the next 25 years. A historical perspective of the importance of chemical separations in the discoveries of the transuranium elements from neptunium (Z=93) through mendelevium (Z=101) is given. The development of techniques for studying the chemical properties of mendelevium and still heavier elements on the basis of measuring the radioactive decay of a single atom (''atom-at-a-time'' chemistry) and combining the results of many separate experiments is reviewed. The influence of relativistic effects (expected to increase as Z 2 ) on chemical properties is discussed. The results from recent atom-at-a-time studies of the chemistry of the heaviest elements through seaborgium (Z=106) are summarized and show that their properties cannot be readily predicted based on simple extrapolation from the properties of their lighter homologues in the periodic table. The prospects for extending chemical studies to still heavier elements than seaborgium are considered and appear promising

  14. CTD data of the Hawaii Ocean Time-series (HOT) program in the North Pacific 100 miles north of Oahu, Hawaii for cruises HOT239-248 during 2012 (NODC Accession 0119895)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — The HOT program makes repeated observations of the physics, biology and chemistry at a site approximately 100 km north of Oahu, Hawaii. Two stations are visited...

  15. Niskin bottle data of the Hawaii Ocean Time-series (HOT) program in the North Pacific 100 miles north of Oahu, Hawaii for cruises HOT239-248 during 2012 (NCEI Accession 0119430)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — The HOT program makes repeated observations of the physics, biology and chemistry at a site approximately 100 km north of Oahu, Hawaii. Two stations are visited...

  16. Oubrou Tareq, Privot Michaël et Baylocq Cédric, Profession imâm : entretiens avec Michaël Privot et Cédric Baylocq, Paris, Albin Michel, 2009, 248 p.

    Directory of Open Access Journals (Sweden)

    Marie-Laure Boursin

    2011-11-01

    Full Text Available Ce recueil d’entretiens avec Tareq Oubrou s’ouvre sur un avant-propos des co-auteurs, Michaël Privot et Cédric Baylocq. Le premier, docteur en langues et lettres, spécialisé en philosophie islamique classique, s’est converti, adolescent, à l’islam ; le second, doctorant en anthropologie, se présente comme agnostique, « animé de profondes convictions laïques républicaines » (p. 15. A partir d’entretiens effectués entre 2006 et 2008, autour de divers thèmes, les auteurs tentent d’appréhender c...

  17. Commentary on manuscript "Comment on 'The one-dimensional acoustic field with arbitrary mean axial temperature gradient and mean flow' (J. Li and A. S. Morgans, Journal of Sound and Vibration 400 (2017) 248-269)"

    Science.gov (United States)

    Li, Jingxuan; Morgans, Aimee S.

    2017-12-01

    The authors sincerely thank Dukumaci for his great interest in our investigation. In his comment, he proposed an analytical solution based on the "matrizant" approach [1,2]. The two linearised Euler equations as functions of pressure p ˆ and velocity perturbations û are transformed to a first order matrix ordinary differential equation (Eq. (3) in Dokumaci's comment) as functions of two new coefficients p± directly linking p ˆ and û (using Eq. (4) in his comment). At sufficiently high frequencies, the off-diagonal terms of the matrizant can be assumed zero; this decouples p+ and p-, and the analytical solution of p± (Eq. (7) in Dokumaci's comment) follows from the simplified first order matrix ordinary differential equation.

  18. Design and characterization of a low-viscous muscle tissue mimicking media at the ISM-band (2.4–2.48 GHz) for easy antenna displacement in in vitro measurements

    DEFF Research Database (Denmark)

    Jónasson, Sævar Þór; Zhurbenko, Vitaliy; Johansen, Tom Keinicke

    2012-01-01

    Phantoms mimicking electromagnetic properties of biological tissues are widely used in evaluation of electromagnetic field distribution in human body. In this paper, low-viscous, optically transparent liquids that mimic muscle tissue, are designed and characterized. Various mixing ratios of de-io...... be produced. For example, a recipe for the grey matter of the human brain is suggested, resulting in less than 4.7% deviation. An improved recipe for muscle tissue, where Triton X-100 is added, improves the target recipe to less than 1% deviation from the reference....

  19. Pap Test Reporting Rates for Conventional Smear and Liquid-Based Cervical Cytology from the Largest Academic Women's Hospital in China: Analysis of 1,248,785 Pap Test Reports.

    Science.gov (United States)

    Tao, Xiang; Austin, R Marshall; Zhang, Hao; Zhang, Lihong; Xiao, Jianan; Wang, Li; Zhou, Xianrong; Zhao, Chengquan

    2015-01-01

    The Obstetrics and Gynecology Hospital of Fudan University (OGHFU) in Shanghai is the largest academic women's hospital in China. Between 2009 and 2014, the use of liquid-based cytology (LBC) significantly increased while gradually adopting the Bethesda System (TBS), and in 2012 local regulations mandated that pathologists replace technicians to sign out Pap tests. A retrospective OGHFU database search documented all Pap test reports between 2009 and 2014 by specimen type, either LBC or conventional Pap smears (CPS), and final reporting category. A total of 1,224,785 Pap reports were analyzed to document variations in Pap test reporting during a period of major change in cervical screening in China. LBC gradually replaced CPS, which declined from over 65% of Pap tests in 2010 to 6.4% in 2014. Of 514,811 Pap reports using the traditional class system, class I (negative) reports accounted for 98.3% of results. With the introduction of TBS reporting, pathologist reviews and substantial replacement of CPS by LBC, the laboratory abnormal Pap test rate increased significantly to almost 5%. Changes in cervical cytology reporting between 2009 and 2014 in China's largest academic women's hospital reflected both increased use of LBC and the introduction of pathologist TBS reporting. Abnormality rates increased significantly and fell within CAP benchmark ranges. © 2016 S. Karger AG, Basel.

  20. Amplification at λ ∼ 2.8 A on Xe(L),(2s-bar2p-bar) double-vacancy states produced by 248 nm excitation of Xe clusters in plasma channels

    International Nuclear Information System (INIS)

    Borisov, Alex B; Song Xiangyang; Zhang Ping; Dasgupta, Arati; Davis, Jack; Kepple, Paul C; Dai Yang; Boyer, Keith; Rhodes, Charles K

    2005-01-01

    Xe(L),(2s-bar2p-bar) double-vacancy states undergo strong amplification in relativistic self-trapped plasma channels on 3d → 2p transitions in the λ = 2.78-2.81 A region. The 2 P 3/2 → 2 S 1/2 component at λ ≅ 2.786 A exhibits saturated amplification demonstrated by both (1) the observation of spectral hole-burning in the spontaneous emission profile and (2) the correlated enhancement of 3p → 2s cascade transitions ( 2 S 1/2 → 2 P j ; j = 1/2, 3/2) at λ = 2.558 and λ = 2.600 A. The condition of saturation places a lower limit of ∼10 17 W cm -2 on the intensity of the x-ray beam produced by the amplification in the channel. The anomalous strength of the amplification signalled by the saturation mirrors the equivalently anomalous behaviour observed for all 3d → 2p transitions corresponding to 2p-bar) single-vacancy Xe q+ arrays (q = 31, 32, 34, 35, 36) that exhibit gain. The conspicuous absence of amplification involving states with (2p-bar) 2 double-vacancy configurations suggests the operation of a selective interaction that enhances the production of 2s-bar2p-bar states. Overall, the generation of double-vacancy states of this genre demonstrates that an excitation rate approaching ∼1 W/atom for ionic species is achievable in self-trapped plasma channels

  1. Protein (Viridiplantae): 128879 [PGDBj - Ortholog DB

    Lifescience Database Archive (English)

    Full Text Available 5:248 3803:248 ... 3814:248 ... 163722:3689 ... 3826:3689 ... 3827:3689 ... PREDICTED: uncharacterized protein LOC101515541 Cicer arietinum MNSSTI...CSLFLGLILISQSANAKGHGGGLVVTICKGATDRAACENILGSNSEISHAKSFSQL

  2. The discovery of 260Md and the decay properties of 258Fm, 258m,gMd and 259Md

    International Nuclear Information System (INIS)

    Lougheed, R.W.; Hulet, E.K.; Dougan, R.J.; Wild, J.F.; Dupzyk, R.J.; Henderson, C.M.; Moody, K.J.; Hahn, R.L.; Suemmerer, K.; Bethune, G.

    1986-01-01

    We have discovered a new neutron-rich isotope, 260 Md, from 18 O and 22 Ne bombardments of 254 Es. We observed a spontaneous-fission (SF) activity with a half-life of 32 days in electromagnetically separated fractions with mass number 260 from these bombardments and we measured the mass and kinetic energy distributions of this SF activity. The mass distribution was symmetric with the principal energy peak at a total kinetic energy (TKE) of 234 MeV, similar to previous observations for heavy fermium isotopes. Surprisingly, we also observed a smaller symmetric component with a TKE of 195 MeV. We interpret these two peaks in the TKE distribution as arising from two types of fission in the same nucleus, or bimodal fission. The observed fission activity may be either from the SF decay of 260 Md or from 260 Fm which would arise from electron-capture (EC) decay of 260 Md. We have eliminated the possible β - decay of 260 Md by measuring β - -SF time correlations for the decay of 260 Md and we plan to determine whether 260 Md decays by EC by measuring time correlations between fermium X-rays and SF events. We also measured various properties of the heavy fermium and mendelevium isotopes and obtained 1. more accurate cross-sections for the neutron-rich mendelevium isotopes which we use to predict the production rates of yet undiscovered nuclides, 2. improved half-life measurements for 258m,g Md and 259 Md, 3. confirmation of the EC decay of 258m Md by measurement of the fermium X-rays preceding the SF decay of 258 Fm and 4. very substantially improved mass and TKE distributions for the SF decay of 258 Fm and 259 Md. (orig.)

  3. ORF Alignment: NC_004757 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available ... Length = 212 ... Query: 189 LSGKRVLVTAGPTFEALDAVRGLTNLSSGKTXXXXXXXXXXXXXXVTLVCGPVCPPFPAV 248 ... LSGKRVLVTAGPTFE...ALDAVRGLTNLSSGKT ... VTLVCGPVCPPFPAV Sbjct: 1 ... LSGKRVLVTAGPTFE

  4. ORF Alignment: NC_004310 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available ALGLAANGLKVGILDADIYGPSMPRLLGLSGRPETVEGRI 60 ... Query: 248 AQLTMAQQVPLAGAVVVSTPQDLALIDARKGLNMFRKVDVPLLGIVENMSYF...IAPDTGTR 307 ... AQLTMAQQVPLAGAVVVSTPQDLALIDARKGLNMFRKVDVPLLGIVENMSYFIAPDTGTR Sbjct: 121 AQLTMAQQVPLAGAVVVSTPQDLALIDAR

  5. ORF Alignment: NC_004369 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available YLESAHKIIIEVNSWQSLELEGMADIYRVPH 180 ... Query: 248 LEGEVRAGRLTYDGYIMQSGVGNVPNAVMAGLLDSKFENIKAYTEVVQDGMLDLIDAGKM... 307 ... LEGEVRAGRLTYDGYIMQSGVGNVPNAVMAGLLDSKFENIKAYTEVVQDGMLDLIDAGKM Sbjct: 241 LEGEVRAGRLTYDGYIMQSGVGNVPNAVMAG

  6. ORF Alignment: NC_004369 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NAAEKIIIEVNSWQSADLEGMHDIWSMPK 180 ... Query: 248 LEGEVRAGRLSYDGYVMQSGVGNVPNAVMAGLLDSKFENIQAYTEVIQDGMVDLIDAGKM 3...07 ... LEGEVRAGRLSYDGYVMQSGVGNVPNAVMAGLLDSKFENIQAYTEVIQDGMVDLIDAGKM Sbjct: 241 LEGEVRAGRLSYDGYVMQSGVGNVPNAVMAG

  7. Study of Search Engine Transaction Logs Shows Little Change in How Users use Search Engines. A review of: Jansen, Bernard J., and Amanda Spink. “How Are We Searching the World Wide Web? A Comparison of Nine Search Engine Transaction Logs.” Information Processing & Management 42.1 (2006: 248‐263.

    Directory of Open Access Journals (Sweden)

    David Hook

    2006-09-01

    Full Text Available Objective – To examine the interactions between users and search engines, and how they have changed over time. Design – Comparative analysis of search engine transaction logs. Setting – Nine major analyses of search engine transaction logs. Subjects – Nine web search engine studies (4 European, 5 American over a seven‐year period, covering the search engines Excite, Fireball, AltaVista, BWIE and AllTheWeb. Methods – The results from individual studies are compared by year of study for percentages of single query sessions, one term queries, operator (and, or, not, etc. usage and single result page viewing. As well, the authors group the search queries into eleven different topical categories and compare how the breakdown has changed over time. Main Results – Based on the percentage of single query sessions, it does not appear that the complexity of interactions has changed significantly for either the U.S.‐based or the European‐based search engines. As well, there was little change observed in the percentage of one‐term queries over the years of study for either the U.S.‐based or the European‐based search engines. Few users (generally less than 20% use Boolean or other operators in their queries, and these percentages have remained relatively stable. One area of noticeable change is in the percentage of users viewing only one results page, which has increased over the years of study. Based on the studies of the U.S.‐based search engines, the topical categories of ‘People, Place or Things’ and ‘Commerce, Travel, Employment or Economy’ are becoming more popular, while the categories of ‘Sex and Pornography’ and ‘Entertainment or Recreation’ are declining. Conclusions – The percentage of users viewing only one results page increased during the years of the study, while the percentages of single query sessions, oneterm sessions and operator usage remained stable. The increase in single result page viewing implies that users are tending to view fewer results per web query. There was also a significant difference in the percentage of queries using Boolean operators between the US‐based and the European‐based search engines. One of the study’s findings was that results from a study of a particular search engine cannot necessarily be applied to all search engines. Finally, web search topics show a trend towards information or commerce searching rather than entertainment.

  8. Comment on "Nanosecond laser textured superhydrophobic metallic surfaces and their chemical sensing applications" by Duong V. Ta, Andrew Dunn, Thomas J. Wasley, Robert W. Kay, Jonathan Stringer, Patrick J. Smith, Colm Connaughton, Jonathan D. Shephard (Appl. Surf. Sci. 357 (2015) 248-254)

    Science.gov (United States)

    Boinovich, L. B.; Emelyanenko, A. M.; Emelyanenko, K. A.; Domantovsky, A. G.; Shiryaev, A. A.

    2016-08-01

    Nowadays the problem of design of durable ecologically friendly superhydrophobic surfaces is of great importance for science and technology. A recent paper in Applied Surface Science reports the method of fabricating the superhydrophobic metallic surfaces by infrared nanosecond laser surface texturing without using hydrophobic agents. Since this method of surface texturing can be considered as one of the most suitable for various industrial applications, the nature of superhydrophobic state of surfaces produced by laser texturing in the abovementioned paper deserves to be analyzed in detail. Authors of the commented paper attributed the change in wettability to the partial deoxidation of CuO into Cu2O on the surface during storage in atmosphere. However, such interpretation of the results contradicts to the basic notions in the theory of wetting and to more accurate and detailed data. In our Comment we discuss these contradictions point by point.

  9. 248. Reemplazo de raíz de aorta según técnica de david y de arco aórtico con injerto trifurcado, en un paciente diagnosticado de síndrome de loeys-dietz

    Directory of Open Access Journals (Sweden)

    A. Forteza Gil

    2010-01-01

    Resultado y conclusiones: No hubo complicaciones postoperatorias. El tratamiento quirúrgico precoz en los pacientes afectos de síndrome de Loeys-Dietz es imprescindible. La experiencia acumulada hasta el momento revela la agresividad de esta enfermedad. Por ello, es necesario un abordaje completo cuando existe afectación a distintos niveles. El empleo de técnicas de preservación valvular permite además disminuir la morbimortalidad asociada a las prótesis valvulares.

  10. Changing composition of human capital: the Czech Republic, Hungary, and Poland

    Czech Academy of Sciences Publication Activity Database

    Jeong, Byeongju; Kejak, Michal; Vinogradov, Viatcheslav

    -, č. 248 (2005), s. 1-27 ISSN 1211-3298 Institutional research plan: CEZ:AV0Z70850503 Keywords : human capital * composition * occupation Subject RIV: AH - Economics http://www.cerge-ei.cz/pdf/wp/Wp248.pdf

  11. Journal of Biosciences | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    Home; Journals; Journal of Biosciences; Volume 28; Issue 3. Issue front cover thumbnail. Volume 28, Issue 3. April 2003, pages 248-358. Viral Evasion of Host Responses. pp 248-248. Preface · Shahid Jameel · More Details Fulltext PDF. pp 249-264 Articles. Viral mimicry of the complement system · John Bernet Jayati ...

  12. AcEST: DK949928 [AcEST

    Lifescience Database Archive (English)

    Full Text Available ing] OS=... 248 2e-65 sp|Q13SR6|GCSP_BURXL Glycine dehydrogenase [decarboxylating...] OS=... 248 2e-65 sp|Q63PL2|GCSP_BURPS Glycine dehydrogenase [decarboxylating] OS=... 248 2e-65 sp|A3NF00|G

  13. Optical simulations for the S3 project - Super separator spectrometer - gamma-electron coincidence spectroscopy of a transfermium nucleus: the 251Md101

    International Nuclear Information System (INIS)

    Dechery, Fabien

    2012-01-01

    In analogy with the atomic closed shells giving rise to the stability and high ionisation energies of noble gases, nuclear physics also has its magic numbers of protons and neutrons which enhance nuclear structure stability. Knowledge of the structure of doubly-magic nuclei, both proton and neutron numbers, is crucial to parameterize theoretical models. The discovery of the next and ultimate magic numbers will provide a strong constraint on the many predictions. These two numbers are like the centre coordinates of an area of enhanced stability of the nuclear chart, well known as 'island of stability'. These superheavy nuclei only exist due to pure quantum shell effects. My thesis work deals with two distinct, but complementary, aspects of fundamental physics with the common goal of studying these extreme mass nuclei structure. The first part corresponds to the development of a next generation instrument for nuclear physics to allow synthesis and spectroscopy studies of superheavy nuclei: the Super Separator Spectrometer S 3 . This project will be installed at SPIRAL2 (GANIL) and has been approved by the French Research National Agency (ANR) within the EQUIPEX framework. It has been designed to take advantage of the high intensity heavy ion beam from the LINAC, giving access to a wide range of physical programs. The second part corresponds to the preparation, realisation and analysis of an experiment on 251-Mendelevium in which the very first prompt gamma-electron coincidence spectroscopy was performed for a transfermium nuclei. (author) [fr

  14. GMRT and VLA Observations at 49 cm and 20 cm of the HII Region ...

    Indian Academy of Sciences (India)

    2007-03-08

    Mar 8, 2007 ... GMRT and VLA Observations at 49 cm and 20 cm of the HII Region near l = 24.8. ◦ l = 24.8. ◦ l = 24.8. ◦. , b = 0.1. ◦ b = 0.1. ◦ b = 0.1. ◦. N. G. Kantharia. 1. , W. M. Goss. 2. , D. Anish Roshi. 3. , Niruj R. Mohan. 4. &. Francois Viallefond. 5. 1National Centre for Radio Astrophysics, Tata Institute of Fundamental ...

  15. Application of alpha spectrometry to the discovery of new elements by heavy-ion-beam bombardment

    International Nuclear Information System (INIS)

    Nitschke, J.M.

    1983-05-01

    Starting with polonium in 1898, α-spectrometry has played a decisive role in the discovery of new, heavy elements. For even-even nuclei, α-spectra have proved simple to interpret and exhibit systematic trends that allow extrapolation to unknown isotopes. The early discovery of the natural α-decay series led to the very powerful method of genetically linking the decay of new elements to the well-established α-emission of daughter and granddaughter nuclei. This technique has been used for all recent discoveries of new elements including Z = 109. Up to mendelevium (Z = 101), thin samples suitable for α-spectrometry were prepared by chemical methods. With the advent of heavy-ion accelerators new sample preparation methods emerged. These were based on the large momentum transfer associated with heavy-ion reactions, which produced energetic target recoils that, when ejected from the target, could be thermalized in He gas. Subsequent electrical deposition or a He-jet technique yielded samples that were not only thin enough for α-spectroscopy, but also for α- and #betta#-recoil experiments. Many variations of these methods have been developed and are discussed. For the synthesis of element 106 an aerosol-based recoil transport technique was devised. In the most recent experiments, α-spectrometry has been coupled with the magnetic analysis of the recoils. The time from production to analysis of an isotope has thereby been reduced to 10 - 6 s; while it was 10 - 1 to 10 0 s for He-jets and 10 1 to 10 3 s for rapid chemical separations. Experiments are now in progress to synthesize super heavy elements (SHE) and to analyze them with these latest techniques. Again, α-spectrometry will play a major role since the expected signature for the decay of a SHE is a sequence of α-decays followed by spontaneous fission

  16. ORF Alignment: EHA1 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available .t00010 [Entamoeba histolytica HM-1:IMSS] ... Length = 50 ... Query: 199 AKEEHECVICRDVLTEAAHLRCGHDFHVSCL...KGWLARASDCPICRNPINL 248 ... AKEEHECVICRDVLTEAAHLRCGHDFHVSCLKGWLARASDCPICRNPINL Sbjct: 1 ... AKEEHECVICRDVLTEAAHLRCGHDFHVSCLKGWLARASDCPICRNPINL 50

  17. ORF Alignment: NC_004567 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available QKGGVGKTTTSINLGASLVELGQKVLLIDTDAQGNATSGLGVQKSTIEREIYDV 60 ... Query: 124 XXCPPSLGLLTINAFTACDSILIPVQSEYYALEGLSQL...LNTIKLVQKHFNKQLRIEGVLL 183 ... CPPSLGLLTINAFTACDSILIPVQSEYYALEGLSQLLNTIK...LVQKHFNKQLRIEGVLL Sbjct: 121 IDCPPSLGLLTINAFTACDSILIPVQSEYYALEGLSQLLNTIKLVQKHFNKQLRIEGVLL 180 ... Query: 244 ALAKEVLA 251 ... ALAKEVLA Sbjct: 241 ALAKEVLA 248

  18. ORF Alignment: NC_003450 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available EITRITEEGYIIPSSSVGNNVEWLNAAEKVILEVNSWQSEDLEGMHDIWSVPA 180 ... Query: 248 LESEVAAGRLSYDGYIMQSGVGNVPNAVMAGLLESKFE...NIQAYTEVIQDGMVDLIDAGKM 307 ... LESEVAAGRLSYDGYIMQSGVGNVPNAVMAGLLESKFENIQAY...TEVIQDGMVDLIDAGKM Sbjct: 241 LESEVAAGRLSYDGYIMQSGVGNVPNAVMAGLLESKFENIQAYTEVIQDGMVDLIDAGKM 300 ... Query: 368 GN

  19. Transformace a konvergence ve střední a východní Evropě

    Czech Academy of Sciences Publication Activity Database

    Kočenda, Evžen

    2001-01-01

    Roč. 51, č. 4 (2001), s. 234-248 ISSN 0015-1920 R&D Projects: GA AV ČR KSK9058117 Institutional research plan: CEZ:AV0Z7085904 Keywords : transition * CEEC Subject RIV: AH - Economics Impact factor: 0.231, year: 2001 http://journal.fsv.cuni.cz/storage/286_005_234_248.pdf

  20. Temporal and spatial varations in concentrations of sediment ...

    African Journals Online (AJOL)

    Temporal and spatial varations in concentrations of sediment nutrients and carbon in the Keta lagoon, Ghana. TH S&#248rensen, G V&#248lund, AK Armah, C Christiansen, LB Jensen, JT Pedersen. Abstract. No Abstract. Full Text: EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT · DOWNLOAD FULL TEXT DOWNLOAD ...

  1. West African Journal of Applied Ecology - Vol 4, No 1 (2003)

    African Journals Online (AJOL)

    Temporal and spatial varations in concentrations of sediment nutrients and carbon in the Keta lagoon, Ghana · EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. TH S&#248rensen, G V&#248lund, AK Armah, C Christiansen, LB Jensen, JT Pedersen ...

  2. Citral derived amides as potent bacterial NorA efflux pump inhibitors

    DEFF Research Database (Denmark)

    Thota, Niranjan; Koul, Surrinder; Reddy, Mallepally V

    2008-01-01

    Monoterpene citral and citronellal have been used as starting material for the preparation of 5,9-dimethyl-deca-2,4,8-trienoic acid amides and 9-formyl-5-methyl-deca-2,4,8-trienoic acid amides. The amides on bioevaluation as efflux pump inhibitors (EPIs) against Staphylococcus aureus 1199 and Nor...

  3. 78 FR 23835 - Sex Offender Registration Amendments

    Science.gov (United States)

    2013-04-23

    .... FOR FURTHER INFORMATION CONTACT: Rorey Smith, Deputy General Counsel, ] (202) 220-5797, or rorey.smith... Notification Act (SORNA), Title I of the Adam Walsh Child Protection and Safety Act of 2006, (Pub. L. 109-248... (SORNA), Title I of the Adam Walsh Child Protection and Safety Act of 2006, (Pub. L. 109-248), requires a...

  4. 76 FR 63322 - Endangered and Threatened Species Permit Applications

    Science.gov (United States)

    2011-10-12

    ... and Wildlife Service, P.O. Box 1306, Room 6034, Albuquerque, NM at (505) 248-6920. Please refer to the...: Susan Jacobsen, Chief, Endangered Species Division, P.O. Box 1306, Albuquerque, NM 87103; (505) 248-6920... loggerhead (Caretta caretta) sea turtles within the Sea Life Center, Galveston, Texas. Permit TE-42739A...

  5. EST Table: FS797970 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available FS797970 E_FL_ffbm_26A06_F_0 10/09/28 100 %/248 aa ref|NP_001119730.1| triosephosph...A 10/09/10 78 %/248 aa gi|189236533|ref|XP_975493.2| PREDICTED: similar to triosephosphate isomerase [Tribolium castaneum] FS793264 ffbm ...

  6. Fission properties and production mechanisms for the heaviest known elements

    Energy Technology Data Exchange (ETDEWEB)

    Hoffman, D.C.

    1981-01-01

    Mass yields of the spontaneous fission of Fm isotopes, Cf isotopes, and /sup 259/Md are discussed. Actinide yields were measured for bombardments of /sup 248/Cm with /sup 16/O, /sup 18/O, /sup 20/Ne, and /sup 22/Ne. A superheavy product might be produced by bombarding /sup 248/Cm with /sup 48/Ca ions. 12 figures. (DLC)

  7. 78 FR 64242 - Outer Continental Shelf (OCS), Gulf of Mexico (GOM), Oil and Gas Lease Sales, Western Planning...

    Science.gov (United States)

    2013-10-28

    ... Lease Sales: 2012-2017; Western Planning Area Lease Sales 229, 233, 238, 246, and 248; Central Planning...: 2013-2014; Western Planning Area Lease Sale 233; Central Planning Area Lease Sale 231, Final... Sales, Western Planning Area (WPA) Lease Sales 238, 246, and 248 AGENCY: Bureau of Ocean Energy...

  8. 78 FR 42544 - Outer Continental Shelf (OCS), Gulf of Mexico (GOM), Oil and Gas Lease Sale, Western Planning...

    Science.gov (United States)

    2013-07-16

    ... Planning Area Lease Sales 229, 233, 238, 246, and 248; Central Planning Area (CPA) Lease Sales 227, 231... 233; Central Planning Area Lease Sale 231-Final Supplemental Environmental Impact Statement (OCS EIS... Sale, Western Planning Area (WPA) Lease Sales 238, 246, and 248 MMAA104000 AGENCY: Bureau of Ocean...

  9. Detecting, mapping and monitoring of land subsidence in Jharia ...

    Indian Academy of Sciences (India)

    Kalidas Road,. Dehradun 248 001, India. 2CSIR – Central Institute of Mining and Fuel Research, Barwa Road, Dhanbad 826 001, India. 3Geodetic and Research Branch (Survey of India), 17 E.C. Road, Dehradun 248 001, India. 4Bharat Coking ...

  10. Detecting, mapping and monitoring of land subsidence in Jharia ...

    Indian Academy of Sciences (India)

    Kalidas Road, Dehradun 248 001, India. CSIR – Central Institute of Mining and Fuel Research, Barwa Road, Dhanbad 826 001, India. Geodetic and Research Branch (Survey of India), 17 E.C. Road, Dehradun 248 001, India. Bharat Coking Coal ...

  11. [Molecular pathogenesis of Waardenburg syndrome type II resulting from SOX10 gene mutation].

    Science.gov (United States)

    Zhang, Hua; Chen, Hongsheng; Feng, Yong; Qian, Minfei; Li, Jiping; Liu, Jun; Zhang, Chun

    2016-08-01

    To explore the molecular mechanism of Waardenburg syndrome type II (WS2) resulting from SOX10 gene mutation E248fs through in vitro experiment. 293T cells were transiently transfected with wild type (WT) SOX10 and mutant type (MT) E248fs plasmids. The regulatory effect of WT/MT SOX10 on the transcriptional activity of MITF gene and influence of E248fs on WT SOX10 function were determined with a luciferase activity assay. The DNA binding capacity of the WT/MT SOX10 with the promoter of the MITF gene was determined with a biotinylated double-stranded oligonucleotide probe containing the SOX10 binding sequence cattgtc to precipitate MITF and E248fs, respectively. The stability of SOX10 and E248fs were also analyzed. As a loss-of-function mutation, the E248fs mutant failed to transactivate the MITF promoter as compared with the WT SOX10 (P<0.01), which also showed a dominant-negative effect on WT SOX10. The WT SOX10 and E248fs mutant were also able to bind specifically to the cattgtc motif in the MITF promoter, whereas E248fs had degraded faster than WT SOX10. Despite the fact that the E248fs has a dominant-negative effect on SOX10, its reduced stability may down-regulate the transcription of MITF and decrease the synthesis of melanin, which may result in haploinsufficiency of SOX10 protein and cause the milder WS2 phenotype.

  12. Alternatives to the Judicially Promulgated Feres Doctrine

    Science.gov (United States)

    2007-04-01

    1950) (barring a soldier’s suit against the Government for negligently performed surgery). 24 See Costo v. United States, 248 F.3d 863 (9th Cir...Doctrine A. Ambiguous Standard 198 See Costo v. United States, 248 F.3d 863 (9th Cir. 2001) (barring suit for the wrongful death of a sailor who drowned...courts tend to bar the service member’s claim. See Costo v. United States, 248 F.3d 863 (9th Cir. 2001) (barring suit for the drowning death of a

  13. Two-quasineutron states in 98248Cf and 98250Cf and the neutron-neutron residual interactions

    International Nuclear Information System (INIS)

    Katori, K.; Ahmad, I.; Friedman, A. M.

    2008-01-01

    Two-quasineutron states in 248 Cf and 250 Cf were investigated by single-neutron transfer reactions, 249 Cf(d,t) 248 Cf and 249 Cf(d,p) 250 Cf. The majority of levels observed were assigned to 12 bands in 248 Cf and six bands in 250 Cf, constructed from the single-particle states in neighboring Cf nuclei. The effective two-body interactions between two odd neutrons coupled outside a deformed core were deduced from the differences in the energies of the bandheads formed by the parallel and antiparallel coupling of the intrinsic spins of the two single-particle states

  14. Život i djelo Dmitrija Ivanoviča Mendeljejeva - povodom 100. obljetnice smrti

    Directory of Open Access Journals (Sweden)

    Vaščić, V.

    2007-04-01

    Full Text Available The life and activities of D. I. Mendeleyev are presented primarily in view of his role in the progress of chemistry. Born in Tobolsk in 1834 to a numerous and poor family, burdened by the family's bad luck and his ill health, he graduated natural sciences in 1855 at St. Petersburg and was awarded a gold medal for exceptional success. In 1855/56 he was teacher at a secondary school in Odessa. He obtained his MSc degree in 1856 in St. Petersburg where he was appointed lecturer in 1857. He was guest scientist 1859-1861 at the University in Heidelberg where he investigated the behavior of gases under various pressures and temperatures and discovered the criticaltemperature of liquefaction. He achieved his PhD degree in 1865 in St. Petersburg with a thesis on ethanol/water mixtures. Therein he had proven the existence of alcohol hydrates. His work later enabled the elaboration of modern conceptions on solvate formation in solutions. In 1865 he was elected professor at the University in St. Petersburg where he worked until 1890 when he was forced to retire. Preparing his textbook "Fundamentals of Chemistry" in 1869, he discovered that properties of chemical elements depend periodically on atomic weights. This enabled the elaboration of a periodic system as the base for classification in chemistry, as well as for further research and development of chemical science and technology. The international scientific community accepted Mendeleyev's system with distrust and it was generally acknowledged not before three "prophecies" of Mendeleyev were realized by the discovery of gallium (1875, scandium (1879 and germanium (1886. Later, in verification of his predictions, other elements - including transuranics - were discovered. Hence, in honor of the creator of the periodic system, the element of atomic number 101 was named mendelevium (1955. Mendeleyev was reactivated in 1892 as director of the Central Bureau for Measures and Weights where he worked until

  15. South African Medical Journal - Vol 83, No 4 (1993)

    African Journals Online (AJOL)

    Indications for colonoscopy An analysis based on indications and diagnostic yield · EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. I. Berkowitz, M. Kaplan, 245-248 ...

  16. Latein als Sprache der mittelalterlichen Schriften über Wettervorhersage

    Czech Academy of Sciences Publication Activity Database

    Kocánová, Barbora

    -, č. 71 (2013), s. 237-248 ISSN 1376-7453 R&D Projects: GA MŠk(CZ) LD13043 Institutional support: RVO:67985955 Keywords : medieval weather forecasting * medieval Latin * medieval manuscripts Subject RIV: AI - Linguistics

  17. Clinical implementation of 4-dihydroxyborylphenylalanine synthesised by an asymetric pathway

    Czech Academy of Sciences Publication Activity Database

    Kulvik, M.; Vahatalo, J.; Buchar, Evžen; Farkkila, M.; Jarviluoma, E.; Jaaskelainen, J.; Kříž, O.; Laakso, J.; Rasilainen, M.; Kallio, M.

    2003-01-01

    Roč. 18, - (2003), s. 155-163 ISSN 0928-0987 Institutional research plan: CEZ:AV0Z5039906 Keywords : Boron neutron capture therapy Subject RIV: FR - Pharmacology ; Medidal Chemistry Impact factor: 2.248, year: 2003

  18. Optimal Mirrleesean taxation in a Ben-Porath economy

    Czech Academy of Sciences Publication Activity Database

    Kapička, Marek

    2015-01-01

    Roč. 7, č. 2 (2015), s. 219-248 ISSN 1945-7707 Institutional support: RVO:67985998 Keywords : optimal tax es * unobservable human capital * income tax es Subject RIV: AH - Economics Impact factor: 2.567, year: 2015

  19. Porcelanit - vzácný materiál broušených kamenných nástrojů

    Czech Academy of Sciences Publication Activity Database

    Šrein, Vladimír; Šťastný, Martin; Šreinová, B.; Langrová, Anna; Kolman, Blahoslav Jan

    - (2001), s. 248-252 R&D Projects: GA AV ČR IAA3407001; GA AV ČR IAA3046701 Institutional research plan: CEZ:AV0Z3046908 Keywords : porcellanite Subject RIV: AC - Archeology, Anthropology, Ethnology

  20. Comparison of diatom community structure from epilithon and fish guts: implications for inferring past changes in water quality

    Czech Academy of Sciences Publication Activity Database

    Bešta, T.; Muška, Milan; Juggins, S.; Těšitel, J.

    2015-01-01

    Roč. 742, č. 1 (2015), s. 233-248 ISSN 0018-8158 Institutional support: RVO:60077344 Keywords : diatoms * fish * palaeolimnology * aquatic quality * eutrophication Subject RIV: DA - Hydrology ; Limnology Impact factor: 2.051, year: 2015

  1. Pityriasis Versicolor in Children

    Directory of Open Access Journals (Sweden)

    A K Miskeen

    1984-01-01

    Full Text Available A six year survey revealed 132 cases of pityriasis versicolor in children below 10 years of age. This constituted 6.70/o of all cases of pityriasis versicol and 24.8 % of cutaneous

  2. Review: Lorenzo Cotula, The Great African Land Grab?: Agricultural Investments and the Global Food System (2013

    Directory of Open Access Journals (Sweden)

    Kerstin Nolte

    2013-01-01

    Full Text Available Review of the monograph:Lorenzo Cotula, The Great African Land Grab?: Agricultural Investments and the Global Food System, London, New York: Zed Books, 2013, ISBN 9781780324203, 248 pages

  3. The Molecular Epidemiology of Malaria in Western Kenya

    National Research Council Canada - National Science Library

    Amon, Joseph

    2002-01-01

    ...) Plasmodium falciparum growth dynamics. The first two research topics were examined in a cohort of 248 males recruited from three highly endemic villages in western Kenya where severe malaria anemia is common...

  4. New Fellows and Honorary Fellow

    Indian Academy of Sciences (India)

    Date of birth: 4 August 1913. Date of death: 2 June 2000. Specialization: Archaeological Chemistry, Archaeometry, Conservation and Environmental Archaeology Last known address: 47, Subhas Road, Dehra Dun 248 001. YouTube; Twitter; Facebook; Blog ...

  5. Tagasi Pariisis / Karl Rumor

    Index Scriptorium Estoniae

    Rumor, Karl, pseud., 1886-1971

    2008-01-01

    Prantsusmaa sisepoliitilisest olustikust. Poliitilistest oludest 1937. aasta Euroopas, sõjameeleoludest Vahemerel, Nyloni konverentsist. Varem ilmunud: Uus Eesti 21. juuni 1937, nr. 166; 8., 13. sept. 1937, nr. 243, 248

  6. Bagchee, Krishnadas

    Indian Academy of Sciences (India)

    . (London), FNA. Date of birth: 19 January 1898. Date of death: 6 January 1973. Specialization: Cytology, Genetics, Timber Pathology, Forest Pathology, Mycology Last known address: Nandadeep, 63A, Rajpur Road, Dehra Dun 248 001.

  7. 49 CFR 1.50 - Delegation to the National Highway Traffic Safety Administrator.

    Science.gov (United States)

    2010-10-01

    ... section 15(f) of the Sanitary Food Transportation Act of 1990 (Pub. L. 101-500; 104 Stat. 1213). (n) Carry...), Renewable Fuel Dispenser Requirements; and (10) Section 248(a), Biofuels Distribution and Advanced Biofuels...

  8. The small binary asteroid (939) Isberga

    Czech Academy of Sciences Publication Activity Database

    Carry, B.; Matter, A.; Scheirich, Peter; Pravec, Petr; Molnar, L.; Mottola, S.; Carbognani, A.; Jehin, E.; Marciniak, A.; Binzel, R. P.; DeMeo, E.F.; Birlan, M.; Delbó, M.; Barbotin, E.; Behrend, R.; Bonnardeau, M.; Colas, F.; Farissier, P.; Fauvaud, M.; Fauvaud, S.; Gillier, C.; Gillon, M.; Hellmich, S.; Hirsch, R.; Leroy, A.; Manfroid, J.; Montier, J.; Morelle, E.; Richard, F.; Sobkowiak, K.; Strajnic, J.; Vachier, F.

    2015-01-01

    Roč. 248, March (2015), s. 516-525 ISSN 0019-1035 Institutional support: RVO:67985815 Keywords : asteroids * dynamics * satellites of asteroids Subject RIV: BN - Astronomy, Celestial Mechanics, Astrophysics Impact factor: 3.383, year: 2015

  9. 77 FR 58527 - Pacific Fishery Management Council; Public Meeting

    Science.gov (United States)

    2012-09-21

    ... National Oceanic and Atmospheric Administration RIN 0648-XC248 Pacific Fishery Management Council; Public Meeting AGENCY: National Marine Fisheries Service (NMFS), National Oceanic and Atmospheric Administration (NOAA), Commerce. ACTION: Notice of a public meeting. SUMMARY: The Pacific Fishery Management Council...

  10. Study of fusion and nucleon transfer channels in the Au-197 + He-6 reaction in an energy range of He-6 to 20 Mev/A

    Czech Academy of Sciences Publication Activity Database

    Skobelev, N. K.; Penionzhkevich, Y. E.; Kulko, A. A.; Demekhina, N. A.; Kroha, Václav; Kugler, Andrej; Lukyanov, S.; Mrázek, Jaromír; Sobolev, Yu. G.; Maslov, V. A.; Muzychka, Yu. A.; Voskoboynik, E. I.; Fomichev, A. S.

    2013-01-01

    Roč. 10, č. 3 (2013), s. 248-255 ISSN 1547-4771 Institutional support: RVO:61389005 Keywords : nuclear reactions * gamma activity * cross section Subject RIV: BG - Nuclear, Atomic and Molecular Physics, Colliders

  11. Animal Production Research Advances - Vol 5, No 4 (2009)

    African Journals Online (AJOL)

    Carcass Characteristics and Economics of Broiler Chickens Fed Different Levels of Grasshopper Meal in Place of Fish Meal · EMAIL FULL TEXT EMAIL FULL TEXT DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. MA Muftau, BR Olorede, 248-251 ...

  12. Žena ve vědě: Alena Lengerová

    Czech Academy of Sciences Publication Activity Database

    Bahenská, Marie

    2011-01-01

    Roč. 3, č. 2 (2011), s. 248-263 ISSN 1803-9448 Institutional research plan: CEZ:AV0Z80770509 Keywords : Lengerová, Alena * history of science * Czechoslovak Academy of Sciences Subject RIV: AB - History

  13. Arora, Dr Baldev Raj

    Indian Academy of Sciences (India)

    Bombay), FNASc. Date of birth: 10 October 1947. Specialization: Electromagnetic Geophysics, Seismotectonics and Geomagnetism Address: 36, Janakpuri, Engineers Enclave, Phase III, GMS Road, Dehra Dun 248 001, Uttarakhand Contact:

  14. Gupta, Prof. Santosh Kumar

    Indian Academy of Sciences (India)

    objective Evolutionary Algorithm and Experimental Online Optimal Control Address: Distinguished Professor, Department of Chemical Engineering, University of Petroleum & Energy Studies, Energy Acres, PO Bidholi, Dehra Dun 248 007, ...

  15. Global patterns of interaction specialization in bird-flower networks

    Czech Academy of Sciences Publication Activity Database

    Zanata, T. B.; Dalsgaard, B.; Passos, F. C.; Cotton, P. A.; Roper, J. J.; Maruyama, P.K.; Fischer, E.; Schleuning, M.; Gonzalez, A. M. M.; Vizentin-Bugoni, J.; Franklin, D. C.; Abrahamczyk, S.; Alarcon, R.; Araujo, A. C.; Araujo, F. P.; de Azevedo-Junior, S. M.; Baquero, A. C.; Boehning-Gaese, K.; Carstensen, D. W.; Chupil, H.; Coelho, A. G.; Faria, R. R.; Hořák, D.; Ingversen, Tanja T.; Janeček, Štěpán; Kohler, G.; Lara, C.; Las-Casas, F. M. G.; Lopes, A. V.; Machado, A. O.; Machado, C. G.; Machado, Isabel C.; Maglianesi, M. A.; Malucelli, T. S.; Mohd-Azlan, J.; Moura, A. C.; Oliveira, G. M.; Oliveira, P. E.; Ornelas, J. F.; Riegert, J.; Rodrigues, L. C.; Rosero-Lasprilla, L.; Rui, A. M.; Sazima, M.; Schmid, B.; Sedláček, O.; Timmermann, A.; Vollstädt, M. G. R.; Wang, Z.; Watts, S.; Rahbek, C.; Varassin, I. G.

    2017-01-01

    Roč. 44, č. 8 (2017), s. 1891-1910 ISSN 0305-0270 Institutional support: RVO:67985939 Keywords : honeyeaters * hummingbirds * modularity Subject RIV: EH - Ecology, Behaviour OBOR OECD: Ecology Impact factor: 4.248, year: 2016

  16. 10 CFR 110.23 - General license for the export of byproduct material.

    Science.gov (United States)

    2010-01-01

    ...) Actinium-225 and -227, americium-241 and -242m, californium-248, -249, -250, -251, -252, -253, and -254, curium-240, -241, -242, -243, -244, -245, -246 and -247, einsteinium-252, -253, -254 and -255, fermium...

  17. Carotenoid-protein interaction alters the S1 energy of hydroxyechinenone in the Orange Carotenoid Protein

    Czech Academy of Sciences Publication Activity Database

    Polívka, Tomáš; Chábera, P.; Kerfeld, C.A.

    2013-01-01

    Roč. 1827, č. 3 (2013), s. 248-254 ISSN 0005-2728 Institutional support: RVO:60077344 Keywords : orange-carotenoid protein * excited states * photoprotection Subject RIV: BO - Biophysics Impact factor: 4.829, year: 2013

  18. Differential behaviour of a Lesser Himalayan watershed in extreme ...

    Indian Academy of Sciences (India)

    Author Affiliations. Pankaj Chauhan1 Nilendu Singh1 Devi Datt Chauniyal2 Rajeev S Ahluwalia1 Mohit Singhal1. Wadia Institute of Himalayan Geology, Dehradun 248 001, India. School of Earth Science, HNB Garhwal University, Srinagar 246 174, India.

  19. Age and Prevalence of Cervical Carcinoma in Subsequent Hysterectomy Following a Conization Procedure

    OpenAIRE

    Ting-Hung Wun; Will Wei-Cheng Chiu; Chen-Bin Wang; Ching-Cheng Tseng; Chun-Hung Chen; Yu-Hsiang Lin; Chung-Yuan Lee; Ying-Lun Sun; Chih-Jen Tseng

    2009-01-01

    Objective: To determine the prevalence and age of patients with cervical carcinoma missed by a loop electrosurgical excision procedure. Materials and Methods: A total of 253 women with cervical dysplasia who underwent conization and 248 women who later underwent hysterectomy were retrospectively reviewed. The age and prevalence of those with cervical carcinoma diagnosed and missed by conization were determined. Results: Of the 248 patients, 11 cases (4.4%) of cervical carcinoma were mis...

  20. Evaluation of alternate lines of Fe for sequential multi-element determination of Cu, Fe, Mn and Zn in soil extracts by high-resolution continuum source flame atomic absorption spectrometry

    International Nuclear Information System (INIS)

    Luiz Raposo, Jorge; Ruella de Oliveira, Silvana; Caldas, Naise Mary; Neto, Jose Anchieta Gomes

    2008-01-01

    The usefulness of the secondary line at 252.744 nm and the approach of side pixel registration were evaluated for the development of a method for sequential multi-element determination of Cu, Fe, Mn and Zn in soil extracts by high-resolution continuum source flame atomic absorption spectrometry (HR-CS FAAS). The influence of side pixel registration on the sensitivity and linearity was investigated by measuring at wings (248.325, 248.323, 248.321, 248.329, and 248.332 nm) of the main line for Fe at 248.327 nm. For the secondary line at 252.744 nm or side pixel registration at 248.325 nm, main lines for Cu (324.754 nm), Mn (279.482 nm) and Zn (213.875 nm), sample flow-rate of 5.0 mL min -1 and calibration by matrix matching, analytical curves in the 0.2-1.0 mg L -1 Cu, 1.0-20.0 mg L -1 Fe, 0.2-2.0 mg L -1 Mn, 0.1-1.0 mg L -1 Zn ranges were obtained with linear correlations better than 0.998. The proposed method was applied to seven soil samples and two soil reference materials (IAC 277; IAC 280). Results were in agreement at a 95% confidence level (paired t-test) with reference values. Recoveries of analytes added to soil extracts containing 0.15 and 0.30 mg L -1 Cu, 7.0 and 14 mg L -1 Fe, 0.60 and 1.20 mg L -1 Mn, 0.07 and 0.15 mg L -1 Zn, varied within the 94-99, 92-98, 93-101, and 93-103% intervals, respectively. The relative standard deviations (n = 12) were 2.7% (Cu), 1.4% (Fe - 252.744 nm), 5.7% (Fe - 248.325 nm), 3.2% (Mn) and 2.8% (Zn) for an extract containing 0.35 mg L -1 Cu, 14 mg L -1 Fe, 1.1 mg L -1 Mn and 0.12 mg L -1 Zn. Detection limits were 5.4 μg L -1 Cu, 55 μg L -1 Fe (252.744 nm), 147 μg L -1 Fe (248.325 nm), 3.0 μg L -1 Mn and 4.2 μg L -1 Zn

  1. “Dead” Rules of Chapter 26 of the Criminal Code of the Russian Federation​

    Directory of Open Access Journals (Sweden)

    Kalinina Oksana M.

    2018-03-01

    Full Text Available The article draws attention to the practice of application of norms about the criminal responsibility for environmental crimes, which include non-performing regulations, in particular articles 248, 259 of the Criminal Code of the Russian Federation. According to the Author, the establishment of criminal responsibility for crimes provided in articles 248, 259 of the Criminal Code of the Russian Federation, not caused by necessity in the absence of violations or their singleness. These regulatory provisions do not implement the objectives of part 1 of article 2 of the Criminal Code of the Russian Federation. These rules are “dead” and should be decriminalized. The responsibility for such illegal actions may be provided in an administrative or civil legislation, or offset by competing norms. In this situation, the change in the content of article 248, 259 of the Criminal Code of the Russian Federation will not affect their effectiveness.

  2. Erythrobacter pelagi sp. nov., a member of the family Erythrobacteraceae isolated from the Red Sea

    KAUST Repository

    Wu, H.-x.

    2011-08-05

    A novel Gram-negative, aerobic, catalase- and oxidase-positive, non-sporulating, non-motile, rod-shaped bacterium, designated strain UST081027-248(T), was isolated from seawater of the Red Sea. Phylogenetic analysis based on 16S rRNA gene sequences showed that strain UST081027-248(T) fell within the genus Erythrobacter. Levels of 16S rRNA gene sequence similarity between the novel strain and the type strains of Erythrobacter species ranged from 95.3% (with Erythrobacter gangjinensis) to 98.2% (with Erythrobacter citreus). However, levels of DNA-DNA relatedness between strain UST081027-248(T) and the type strains of closely related species were below 70%. Optimal growth of the isolate occurred in the presence of 2.0% NaCl, at pH 8.0-9.0 and at 28-36 degrees C. The isolate did not produce bacteriochlorophyll a. The predominant cellular fatty acids were C-17:1 omega 6c, summed feature 8 (C-18:1 omega 6c and/or C-18:1 omega 7c) and C-15:0 2-OH. The genomic DNA G+C content of strain UST081027-248(T) was 60.4 mol%. Phenotypic properties and phylogenetic distinctiveness clearly indicated that strain UST081027-248(T) represents a novel species of the genus Erythrobacter, for which the name Erythrobacter pelagi sp. nov. is proposed. The type strain is UST081027-248(T) (=JCM 17468(T)=NRRL 59511(T)).

  3. Settlement induction of Acropora palmata planulae by a GLW-amide neuropeptide

    Science.gov (United States)

    Erwin, P. M.; Szmant, A. M.

    2010-12-01

    Complex environmental cues dictate the settlement of coral planulae in situ; however, simple artificial cues may be all that is required to induce settlement of ex situ larval cultures for reef re-seeding and restoration projects. Neuropeptides that transmit settlement signals and initiate the metamorphic cascade have been isolated from hydrozoan taxa and shown to induce metamorphosis of reef-building Acropora spp. in the Indo-Pacific, providing a reliable and efficient settlement cue. Here, the metamorphic activity of six GLW-amide cnidarian neuropeptides was tested on larvae of the Caribbean corals Acropora palmata, Montastraea faveolata and Favia fragum. A. palmata planulae were induced to settle by the exogenous application of the neuropeptide Hym-248 (concentrations ≥1 × 10-6 M), achieving 40-80% attachment and 100% metamorphosis of competent planulae (≥6 days post-fertilization) during two spawning seasons; the remaining neuropeptides exhibited no activity. Hym-248 exposure rapidly altered larval swimming behavior (96% metamorphosis after 6 h. In contrast , M. faveolata and F. fragum planulae did not respond to any GLW-amides tested, suggesting a high specificity of neuropeptide activators on lower taxonomic scales in corals. Subsequent experiments for A. palmata revealed that (1) the presence of a biofilm did not enhance attachment efficiency when coupled with Hym-248 treatment, (2) neuropeptide-induced settlement had no negative effects on early life-history developmental processes: zooxanthellae acquisition and skeletal secretion occurred within 12 days, colonial growth occurred within 36 days, and (3) Hym-248 solutions maintained metamorphic activity following storage at room temperature (10 days), indicating its utility in remote field settings. These results corroborate previous studies on Indo-Pacific Acropora spp. and extend the known metamorphic activity of Hym-248 to Caribbean acroporids. Hym-248 allows for directed and reliable settlement of

  4. Tracing Method with Intra and Inter Protocols Correlation

    Directory of Open Access Journals (Sweden)

    Marin Mangri

    2009-05-01

    Full Text Available MEGACO or H.248 is a protocol enabling acentralized Softswitch (or MGC to control MGsbetween Voice over Packet (VoP networks andtraditional ones. To analyze much deeper the realimplementations it is useful to use a tracing systemwith intra and inter protocols correlation. For thisreason in the case of MEGACO-H.248 it is necessaryto find the appropriate method of correlation with allprotocols involved. Starting from Rel4 a separation ofCP (Control Plane and UP (User Plane managementwithin the networks appears. MEGACO protocol playsan important role in the migration to the new releasesor from monolithic platform to a network withdistributed components.

  5. Structure and Recognition of a Novel HIV-1 gp120-gp41 Interface Antibody that Caused MPER Exposure through Viral Escape

    Energy Technology Data Exchange (ETDEWEB)

    Wibmer, Constantinos Kurt; Gorman, Jason; Ozorowski, Gabriel; Bhiman, Jinal N.; Sheward, Daniel J.; Elliott, Debra H.; Rouelle, Julie; Smira, Ashley; Joyce, M. Gordon; Ndabambi, Nonkululeko; Druz, Aliaksandr; Asokan, Mangai; Burton, Dennis R.; Connors, Mark; Abdool Karim, Salim S.; Mascola, John R.; Robinson, James E.; Ward, Andrew B.; Williamson, Carolyn; Kwong, Peter D.; Morris, Lynn; Moore, Penny L.; Desrosiers, Ronald C.

    2017-01-11

    A comprehensive understanding of the regions on HIV-1 envelope trimers targeted by broadly neutralizing antibodies may contribute to rational design of an HIV-1 vaccine. We previously identified a participant in the CAPRISA cohort, CAP248, who developed trimer-specific antibodies capable of neutralizing 60% of heterologous viruses at three years post-infection. Here, we report the isolation by B cell culture of monoclonal antibody CAP248-2B, which targets a novel membrane proximal epitope including elements of gp120 and gp41. Despite low maximum inhibition plateaus, often below 50% inhibitory concentrations, the breadth of CAP248-2B significantly correlated with donor plasma. Site-directed mutagenesis, X-ray crystallography, and negative-stain electron microscopy 3D reconstructions revealed how CAP248-2B recognizes a cleavage-dependent epitope that includes the gp120 C terminus. While this epitope is distinct, it overlapped in parts of gp41 with the epitopes of broadly neutralizing antibodies PGT151, VRC34, 35O22, 3BC315, and 10E8. CAP248-2B has a conformationally variable paratope with an unusually long 19 amino acid light chain third complementarity determining region. Two phenylalanines at the loop apex were predicted by docking and mutagenesis data to interact with the viral membrane. Neutralization by CAP248-2B is not dependent on any single glycan proximal to its epitope, and low neutralization plateaus could not be completely explained by N- or O-linked glycosylation pathway inhibitors, furin co-transfection, or pre-incubation with soluble CD4. Viral escape from CAP248-2B involved a cluster of rare mutations in the gp120-gp41 cleavage sites. Simultaneous introduction of these mutations into heterologous viruses abrogated neutralization by CAP248-2B, but enhanced neutralization sensitivity to 35O22, 4E10, and 10E8 by 10-100-fold. Altogether, this study expands the region of the HIV-1 gp120-gp41 quaternary interface that is a target for broadly neutralizing

  6. Properties of Lactose Plasmid pLY101 in Lactobacillus casei

    OpenAIRE

    Shimizu-Kadota, Mariko

    1987-01-01

    A starter strain, Lactobacillus casei C257, was found to carry a lactose plasmid, pLY101. Restriction mapping showed that pLY101 DNA was 68.2 kilobases long. Since a non-lactose-utilizing variant of C257, MSK248, lost phospho-β-galactosidase (P-β-gal) activity and pLY101 DNA had a sequence(s) homologous to the streptococcal fragment including a P-β-gal gene, pLY101 is likely to encode a P-β-gal gene required for lactose metabolism in C257. MSK248 grew in galactose medium at a rate identical t...

  7. Magnetic susceptibility of curium pnictides

    International Nuclear Information System (INIS)

    Nave, S.E.; Huray, P.G.; Peterson, J.R.; Damien, D.A.; Haire, R.G.

    1981-09-01

    The magnetic susceptibility of microgram quantities of 248 CmP and 248 CmSb has been determined with the use of a SQUID micromagnetic susceptometer over the temperature range 4.2 to 340 K and in the applied magnetic field range of 0.45 to 1600 G. The fcc (NaCl-type) samples yield magnetic transitions at 73K and 162 K for the phosphide and antimonide, respectively. Together with published magnetic data for CmN and CmAs, these results indicate spatially extended exchange interactions between the relatively localized 5f electrons of the metallic actinide atoms

  8. Experiments on the interaction of intense femtosecond radiation with dense plasmas. Final report

    International Nuclear Information System (INIS)

    Rhodes, C.K.

    1996-01-01

    An upgraded KrF * (248 nm) system producing a pulse energy of ∼ 400 mJ, a pulse width of ∼ 220 fs, and focal intensities above 10 19 W/cm 2 , has been constructed, tested, operated, and used in experimental studies. The spatial morphology of channeled radiation in plasmas has been measured with a spatial resolution of ∼ 30 μm and damage studies of fused silica indicate that femtosecond (200 - 300 fs) 248 nm radiation has a damage limit not exceeding ∼ 50 GW/cm 2 , an unfavorably low level. 2 figs

  9. Redefining Projections of Disease and Nonbattle Injury Patient Condition Code Distributions with Casualty Data from Operation Iraqi Freedom

    Science.gov (United States)

    2006-07-30

    2.48% 3.12% 198 Inguinal hernia complicated direct or indirect sliding incarceration of bowel 1.40% 1.76% 199 Inguinal hernia uncomplicated direct...symptoms 0.04% 0.09% 245 Diarrheal disease severe 0.14% 0.34% 246 Diarrheal disease moderate 0.80% 1.88% 248 Gastritis acute all cases 1.69% 4.00...Sexually transmitted diseases complicated 0.00% 0.01% 0.22% 0.35% Patient Condition Code Distributions 21 Appendix A. Estimated Distributions

  10. Association of a functional Indoleamine 2,3-dioxygenase 2 genotype with specific immune responses

    DEFF Research Database (Denmark)

    Køllgaard, Tania; Klausen, Tobias Wirenfeldt; Idorn, Manja

    2012-01-01

    protein and, consequently, is restricted to individuals that are not homozygous for the stop codon. Furthermore, we detected stronger T-cell responses in donors with the homozygous Y wild type at position 359 when compared with the heterozygous genotype. Interestingly, we found a higher number of immune...... responses against IDO2 in patients homozygous for the 248W giving reduction in IDO2 activity compared with the 248R. Hence, spontaneous immune responses against IDO2 seem to be correlated with reduced enzymatic activity of IDO2. The patient IDO2 genotype may well influence the outcome of IDO2-based anti......-cancer vaccination....

  11. UV and RIR matrix assisted pulsed laser deposition of organic MEH-PPV films

    DEFF Research Database (Denmark)

    Christensen, Bo Toftmann; Papantonalis, M.R.; Auyeung, R.C.Y.

    2004-01-01

    were analyzed by Fourier transform infrared spectroscopy, UV-visible absorbance and photoluminescence. Photoluminescent material was deposited by RIR-MAPLE and 248-nm MAPLE, while the RIR-PLD and 193-nm-MAPLE depositions displayed the smoothest surfaces but did not show photoluminescence. (C) 2003......-PLD). For the first time resonant infrared matrix assisted pulsed laser evaporation (RIR-MAPLE) was successfully demonstrated on a luminescent polymer system. In addition to this, an excimer laser has been used for UV-MAPLE depositions at 193 and 248-nm irradiation. Films deposited onto NaCl and quartz substrates...

  12. Structure and Recognition of a Novel HIV-1 gp120-gp41 Interface Antibody that Caused MPER Exposure through Viral Escape.

    Science.gov (United States)

    Wibmer, Constantinos Kurt; Gorman, Jason; Ozorowski, Gabriel; Bhiman, Jinal N; Sheward, Daniel J; Elliott, Debra H; Rouelle, Julie; Smira, Ashley; Joyce, M Gordon; Ndabambi, Nonkululeko; Druz, Aliaksandr; Asokan, Mangai; Burton, Dennis R; Connors, Mark; Abdool Karim, Salim S; Mascola, John R; Robinson, James E; Ward, Andrew B; Williamson, Carolyn; Kwong, Peter D; Morris, Lynn; Moore, Penny L

    2017-01-01

    A comprehensive understanding of the regions on HIV-1 envelope trimers targeted by broadly neutralizing antibodies may contribute to rational design of an HIV-1 vaccine. We previously identified a participant in the CAPRISA cohort, CAP248, who developed trimer-specific antibodies capable of neutralizing 60% of heterologous viruses at three years post-infection. Here, we report the isolation by B cell culture of monoclonal antibody CAP248-2B, which targets a novel membrane proximal epitope including elements of gp120 and gp41. Despite low maximum inhibition plateaus, often below 50% inhibitory concentrations, the breadth of CAP248-2B significantly correlated with donor plasma. Site-directed mutagenesis, X-ray crystallography, and negative-stain electron microscopy 3D reconstructions revealed how CAP248-2B recognizes a cleavage-dependent epitope that includes the gp120 C terminus. While this epitope is distinct, it overlapped in parts of gp41 with the epitopes of broadly neutralizing antibodies PGT151, VRC34, 35O22, 3BC315, and 10E8. CAP248-2B has a conformationally variable paratope with an unusually long 19 amino acid light chain third complementarity determining region. Two phenylalanines at the loop apex were predicted by docking and mutagenesis data to interact with the viral membrane. Neutralization by CAP248-2B is not dependent on any single glycan proximal to its epitope, and low neutralization plateaus could not be completely explained by N- or O-linked glycosylation pathway inhibitors, furin co-transfection, or pre-incubation with soluble CD4. Viral escape from CAP248-2B involved a cluster of rare mutations in the gp120-gp41 cleavage sites. Simultaneous introduction of these mutations into heterologous viruses abrogated neutralization by CAP248-2B, but enhanced neutralization sensitivity to 35O22, 4E10, and 10E8 by 10-100-fold. Altogether, this study expands the region of the HIV-1 gp120-gp41 quaternary interface that is a target for broadly neutralizing

  13. Effect of Atmospheric Pressure and Temperature on a Small Spark Ignition Internal Combustion Engine’s Performance

    Science.gov (United States)

    2011-03-24

    by looking at aftermarket automobile supercharger compressors. It was calculated, using Eq. (28) that a 20 horsepower motor would be required to run...of data were recorded at each set point at a rate of 50 kHz. The CompactDAQ chassis and computer were mounted in a small 19” electronics rack, shown... Chassis 1 Installed Simon Johnson, Kistler T248 489 1090 x 6030 F248 489 1280 5064B11 Amp, 2852A12 Chassis Amp: 1910377 Chassis : 1931559

  14. Probe development of CMUT and PZT row-column-addressed 2-D arrays

    DEFF Research Database (Denmark)

    Engholm, Mathias; Bouzari, Hamed; Christiansen, Thomas Lehrmann

    2018-01-01

    integrated apodization to reduce ghost echoes and were designed with similar acoustical features i.e. 3 MHz center frequency, λ/2-pitch and 24.8 mm2  × 24.8 mm2 active footprint. The transducer arrays were assembled in a 3-D printed probe handle with electromagnetic shield and integrated electronics......, and acoustical crosstalk, were based on several single element measurements, including pressure and pulse-echo, and were evaluated quantitatively and comparatively. The weighted center frequency was 3.0 MHz for both probes and the measured -6 dB fractional bandwidth was 109 ± 4% and 80 ± 3% for the CMUT...

  15. Adolescents' Perceptions of Family Connectedness, Intrinsic Religiosity, and Depressed Mood

    Science.gov (United States)

    Houltberg, Benjamin J.; Henry, Carolyn S.; Merten, Michael J.; Robinson, Linda C.

    2011-01-01

    Using a sample of 248 ninth and tenth grade students at public high schools, we examined adolescents' perceptions of family connectedness, intrinsic religiosity, and adolescents' gender in relation to depressed mood and whether intrinsic religiosity and gender moderated the association of aspects of family connectedness to adolescent depressed…

  16. Effects of laser wavelength and fluence on the growth of ZnO thin films by pulsed laser deposition

    NARCIS (Netherlands)

    Craciun, V.; Amirhaghi, S.; Craciun, D.; Elders, J.; Gardeniers, Johannes G.E.; Boyd, Ian W.

    Transparent, electrically conductive and c-axis oriented ZnO thin films have been grown by the pulsed laser deposition (PLD) technique on silicon and Corning glass substrates employing either a KrF excimer laser (λ = 248 nm) or a frequency-doubled Nd:YAG laser (λ = 532 nm). The crystalline

  17. An Investigation of Personality Traits in Relation to Adolescent School Absenteeism.

    Science.gov (United States)

    Lounsbury, John W.; Steel, Robert P.; Loveland, James M.; Gibson, Lucy W.

    2004-01-01

    We examined the Big Five personality traits of Agreeableness, Conscientiousness, Emotional Stability, Extraversion, and Openness, as well as four narrower traits of Aggression, Optimism, Tough-Mindedness, and Work Drive in relation to absences from school for middle- and high-school students. Participants were 248 seventh grade students, 321 tenth…

  18. The leisure style of Canadian rural recreation participants: An analysis based on three different rural leisure settings

    Science.gov (United States)

    Paul Heintzman; Don. Dawson

    2012-01-01

    This study was a secondary analysis of data from a previous study of 248 Canadians on four dimensions of leisure style: time use, leisure setting, leisure activity participation, and leisure motivation. Correlation analyses were conducted to determine if frequency of participation in three rural leisure settings were related to other leisure style dimensions.

  19. Estrogenic activity in extracts and exudates of cyanobacteria and green algae

    Czech Academy of Sciences Publication Activity Database

    Sychrová, E.; Štěpánkdová, T.; Nováková, K.; Bláha, Luděk; Giesy, J.P.; Hilscherová, K.

    2012-01-01

    Roč. 39, č. 1 (2012), s. 134-140 ISSN 0160-4120 R&D Projects: GA ČR GA524/08/0496 Institutional support: RVO:67985939 Keywords : cyanobacteria * endocrine disruption * estrogenicity * algae * phytoplankton Subject RIV: EF - Botanics Impact factor: 6.248, year: 2012

  20. Risk of Abnormal Eating Attitudes among Turkish Dietetic Students

    Science.gov (United States)

    Kiziltan, Gul; Karabudak, Efsun

    2008-01-01

    The purpose of this study was to determine the prevalence of abnormal eating attitudes among Turkish dietetic students and the relations between nutrition education and eating attitudes. The study population was 568 female university students (248 dietetic students, 320 non-dietetic students). Two scales were used: Eating Attitudes Test (EAT-26)…

  1. Ichnology of the Early Cambrian Tal Group, Mussoorie Syncline ...

    Indian Academy of Sciences (India)

    Wadia Institute of Himalayan Geology, 33, General Mahadeo Singh Road, Dehradun 248 001, India. ∗. Corresponding author. e-mail: ... Belt of Lesser Himalaya is represented by the Tal. Group. Medlicott (1864) identified it for the first ..... animals and initiative markings on Carboniferous rocks. American J. Sci. 5(3) 16–24.

  2. Local search algorithms for a single-machine scheduling problem with positive and negative time-lags

    NARCIS (Netherlands)

    Hurink, Johann L.; Keuchel, J.

    Positive and negative time-lags are general timing restrictions between the starting times of jobs which have been introduced by Roy (C.R. Acad. Sci., 1959, T.248) in connection with the Metra Potential Method. Although very powerful, these relations have been considered only seldom in the

  3. Pd/MWCNTs catalytic activity in the formic acid electrooxidation dependent on catalyst surface treatment

    Czech Academy of Sciences Publication Activity Database

    Mazurkiewicz, M.; Malolepszy, A.; Mikolajczuk, A.; Stobinski, L.; Borodzinski, A.; Lesiak, B.; Zemek, Josef; Jiříček, Petr

    2011-01-01

    Roč. 248, č. 11 (2011), s. 2516-2519 ISSN 0370-1972 Institutional research plan: CEZ:AV0Z10100521 Keywords : electrooxidation reaction * Pd/MWCNT * TEM * XPS * XRD Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 1.316, year: 2011

  4. Browse Title Index

    African Journals Online (AJOL)

    Items 101 - 150 of 248 ... Vol 35 (2006), Job satisfaction amongst agricultural extension personnel in Kurdistan Province of Iran, Abstract. A Rezvanfar, H Vaisy. Vol 45, No 1 (2017), Knowledge and attitude towards collaboration in agricultural innovation systems amongst stakeholders in the North West Province, South Africa ...

  5. Cloning and expression analysis of a partial LEAFY homologue from ...

    African Journals Online (AJOL)

    A partial homologue of LEAFY, designated as AcLFY (Genebank accession no HQ433335), was isolated from pineapple (Ananas comosus L. cv. Comte de Paris) by PCR. The conserved cDNA fragment of AcLFY is 256 bp in length and contained an open reading frame of 248 bp, which encodes 82 amino acids protein.

  6. Časově korelované čítání jednotlivých fotonů: Nová metoda pro studium doznívání katodoluminiscence

    Czech Academy of Sciences Publication Activity Database

    Lalinský, Ondřej; Schauer, Petr

    2017-01-01

    Roč. 62, č. 10 (2017), s. 248-250 ISSN 0447-6441 R&D Projects: GA MŠk(CZ) LO1212 Institutional support: RVO:68081731 Keywords : cathodoluminescence * time -correlated single-photon counting Subject RIV: JA - Electronics ; Optoelectronics, Electrical Engineering OBOR OECD: Electrical and electronic engineering

  7. Sbírka rukopisných zlomků ve Státním okresním archivu v Kutné Hoře

    Czech Academy of Sciences Publication Activity Database

    Brodský, Pavel; Hradilová, Marta; Hrdinová, Martina; Petr, Stanislav; Tošnerová, Marie

    2013-01-01

    Roč. 43, č. 0 (2013), s. 207-248 ISSN 0585-5691 R&D Projects: GA ČR GAP405/10/0027 Institutional support: RVO:67985921 Keywords : codicology * manuscripts fragments * Státní okresní archiv Kutná Hora Subject RIV: AB - History

  8. Determinants of Use of Indigenous Fish Processing Practices in ...

    African Journals Online (AJOL)

    Descriptive statistics was used to analyze the socio- economic features of the fish processors while the logit model was used to capture the socio-economic factors ... education (β=1.90), household size (β=2.48), FAI (β=2.80), consumers preference (β=3.37), processing tradition (β=3.74), VFP (β=0.02) and cosmopoliteness ...

  9. Postsecondary Strengths, Challenges, and Supports Experienced by Foster Care Alumni College Graduates

    Science.gov (United States)

    Salazar, Amy M.; Jones, Kevin R.; Emerson, John C.; Mucha, Lauren

    2016-01-01

    Young people transitioning from foster care to college experience unique identities and circumstances that make being successful in college especially challenging. We used qualitative survey data from 248 college graduates who were formerly in foster care to explore the strengths, challenges, and supports they experienced while in college that…

  10. 77 FR 29346 - Agency Information Collection Activities: Announcement of Board Approval Under Delegated...

    Science.gov (United States)

    2012-05-17

    ... believes that the additions to the panel would provide deeper coverage of commercial real estate loans and... coverage of banks that lend in commercial real estate and small business markets. The reporting panel... agencies of foreign banks. Estimated annual reporting hours: 1,248 hours. Estimated average hours per...

  11. Sand and clay mineralogy of sal forest soils of the Doon Siwalik ...

    Indian Academy of Sciences (India)

    3Forest Soil & Land Reclamation Division, Forest Research Institute, Dehradun 248 006, India. .... also helps in characterizing the soil mineralogical make-up in relation to the growth and develop- ment of the species essential for sustainable forest management. ...... and Weed S B (Madison: Soil Science Society of America).

  12. Differential Effects of Women's Child Sexual Abuse and Subsequent Sexual Revictimization.

    Science.gov (United States)

    Wyatt, Gail Elizabeth; And Others

    1992-01-01

    Examined differential effects of sexual revictimization in community sample of 248 African-American and white women, ages 18 to 36. Findings suggest that unintended pregnancies and abortions were significantly associated with sexual revictimization. Women who reported more than one incident in both childhood and adulthood were also likely to have…

  13. 2015-2016 Travel and Hospitality Expense Reports for Joanne ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Ruxandra Staicu

    Montreal, Toronto, Vancouver. Airfare: $968.74. Other. Transportation: $248.71. Accommodation: $461.37. Meals and. Incidentals: $302.96. Other: $0.00. Total: $1,981.78. Comments: 2015-2016 Travel and Hospitality Expense. Reports for Joanne Charette, Vice-President,. Corporate Strategy and Communications.

  14. The course of skull deformation from birth to 5 years of age: a prospective cohort study

    NARCIS (Netherlands)

    Vlimmeren, L.A. van; Engelbert, R.H.; Pelsma, M.; Groenewoud, H.; Boere-Boonekamp, M.M.; Nijhuis-Van der Sanden, M.W.G.

    2017-01-01

    In a continuation of a prospective longitudinal cohort study in a healthy population on the course of skull shape from birth to 24 months, at 5 years of age, 248 children participated in a follow-up assessment using plagiocephalometry (ODDI-oblique diameter difference index, CPI-cranio proportional

  15. Untitled

    Indian Academy of Sciences (India)

    Frost HJ, Ashby M F 1982 Deformation mechanism maps: the plasticity and creep of metals and ceramics (Oxford: Pergamon). Greenwood GW 1956 The growth of dispersed precipitates in solution Acta Metall. 4: 243-248. Iacocca RG, Woodford D A 1988 The growth of dispersed precipitates in nickel and its relevance.

  16. Analysis of inheritance mode in chrysanthemum using EST-derived SSR markers

    NARCIS (Netherlands)

    Park, Sang Kun; Arens, Paul; Esselink, Danny; Lim, Jin Hee; Shin, Hak Ki

    2015-01-01

    To study the inheritance mode of hexaploid chrysanthemum (random or preferential chromosome pairing), a segregation analysis was carried out using SSR markers derived from chrysanthemum ESTs in the public domain. A total of 248 EST-SSR primer pairs were screened in chrysanthemum cultivars

  17. 77 FR 49852 - Notice of Passenger Facility Charge (PFC) Approvals and Disapprovals

    Science.gov (United States)

    2012-08-17

    .... Public Agency: County of Gregg, Longview, Texas. Application Number: 12-03-C-00-GGG. Application Type...,066,265 $6,669,248 04/01/16 12/01/16 *02-02-C-01-GGG, Longview, TX 07/10/12 699,232 699,232 12/01/12...

  18. ADHD and DAT1: Further evidence of paternal over-transmission of risk alleles and haplotype

    NARCIS (Netherlands)

    Hawi, Z.; Kent, L.; Hill, M.; Anney, R.J.; Brookes, K. J.; Barry, E.; Franke, B.; Banaschewski, T.; Buitelaar, J.; Ebstein, R.; Miranda, A.; Oades, R.D.; Roeyers, H.; Rothenberger, A.; Sergeant, J.A.; Sonuga-Barke, E.; Steinhausen, H.C.; Faraone, S.V.; Asherson, P.; Gill, M.

    2009-01-01

    We [Hawi et al. (2005); Am J Hum Genet 77:958-965] reported paternal over-transmission of risk alleles in some ADHD-associated genes. This was particularly clear in the case of the DAT1 30-UTR VNTR. In the current investigation, we analyzed three new sample comprising of 1,248 ADHD nuclear families

  19. ADHD and DAT1: further evidence of paternal over-transmission of risk alleles and haplotype.

    NARCIS (Netherlands)

    Hawi, Z.; Kent, L.; Hill, M.; Anney, R.J.; Brookes, K.J.; Barry, E.; Franke, B.; Banaschewski, T.; Buitelaar, J.K.; Ebstein, R.; Miranda, A.; Oades, R.D.; Roeyers, H.; Rothenberger, A.; Sergeant, J.A.; Sonuga-Barke, E.J.S.; Steinhausen, H.C.; Faraone, S.V.; Asherson, P.; Gill, M.

    2010-01-01

    We [Hawi et al. (2005); Am J Hum Genet 77:958-965] reported paternal over-transmission of risk alleles in some ADHD-associated genes. This was particularly clear in the case of the DAT1 3'-UTR VNTR. In the current investigation, we analyzed three new sample comprising of 1,248 ADHD nuclear families

  20. Download this PDF file

    African Journals Online (AJOL)

    Rivista di Agricultura Sub- tropicale e Tropicale 77:209—248. Rezene Fessehaie and Parker, C. (1992). Problems and control of parasitic weeds in Ethiopia. In: Proceedings, 2nd Ethiopian Weed Science Workshop, Addis. Ababa, 1988, pp. 61—63. EWSC, Addis Ababa, Ethiopia. Saghir, A.R. (1979). Different chemicals and ...

  1. ERRATUM- Paradoxical helminthiasis and giardiasis in Cape Town ...

    African Journals Online (AJOL)

    Eggs and cysts were seen at the following prevalence: Ascaris 24.8%; Trichuris 50.6%; Hymenolepis nana 2.2%; Enterobius 0.6%; Giardia 17.3%; hookworm 0.08%; and Trichostrongylus 0.1%. Approximately 60% of sewage sludge is used in a form that will contain viable eggs and cysts. Conclusions: Prevalence trends in ...

  2. Journal of Astrophysics and Astronomy | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    2016-01-27

    Jan 27, 2016 ... pp 167-170. Ultraviolet Spectroscopic Observations of Coronal Streamers in the SOHO Era .... pp 243-248. Damping of Slow Magnetoacoustic Waves in an Inhomogeneous Coronal Plasma .... Energy Dependence of Near-relativistic Electron Spectrum at Geostationary Orbit during the SEP Events of 2005.

  3. Genetic diversity in Balkhi, Hashtnagri and Michni sheep ...

    African Journals Online (AJOL)

    hope&shola

    2010-11-08

    Nov 8, 2010 ... Detecting immigration by using multilocus genotypes. Proc. Natl. Acad. Sci. USA, 94: 9197-9221. Raymond M, Rousset F (1995). GENEPOP (version 4.0): population genetic software for exact test and ecumenicism. J. Hered. 86: 248-. 249. Saitbekova NS, Gaillard C, Obexer-Ruff G, Dolf G (1999). Genetic.

  4. The Liberation of Emilia | Iyasere | Shakespeare in Southern Africa

    African Journals Online (AJOL)

    “So speaking as I think, I die, I die.” (Othello 5.2.248) No episode in Shakespeare's tragedies is more shocking and more heart-rending than the murder of Desdemona, an event 'too dreadful to be endured'. From the Renaissance to the present, the dastardliness of this excruciating spectacle has evoked strong emotions in ...

  5. Properties of carbonisation products obtained from impregnated coal

    Czech Academy of Sciences Publication Activity Database

    Plevová, Eva; Šugárková, Věra; Kaloč, M.; Vaculíková, Lenka

    -, - (2008), s. 52-61. ISBN 978-80-248-1939-6 Grant - others:GA CŘ(CZ) GA105/00/1698 Institutional research plan: CEZ:AV0Z30860518 Keywords : chlorides * impregnation * coal Subject RIV: CC - Organic Chemistry

  6. Species Profiles. Life Histories and Environmental Requirements of Coastal Fishes and Invertebrates (South Florida). Reef-Building Tube Worm.

    Science.gov (United States)

    1989-12-01

    Phragmatopona in southeastern Florida. Master’s Thesis. Florida hipidosa en fondos blandos de Punta Moron ( Golfo Atlantic University, Boca Raton. 290 pp...develolpment of 28:221-248. Sabellaria floridensis from Florida and Phragmatopoma californica from southern California Gram, R. 1968. A Florida...1979. Ultrastructural evidence for California . Part 6: Paraonidae, Magelonidae, both autosynthetic and heterosynthetic yolk formation Longosomidae

  7. AFRICAN JOURNAL OF ECONOMIC REVIEW

    African Journals Online (AJOL)

    Dr Kazungu

    terrorism was felt in Africa in 1976 when Palestinian terrorists hijacked a commercial plane of Air France, carrying. 248 passengers taken to Uganda. Israeli Defense Forces carried out a raid in order to resolve the issue but this fueled the situation and in reaction, almost four years later the Palestinian Liberation Organization ...

  8. Olusola and Adeniji Afr. J. Infect. Dis.

    African Journals Online (AJOL)

    cadewumi

    according to the 2011; estimate (CIA, 2012). In 2011, confirmed measles cases were 17,248, with an annual incidence rate of 18.2 per 100,000 children (FMOH, 2013]. Epidemics are annually reported in northern Nigeria but rarely in the southern part of the country. Since there are other conditions that present with similar ...

  9. DISHA

    Indian Academy of Sciences (India)

    ranjeetha

    ... 1273 in-hose R&D units including 248 SIRO units. Data does not include small scale industries and higher education. 50000. 60000. 70000. R&D. 30000. 40000. 50000. Auxillary Activities. Administrative. Activities ... their management for a period of one year for career progression and self employment. p g. p y. • Training ...

  10. DIE RING In diens van onderlinge sorg

    African Journals Online (AJOL)

    kerk (Spoelstra 1989:248). Wanneer gemeentes in kerkverband met mekaar tree, en as 'n eerste uitdrukking hiervan in ringsverband vergader (in hulle eie omgewing), is dit in gehoorsaamheid aan hulle God se opdrag. Die ring het dus opsig self reeds 'n getuienisfunksie en mag daarom nie opsioneel raak nie. 8. DIE WEG ...

  11. Uplatnění PETL při řešení některých složitých kauz v oblasti příčinné souvislosti v medicínskoprávních sporech

    Czech Academy of Sciences Publication Activity Database

    Doležal, Adam; Doležal, Tomáš

    2013-01-01

    Roč. 19, 7-8 (2013), s. 242-248 ISSN 1211-4405 R&D Projects: GA ČR GAP408/12/2574 Institutional support: RVO:68378122 Keywords : medical law * causality * medico-legal disputes Subject RIV: AG - Legal Sciences

  12. 78 FR 73191 - Sunshine Act Meeting

    Science.gov (United States)

    2013-12-05

    ... in advance and provide your name, date of birth, and social security number (SSN) or passport number... premises and personnel. In order to do this, we may disclose your information consistent with the routine... collect your information by 12 U.S.C. 243 and 248, and Executive Order 9397. In accordance with Executive...

  13. 78 FR 39294 - Government in the Sunshine; Meeting Notice

    Science.gov (United States)

    2013-07-01

    ... provide your name, date of birth, and social security number (SSN) or passport number. You may provide... order to do this, we may disclose your information consistent with the routine uses listed in the....C 243 and 248, and Executive Order 9397. In accordance with Executive Order 9397, we collect your...

  14. 77 FR 32637 - Sunshine Act Meeting Notice

    Science.gov (United States)

    2012-06-01

    ... provide your name, date of birth, and social security number (SSN) or passport number. You may provide... order to do this, we may disclose your information consistent with the routine uses listed in the... information by 12 U.S.C 243 and 248, and Executive Order 9397. In accordance with Executive Order 9397, we...

  15. 76 FR 36923 - Sunshine Act Meeting

    Science.gov (United States)

    2011-06-23

    ... notify us in advance and provide your name, date of birth, and social security number (SSN) or passport... premises and personnel. In order to do this, we may disclose your information consistent with the routine... collect your information by 12 U.S.C. 243 and 248, and Executive Order 9397. In accordance with Executive...

  16. Postmoderne kerk-wees in die lig van publieke teologie – eenheid ...

    African Journals Online (AJOL)

    UPuser

    Die filosoof Immanuel Kant (1724-1804) het volgens Newbigin (in De Reuver 2004:248) .... Postmoderniteit, aan die ander kant, kan geloof nie probeer uitsluit of tot niet maak nie. Dit word dan selfs moontlik dat ..... lesbians from the traditional sexual ethics that support male dominance. (Poling 1995:122). 'n Lewe sonder ...

  17. 78 FR 59715 - Notice of Resource Advisory Council Meetings for the Dominguez-Escalante National Conservation...

    Science.gov (United States)

    2013-09-27

    ... Whitman Educational Center, 248 S. 4th St., Grand Junction, CO 81501. FOR FURTHER INFORMATION CONTACT... presentations from various resource specialists working on the RMP, as well as Council reports on the following..., and will be published in the Federal Register, announced through local media and on the BLM's Web site...

  18. A Review of Breast Calcifications on Mammography in a Tertiary ...

    African Journals Online (AJOL)

    Biopsies were performed where indicated and histology results were compared with radiological findings. Data was analyzed using the Epi-info statistical software. Results Out of the 248 patients assessed, the predominant presenting symptoms were breast pain (30.2%) and breast lump (27.4%). While assessing the ...

  19. Go4Life

    Medline Plus

    Full Text Available ... all Try some of these Go4Life exercises to improve your flexibility! 2:48 Play next Play now ... all Try some of these Go4Life exercises to improve your strength! Stronger muscles can make it easier ...

  20. Optimal Mirrleesean taxation in a Ben-Porath economy

    Czech Academy of Sciences Publication Activity Database

    Kapička, Marek

    2015-01-01

    Roč. 7, č. 2 (2015), s. 219-248 ISSN 1945-7707 R&D Projects: GA ČR(CZ) GA13-29370S Institutional support: PRVOUK-P23 Keywords : optimal tax es * unobservable human capital * income tax es Subject RIV: AH - Economics Impact factor: 2.567, year: 2015

  1. Cumulative Reports and Publications through December 31, 1992

    Science.gov (United States)

    1993-04-01

    tip body and time hysteresis camping. ICASE Report No. 89-22, April 18, 1989. 24 pages. Matematica Aplicada e Computacional , Vol. 8, No. 2, pp. 101-118...distributed parameter systems. ICASE Report No. 85-58, November 22, 1985, 102 pages. Mathematica Applicada e Computacional , Vol. 5, No. 3, 1987, pp. 203-248

  2. Sexual Advances by Patients in Dental Practice: Implications for the Dental and Dental Hygiene Curricula.

    Science.gov (United States)

    Chiodo, Gary T.; And Others

    1992-01-01

    A survey of Oregon dentists (n=248) and dental hygienists (n=235) investigated frequency of patient-initiated sexual advances and methods of dealing with them. Up to 44 percent experienced 1 or more patient verbal advances, and 23 percent experienced physical advances during a 5-year period. Inclusion of related issues in professional curricula is…

  3. Pollen-inferred millennial changes in landscape patterns at a major biogeographical interface within Europe

    Czech Academy of Sciences Publication Activity Database

    Jamrichová, Eva; Petr, L.; Jiménez-Alfaro, B.; Jankovská, Vlasta; Dudová, Lydie; Pokorný, P.; Kolaczek, P.; Zernitskaya, V.; Čierniková, M.; Břízová, E.; Syrovátka, V.; Hájková, Petra; Hájek, M.

    2017-01-01

    Roč. 44, č. 10 (2017), s. 2386-2397 ISSN 0305-0270 EU Projects: European Commission(XE) 278065 - LONGWOOD Institutional support: RVO:67985939 Keywords : distribution patterns * gradient analysis * historical biogeography * Holocene * pollen Subject RIV: EH - Ecology, Behaviour OBOR OECD: Ecology Impact factor: 4.248, year: 2016

  4. Ambient nitrogen oxides exposure and early childhood respiratory illnesses

    Czech Academy of Sciences Publication Activity Database

    Ghosh, R.; Joad, J.; Beneš, I.; Dostál, Miroslav; Šrám, Radim; Hertz-Picciotto, I.

    2012-01-01

    Roč. 39, č. 1 (2012), s. 96-102 ISSN 0160-4120 R&D Projects: GA MŽP(CZ) SP/1B3/50/07 Institutional research plan: CEZ:AV0Z50390703 Keywords : air pollution * bronchitis * croup Subject RIV: DN - Health Impact of the Environment Quality Impact factor: 6.248, year: 2012

  5. Fluid mechanics of needle valves with rounded components Part III: Pressure distributions on walls

    Czech Academy of Sciences Publication Activity Database

    Tesař, Václav

    2016-01-01

    Roč. 248, September (2016), s. 138-147 ISSN 0924-4247 R&D Projects: GA ČR GA13-23046S Institutional support: RVO:61388998 Keywords : needle valves * pressure measurements * valves Subject RIV: BK - Fluid Dynamics Impact factor: 2.499, year: 2016 http://www.sciencedirect.com/science/article/pii/S0924424716303417

  6. Fish Farmers' Perception of Climate change impact on fish ...

    African Journals Online (AJOL)

    Michael Madukwe

    Physical assets that use wood and fuelwood which impinged on climate .... and consumption. For instance, Kainji lake basin data revealed a sharp decline on fish yield from 32,474 tonnes in 1995 to 13,361 tonnes in 2001 and 9,248 tonnes in 2004. (Abiodun, 2003 .... fibre or plastic will reduce the cutting of wood for canoe ...

  7. Spectroscopy of heavy fissionable nuclei

    Indian Academy of Sciences (India)

    2015-08-05

    Aug 5, 2015 ... phenomena. Recent advances in instrumentation and analysis techniques have made feasible sensi- .... the ATLAS superconducting linear accelerator were made incident on radioactive targets of 248Cm ..... and neutron shells, and provided critical validation of theoretical models which predict properties ...

  8. Zum Stand und den Perspektiven der allgemeinsprachlichen ...

    African Journals Online (AJOL)

    Mev. R.B. Ruthven

    Kritische Anmerkun- gen zur neueren und neuesten Wörterbuchforschung. Lexicographica 17: 217-248. Wiegand, Herbert Ernst. 2001a. Sprachkontaktwörterbücher, Typen, Funktionen, Strukturen. Igla,. Birgit, Pavel Petkov und Herbert Ernst Wiegand (Hrsg.). 2001. Theoretische und praktische. Probleme der Lexikographie.

  9. Ontogenesis of the oral vestibule in the sheep (Ovis aries, Ruminantia)

    Czech Academy of Sciences Publication Activity Database

    Pavlíková, H.; Witter, K.; Míšek, Ivan

    2001-01-01

    Roč. 248, č. 3 (2001), s. 270-270 ISSN 0362-2525 R&D Projects: GA AV ČR IAA7039901; GA AV ČR KSK6005114 Keywords : striated palatal muscle Subject RIV: EG - Zoology Impact factor: 0.959, year: 2001

  10. Effective School-Community Relations as a Key Performance Indicator for the Secondary School Administrator in Aba South District, Nigeria

    Science.gov (United States)

    Abraham, Nath. M.; Ememe, Ogbonna N.

    2012-01-01

    This study investigates Effective School-Community Relations as a key Performance Indicator (KPI) of Secondary Schools Administrator in Aba South District, Nigeria. Descriptive survey method was adopted. All the 248 teachers made up the population and sample in a purposive sampling technique representing 100% of the entire population as sample. A…

  11. ORF Alignment: NC_000913 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available s; ... ATP-dependent adenylate transferase, modifies MoaD ... [Escherichia coli K12] dbj|BAA35...nylate transferase, modifies MoaD [Escherichia ... coli K12] gb|AAC73913.1| molybdopterin biosynthesi... NC_000913 gi|16128794 >1jw9B 1 247 2 248 9e-96 ... ref|NP_415347.1| ATP-dependent ade

  12. Longitudinal Study on Reciprocity between Personality Traits and Parenting Stress

    Science.gov (United States)

    Rantanen, Johanna; Tillemann, Kati; Metsäpelto, Riitta-Leena; Kokko, Katja; Pulkkinen, Lea

    2015-01-01

    Reciprocal associations between the Big Five personality traits and parenting stress--including both parents' feelings of their distress and perception of their incompetence as parents--were studied with 248 participants (49% of which were males). Longitudinal data, collected at ages 33/36, 42 and 50 years, were used. Cross-lagged path analysis…

  13. Sales Simulation Games: Student and Instructor Perceptions

    Science.gov (United States)

    Beuk, Frederik

    2016-01-01

    This study combines the perspective of students (n = 137) and sales instructors (n = 248). It compares how well selling and sales management simulation games, case discussions, and traditional lectures are perceived to conform to the seven principles for good practice in undergraduate education. The study further compares each method's performance…

  14. Stable carbon and oxygen isotope study on benthic foraminifera ...

    Indian Academy of Sciences (India)

    Ajoy K Bhaumik

    2017-07-24

    Jul 24, 2017 ... Unconventional Resources Group, Keshav Dev Malviya Institute of Petroleum Exploration, Oil and Natural Gas. Corporation Ltd., 9, Kaulagarh Road, Dehradun 248 195, India. 6. Gas-Hydrate Group, CSIR-National Geophysical Research Institute, Uppal Road, Hyderabad 500 007, India. *Corresponding ...

  15. How Hearing Loss and Age Affect Emotional Responses to Nonspeech Sounds

    Science.gov (United States)

    Picou, Erin M.

    2016-01-01

    Purpose: The purpose of this study was to evaluate the effects of hearing loss and age on subjective ratings of emotional valence and arousal in response to nonspeech sounds. Method: Three groups of adults participated: 20 younger listeners with normal hearing (M = 24.8 years), 20 older listeners with normal hearing (M = 55.8 years), and 20 older…

  16. Crystallization of poly(.i.N./i.-methyldodecano-12-lactam) in blends with poly(styrene-stat-acrylic acid)

    Czech Academy of Sciences Publication Activity Database

    Kratochvíl, Jaroslav; Sikora, Antonín

    2007-01-01

    Roč. 43, č. 5 (2007), s. 2155-2164 ISSN 0014-3057 R&D Projects: GA ČR GA106/02/1248 Institutional research plan: CEZ:AV0Z40500505 Keywords : polymer blend s * crystallization * secondary crystallization Subject RIV: CD - Macromolecular Chemistry Impact factor: 2.248, year: 2007

  17. Optimized method for isolation of immature intracytoplasmic retroviral particles from mammalian cells

    Czech Academy of Sciences Publication Activity Database

    Langerová, Hana; Ruml, T.; Rumlová, M.

    2017-01-01

    Roč. 248, Oct (2017), s. 19-25 ISSN 0166-0934 Institutional support: RVO:61388963 Keywords : intracytoplasmic particles (ICAPs) * retrovirus * assembly * Mason-Pfizer monkey virus Subject RIV: EE - Microbiology, Virology OBOR OECD: Virology Impact factor: 1.693, year: 2016

  18. Nigerian Quarterly Journal of Hospital Medicine - Vol 8, No 4 (1998)

    African Journals Online (AJOL)

    Clinical trial of Roxithromychin in the Lagos University Teaching Hospital and other health facilities in Lagos · EMAIL FULL TEXT EMAIL FULL TEXT DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. A F Mabadeje, E O Bandele, T Odugbemi, M O Mabayoje, E L Bamgboye, R B Sanusi, A K Abiose, T A Odutola, 248-250.

  19. A prototype parabolic trough solar concentrators for steam production

    African Journals Online (AJOL)

    The maximum temperature of steam obtained was 248.3oC while average temperature of steam was produced was 150oC. When closed their efficiencies were: Aluminium sheet reflector PTSC; 55.52 %, Car solar reflector PTSC; 54.65 % and Aluminium foil reflector PTSC; 51.29 %. The open solar concentrator efficiencies ...

  20. Detection of Hg2+ ions in aqueous medium using an indole-based fluorescent probe: Experimental and theoretical investigations

    Czech Academy of Sciences Publication Activity Database

    Joshi, S.; Kumari, S.; Sarmah, Amrit; Pant, D. D.; Sakhuja, R.

    2017-01-01

    Roč. 248, Dec (2017), s. 668-677 ISSN 0167-7322 Institutional support: RVO:61388963 Keywords : coumarin * chemosensor * fluorescence * quenching * mercury * DFT calculations Subject RIV: CF - Physical ; Theoretical Chemistry OBOR OECD: Physical chemistry Impact factor: 3.648, year: 2016

  1. Bacterial diversity in snow on North Pole ice floes

    DEFF Research Database (Denmark)

    Hauptmann, Aviaja Zenia Edna Lyberth; Stibal, Marek; Bælum, Jacob

    2014-01-01

    The microbial abundance and diversity in snow on ice floes at three sites near the North Pole was assessed using quantitative PCR and 454 pyrosequencing. Abundance of 16S rRNA genes in the samples ranged between 43 and 248 gene copies per millilitre of melted snow. A total of 291,331 sequences we...

  2. An Investigation of Big Five Personality Traits and Career Decidedness among Early and Middle Adolescents

    Science.gov (United States)

    Lounsbury, John W.; Hutchens, Teresa; Loveland, James M.

    2005-01-01

    Big Five personality traits were analyzed in relation to career decidedness among adolescents in middle and high school. Participants were 248 7th-grade, 321 10th-grade, and 282 12th-grade students. As hypothesized, Conscientiousness was positively and significantly correlated with career decidedness in all three grades. Openness and Agreeableness…

  3. 7 CFR 900.101 - Definitions.

    Science.gov (United States)

    2010-01-01

    ... Regulations of the Department of Agriculture (Continued) AGRICULTURAL MARKETING SERVICE (Marketing Agreements... Governing Meetings To Arbitrate and Mediate Disputes Relating to Sales of Milk or Its Products § 900.101... Agricultural Marketing Agreement Act of 1937, as amended (50 Stat. 248, as amended; 7 U.S.C. 671); (b) The term...

  4. Bayesian estimation of the parameters of the birnbaum-saunders ...

    African Journals Online (AJOL)

    Bayesian estimation of the parameters of the birnbaum-saunders distribution. K Robert, LO Odongo. Abstract. No Abstract > East African Journal of Statistics Vol. 1 (3) 2007: pp.248-260. Full Text: EMAIL FULL TEXT EMAIL FULL TEXT · DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT.

  5. A toadfish (Batrachoidiformes) from the Oligocene of the Eastern Carpathians (Piatra Neamt, Romania)

    Czech Academy of Sciences Publication Activity Database

    Přikryl, Tomáš; Grădianu, I.; Georgescu, V.; Carnevale, G.

    2018-01-01

    Roč. 287, č. 2 (2018), s. 241-248 ISSN 0077-7749 R&D Projects: GA ČR(CZ) GA16-21523S Institutional support: RVO:67985831 Keywords : Batrachoidiformes * toadfish * Bituminous Marls Formation * Eastern Carpathians * Oligocene Subject RIV: DB - Geology ; Mineralogy Impact factor: 0.777, year: 2016

  6. Performance Analysis of an Experimental Centrifugal Pump ...

    African Journals Online (AJOL)

    The maximum possible power coefficient is 2.48x10-4 at a corresponding flow coefficient of 3.2x10-3 giving a head coefficient of 0.078 at the best efficient point (BEP). Electronic sensors on the H47 rig provided measurements that ensured noticing of fluctuations across the Venturi meter caused by the onset of cavitation.

  7. Vlevo?

    Czech Academy of Sciences Publication Activity Database

    Janáček, Pavel; Šindelka, M.; Mandys, P.

    2013-01-01

    Roč. 57, 248 příl. Víkend č. 51 (2013), s. 32-34 ISSN 0862-9587 Institutional support: RVO:68378068 Keywords : Czech prose * Czech poetry * literature for children and youth * literature and politics Subject RIV: AJ - Letters, Mass-media, Audiovision

  8. Elemental analysis of ash residue from combustion of CCA treated wood waste before and after electrodialytic extraction

    DEFF Research Database (Denmark)

    Pedersen, Anne Juul; Ottosen, Lisbeth M.

    2006-01-01

    . Chemical analyses of untreated and treated ash confirmed that most As, but only smaller amounts of Cu and Cr was removed due to the electrodialytic extraction. Overall metal contents in the original ash residue were: 1.4 g As, 2.76 g Cu and 2.48 g Cr, after electrodialytic extraction these amounts were...

  9. Novel thidiazuron-derived inhibitors of cytokinin oxidase/dehydrogenase

    Czech Academy of Sciences Publication Activity Database

    Nisler, Jaroslav; Kopečný, D.; Končitíková, R.; Zatloukal, Marek; Bazgier, Václav; Berka, K.; Zalabák, D.; Briozzo, P.; Strnad, Miroslav; Spíchal, Lukáš

    2016-01-01

    Roč. 92, 1-2 (2016), s. 235-248 ISSN 0167-4412 R&D Projects: GA MŠk(CZ) LO1204; GA ČR GA15-22322S Institutional support: RVO:61389030 Keywords : Cytokinin oxidase/dehydrogenase * Crystal structure * Molecular docking Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 3.356, year: 2016

  10. Thinking about Applications: Effects on Mental Models and Creative Problem-Solving

    Science.gov (United States)

    Barrett, Jamie D.; Peterson, David R.; Hester, Kimberly S.; Robledo, Issac C.; Day, Eric A.; Hougen, Dean P.; Mumford, Michael D.

    2013-01-01

    Many techniques have been used to train creative problem-solving skills. Although the available techniques have often proven to be effective, creative training often discounts the value of thinking about applications. In this study, 248 undergraduates were asked to develop advertising campaigns for a new high-energy soft drink. Solutions to this…

  11. Haddam Neck Plant. Annual operating report: January--December 1976

    International Nuclear Information System (INIS)

    1976-01-01

    Net electric power generated was 4,026,168.66 MWH with the reactor on line 7,248.60 hrs. Information is presented concerning operations, design changes, start-up physics testing, steam generator eddy current examination, corrective maintenance, shutdowns and power reductions, coolant chemistry, personnel radiation exposure, power generation and fuel performance

  12. Evolutionary history of the thicket rats (genus Grammomys) mirrors the evolution of African forests since late Miocene

    Czech Academy of Sciences Publication Activity Database

    Bryja, J.; Šumbera, R.; Kerbis Peterhans, J. C.; Aghová, T.; Bryjová, A.; Mikula, Ondřej; Nicolas, V.; Denys, C.; Verheyen, E.

    2017-01-01

    Roč. 44, č. 1 (2017), s. 182-194 ISSN 0305-0270 Institutional support: RVO:67985904 Keywords : Arvicanthini * coastal forests * late Miocene Subject RIV: EA - Cell Biology OBOR OECD: Biology (theoretical, mathematical, thermal, cryobiology, biological rhythm), Evolutionary biology Impact factor: 4.248, year: 2016

  13. Multilocus phylogeny of East African gerbils (Rodentia, Gerbilliscus) illuminates the history of the Somali-Masai savanna

    Czech Academy of Sciences Publication Activity Database

    Aghová, T.; Šumbera, R.; Piálek, L.; Mikula, Ondřej; McDonough, M. M.; Lavrenchenko, L. A.; Meheretu, Y.; Mbau, J. S.; Bryja, J.

    2017-01-01

    Roč. 44, č. 10 (2017), s. 2295-2307 ISSN 0305-0270 Institutional support: RVO:67985904 Keywords : biogeography * Gerbillinae * historical DNA * murid rodents * phylogeography Subject RIV: EA - Cell Biology OBOR OECD: Biology (theoretical, mathematical, thermal, cryobiology, biological rhythm), Evolutionary biology Impact factor: 4.248, year: 2016

  14. Evolutionary history of the thicket rats (genus Grammomys) mirrors the evolution of African forests since late Miocene

    Czech Academy of Sciences Publication Activity Database

    Bryja, Josef; Šumbera, R.; Kerbis Peterhans, J. C.; Aghová, Tatiana; Bryjová, Anna; Mikula, Ondřej; Nicolas, V.; Denys, C.; Verheyen, E.

    2017-01-01

    Roč. 44, č. 1 (2017), s. 182-194 ISSN 0305-0270 Institutional support: RVO:68081766 Keywords : Arvicanthini * coastal forests * late Miocene * lowland forests * mountain forests * phylogeography * Plio-Pleistocene climate changes * Rodentia * tropical Africa Subject RIV: EG - Zoology OBOR OECD: Ecology Impact factor: 4.248, year: 2016

  15. Chemical behaviour of a few atoms of rutherfordium (Rf, Z= 104) and of dubnium (Db, Z= 105) produced at Orsay

    International Nuclear Information System (INIS)

    Trubert, D.; Hussonnois, M.; Le Naour, C.; Brillard, L.; Monroy Guzman, F.; Le Du, J.F.; Servajean, V.

    1998-01-01

    The isotopes 261 Rf and 262 Db were produced by irradiation of a 248 Cm target with respectively 18 O and 19 F ions, at the MP Tandem accelerator of Orsay (France). These isotopes were isolated in HF medium, using he RACHEL setup. Moreover, the radioisotope 262 DB was produced by a nuclear reaction. (authors)

  16. Experiment mimořádných měsíčních odečtů u zákazníků kategorie maloodběr a domácnost

    Czech Academy of Sciences Publication Activity Database

    Bečvář, J.; Blahová, L.; Pihera, M.; Pelikán, Emil; Brabec, Marek

    2007-01-01

    Roč. 87, - (2007), s. 248-250 ISSN 0032-1761 R&D Project s: GA AV ČR 1ET400300513 Institutional research plan: CEZ:AV0Z10300504 Keywords : spotřeba energie * matematické modelování * zemní plyn Subject RIV: IN - Informatics, Computer Science

  17. Discovery of SM Higgs Boson in ATLAS Experiment

    Indian Academy of Sciences (India)

    Home; Journals; Resonance – Journal of Science Education; Volume 18; Issue 3. Discovery of SM Higgs Boson in ATLAS Experiment. Prafulla Kumar Behera. General Article Volume 18 Issue 3 March 2013 pp 248-263. Fulltext. Click here to view fulltext PDF. Permanent link:

  18. Fulltext PDF

    Indian Academy of Sciences (India)

    Energy distribution of cosmic rays in the Earth's atmosphere and avionic area using Monte. Carlo codes . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . M Ould Mohamed, A S A Dib and A H Belbachir. 1. Influence of nuclear dissipation on fission dynamics of the excited nucleus 248Cf within a stochastic approach .

  19. Antibiotic Sensitivity Pattern of Urinary Tract Pathogens in Port ...

    African Journals Online (AJOL)

    DR. MIKE HORSFALL

    New mechanisms of bacterial resistance to antimicrobial agents. New. England Journal of Medicine, 324: 601-612. Kabins, A E and Cohen, S (1966). Resistance factor in. Enterobacteriaceae. New England Journal of. Medicine, 275: 248-252. Kunin, C M (1987). Detection, Prevention and. Management of Urinary Tract ...

  20. Analysis of genetic diversity of Piper spp. in Hainan Island (China ...

    African Journals Online (AJOL)

    use

    2011-10-26

    Oct 26, 2011 ... Inter-simple sequence repeat (ISSR) analysis was used to evaluate the genetic variation of Piper spp. from Hainan, China. 247 polymorphic bands out of a total of 248 (99.60%) were generated from 74 individual plants of Piper spp. The overall level of genetic diversity among Piper spp. in Hainan was.

  1. Research Article Special Issue

    African Journals Online (AJOL)

    2018-01-15

    Jan 15, 2018 ... observation sites and its dependence on human generated RFI. Research in Astronomy and. Astrophysics, 2014, 14(2):241-248. [8] Abidin Z Z, Umar R, Ibrahim Z A, Rosli Z, Asanok K, Gasiprong N. Investigation on the frequency allocation for radio astronomy at the L band. Publications of the Astronomical.

  2. Application of solar treatment for the disinfection of geophagic clays ...

    African Journals Online (AJOL)

    Elvis Fosso-Kankeu

    by the vendors then put in a black plastic bag as normal practice with any customer. As per arrangement the trips to the ... Small holes were perforated at the backwall of the chamber to ensure proper circulation of ..... disinfection: effectiveness in peri-urban households in Nepal. J. Water Health 3:239-248. Rubery E (2002).

  3. Pilgrim Nuclear Power Station, Unit 1. Annual operating report, 1975

    International Nuclear Information System (INIS)

    1976-01-01

    Net electrical power generated was 2,587,248 MWH(e) with the reactor on line 6,242.4 hr. Information is presented concerning operations, power generation, shutdowns, corrective maintenance, chemistry and radiochemistry, occupational radiation exposure, release of radioactive materials, and reportable occurrences

  4. Pacific Partnership 2007: The First Dedicated United States Ship Humanitarian and Civic Assistance Mission

    Science.gov (United States)

    2010-10-25

    and education for public health officials. Training for HN medical personnel included lifesaving skills, nutrition , and prenatal care. Biomedical...38.27 Lower back pain 998 245 295 248 124 19 67 33.50 Muscle pain 403 61 77 197 38 18 12 13.53 Sprain, strain, tendonitis 78 23 12 25 11 3 4

  5. Microwave - Assisted Intercatation of 1-Alkanols and 1, omega-Alkanediols into alpha-Zirconium Phosphate. Evidence of Conformational Phase Transitions in the Bimolecular Film of Alkyl Chains

    Czech Academy of Sciences Publication Activity Database

    Costantino, U.; Vivani, R.; Zima, Vítězslav; Beneš, Ludvík; Melánová, Klára

    xx, č. 18 (2002), s. 1211-1217 ISSN 0743-7463 R&D Projects: GA ČR GA202/01/0520 Keywords : zirconium phosphate * intercalation * alkanols Subject RIV: CA - Inorganic Chemistry Impact factor: 3.248, year: 2002

  6. Journal of Earth System Science | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    mean rate 0.084 m/y) whereas comparatively six salt lakes (out of seven salt lakes) exhibited ∼3 times higher mean rate of lake level ... Centre for Glaciology, Wadia Institute of Himalayan Geology, 33 GMS Road, Dehradun 248 001, India.

  7. Tribological and mechanical properties of nanocrystalline-TiC/a-C nanocomposite thin films

    Czech Academy of Sciences Publication Activity Database

    Musil, Jindřich; Novák, P.; Čerstvý, R.; Soukup, Z.

    2010-01-01

    Roč. 28, č. 2 (2010), s. 244-248 ISSN 0734-2101 R&D Projects: GA AV ČR(CZ) KAN400480701 Institutional research plan: CEZ:AV0Z10100522 Keywords : nc-TiC/a-C nanocomposite * friction * mechanical properties * magnetron sputtering * wear Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 1.291, year: 2010

  8. 77 FR 74178 - Notice of Intent To Grant Exclusive Patent License: Kismet Management Fund LLC

    Science.gov (United States)

    2012-12-13

    ... throughout the United States, the Government-owned inventions described in U.S. Patent No. 7,051,098: System... Applications in a Resource Management System//U.S. Patent No. 7,096,248: Program Control for Resource Management Architecture and Corresponding Programs//U.S. Patent No. 7,171,654: System Specification Language...

  9. 75 FR 26310 - Self-Regulatory Organizations; International Securities Exchange, LLC; Notice of Filing and...

    Science.gov (United States)

    2010-05-11

    .... Index Fund. 237 COST Costco Wholesale 288 KBH KB Home. Corp. 239 MJN Mead Johnson 289 CREE Cree Inc... Act. \\4\\ Index products would be included in the expansion if the underlying index level was under 200... Fund. 155 CIEN Ciena Corp. 248 ACL Alcon Inc. 157 AMLN Amylin 249 STP Suntech Power Pharmaceuticals Inc...

  10. Cretaceous park of sex determination: sex chromosomes are conserved across iguanas

    Czech Academy of Sciences Publication Activity Database

    Rovatsos, M.; Pokorná, Martina; Altmanová, M.; Kratochvíl, L.

    2014-01-01

    Roč. 10, č. 3 (2014), s. 20131093 ISSN 1744-9561 R&D Projects: GA ČR GAP506/10/0718 Institutional support: RVO:67985904 Keywords : Anolis * lizard * male heterogamety Subject RIV: EG - Zoology Impact factor: 3.248, year: 2014

  11. Activity Energy Expenditure and Mobility Limitation in Older Adults: Differential Associations by Sex

    NARCIS (Netherlands)

    Manini, T.M.; Everhart, J.E.; Patel, K.V.; Schoeller, D.A.; Cummings, S.; Mackey, D.C.; Bauer, D.C.; Simonsick, E.M.; Cobert, L.H.; Visser, M.; Tylavsky, F.; Newman, A.B.; Harris, T.B.

    2009-01-01

    In this study, the authors aimed to determine whether higher activity energy expenditure, assessed by using doubly labeled water, was associated with a reduced decline in mobility limitation among 248 older community-dwelling US adults aged 70-82 years enrolled in 1998-1999. Activity energy

  12. Hydrogeochemical and anthropogenic influence on the quality of ...

    African Journals Online (AJOL)

    Sixty percent (60%) of the groundwater samples were slightly acidic (5.5-6.4) and were different from the WHO (2004) standard for drinking water. Electrical conductivity values (3-274 μS/cm) and total dissolved solids (7.66 to 248.30 mg/l) for groundwater sources were low and signified low mineralisation and freshwater ...

  13. Upgradation of MOT and its Relevance to WET Campaigns Alisher S ...

    Indian Academy of Sciences (India)

    median values). Outer scale (m). 25.9 ± 19.0. Seeing angle (arcsec). 0.67 ± 0.25. Isoplanatic patch (arcsec). 2.48 ± 0.70 of Chilean sites – La Silla (dotted line) and Paranal (dashed line) in 1989–1995 and. Canarian site – Roque de los ...

  14. A study on matrix assisted pulsed evaporation (MAPLE) of organic materials

    DEFF Research Database (Denmark)

    Matei, Andreea; Canulescu, Stela; Constantinescu, Catalin

    2012-01-01

    Organic films can be produced either by MAPLE or directly by PLD (Pulsed laser deposition). For a reasonable deposition rate of ng/cm2 per pulse for film production by MAPLE a fluence of 1-1.5 J/cm2 is required at the laser wavelength of 355 nm, while the fluence can be considerably lower at 248 ...

  15. The Context Is the Message?! Learning about the Israeli-Palestinian Conflict through Computerized Simulations in Different National Contexts

    Science.gov (United States)

    Kampf, Ronit

    2016-01-01

    Two cross-national experimental studies examined the effects of PeaceMaker and Global Conflicts on knowledge acquisition and attitude change regarding the Israeli-Palestinian conflict. PeaceMaker and Global Conflicts are role-playing computerized simulations of this conflict. 248 undergraduate students from Turkey, Israel, Palestine and the US…

  16. A closed solar photobioreactor for cultivation of microalgac under supra-high irradiance: basic design and performance

    Czech Academy of Sciences Publication Activity Database

    Masojídek, Jiří; Papáček, Štěpán; Sergejevova, Magda; Jirka, V.; Červený, J.; Kunc, J.; Korečko, J.; Verbovikova, O.; Kopecký, Jiří; Štys, Dalibor; Torzillo, G.

    2003-01-01

    Roč. 15, - (2003), s. 239-248 ISSN 0921-8971 R&D Projects: GA MŠk LN00A141 Institutional research plan: CEZ:AV0Z5020903 Keywords : cyanobacterium * spirulina * photoinhibition Subject RIV: CE - Biochemistry Impact factor: 0.828, year: 2003

  17. Multiple Facets of Self-Control in Arab Adolescents: Parallel Pathways to Greater Happiness and Less Physical Aggression

    Science.gov (United States)

    Gavriel-Fried, Belle; Ronen, Tammie; Agbaria, Qutaiba; Orkibi, Hod; Hamama, Liat

    2018-01-01

    Adolescence is a period of dramatic change that necessitates using skills and strengths to reduce physical aggression and increase happiness. This study examined the multiple facets of self-control skills in achieving both goals simultaneously, in a sample of 248 Arab adolescents in Israel. We conceptualized and tested a new multi-mediator model…

  18. File list: Pol.Epd.20.RNA_polymerase_II.AllCell [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available Pol.Epd.20.RNA_polymerase_II.AllCell hg19 RNA polymerase RNA polymerase II Epidermi...248,SRX663247,SRX807622 http://dbarchive.biosciencedbc.jp/kyushu-u/hg19/assembled/Pol.Epd.20.RNA_polymerase_II.AllCell.bed ...

  19. Resonance – Journal of Science Education | News

    Indian Academy of Sciences (India)

    The Central Dogma of Molecular Biology - A Retrospective after Fifty Years · Michel Morange · More Details Fulltext PDF. pp 248-258 General Article. Chemistry is Everygreen - 2008 Nobel Prize in Chemistry · Swagata Dasgupta · More Details Fulltext PDF. pp 259-271 Series Article. Snippets of Physics - Hubble Expansion ...

  20. Educators' Self-Reported Training, Use, and Perceived Effectiveness of Evidence-Based Classroom Management Practices

    Science.gov (United States)

    Cooper, Justin T.; Gage, Nicholas A.; Alter, Peter J.; LaPolla, Stefanie; MacSuga-Gage, Ashley S.; Scott, Terrance M.

    2018-01-01

    A survey study of 248 educators in four states was conducted to identify respondents' formal training, use, and perceived effectiveness of 37 evidence-based classroom management practices within four general categories: (a) antecedent-based, (b) instructionally based, (c) consequence-based, and (d) self-management. Results indicated that, on…

  1. Endemic Hepatitis E in two Nordic Countries

    DEFF Research Database (Denmark)

    Norder, H.; Sundqvist, L.; Magnusson, L.

    2009-01-01

    Antibodies against hepatitis E virus (anti-HEV) were found in 248 Swedish and Danish patients between 1993 and 2007. Most patients were symptomatic and tested for anti-HEV due to travel abroad. Among patients with known country of infection, most were infected in Asia, mainly on the Indian...

  2. Chemistry is Evergreen

    Indian Academy of Sciences (India)

    Home; Journals; Resonance – Journal of Science Education; Volume 14; Issue 3. Chemistry is Everygreen - 2008 Nobel Prize in Chemistry. Swagata Dasgupta. General Article Volume 14 Issue 3 March 2009 pp 248-258. Fulltext. Click here to view fulltext PDF. Permanent link:

  3. 75 FR 7302 - Union Pacific Railroad Company-Abandonment Exemption-in Polk County, IA

    Science.gov (United States)

    2010-02-18

    ... DEPARTMENT OF TRANSPORTATION Surface Transportation Board [STB Docket No. AB-33 (Sub-No. 248X)] Union Pacific Railroad Company--Abandonment Exemption--in Polk County, IA Union Pacific Railroad Company... 225.56 near Berwick to milepost 232.80 near Bondurant, a distance of 7.24 miles, in Polk County, IA...

  4. Voltammetry of osmium-modified DNA at a mercury film electrode application in detecting DNA hybridization

    Czech Academy of Sciences Publication Activity Database

    Kostečka, Pavel; Havran, Luděk; Pivoňková, Hana; Fojta, Miroslav

    2004-01-01

    Roč. 63, 1-2 (2004), s. 245-248 ISSN 1567-5394 R&D Projects: GA AV ČR IAA4004108; GA AV ČR KJB4004302 Institutional research plan: CEZ:AV0Z5004920 Keywords : osmium * DNA hybridization * mercury film electrode Subject RIV: BO - Biophysics Impact factor: 2.261, year: 2004

  5. Associateship | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    Date of birth: 28 March 1982. Specialization: Molecular Ecology, Conservation Genetics, Wildlife Endocrinology Address: AECB Department, Wildlife Inst. of India, PO Box 18, Chandrabani, Dehradun 248 001, Uttarakhand Contact: Office: (0135) 264 6249. Residence: (0135) 264 6177, 81919 70271. Fax: (0135) 264 0117

  6. Effect O6-Guanine Alkylation on DNA Flexibility Studied by Comparative Molecular Dynamics Simulations

    Czech Academy of Sciences Publication Activity Database

    Kara, M.; Dršata, Tomáš; Lankaš, Filip; Zacharias, M.

    2015-01-01

    Roč. 103, č. 1 (2015), s. 23-32 ISSN 0006-3525 R&D Projects: GA ČR(CZ) GA14-21893S Institutional support: RVO:61388963 Keywords : DNA damage * DNA alkylation * DNA repair * molecular simulation * molecular dynamics simulation Subject RIV: BO - Biophysics Impact factor: 2.248, year: 2015

  7. The influence of criminal offending on union formation and union dissolution for disadvantaged individuals

    NARCIS (Netherlands)

    Zoutewelle-Terovan, M.; van der Geest, V.; Liefbroer, A.C.; Bijleveld, C.

    2016-01-01

    Using a sample of 248 males and females from The Netherlands, we study the effect of criminal offending on union formation and union dissolution. Criminal and relational careers of high-risk respondents are analyzed using a long observation period (age 12 to age 36). Findings for men support the

  8. Pediatric Palliative Care: A Personal Story

    Medline Plus

    Full Text Available ... 186,248 views 4:24 Portraits of Life, Love and Legacy through Pediatric Palliative Care - Duration: 5: ... 40,056 views 4:38 Portraits of Life, Love & Legacy Through Pediatric Palliative Care - Duration: 54:51. ...

  9. Five-Factor Personality Traits as Predictor of Career Maturity

    Science.gov (United States)

    Atli, Abdullah

    2017-01-01

    Purpose: This study aims to determine the predictive strength of personality traits based on the five-factor theory on the level of career maturity Research Methods: The sample of the study included a total of 429 high school students, 248 females (57.8%) and 181 males (42.2%). The study utilized the "Career Maturity Scale" to determine…

  10. Affinity Capillary Electrophoresis – A Powerful Tool to Investigate Biomolecular Interactions

    Czech Academy of Sciences Publication Activity Database

    Kašička, Václav

    2017-01-01

    Roč. 30, č. 5 (2017), s. 248 ISSN 1471-6577 Institutional support: RVO:61388963 Keywords : capillary affinity electrophoresis * biomolecular interactions * binding constants Subject RIV: CB - Analytical Chemistry, Separation OBOR OECD: Analytical chemistry Impact factor: 0.663, year: 2016

  11. African Journal of Environmental Science and Technology - Vol 2 ...

    African Journals Online (AJOL)

    Adaptation technologies and legal instruments to address climate change impacts to coastal and marine resources in Tanzania · EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. R.E. Sallema, G.Y.S. Mtui, 239-248 ...

  12. Predictors of Maternal Sensitivity in At-Risk Families

    Science.gov (United States)

    Neuhauser, Alex

    2018-01-01

    Maternal sensitivity is of central importance to a child's healthy development. This study examines how different types of psychosocial stress originating from the child, the parents, the context, and overall stress relate to maternal sensitivity. Psychosocial stress and its impact on maternal sensitivity are assessed in an at-risk sample of 248

  13. Journal of Biosciences | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    April 2003, pages 248-358. Viral Evasion of Host Responses ... pp 273-285 Articles. Lessons in Détente or know thy host: The immunomodulatory gene products of myxoma virus .... pp 337-348 Articles. Molecular interactions of 'high risk' human papillomaviruses E6 and E7 oncoproteins: implications for tumour progression.

  14. Deposition and characterization of ITO films produced by laser ablation at 355 nm

    DEFF Research Database (Denmark)

    Holmelund, E.; Thestrup Nielsen, Birgitte; Schou, Jørgen

    2002-01-01

    Indium tin oxide (ITO) films have been deposited by pulsed laser deposition (PLD) at 355 nm. Even though the absorption of laser light at the wavelength 355 nm is much smaller than that of the standard excimer lasers for PLD at 248 nm and 193 nm, high-quality films can be produced. At high fluence...

  15. Detection of some virulence factors in Staphylococcus aureus ...

    African Journals Online (AJOL)

    USER

    2010-06-21

    Jun 21, 2010 ... region gene, 22 samples contained X region coding gene protein A, 3 sample contained Toxic shock syndrome toxin gene (tst), ..... Vandenesch F, Moghazeh S (1995). The agr P2 operon: an autocatalytic sensory transduction system in Staphylococcus aureus. Mol. Gen. Genet. 248: 446-458. Novick RP ...

  16. Nutrition management of a trauma patient with pneumatosis ...

    African Journals Online (AJOL)

    BMI) was calculated to be 24.8 kg/m², reflecting the clinical impression. His serum lactate was significantly raised (6.2 mmol/l) on admission, and the urea, creatinine and liver function tests were mildly raised. After two days of free drainage (300 ...

  17. The use of urban plant resources for health and food security in Kampala, Uganda

    DEFF Research Database (Denmark)

    Mollee, Eefke Maria

    of 270 plant species were identified of which 248 different food plants were considered useful: 101 medicinal species, 70 food plants, 53 utilitarian plants and 24 ornamental species. No significant association was found between child nutrition and garden agrobiodiversity, however 5% of the food items...

  18. Number 1, July

    Indian Academy of Sciences (India)

    Energy distribution of cosmic rays in the Earth's atmosphere and avionic area using Monte. Carlo codes . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . M Ould Mohamed, A S A Dib and A H Belbachir. 1. Influence of nuclear dissipation on fission dynamics of the excited nucleus 248Cf within a stochastic approach .

  19. Geotechnická měření v historickém důlním díle

    Czech Academy of Sciences Publication Activity Database

    Kaláb, Zdeněk

    -, - (2009), s. 1-45. ISBN 978-80-248-1999-0. ISSN 1213-7456 R&D Projects: GA ČR GA105/09/0089 Institutional research plan: CEZ:AV0Z30860518 Keywords : geotechnical measurement * seismological measurement * distributed measurement network Subject RIV: DC - Siesmology, Volcanology, Earth Structure http://www.waset.org/pwaset/current.html

  20. Demonstrating Efficacy in Preclinical Studies of Cellular Therapies for Spinal Cord Injury - How Much is Enough?

    Czech Academy of Sciences Publication Activity Database

    Kwon, B. K.; Soril, L. J. J.; Bacon, M.; Beattie, M. S.; Blesch, A.; Bresnahan, J. C.; Bunge, M. B.; Dunlop, S. A.; Fehlings, M. G.; Ferguson, A. R.; Hill, C. E.; Karimi-Abdolrezaee, S.; Lu, P.; McDonald, J. W.; Müller, H. W.; Oudega, M.; Rosenzweig, E. S.; Reier, P. J.; Silver, J.; Syková, Eva; Xu, X. M.; Guest, J. D.; Tetzlaff, W.

    2013-01-01

    Roč. 248, Oct (2013), s. 30-44 ISSN 0014-4886 R&D Projects: GA ČR GA13-00939S; GA ČR(CZ) GBP304/12/G069 Institutional support: RVO:68378041 Keywords : spinal cord injury * cell transplantation therapies * clinical trial Subject RIV: FH - Neurology Impact factor: 4.617, year: 2013

  1. 30 CFR 250.242 - What information must accompany the DPP or DOCD?

    Science.gov (United States)

    2010-07-01

    ... § 250.248; (g) Air emissions information required by § 250.249; (h) Oil and hazardous substance spills...? 250.242 Section 250.242 Mineral Resources MINERALS MANAGEMENT SERVICE, DEPARTMENT OF THE INTERIOR....258; (q) Sulphur operations information required by § 250.259; (r) Coastal zone management information...

  2. Charged-particle multiplicity measurement in proton-proton collisions at root s=7 TeV with ALICE at LHC

    Czech Academy of Sciences Publication Activity Database

    Aamodt, K.; Abel, N.; Abeysekara, U.; Abrahantes Quintana, A.; Abramyan, A.; Adamová, Dagmar; Bielčík, Jaroslav; Bielčíková, Jana; Kapitán, Jan; Kushpil, Svetlana; Kushpil, Vasilij; Pachr, M.; Petráček, Vojtěch; Rak, Jan; Šumbera, Michal; Tlustý, David; Wagner, Vladimír; Mareš, Jiří A.; Polák, Karel; Závada, Petr

    2010-01-01

    Roč. 68, 3-4 (2010), s. 345-354 ISSN 1434-6044 R&D Projects: GA MŠk LA08015 Institutional research plan: CEZ:AV0Z10480505; CEZ:AV0Z10100502 Keywords : PSEUDORAPIDITY DISTRIBUTIONS * PP INTERACTIONS * ENERGIES Subject RIV: BG - Nuclear, Atomic and Molecular Physics, Colliders Impact factor: 3.248, year: 2010

  3. Synaptospora olandica, a new species from Sweden

    Czech Academy of Sciences Publication Activity Database

    Réblová, Martina

    2002-01-01

    Roč. 54, č. 2 (2002), s. 248-255 ISSN 0082-0598 R&D Projects: GA AV ČR KSK6005114; GA ČR GA206/99/D082 Institutional research plan: CEZ:AV0Z6005908 Keywords : ascospore morphology * Collematospora * Coniochaetaceae Subject RIV: EF - Botanics Impact factor: 0.500, year: 2002

  4. Ligninolytic enzyme complex of Armillaria spp

    Czech Academy of Sciences Publication Activity Database

    Stoychev, I.; Nerud, František

    2000-01-01

    Roč. 45, č. 3 (2000), s. 248-250 ISSN 0015-5632 Institutional research plan: CEZ:AV0Z5020903 Keywords : lignin olytic enzyme * lignin peroxidase Subject RIV: EE - Microbiology, Virology Impact factor: 0.752, year: 2000

  5. Biased and Constitutive Signaling in the CC-Chemokine Receptor CCR5 by manipulating the Interface between Transmembrane Helix 6 and 7

    DEFF Research Database (Denmark)

    Steen, Anne; Thiele, Stefanie; Guo, Dong

    2013-01-01

    The equilibrium state of CCR5 is manipulated here toward either activation or inactivation by introduction of single amino acid substitutions in the transmembrane domains (TMs) 6 and 7. Insertion of a steric hindrance mutation in the center of TM7 (G286F in position VII:09/7.42) resulted in biased...... signaling. Thus, beta-arrestin recruitment was eliminated, whereas constitutive activity was observed in Gi-mediated signaling. Furthermore, the CCR5 antagonist aplaviroc was converted to a full agonist (a so-called efficacy switch). Computational modeling revealed that the position of the 7TM receptor......-conserved Trp in TM6 (Trp-248 in position VI:13/6.48, part of the CWXP motif) was influenced by the G286F mutation, causing Trp-248 to change orientation away from TM7. The essential role of Trp-248 in CCR5 activation was supported by complete inactivity of W248A-CCR5 despite maintaining chemokine binding...

  6. Mesophase properties after anthracene thermal exposure

    Czech Academy of Sciences Publication Activity Database

    Šugárková, Věra; Plevová, Eva; Kaloč, M.

    -, - (2008), s. 62-70. ISBN 978-80-248-1939-6 Grant - others:GA ČR GA105/00/1698 Institutional research plan: CEZ:AV0Z30860518 Keywords : mesophase * anthracene * thermal behaviour * anisotropy Subject RIV: CC - Organic Chemistry

  7. Balancing the Trinity: U.S. Approaches to Marginalizing Islamic Militancy in Pakistan

    Science.gov (United States)

    2013-12-01

    Pakistani ground supply lines, airfields, and seaports (Anderson, 2011; Grevatt, 2009). Despite this, Pakistan appears to be generally complacent in...and Terrorism, 2012). These attacks culminated with the 2008 attacks on hotels in Mumbai, which left 172 dead and 248 injured. Following the complex

  8. Relaxation of Shot-Peened Residual Stresses Under Creep Loading (Preprint)

    Science.gov (United States)

    2008-10-01

    relaxation in an AISI 4140 steel due to quasistatic and cyclic loading at higher temperatures,” Material Science and Engineering A248, 1998, pp. 9...Applications to Type 304 Stainless Steel,” Trans. ASME Journal of Engineering Materials and Technology, 96, 1976, pp. 97. [33] Parker, J. D., and

  9. The prognosis following amphetamine poisoning

    DEFF Research Database (Denmark)

    Horwitz, Henrik; Dalhoff, Kim P.; Klemp, Marc

    2017-01-01

    the background population. Results: From August 2006 to December 2013 we identified 1444 patients (70% males) who experienced amphetamine poisoning; 52% of the cases were classified as mixed poisonings and the average age at first contact was 24.8 years (SD 8.6). The prevalence of psychiatric disorders, HIV...

  10. Insight into band positions and inter-particle electron transfer dynamics between CdS nanoclusters and spatially isolated TiO2 dispersed in cubic MCM-48 mesoporous materials: a highly efficient system for photocatalytic hydrogen evolution under visible light illumination

    NARCIS (Netherlands)

    Peng, R.; Lin, C.K.; Baltrusaitis, Jonas; Wu, C.M.; Dimitrijevic, N.M.; Rajh, T.; May, S.; Koodali, R.T.

    2014-01-01

    CdS incorporated Si-MCM-48 and Ti-MCM-48 cubic phased mesoporous photocatalysts were prepared by a two-step modification synthetic approach under relatively mild conditions. A highly efficient (24.8%, apparent quantum yield (AQY)) photocatalyst for visible light (λ > 400 nm) enabled solar hydrogen

  11. Macroporous hydrogels based on 2-hydroxyethyl methacrylate. Part 3. Hydrogels as carriers for immobilization of proteins

    Czech Academy of Sciences Publication Activity Database

    Michálek, Jiří; Přádný, Martin; Artyukhov, A.; Šlouf, Miroslav; Smetana Jr., K.

    2005-01-01

    Roč. 16, č. 8 (2005), s. 783-786 ISSN 0957-4530 R&D Projects: GA ČR GA203/01/0737; GA AV ČR IBS4050005; GA MŠk LN00A065 Keywords : macroporous hydrogels * hydroxyethyl methacrylate * crosslinked copolymers Subject RIV: CD - Macromolecular Chemistry Impact factor: 1.248, year: 2005

  12. Analysis of genetic diversity of Piper spp. in Hainan Island (China ...

    African Journals Online (AJOL)

    Inter-simple sequence repeat (ISSR) analysis was used to evaluate the genetic variation of Piper spp. from Hainan, China. 247 polymorphic bands out of a total of 248 (99.60%) were generated from 74 individual plants of Piper spp. The overall level of genetic diversity among Piper spp. in Hainan was high, with the mean ...

  13. Resonance – Journal of Science Education | Indian Academy of ...

    Indian Academy of Sciences (India)

    Home; Journals; Resonance – Journal of Science Education; Volume 23; Issue 3. Issue front cover thumbnail Issue back cover thumbnail. Volume 23, Issue 3. March 2018, pages 245-413. pp 245-248 Editorial. Editorial · More Details Abstract Fulltext PDF. pp 249-249 Science Smiles. Science Smiles · More Details Abstract ...

  14. Development of an advanced, continuous mild gasification process for the production of co-products: Topical report

    Energy Technology Data Exchange (ETDEWEB)

    Cha, C.Y.; Merriam, N.W.; Jha, M.C.; Breault, R.W.

    1988-06-01

    Research on mild gasification is discussed. The report is divided into three sections: literature survey of mild gasification processes; literature survey of char, condensibles, and gas upgrading and utilization methods; and industrial market assessment of products of mild gasification. Recommendations are included in each section. (CBS) 248 refs., 58 figs., 62 tabs.

  15. Half a century of succession in a temperate oakwood: from species-rich community to mesic forest

    Czech Academy of Sciences Publication Activity Database

    Hédl, Radim; Kopecký, M.; Komárek, J.

    2010-01-01

    Roč. 16, č. 2 (2010), s. 267-276 ISSN 1366-9516 R&D Projects: GA AV ČR IAA600050812; GA ČR GD206/08/H049 Institutional research plan: CEZ:AV0Z60050516 Keywords : homogenization * long-term change * biodiversity loss Subject RIV: EF - Botanics Impact factor: 4.248, year: 2010

  16. Biodiversity of traits and species both show weak responses to hydromorphological alteration in lowland river macroinvertebrates

    Czech Academy of Sciences Publication Activity Database

    Feld, Ch. K.; de Bello, Francesco; Dolédec, S.

    2014-01-01

    Roč. 59, č. 2 (2014), s. 233-248 ISSN 0046-5070 R&D Projects: GA ČR GAP505/12/1296 Institutional support: RVO:67985939 Keywords : taxonomic distinctness * taxonomic diversity * trait diversity Subject RIV: EH - Ecology, Behaviour Impact factor: 2.738, year: 2014

  17. Disiplin Hukum Yang Mewujudkan Kesetaraan dan Keadilan Gender (Law Discipline to Manifest Gender Equality and Justice

    Directory of Open Access Journals (Sweden)

    Tien Handayani Nafi

    2012-05-01

    Full Text Available This 248-page book enable the readers to see the author’s intent to desribe the position of law and gender in law discipline, hence the public (especially the law students can understand that law and gender can be manifested through law disciplines.

  18. The Holy Logos in the Writings of Philo of Alexandria

    Czech Academy of Sciences Publication Activity Database

    Hoblík, Jiří

    2014-01-01

    Roč. 56, č. 3 (2014), s. 248-266 ISSN 0010-3713 R&D Projects: GA ČR(CZ) GBP401/12/G168 Institutional support: RVO:67985955 Keywords : Philo of Alexandria * Ancient Jewish philosophy * Logos * holiness Subject RIV: AA - Philosophy ; Religion

  19. Effect of collection techniques on cumulus oocyte complexes (COCs ...

    African Journals Online (AJOL)

    Jane

    2011-08-17

    Aug 17, 2011 ... contrast, the number of normal COCs/ovary was significantly higher (p < 0.01) in aspiration (2.48) followed by slicing (1.91) and ... can be recovered in relatively large numbers from abattoir ovaries, the oocytes ..... vitro environments on the metabolism of the cumulus-oocyte complex and its influence on the ...

  20. Kinematics and physical conditions of H I in nearby radio sources. The last survey of the old Westerbork Synthesis Radio Telescope

    NARCIS (Netherlands)

    Maccagni, F. M.; Morganti, R.; Oosterloo, T. A.; Geréb, K.; Maddox, N.

    2017-01-01

    We present an analysis of the properties of neutral hydrogen (H I) in 248 nearby (0.02 30 mJy and for which optical spectroscopy is available. The observations were carried out with the Westerbork Synthesis Radio Telescope as the last large project before the

  1. Mutations that modify or exclude binding of the QA ubiquinone and carotenoid in the reaction center from Rhodobacter sphaeroides

    NARCIS (Netherlands)

    Ridge, J.P.; van Brederode, M.E.; Goodwin, M.G.; van Grondelle, R.; Jones, M.R.

    1999-01-01

    Three single-site mutations have been introduced at positions close to the Q(A) ubiquinone in the reaction centre from Rhodobacter sphaeroides. Two of these mutations, Ala M260 to Trp and Ala M248 to Trp, result in a reaction centre that does not support photosynthetic growth of the bacterium, and

  2. Bulletin of Materials Science | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    ... India; Department of Physics, University of Petroleum and Energy Studies, Dehradun 248 007, India; Centre of Nanotechnology, Institute Instrumentation Centre, Indian Institute of Technology Roorkee, Roorkee 247 667, India; Department of Metallurgical and Materials Engineering, Indian Institute of Technology Roorkee, ...

  3. Thakur, Dr Vikram Chandra

    Indian Academy of Sciences (India)

    Fellow Profile. Elected: 1991 Section: Earth & Planetary Sciences. Thakur, Dr Vikram Chandra Ph.D. (London). Date of birth: 15 January 1940. Specialization: Structural Geology, Tectonics of Himalayan Geology and Active Tectonics Address: 9/12 (Lane 9), Ashirwad Eclave, Dehra Dun 248 001, Uttarakhand Contact:

  4. Inductive Information Retrieval Using Parallel Distributed Computation.

    Science.gov (United States)

    1984-06-01

    ormance, 8, pp. 793-810, 196. ONR -0)1. Jonathan T. Grudin and Serge Larochelle. Digraph Frequency Effects in Skilled Typing. February 1982. ONR-8202...248, 1983. ONR-4083. Gary Perlman. Natural Artificial Lang ges: Low-Level Processes. December 192. Also published in The Internatonal Journal of Man

  5. Physical modeling of triple near-Earth Asteroid (153591) 2001 SN263 from radar and optical light curve observations

    Czech Academy of Sciences Publication Activity Database

    Becker, T.M.; Howell, E. S.; Nolan, M. C.; Magri, C.; Pravec, Petr; Taylor, P.A.; Oey, J.; Higgins, D.; Világi, J.; Kornoš, L.; Galád, A.; Gajdoš, Š.; Gaftonyuk, N. M.; Krugly, Yu. N.; Molotov, I.E.; Hicks, M. D.; Carbognani, A.; Warner, B. D.; Vachier, F.; Marchis, F.; Pollock, J.

    2015-01-01

    Roč. 248, March (2015), s. 499-515 ISSN 0019-1035 R&D Projects: GA ČR GAP209/12/0229 Grant - others:SAV(SK) Vega1/0670/13 Institutional support: RVO:67985815 Keywords : asteroids * near-Earth objects * satellites of asteroids Subject RIV: BN - Astronomy, Celestial Mechanics, Astrophysics Impact factor: 3.383, year: 2015

  6. Low-mass binary X-Ray sources: Monitoring with various satellites

    Czech Academy of Sciences Publication Activity Database

    Šimon, Vojtěch

    2014-01-01

    Roč. 54, č. 3 (2014), s. 248-253 ISSN 1210-2709. [IBWS (INTEGRAL/BART) workshop. Karlovy Vary, 22.03.2013-25.3.2013] Grant - others:GA ČR(CZ) GA13-33324S Institutional support: RVO:67985815 Keywords : radiation mechanisms * accretion disks * X-rays Subject RIV: BN - Astronomy, Celestial Mechanics, Astrophysics

  7. The appraisal of mathematics teachers in Ghana | Fletcher | African ...

    African Journals Online (AJOL)

    This study examined the nature and existing methods of teacher appraisal in Ghana. 441 secondary mathematics teachers participated, of whom 193 teach the subject at the junior secondary level and 248 teach it at the senior secondary level. In addition, 44 Ghana Education Service Officials and 6 Heads of secondary ...

  8. Debating the Social Thinking of Carlos Nelson Coutinho

    Directory of Open Access Journals (Sweden)

    Bruno Bruziguessi

    2017-10-01

    Full Text Available BRAZ, Marcelo; RODRIGUES, Mavi (Org.. Cultura, democracia e socialismo: as idéias de Carlos Nelson Coutinho em debate. [Culture, democracy and socialism: The ideas of Carlos Nelson Coutinho in debate]. Rio de Janeiro: Mórula, 2016. 248 p.

  9. First proton-proton collisions at the LHC as observed with the ALICE detector: measurement of the charged-particle pseudorapidity density at root s=900 GeV

    Czech Academy of Sciences Publication Activity Database

    Aamodt, K.; Adamová, Dagmar; Bielčík, J.; Bielčíková, Jana; Kapitán, Jan; Král, J.; Krus, M.; Kushpil, Svetlana; Kushpil, Vasilij; Mareš, Jiří A.; Pachr, M.; Petráček, V.; Polák, Karel; Pospíšil, V.; Šmakal, R.; Šumbera, Michal; Tlustý, D.; Wagner, V.; Závada, Petr; Zycháček, V.

    2010-01-01

    Roč. 65, 1-2 (2010), s. 111-125 ISSN 1434-6044 R&D Projects: GA MŠk LA09013 Institutional support: RVO:68378271 ; RVO:61389005 Keywords : ALICE * high energies * hadrons Subject RIV: BG - Nuclear, Atomic and Molecular Physics, Colliders; BF - Elementary Particles and High Energy Physics (FZU-D) Impact factor: 3.248, year: 2010

  10. Spreading to a limit: the time required for a neophyte to reach its maximum range

    Czech Academy of Sciences Publication Activity Database

    Gassó, N.; Pyšek, Petr; Vila, M.; Williamson, M.

    2010-01-01

    Roč. 16, č. 2 (2010), s. 310-311 ISSN 1366-9516 R&D Projects: GA MŠk LC06073 Institutional research plan: CEZ:AV0Z60050516 Keywords : plant invasions * maximum range * residence time Subject RIV: EF - Botanics Impact factor: 4.248, year: 2010

  11. In situ polymerized polyaniline films

    Czech Academy of Sciences Publication Activity Database

    Riede, A.; Helmdstedt, M.; Sapurina, I.; Stejskal, Jaroslav

    2002-01-01

    Roč. 248, č. 2 (2002), s. 413-418 ISSN 0021-9797 R&D Projects: GA AV ČR KSK4050111 Institutional research plan: CEZ:AV0Z4050913 Keywords : polyaniline * conducting polymer * thin films Subject RIV: CD - Macromolecular Chemistry Impact factor: 1.466, year: 2002

  12. Data of evolutionary structure change: 1I7KB-2ONUA [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1I7KB-2ONUA 1I7K 2ONU B A PVGKRLQQELMTLMMSGDKGISAFPESDNLFKWVGTIHG.../entryChain> 2ONU A 2ONUA LEU CA 387 2ONU A 2ONU...248 THR CA 202 ALA CA 208 PHE CA 291 2ONU... A 2ONUA

  13. Postprandial triglyceride response in young adult men and familial risk for coronary atherosclerosis

    NARCIS (Netherlands)

    Uiterwaal, C.S.P.M.; Grobbee, D.E.; Witteman, J.C.M.; Stiphout, W.A.H.J. van; Krauss, X.H.; Havekes, L.M.; Bruijn, A.M. de; Tol, A. van; Hofman, A.

    1994-01-01

    Setting: Coronary angiography departments of four central general hospitals in the Netherlands. Patients: 80 sons (mean age, 24.8 years) of men with severe coronary artery disease and 55 sons (mean age, 23.2 years) of controls. Measurements: Postprandial levels of serum triglycerides, retinyl

  14. Vliv typu vazby historického zdiva na jeho teplotní namáhání

    Czech Academy of Sciences Publication Activity Database

    Beran, Pavel

    2013-01-01

    Roč. 22, č. 10 (2013), s. 248-253 ISSN 1805-2576 R&D Projects: GA ČR(CZ) GBP105/12/G059 Institutional support: RVO:68378297 Keywords : thermal expansion * masonry * thermal stress * compatibility Subject RIV: JN - Civil Engineering http://www.stavebniobzor.cz/clanek/vliv-typu-vazby-historickeho-zdiva-na-jeho-teplotni-namahani/

  15. Egyptian Journal of Medical Human Genetics - Vol 9, No 2 (2008)

    African Journals Online (AJOL)

    Frequency of fragile-x in x‑linked mental retardation · EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT · DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. ES El Sobky, SA El‑Ella, MA Tawfik, WF Mohamed, 237-248 ...

  16. Gender and Developmental Differences in Attitudes toward Science ...

    African Journals Online (AJOL)

    This study aimed at investigating gender differences in attitudes toward science in Ghanaian schools. It also attempted to study developmental differences in attitudes toward science between pupils when they were in grade 7 and when they got to grade 9 two years after. A stratified random sample (N=248) was obtained ...

  17. Can epigenetic control explain pronounced within plant heterogeneity of meiosis in a translocation trisome of Secale L.?

    NARCIS (Netherlands)

    Sybenga, J.

    2012-01-01

    Meiotic metaphase I configuration frequencies were determined in different tillers of genetically related plants of rye (Secale cereale L.) heterozygous for reciprocal translocation T248W (between chromosome arms 1RS and 6RS) and with an additional (telocentric) arm 1RS. Seventeen different

  18. Computer Aided Layout Programs. A Contemporary Appraisal,

    Science.gov (United States)

    1982-01-01

    Hale [4], Ritzman [15], Hitchings and Cottam [8], and Scriabin and Vergin [16]. Unfortunately, all of these studies dealt with the quadratic assignment...Algorithms for Plant Loca’tion," Management Science, Vol. 18, pp. 240-248, 1972. [16] Scriabin , M., and R. C. Vergin, "Comparison of Computer Algorithms and

  19. Journal of Chemical Sciences | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    Polyimido sulphur anions S(NR) n m − : Free radicals and coordination behaviour · Dietmar Stalke .... pp 239-248. Aspects of organochalcogen (S, Se, Te) compounds stabilized by intramolecular coordination .... De novo design and synthesis of water-soluble gold(I) compounds: Structure-antitumor activity considerations.

  20. Arora, Dr Baldev Raj

    Indian Academy of Sciences (India)

    Date of birth: 10 October 1947. Specialization: Electromagnetic Geophysics, Seismotectonics and Geomagnetism Address: 36, Janakpuri, Engineers Enclave, Phase III, GMS Road, Dehra Dun 248 001, Uttarakhand Contact: Residence: 98712 87209. Mobile: 98973 91661. Email: arorabr47@gmail.com. YouTube; Twitter ...

  1. Thakur, Dr Vikram Chandra

    Indian Academy of Sciences (India)

    Date of birth: 15 January 1940. Specialization: Structural Geology, Tectonics of Himalayan Geology and Active Tectonics Address: 9/12 (Lane 9), Ashirwad Eclave, Dehra Dun 248 001, Uttarakhand Contact: Residence: (0135) 276 1271. Mobile: 98970 46455. Email: thakurvc12@gmail.com. YouTube; Twitter; Facebook ...

  2. A M Umarji

    Indian Academy of Sciences (India)

    Home; Journals; Bulletin of Materials Science. A M Umarji. Articles written in Bulletin of Materials Science. Volume 23 Issue 4 August 2000 pp 243-248 Refractory Cements. Ceramic joining through reactive wetting of alumina with calcium aluminate refractory cements · K Geetha A M Umarji T R N Kutty · More Details ...

  3. Accuracy of Cartosat-1 DEM and its derived attribute at multiple ...

    Indian Academy of Sciences (India)

    Accuracy of Cartosat-1 DEM and its derived attribute at multiple scale representation. Samadrita Mukherjee1, Sandip Mukherjee2,∗. , A Bhardwaj1,. Anirban Mukhopadhyay3, R D Garg4 and S Hazra3. 1Indian Institute of Remote Sensing, Indian Space Research Organisation, Dehradun 248 001, India. 2Department of ...

  4. Electrically conductive composites of polyethylene filled with polyamide particles coated with silver

    Czech Academy of Sciences Publication Activity Database

    Krupa, I.; Miková, G.; Novák, I.; Janigová, I.; Nógellová, Z.; Prokeš, J.; Lednický, František

    2007-01-01

    Roč. 43, č. 6 (2007), s. 2401-2413 ISSN 0014-3057 Institutional research plan: CEZ:AV0Z40500505 Keywords : electro-conductive composites * silver coated filler * mechanical properties * adhesion Subject RIV: CD - Macromolecular Chemistry Impact factor: 2.248, year: 2007

  5. New Fellows and Honorary Fellow

    Indian Academy of Sciences (India)

    Home; Fellowship. Fellow Profile. Elected: 1948 Section: Chemistry. Lal, Dr Bijan Bihari Ph.D. (Lucknow). Date of birth: 4 August 1913. Date of death: 2 June 2000. Specialization: Archaeological Chemistry, Archaeometry, Conservation and Environmental Archaeology Last known address: 47, Subhas Road, Dehra Dun 248 ...

  6. University Counseling Centers' Perceptions and Experiences Pertaining to Emotional Support Animals

    Science.gov (United States)

    Kogan, Lori R.; Schaefer, Karen; Erdman, Phyllis; Schoenfeld-Tacher, Regina

    2016-01-01

    Increasing numbers of students are requesting accommodations for emotional support animals (ESAs) in higher education settings. Since the legislation pertaining to this type of service animal differs from the laws governing disability service animals, colleges and universities are faced with developing new policies and guidelines. A sample of 248

  7. 75 FR 12519 - Notice of Intent To Prepare an Environmental Impact Statement for Beddown of Training F-35A Aircraft

    Science.gov (United States)

    2010-03-16

    ... Department of the Air Force Notice of Intent To Prepare an Environmental Impact Statement for Beddown of..., 2010 at De Baca County Courthouse Annex, 248 East Avenue C, Fort Sumner, New Mexico; Friday, April 16..., times, locations and addresses for the meetings will be published in local media a minimum of 15 days...

  8. Studies on the chemistry of element 104 with the centrifuge system SISAK-3

    Energy Technology Data Exchange (ETDEWEB)

    Eberhardt, K.; Kratz, J.V.; Mendel, M.; Naehler, A.; Trautmann, N.; Wiehl, N. [Mainz Univ. (Germany); Alstadt, J.; Omtvedt, J.P. [Oslo Univ. (Norway); Malmbeck, R.; Skarnemark, G.; Wierczinski, B. [Chalmers Univ. of Technology, Goeteborg (Sweden); Eichler, B.; Gaeggeler, H.W.; Jost, D.T.; Tuerler, A. [Paul Scherrer Inst. (PSI), Villigen (Switzerland)

    1997-09-01

    The centrifuge system SISAK-3 combined with a detector for the measurement of {alpha}-particles and spontaneous fission (SF) fragments in a flowing organic liquid has been applied to study the chemical behaviour of element 104 produced in the reaction {sup 248}Cm({sup 18}O,5n){sup 261}104. (author) 2 figs., 2 refs.

  9. The influence of various toxic effects on the cornea and changes in corneal light transmission

    Czech Academy of Sciences Publication Activity Database

    Čejka, Čestmír; Ardan, Taras; Širc, Jakub; Michálek, Jiří; Brůnová, B.; Čejková, Jitka

    2010-01-01

    Roč. 248, č. 12 (2010), s. 1749-1756 ISSN 0721-832X Institutional research plan: CEZ:AV0Z50390512; CEZ:AV0Z40500505 Keywords : spectrophotometric method * cornea l hydration * cornea l light transmission Subject RIV: FF - HEENT, Dentistry Impact factor: 2.158, year: 2010

  10. 78 FR 16921 - Physical Protection of Byproduct Material

    Science.gov (United States)

    2013-03-19

    ... material possessed by the licensee. The NRC issued the first series of orders to certain panoramic and... to panoramic and underwater irradiator licensees (EA-06-248) (71 FR 63043; October 27, 2006), M&D... radiography cameras and well- logging devices. In November 2009, the NRC issued the Increased Control Order...

  11. 75 FR 33901 - Physical Protection of Byproduct Material

    Science.gov (United States)

    2010-06-15

    ... material possessed by the licensee. The NRC issued the first series of orders to certain panoramic and... 17, 2006, the NRC issued orders to panoramic and underwater irradiator licensees (EA-06-248) (71 FR... possesses a radiography source would not need to implement the part 37 provisions if the source is protected...

  12. Synthesis of dehydroepiandrosterone and pregnenolone sulfates labeled with deuterium

    Czech Academy of Sciences Publication Activity Database

    Černý, Ivan; Bičíková, M.; Hill, M.; Hampl, R.; Buděšínský, Miloš; Pouzar, Vladimír

    2003-01-01

    Roč. 97, - (2003), s. s248 ISSN 0009-2770. [Conference on Isoprenoids /20./. 12.09.2003-18.09.2003, Liberec] R&D Projects: GA ČR GA203/02/1440 Institutional research plan: CEZ:AV0Z4055905 Keywords : labeling deuterium Subject RIV: CC - Organic Chemistry

  13. 77 FR 30532 - Ocean Transportation Intermediary License; Revocation

    Science.gov (United States)

    2012-05-23

    ... 515, effective on the corresponding date shown below: License Number: 004626N. Name: J.B.R. Marine Inc.... Name: Ramin Razi dba Acorn International Inc. Address: 20501 Ventura Blvd., Suite 248, Woodland Hills, CA 91364. Date Revoked: April 30, 2012. Reason: Failed to maintain valid bonds. Vern W. Hill...

  14. Climate reconstruction from subsurface temperatures demonstrated on example of Cuba

    Czech Academy of Sciences Publication Activity Database

    Čermák, Vladimír; Bodri, L.

    2001-01-01

    Roč. 126, 3/4 (2001), s. 295-310 ISSN 0031-9201 Institutional research plan: CEZ:AV0Z3012916 Keywords : climate change * recent warming * borehole temperatures * inversion technique Subject RIV: DC - Siesmology, Volcanology, Earth Structure Impact factor: 1.248, year: 2001

  15. Pattern Definition with DUV-Lithography at DTU Danchip

    DEFF Research Database (Denmark)

    Keil, Matthias; Khomtchenko, Elena; Nyholt, Henrik

    2014-01-01

    Deep ultra violet (DUV) illumination generated with the help of a KrF laser can be utilized to produce components having sizes of some hundreds of nanometers. This light source with its 248nm wavelength is exploited in the DUV-lithography equipment at DTU Danchip in order to fill the resolution g...

  16. Floating knee: epidemiology and results of treatment | Abalo ...

    African Journals Online (AJOL)

    According to Fraser's classification, there were 21 type I, 10 type IIa, 7 type IIb, and 5 type IIc. Most of the floating knee injuries were treated with antegrade intramedullary nailing for both the femur and tibia. The mean follow up was 24.8 months. All the fractures united within a reasonable time except for three femur and 14 ...

  17. AcEST: BP916470 [AcEST

    Lifescience Database Archive (English)

    Full Text Available 30 6.4 sp|Q00496|BXE_CLOBO Botulinum neurotoxin type E OS=Clostridium b... 30 6.5 >sp|P83006|PAFA2_RAT Plat... ++R L + P +LKT+SS PC+D Sbjct: 204 LIQPEGISEIDTAKKLLEYHRHIIRILPSYPKILKTISSDQPCVD 248 >sp|Q00496|BXE_CLOBO Botulinum neurotoxin

  18. ORF Alignment: NC_002689 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_002689 gi|13541621 >1e1hD 9 166 248 399 1e-33 ... emb|CAA43999.1| botulinum neurotoxin... type E [Clostridium botulinum] ... sp|Q00496|BXE_CLOBO Botulinum neurotoxin type E ... pr

  19. Towards the spatial coherence of biogeographical regionalizations at subcontinental and landscape scales

    Czech Academy of Sciences Publication Activity Database

    Divíšek, Jan; Storch, D.; Zelený, D.; Culek, M.

    2016-01-01

    Roč. 43, č. 43 (2016), s. 2489-2501 ISSN 0305-0270 Institutional support: RVO:68145535 Keywords : beta diversity * biogeographical regions * spatial scale Subject RIV: DE - Earth Magnetism, Geodesy, Geography Impact factor: 4.248, year: 2016 http://onlinelibrary.wiley.com/doi/10.1111/jbi.12832/full

  20. 17 CFR Appendix to Subpart B of... - Model Forms

    Science.gov (United States)

    2010-04-01

    ... investment companies, investment advisers, transfer agents, and broker-dealers] affiliates, from marketing...) REGULATIONS S-P AND S-AM Regulation S-AM: Limitations on Affiliate Marketing Pt. 248, Subpt. B, App. Appendix...—Model Form for Renewal Notice (Joint Notice) A-5—Model Form for Voluntary “No Marketing” Notice A-1...

  1. Refractive microlenses produced by excimer laser machining of poly(methyl methacrylate)

    DEFF Research Database (Denmark)

    Jensen, Martin Frøhling; Krühne, Ulrich; H., L.

    2005-01-01

    A method has been developed whereby refractive microlenses can be produced in poly (methyl methacrylate) by excimer laser irradiation at λ = 248 nm. The lenses are formed by a combined photochemical and thermal process. The lenses are formed as depressions in the substrate material (negative foca...

  2. Characteristics of Surface Ozone in Agra, a Sub-urban site in Indo ...

    Indian Academy of Sciences (India)

    65

    (2003) conducted their study at the high altitude site of Mt. ..... 247 other sites in India, ozone followed different diurnal and seasonal variations. At the high altitude. 248 site in Nainital (Sarangi et al., 2014), highest monthly mean (62 ..... meteorology on temporal evolution of O3 at a tropical location in northeast India; Environ.

  3. Dicty_cDB: Contig-U10778-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available oma floridae alpha-tubul... 246 e-130 EF432420_1( EF432420 |pid:none) Gymnodinium beii clone 7C alpha tu... ...=Tubulin alpha-4 chain; &AE014296_1817(AE... 248 e-130 EF432419_1( EF432419 |pid:none) Gymnodinium beii clon

  4. Management of HIV/AIDS among small to medium hospitality ...

    African Journals Online (AJOL)

    Management of HIV/AIDS among small to medium hospitality businesses in Buffalo City, Eastern Cape, South Africa. Nancy Phaswana-Mafuya, Jurgen Gasche. Abstract. No Abstract. African Journal for Physical, Health Education, Recreation and Dance Vol. 11(3) 2005: 228-248. Full Text: EMAIL FULL TEXT EMAIL FULL ...

  5. Journal of Earth System Science | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    The dominant forest type is tropical semi-evergreen which comprises 21,678 km2 (35.2%) of the total forest area of Western Ghats, followed by wet evergreen forest (30.6%), moist deciduous forest (24.8%) and dry deciduous forest (8.1%) in 2013. Even though it has the highest population density among the hotspots, there ...

  6. The Omics Revolution in Agricultural Research

    Science.gov (United States)

    The Agrochemicals Division cosponsored the 13th International Union of Pure and Applied Chemistry International Congress of Pesticide Chemistry held as part of the 248th National Meeting and Exposition of the American Chemical Society in San Francisco, CA, USA, August 10–14...

  7. Study of the influencing effect of pigments on the photoageing of terpenoid resins used as pictorial media

    Czech Academy of Sciences Publication Activity Database

    Doménech-Carbó, M.T.; Kučková, Štěpánka; de la Cruz-Canizares, J.; Osete-Cortina, L.

    2006-01-01

    Roč. 1121, č. 2 (2006), s. 248-258 ISSN 0021-9673 Institutional research plan: CEZ:AV0Z40320502 Keywords : GC-MS * FTIR * terpenoid resin * colophony * Mexican copal Subject RIV: CA - Inorganic Chemistry Impact factor: 3.554, year: 2006

  8. Browse Title Index

    African Journals Online (AJOL)

    Items 51 - 100 of 248 ... Vol 42, No 1 (2014), Exploring the role of sugarcane in small-scale farmers' livelihoods in the Noodsberg Area, Kwazulu-Natal, South Africa, Abstract PDF. JJ Cockburn, HC Coetzee, J Van den Berg, DE Conlong, J Witthöft. Vol 35 (2006), Extension agents\\' marketing related services: The relevance to ...

  9. Self-reported knee instability and activity limitations in patients with knee osteoarthritis: results of the Amsterdam osteoarthritis cohort

    NARCIS (Netherlands)

    van der Esch, M.; Knoop, J.; van der Leeden, M.; Voorneman, R.; Gerritsen, M.; Reiding, D.; Romviel, S.; Knol, D.L.; Lems, W.F.; Dekker, J.; Roorda, L.D.

    2012-01-01

    The objective of this study was to evaluate whether self-reported knee instability is associated with activity limitations in patients with knee osteoarthritis (OA), in addition to knee pain and muscle strength. A cohort of 248 patients diagnosed with knee OA was examined. Self-reported knee

  10. Generation of 2.1 μm wavelength from degenerate high gray track ...

    Indian Academy of Sciences (India)

    N S VASAN and S P GABA. Instruments Research and Development Establishment, Raipur Road, Dehradun 248 008, India. ∗. Corresponding author. E-mail: swatidrdo@gmail.com. DOI: 10.1007/s12043-013-0668-3; ePublication: 12 February 2014. Abstract. This paper presents the experimental results of degenerate ...

  11. Potential Of Fired Clay Bricks Produced From Aponmu Clay Deposits

    African Journals Online (AJOL)

    The potential of fired clay obtained from Aponmu river, Ondo State. Nigeria for brick production have been investigated. Properties of produced bricks investigated was compressive strength, density and water absorption. The results shows that the Compressive strength, density and water absorption values ranged from 2.48 ...

  12. Production parameters of the therapeutic Rh radionuclide using ...

    Indian Academy of Sciences (India)

    243–248. Production parameters of the therapeutic. 105. Rh radionuclide using medium energy cyclotron. MAYEEN UDDIN KHANDAKER1,2,∗. , KWANGSOO KIM2 and. GUINYUN KIM2. 1Department of Physics, University of Malaya, 50603 Kuala Lumpur, Malaysia. 2Department of Physics, Kyungpook National University, ...

  13. Rapid Response Research and Development (R&D) for the Aerospace Systems Directorate. Delivery Order 0021: Engineering Research and Technical Analyses of Advanced Airbreathing Propulsion Fuels, Subtask: Fit-for-Purpose (FFP) and Dynamic Seal Testing of Alternative Aviation Fuels

    Science.gov (United States)

    2014-08-01

    RESEARCH DIVISION ISO 9001 CERTIFIED ISO 14001 CERTIFIED 247 Approved for public release; distribution unlimited. 248 Approved for public...public release; distribution unlimited. See additional restrictions described on inside pages STINFO COPY AIR FORCE RESEARCH LABORATORY AEROSPACE...general public, including foreign nationals. Copies may be obtained from the Defense Technical Information Center (DTIC) (http://www.dtic.mil). AFRL

  14. Parent-Endorsed Sex Differences in Toddlers with and without ASD: Utilizing the M-CHAT

    Science.gov (United States)

    Øien, Roald A.; Hart, Logan; Schjølberg, Synnve; Wall, Carla A.; Kim, Elizabeth S.; Nordahl-Hansen, Anders; Eisemann, Martin R.; Chawarska, Katarzyna; Volkmar, Fred R.; Shic, Frederick

    2017-01-01

    Sex differences in typical development can provide context for understanding ASD. Baron-Cohen ("Trends Cogn Sci" 6(6):248-254, 2002) suggested ASD could be considered an extreme expression of normal male, compared to female, phenotypic profiles. In this paper, sex-specific M-CHAT scores from N = 53,728 18-month-old toddlers, including n…

  15. Journal of Chemical Sciences | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    Home; Journals; Journal of Chemical Sciences. G Mugesh. Articles written in Journal of Chemical Sciences. Volume 112 Issue 3 June 2000 pp 239-248. Aspects of organochalcogen (S, Se, Te) compounds stabilized by intramolecular coordination · G Mugesh Arunashree Panda Harkesh B Singh · More Details Abstract ...

  16. HTS Teologiese Studies / Theological Studies - Vol 64, No 2 (2008)

    African Journals Online (AJOL)

    Die hermeneutiek van kerkgeskiedenis en “teologiegeskiedenis”: 'n “Nuwe paradigma” vir kerkgeskiedenis · EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT · DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. JP Labuschagne, 861-883. http://dx.doi.org/10.4102/hts.v64i2.48 ...

  17. Journal of Chemical Sciences | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    Articles written in Journal of Chemical Sciences. Volume 114 Issue 3 June 2002 pp 163-174 Inorganic and Analytical. Mixed ligand complex ... 115 Issue 4 August 2003 pp 241-248 Inorganic and Analytical. Equilibrium study on the reactions of boric acid with some cis-diaqua Cr-complexes · G N Mukherjee Ansuman Das.

  18. Yadav, Dr Ram Ratan

    Indian Academy of Sciences (India)

    Yadav, Dr Ram Ratan Ph.D. (Lucknow), FNASc. Date of birth: 5 January 1956. Specialization: Palaeoclimatology, Tree Ring Analysis, Climate Change, Biodiversity Address: CSIR Emeritus Scientist, Wadia Institute of Himalayan Geology, 33, Gen. Mahadev Singh Road, Dehra Dun 248 001, Uttrakhand Contact: Residence: ...

  19. An integrative taxonomic approach to assess the status of Corsican bumblebees: implications for conservation

    Czech Academy of Sciences Publication Activity Database

    Lecocq, T.; Brasero, N.; De Meulemeester, T.; Michez, D.; Dellicour, S.; Lhomme, P.; de Jonghe, R.; Valterová, Irena; Urbanová, Klára; Rasmont, P.

    2015-01-01

    Roč. 18, č. 3 (2015), s. 236-248 ISSN 1367-9430 Institutional support: RVO:61388963 Keywords : Bayesian * bumblebees * endemic * evolutionarily significant unit * genetic marker * insular Subject RIV: CC - Organic Chemistry Impact factor: 2.788, year: 2015

  20. Composition dependence of the lattice vibrations in Sr.sub.n+1./sub.Ti.sub.n./sub.O.sub.3n+1./sub. Ruddlesden-Popper homologous series

    Czech Academy of Sciences Publication Activity Database

    Kamba, Stanislav; Samoukhina, Polina; Kadlec, Filip; Pokorný, Jan; Petzelt, Jan; Reaney, I. M.; Wise, P. L.

    2003-01-01

    Roč. 23, - (2003), s. 2639-2645 ISSN 0955-2219 R&D Projects: GA ČR GA202/01/0612; GA ČR GA203/99/0067 Institutional research plan: CEZ:AV0Z1010914 Keywords : dielectric properties * perovskites * spectroscopy Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 1.248, year: 2003

  1. [Results of school inspections in the county of Karl-Marx-Stadt (author's transl)].

    Science.gov (United States)

    Arnold, J

    1978-10-01

    Within the Health Protection in Childhood and Adolescence Research Project a hygienic inspection questionnaire was designed for schools. To test this questionnaire, 248 schools in 11 districts of the county of Karl-Marx-Stadt were inspected. From the ascertainments made, several instances are cited to point out the priorities of school hygiene.

  2. All projects related to | Page 187 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Topic: WEST AFRICA, HIGHER EDUCATION INSTITUTIONS, INFORMATION TECHNOLOGY, EDUCATIONAL REFORM, UNIVERSITIES. Region: Ivory Coast, Canada. Total Funding: CA$ 248,600.00. Modernization of the Education and Research System at Universite´ Nangui Abrogoua Following the Post-Election Crisis ...

  3. The impact of war experiences and physical abuse on formerly ...

    African Journals Online (AJOL)

    2006-04-25

    Apr 25, 2006 ... Department of Psychology, Gulu University, PO Box 166, Gulu, Uganda e-mail: kamone682002@yahoo.co. ... 2Division of Clinical and Health Psychology, University of Leiden, The Netherlands. ABSTRACT. Objective: In this ...... Journal of Abnormal Psychology 1996; 105: 237-. 248. 29. Huzziff CA, Ronan ...

  4. Prevalence of iodine deficiency among school children and access ...

    African Journals Online (AJOL)

    The median urinary iodine concentration (MUIC) was 248.5μg/l and the Interquartile Range (IQR) was 145 – 380 μg/L. These results indicated that Iodine Deficiency was not of public health concern among children in Zambia at the time of this study. However, the proportion of households with access to adequately iodised ...

  5. Effect of pressure and high magnetic field on phase transitions and magnetic properties of Ni.sub.1.92./sub.Mn.sub.1.56./sub.Sn.sub.0.52./sub. and Ni.sub.2./sub.MnSn Heusler compounds

    Czech Academy of Sciences Publication Activity Database

    Kaštil, Jiří; Kamarád, Jiří; Isnard, O.; Skourski, Y.; Míšek, Martin; Arnold, Zdeněk

    2015-01-01

    Roč. 650, Nov (2015), s. 248-255 ISSN 0925-8388 R&D Projects: GA ČR GA15-03777S Institutional support: RVO:68378271 Keywords : intermetallics * crystal structure * high pressure * magnetocaloric * magentisation Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 3.014, year: 2015

  6. to view fulltext PDF

    Indian Academy of Sciences (India)

    Awasthi Reena, Materials Science Division, Bhabha Atomic Research Centre, Mumbai. 400 085, India. Baburaj Anu, Atmospheric Science Division, Centre for Earth Science Studies, Thiru- vananthapuram 695 031, India. Babu S Surendra, IRDE, Defence Research and Development Organization, Dehradun. 248 008, India.

  7. Bacteriology of post–operative wound infections in the surgical ...

    African Journals Online (AJOL)

    A total of 248 swab specimens from post-operative wounds suspected to be infected were bacteriologically evaluated. Of these, bacterial growth was recorded in 204 specimens (82.3%) while 44 specimens (17.7%) yielded no growth. The bacteria isolated from the samples in decreasing order of prevalence were: ...

  8. Determinants of Full Vaccination Status in a Rural Community with ...

    African Journals Online (AJOL)

    Femi

    odds ratios (OR) with their 95% confidence intervals (CI) were used to explore factors associated with full vaccination. Results: A total of 305 mothers were ... being employed (P = 0.003; OR = 2.48, 95%CI =1.32-4.68) and a high birth order (P = 0.002) were significantly associated with full vaccination. Conclusion: Birth and ...

  9. Effect of Calcium chloride and Cadmium chloride on the enthalpy of ...

    African Journals Online (AJOL)

    user

    Enthalpy of mixing of methanol + benzene + mercuric chloride at 303.15 K, Journal of Chemical Engineering Data, Vol.44, pp248- 250. Dharmendira Kumar. M. and Rajendran. M. 1999. Salt effect on enthalpy of mixing of water + methanol at 303.15 K, Fluid Phase. Equilibria, Vol.164, pp. 217-224. Furter.W.F. and Cook.

  10. Antiproliferative heparin (glycosaminoglycans) isolated from giant ...

    African Journals Online (AJOL)

    STORAGESEVER

    2009-05-18

    May 18, 2009 ... Heparin was isolated from two bivalve mollusks, Tridacna maxima (giant clam) and Perna viridis (green mussel). The isolated heparin was quantified in crude as well as purified samples and they were estimated as 2.72 and 2.2 g/kg (in crude) and 260 and 248 mg/g (in purified samples) in T. maxima and.

  11. Download this PDF file

    African Journals Online (AJOL)

    sates, or collected solar thermal energy. 248. hybrid systemis realized which presents both theoreti- cal interestaswell as practical. DaWen Sun {4), Huang et al. 15), presented papers on compression-ejection combined cycles destined for air conditioning and re- frigeration at average temperature. Tuag and Murty.

  12. Rickettsia typhi and R. felis in Rat Fleas (Xenopsylla cheopis), Oahu, Hawaii

    OpenAIRE

    Eremeeva, Marina E.; Warashina, Wesley R.; Sturgeon, Michele M.; Buchholz, Arlene E.; Olmsted, Gregory K.; Park, Sarah Y.; Effler, Paul V.; Karpathy, Sandor E.

    2008-01-01

    Rickettsia typhi (prevalence 1.9%) and R. felis (prevalence 24.8%) DNA were detected in rat fleas (Xenopsylla cheopis) collected from mice on Oahu Island, Hawaii. The low prevalence of R. typhi on Oahu suggests that R. felis may be a more common cause of rickettsiosis than R. typhi in Hawaii.

  13. Rickettsia typhi and R. felis in rat fleas (Xenopsylla cheopis), Oahu, Hawaii.

    Science.gov (United States)

    Eremeeva, Marina E; Warashina, Wesley R; Sturgeon, Michele M; Buchholz, Arlene E; Olmsted, Gregory K; Park, Sarah Y; Effler, Paul V; Karpathy, Sandor E

    2008-10-01

    Rickettsia typhi (prevalence 1.9%) and R. felis (prevalence 24.8%) DNA were detected in rat fleas (Xenopsylla cheopis) collected from mice on Oahu Island, Hawaii. The low prevalence of R. typhi on Oahu suggests that R. felis may be a more common cause of rickettsiosis than R. typhi in Hawaii.

  14. Wind Tunnel Simulation of Air Pollution Dispersion in a Street Canyon

    Czech Academy of Sciences Publication Activity Database

    Civiš, Svatopluk; Střižík, M.; Jaňour, Zbyněk; Holpuch, Jan; Zelinger, Zdeněk

    2002-01-01

    Roč. 85, č. 1 (2002), s. 243-248 ISSN 1060-3271 R&D Projects: GA AV ČR IAA3040101; GA MŠk OC 715.50 Institutional research plan: CEZ:AV0Z4040901 Keywords : air pollution * photoacoustic spectrometry * wind tunnel Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 0.907, year: 2002

  15. LIST OF ABBREVIATIONS

    African Journals Online (AJOL)

    four

    2013-02-20

    Feb 20, 2013 ... microsatellite or simple sequence repeat (SSR) markers. Twenty .... The amplified SSR DNA bands representing different alleles were. Berilus et al. .... 248 210. 228. RM152. 53 gaaaccaccacacctcaccg ccgtagaccttcttgaagtag. 133. 157 135. 153. 9. RM316. 55 ctagttgggcatacgatggc acgcttatatgttacgtcaac. 194.

  16. Ulcerative chickenpox in an immunocompetent child

    African Journals Online (AJOL)

    respiratory distress syndrome. Skin and soft-tissue bacterial infections complicating varicella in a multicentre hospital-based study in France were cellulitis (24.8% of the group with complications), abscess (7.2%), necrotising skin lesions (4.6%), staphylococcal scalded skin syndrome (2.8%) and necrotising fasciitis (0.8%).3.

  17. Impact of Mild versus Moderate Intensity Aerobic Walking Exercise ...

    African Journals Online (AJOL)

    2014-03-01

    Mar 1, 2014 ... Results: There was a 32.1% and 24.8% increase in mean values of serum calcium and hand grip strength respectively and. 22.7 % reduction in mean values of parathyroid hormone in moderate exercise training group (A). While there was a ..... Tlacuilo-Parra A, Morales-Zambrano R, Tostado-. Rabago N ...

  18. Relation between body composition at birth and child development at 2 years of age

    DEFF Research Database (Denmark)

    Abera, Mubarek; Tesfaye, Markos; Girma, Tsinuel

    2017-01-01

    developmental score at 2 years of age (β=2.48, 95% confidence interval (CI) 0.17; 4.79) adjusted for neonatal, postnatal and parental characteristics. This association was attributable to the association with the language developmental domain (β=1.61, 95 CI 0.33; 2.90). CONCLUSIONS: Among Ethiopian children...

  19. Fulltext PDF

    Indian Academy of Sciences (India)

    number of species belonging to different groups of organisms; this variation is indicated by the relative sizes of different organisms. Thus there are many more species of insects and crabs and their. 1 Monera (bacteria, cyanobacteria), 4800. 2 Fungi, 69,000. 3 Algae, 26,900. 4 Higher plants, 248,400. 5 Protozoa, 30,800.

  20. Life history and population dynamics of an estuarine amphipod, Eriopisa chilkensis Chilton (Gammaridae)

    Digital Repository Service at National Institute of Oceanography (India)

    Aravind, N.P.; Sheeba, P.; Nair, K.K.C.; Achuthankutty, C.T.

    of Experimental Marine Biology and Ecology 248, 207-223. Dick, J.T.A., Bailey, R.J.E., Elwood, R.W., 2002. Maternal care in the rockpool amphipod Apherusa jurinei, developmental and environmental cues. Animal Behaviour 63, 707- 713. El. Wakeel, S.K., Riley, J...